GenomeNet

Database: RefSeq
Entry: NC_052375
LinkDB: NC_052375
Original site: NC_052375 
LOCUS       NC_052375            1427540 bp    DNA     linear   CON 13-FEB-2021
DEFINITION  Brettanomyces nanus chromosome 2, complete sequence.
ACCESSION   NC_052375
VERSION     NC_052375.1
DBLINK      BioProject: PRJNA691332
            BioSample: SAMN12257692
            Assembly: GCF_011074865.1
KEYWORDS    RefSeq.
SOURCE      Brettanomyces nanus
  ORGANISM  Brettanomyces nanus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
REFERENCE   1  (bases 1 to 1427540)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 1427540)
  AUTHORS   Roach,M.J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2020) Research, Australian Wine Research
            Institute, Adelaide, SA 5064, AUS
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP064813.
            Annotated using 1.8.1.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: OCT-2018
            Assembly Method        :: Celera Assembler v. Canu v1.7
            Assembly Name          :: AWRI2847_1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 50.0x
            Sequencing Technology  :: Oxford Nanopore MinION
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1427540
                     /organism="Brettanomyces nanus"
                     /mol_type="genomic DNA"
                     /strain="CBS 1945"
                     /isolation_source="Bottled beer"
                     /culture_collection="AWRI:2847"
                     /type_material="type material of Eeniella nana"
                     /db_xref="taxon:13502"
                     /chromosome="2"
                     /country="Sweden"
                     /collection_date="21-Jan-2014"
     gene            complement(<16130..>17803)
                     /gene="LAC12_2"
                     /locus_tag="FOA43_001962"
                     /db_xref="GeneID:62195363"
     mRNA            complement(<16130..>17803)
                     /gene="LAC12_2"
                     /locus_tag="FOA43_001962"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_038922267.1"
                     /db_xref="GeneID:62195363"
     CDS             complement(16130..17803)
                     /gene="LAC12_2"
                     /locus_tag="FOA43_001962"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_038778195.1"
                     /db_xref="GeneID:62195363"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSESINSRDNSLEREESAISKAALQKTEDDVPENMDTIELPSAF
                     SKQYLPLYGICLVVYFVSTMQGYDGSLMGSIYTMKDYLAYYNLDVNSSTGTGLVFSIY
                     NVGQITGAFFVWIMDWKGRKIAIMIGCFGAIVGAIITAATTNKEGLIGGRWFLSFFTT
                     IANTAAPSYCVEVSPPHIRGKVAGLYNTLWYCGSILAAFTTYGTNKNFAGSSLSFKIP
                     LYVQVCFPGLVVLFGWFLPESPRWLVGVGRYDEARKFLVKYHCNGDDSNPLVDLEMAE
                     MEESFKDVKISDPLTAMDIRPLFKNRSDRYRLGLVVAMAWFGQFSGNNVCSYYLPTML
                     IKVGMTSVSTNVLMNGVYSIVSWISSILGSFAHDKVGRRKMFMISTLGSALALTGLAV
                     CTARYEATQSDGASKGTLVFIYLFGVIFSFAFTPMQPIYPGEVSSNLIRGKAQFVLSI
                     VAGVAQFVNQFASPKAMENIRYWFYVFYAFFDIFEFIIIYFFFVETRGKTLEELEYVF
                     EAPNPRKASTDPEFLSSIRVASGFEAENMKNEHDIKATVDHLEEGVDSE"
     gene            <18981..>22049
                     /gene="LAC4_2"
                     /locus_tag="FOA43_001963"
                     /db_xref="GeneID:62195364"
     mRNA            <18981..>22049
                     /gene="LAC4_2"
                     /locus_tag="FOA43_001963"
                     /product="Beta-galactosidase (Lactase)"
                     /transcript_id="XM_038922268.1"
                     /db_xref="GeneID:62195364"
     CDS             18981..22049
                     /gene="LAC4_2"
                     /locus_tag="FOA43_001963"
                     /note="CAZy:GH2"
                     /codon_start=1
                     /product="Beta-galactosidase (Lactase)"
                     /protein_id="XP_038778196.1"
                     /db_xref="GeneID:62195364"
                     /db_xref="InterPro:IPR004199"
                     /db_xref="InterPro:IPR006101"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006103"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR023230"
                     /db_xref="InterPro:IPR036156"
                     /db_xref="PFAM:PF00703"
                     /db_xref="PFAM:PF02836"
                     /db_xref="PFAM:PF02837"
                     /db_xref="PFAM:PF02929"
                     /db_xref="PFAM:PF16353"
                     /translation="MTTELIPHFLEDPTFVFENRLPTRAYTYDPEIFQSLNGEWSFKL
                     FESPVLSPNLRTLRPSDFDAWSSIKVPSHWQLQNNGKYGYPYYTNVQFPFQIDIPNPP
                     TLNPTGVYSRQFYISNPKESNYRIRFEGVDNSYEVYMNQKYVGFNKGSRNGAEFDVQR
                     FLVQGQNLISVKVFQWSDSSYMEDQDQWWLSGIFRDVSLLTLPRAAHIENYKVDPRFF
                     DSNYKDARLLLDLNIVGTDYEFIKFTLFDFEDPHKSIDTEALLNDFDKPTTPAIKSVE
                     FGKEDAQSTLKIPIGSPKHWTAEDPYLYKYALQLIGTNGAPVHTVNNHIGFRQVELLD
                     GNIKVNGRTILFRGVNRHEHHPRCGRAVPLEFVIRDLALMKSHNINAVRTSHYPNHPR
                     VYNFFDKLGFWVIDEADLETHGVQEPYNRYKDIITENSDTKILHHDVSVRYVSSNPDY
                     KIAYLDRASQLVLRDINHPSVIIWSLGNESGYGTNHKLMYQLIKKLDSSRLVHYEGDV
                     NAETTDMYSFMYPSLNKMEKWRKHRTDSNGKFDKPLILCEYSHAMGNGPGSLKEYQDL
                     FYTYKFYQGGFIWEWANHGIEFQTISKSDGKLHKAYAYGGDFNEEINDGVFIMDGLLN
                     SEHNPTPGVVELKKVLEPVVIDVSSSKVKITNRYDFSTTDHLKFLDVDNDKFLEVPSL
                     KPNETVTLEVTTKNVSAVLNRDYGVLKAGFEVAWGQSEPELQAIDTSPKTIENEVAIE
                     ETTRLVRVTSKSVFLEFNKLLGKIEHLKIGNRTMSTKYDGSSITFWRPPTNNDNAKDA
                     PNWKKFNMNLVKQNVREVIVKKGTGEYLAKVIVKSRVGPPVFYYGFDVIQEYIIFPNR
                     LTLHTTLKLTGDYQPKDIPRIGYEFWLGDNYDSYEWSGRGPGESYPDKKLSQRFGTFN
                     SNEVEDFVYDYPQENGNHTDTHYLKIKYKNADKLVISEKNKTFNFKVSDEYGVDEADH
                     PCDVKHYDQYYVRLDHAIHGVGSEACGPPVLDKYRLNIQNFDFTFDFGFD"
     gene            complement(<24237..>24475)
                     /locus_tag="FOA43_001964"
                     /db_xref="GeneID:62195365"
     mRNA            complement(join(<24237..24425,24467..>24475))
                     /locus_tag="FOA43_001964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922269.1"
                     /db_xref="GeneID:62195365"
     CDS             complement(join(24237..24425,24467..24475))
                     /locus_tag="FOA43_001964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778197.1"
                     /db_xref="GeneID:62195365"
                     /translation="MRSMLVVVDFKKGIDPFSRDRVHAPLLRSNEMPYAGFADGAEPW
                     FRIDKIFITGINVSDDVKDAN"
     gene            complement(<26534..>27724)
                     /locus_tag="FOA43_001965"
                     /db_xref="GeneID:62195366"
     mRNA            complement(<26534..>27724)
                     /locus_tag="FOA43_001965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922270.1"
                     /db_xref="GeneID:62195366"
     CDS             complement(26534..27724)
                     /locus_tag="FOA43_001965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778198.1"
                     /db_xref="GeneID:62195366"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="PFAM:PF01758"
                     /translation="MPSGSSALREVFSQLSWRDKLLPPAIVICIVVGIVISVYAPQSQ
                     KAFEGAEVLRVSVPLAIGMIIMIVPPLCCLQLENWRMFLKKRMLKQLAISLVLNWIVC
                     PFFMLSLAWMTLFDLDEYRNGIILIGLGRCIAMVMIWNQIAHGDENLCAILVIANSLL
                     QLVLYAPYKIFFCDILGGAGNLTTSSQSMTELYSTVAKTVGFFLGIPLALGVIIRAIG
                     VGLFGKKVYESRIIKFISPWSTIGLLYTIVVIFINKGDAFISDIGTSFRCFVPLVAYF
                     VIVWFSVFFGLRICFGRGSKPREEERGLLCGCEKQLQSGVDSKMWKRYCASSYPEIAT
                     QSFTAASNNFELSLAVAISLYGVDSQQVVAATYGPLLEIPVLIILTVVSRYFQIAFLW
                     SDEE"
     gene            <29754..>30806
                     /gene="ADH1_2"
                     /locus_tag="FOA43_001966"
                     /db_xref="GeneID:62195367"
     mRNA            <29754..>30806
                     /gene="ADH1_2"
                     /locus_tag="FOA43_001966"
                     /product="Alcohol dehydrogenase"
                     /transcript_id="XM_038922271.1"
                     /db_xref="GeneID:62195367"
     CDS             29754..30806
                     /gene="ADH1_2"
                     /locus_tag="FOA43_001966"
                     /codon_start=1
                     /product="Alcohol dehydrogenase"
                     /protein_id="XP_038778199.1"
                     /db_xref="GeneID:62195367"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /translation="MSLTVPKTQYACVFDKPFGPIVYKKTAVPTPKPTEILVHVLYSG
                     VCHTDLHAWRGDWELKTKLPLVGGHEGAGVVVAKGSQVTSFEIGDYAGIKWLNGSCMS
                     CEYCMQGAEPTCPDGDYSGYTHDGTFQEYATADAVQAAHLPKDVKLDAVAPILCAGVT
                     SYKALKTADLRAGQWVAVSGAGGGLGSLAVQYGVAMGLRVLAIDGGDDKAALCKSLGA
                     EAFVDFTKTKDLVKEVQRITNGGPHGVINVSVSEKAINQSTLYVRPLGKVVLVGMPAD
                     SKLTCDVLTQVFKCSQIRGSCVGNREDTAEALDFFYRGLVHSPFEVVGLSKLPEVFKL
                     MAENKIVGRYVLDTSK"
     gene            complement(<31522..>32790)
                     /locus_tag="FOA43_001967"
                     /db_xref="GeneID:62195368"
     mRNA            complement(<31522..>32790)
                     /locus_tag="FOA43_001967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922272.1"
                     /db_xref="GeneID:62195368"
     CDS             complement(31522..32790)
                     /locus_tag="FOA43_001967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778200.1"
                     /db_xref="GeneID:62195368"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR023444"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="InterPro:IPR036849"
                     /db_xref="PFAM:PF02746"
                     /db_xref="PFAM:PF13378"
                     /translation="MTALTSKTVVEFPRIKAIKTYLLQGKGIGGDYHNVAKGHWLVDN
                     YISNPMSKFEEYRASRTSWGINVLGSFCVEIETTDGTKGFATGFGGPIACWLVQHHFE
                     RFILGADPRDINLLWDKMFRASMFYGRKGVTMATISVIDLALWDLLGKIRNEPVYKMI
                     GGATREKIDFYCTGCDPEAAKKMGFWGGKVALPFGPDEGHKGLRKNVEFLRKHREAVG
                     PDFPLMVDCYMSLNVSYTIDLVKATQDLDINWWEEVLHPDDFDGYALLKRAYPNMKFT
                     TGEHEYTKYGFRKLIEGRNIDILQPDVMWVGGMTELLKIAAQAAAYDIPVVPHASGQY
                     SYHFVASQNNTPFQEYLANSPDSKSVLPVFGALFTNETVPTKGYLHLSQLDNPGFGLT
                     LNPKVKLIDAAGILDPAPEKPLKFDEKKTN"
     gene            complement(<33221..>35419)
                     /locus_tag="FOA43_001968"
                     /db_xref="GeneID:62195369"
     mRNA            complement(<33221..>35419)
                     /locus_tag="FOA43_001968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922273.1"
                     /db_xref="GeneID:62195369"
     CDS             complement(33221..35419)
                     /locus_tag="FOA43_001968"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778201.1"
                     /db_xref="GeneID:62195369"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MSSRSLNSHQKLSKSCDVCRAKKLKCDSGQDCGYCRKHGLVCVY
                     SLVSKPGLKPGYGKDVLRRLTQLEDQSRVYEQRLRAMELQLSQPQMQQQLSQAPKQPI
                     QPQQQQQLMPSESSQQLTLQMTHTVQVQQPPTQIDIKDPPFYDGLPRISTVRRLIDIF
                     FVRVFSVFPIVHPHYTKAKIERYIKHVLSHPQGPTKEPPVVSFAIILNALQYTSPDLD
                     IKLTAAEKDDLINKCKEKIILECYAISSIPQLQAITLMAFHRVANGSGTESWSVIGIA
                     ATGVISLNMSDIRQRIPTLPSSYRDGHSPASTGSVSSTNTKVIRTKRAKILKEPVDWL
                     DEEDRRRLVWGIAILDVFSSFASGTPLRIPNSEIQFSAPFSTTAWLESRRSNGALFPS
                     GSDKDGQDFYDAFSYYTQIIKIFRGVHSFLAQPRDISDKGAVGEWFVSFHQIETDIRE
                     WKDRLPLKYKLLLNSNVLDIRGSGAELSSMVLLHSAYNIALIKMHSAYGYPHLESYAF
                     KHSELSRKICTSSVDSISALAKQIMEYESENGVKLLEYLGPHYGFNIWVCSRLLIADS
                     IFSQKDGKTIDKNSMNIKLKLFCNILQGVGNYCPAIQKYNKILRQLINLNISVSSAVS
                     DTSPNDAESEEDDDKMAPSQAIADMRINTDLLSLILANKLAVLEGQSTTTHPPSASQS
                     TLDLQGMATKYILSDANQQESMPLEAFQFDASSYGFEDLFGYLDNNISQQ"
     gene            <35712..>36644
                     /locus_tag="FOA43_001969"
                     /db_xref="GeneID:62195370"
     mRNA            <35712..>36644
                     /locus_tag="FOA43_001969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922274.1"
                     /db_xref="GeneID:62195370"
     CDS             35712..36644
                     /locus_tag="FOA43_001969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778202.1"
                     /db_xref="GeneID:62195370"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00701"
                     /translation="MSHTQVNPPEAGVYTPIPTFFKKDQVTIDYETQVRHAKFLKENG
                     IKGAVIMGSTGEAAHLTRVERASIISAIHKGVPGFTIIGGSSQNSIEDTLDEIDSIKA
                     AGASYALVLCSSYYGAGISQQGMIDFYTAVADKSPLPVMIYVYPGVSNGLVVEPETVV
                     KLSSHPNIVGCKLSYGDVSHHTLIASNPKVKKSNFHLFTGLGQILLPVLMVGGKGTVD
                     ALSGAFPKLYVKIFDLVQKKQYEEAAKYQYIASRGEELVVKFGVVGIKKLVHSQGFGE
                     TYLCRIPLNYDVDEARWAELSDNFNDCVACEKSL"
     gene            complement(<38285..>39913)
                     /locus_tag="FOA43_001970"
                     /db_xref="GeneID:62195371"
     mRNA            complement(<38285..>39913)
                     /locus_tag="FOA43_001970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922275.1"
                     /db_xref="GeneID:62195371"
     CDS             complement(38285..39913)
                     /locus_tag="FOA43_001970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778203.1"
                     /db_xref="GeneID:62195371"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSEELNIHQQASGSSSQVGETSEKENFLGKDASTTKDSQAPVEV
                     RGSYLALTAITFLISFGAFIYGWDSGTISGIVNTPDYLQRFGEWSKSDQDYYLSEVRM
                     GLIVSIFNMGAAFGGVTLGRLGDMWGRREGIMFSTCIYIVGTVIQMAASHSWVQYFIG
                     RILTGLSVGCNCVLCPMYISELAPMAIRGTMVTIYQLMQSAGLFLGYCACYGSNKGYT
                     DSRSWRIPLGLCFAFALLLICGLIFAPESPRYLVKKNRVDKAKHSLSRVTRVPESSPL
                     IQREIDSLLEGIEIEKRAGNSSWKELLTGKPKIFYRVVMGVMLQTLQQLTGDNYFFYY
                     SNTVFKSVGLNDSYVTSIIIGVVFFVSTFVPLYTMDRFGRRVTLLVGSAAMLICLLVF
                     ATIGVKSLFPGEYGVNPKKSVGDGMIFLVCLFMFFFSATWGPGPYVVVSESYPMRIRA
                     KGMAIASIGNWLWGFLIGFFTPFIAGAIHFAYGYVFFGCTLFGFIFVFTCVPETKGLR
                     LEDVDELYSKLKPGFAWRKIEIGKDDTEGRDSDA"
     gene            <42826..>43590
                     /gene="DHG2"
                     /locus_tag="FOA43_001971"
                     /db_xref="GeneID:62195372"
     mRNA            <42826..>43590
                     /gene="DHG2"
                     /locus_tag="FOA43_001971"
                     /product="L-rhamnose-1-dehydrogenase"
                     /transcript_id="XM_038922276.1"
                     /db_xref="GeneID:62195372"
     CDS             42826..43590
                     /gene="DHG2"
                     /locus_tag="FOA43_001971"
                     /codon_start=1
                     /product="L-rhamnose-1-dehydrogenase"
                     /protein_id="XP_038778204.1"
                     /db_xref="GeneID:62195372"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSGAKLLQGKVVVVTGAATGIGRAIAEEMSKQGAKVAINYYPGR
                     DKEIAEMKRDIPDLLAVPGDISKPETSEHLVAEVVKKFGELNVFVSNAGICKFEEFTN
                     VSPELFRKTVAINLGGCYFATQAAAKQMIKQGKGGSIIGISSISALVGGSHQTHYTPT
                     KAGILSLMQSEACALGQYNIRCNALLPGTIATQLNTEDLADPEKKHYMESRTPLGRIG
                     VTSDMAGPAVFLASDLSSFVTGAQLLVDGGMYVNLQ"
     gene            complement(<45548..>46480)
                     /locus_tag="FOA43_001972"
                     /db_xref="GeneID:62195373"
     mRNA            complement(<45548..>46480)
                     /locus_tag="FOA43_001972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922277.1"
                     /db_xref="GeneID:62195373"
     CDS             complement(45548..46480)
                     /locus_tag="FOA43_001972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778205.1"
                     /db_xref="GeneID:62195373"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00701"
                     /translation="MSHTQVNPPEAGVYTPIPTFFKKDQVTIDYETQVRHAKFLKENG
                     IKGAVIMGSTGEAAHLTRVERASIISAIHKGVPGFTIIGGSSQNSIEDTLDEIDSIKA
                     AGASYALVLCSSYYGAGISQQGMIDFYTAVADKSPLPVMIYVYPGVSNGLVVEPETVV
                     KLSSHPNIVGCKLSYGDVSHHTLIASNPKVKKSNFHLFTGLGQILLPVLMVGGKGTVD
                     ALSGAFPKLYVKIFDLVQKKQYEEAAKYQYIASRGEELVVKFGVVGIKKLVHSQGFGE
                     TYLCRIPLNYDVDEARWAELSDNFNDCVACEKSL"
     gene            <46772..>48970
                     /locus_tag="FOA43_001973"
                     /db_xref="GeneID:62195374"
     mRNA            <46772..>48970
                     /locus_tag="FOA43_001973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922278.1"
                     /db_xref="GeneID:62195374"
     CDS             46772..48970
                     /locus_tag="FOA43_001973"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778206.1"
                     /db_xref="GeneID:62195374"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MSSRSLNSHQKLSKSCDVCRAKKLKCDSGQDCGYCRKHGLVCVY
                     SLVSKPGLKPGYGKDVLRRLTQLEDQSRVYEQRLRAMELQLSQPQMQQQLSQAPKQPI
                     QPQQQQQLMPSESSQQLTLQMTHTVQVQQPPTQIDIKDPPFYDGLPRISTVRRLIDIF
                     FVRVFSVFPIVHPHYTKAKIERYIKHVLSHPQGPTKEPPVVSFAIILNALQYTSPDLD
                     IKLTAAEKDDLINKCKEKIILECYAISSIPQLQAITLMAFHRVANGSGTESWSVIGIA
                     ATGVISLNMSDIRQRIPTLPSSYRDGHSPASTGSVSSTNTKVIRTKRAKILKEPVDWL
                     DEEDRRRLVWGIAILDVFSSFASGTPLRIPNSEIQFSAPFSTTAWLESRRSNGALFPS
                     GSDKDGQDFYDAFSYYTQIIKIFRGVHSFLAQPRDISDKGAVGEWFVSFHQIETDIRE
                     WKDRLPLKYKLLLNSNVLDIRGSGAELSSMVLLHSAYNIALIKMHSAYGYPHLESYAF
                     KHSELSRKICTSSVDSISALAKQIMEYESENGVKLLEYLGPHYGFNIWVCSRLLIADS
                     IFSQKDGKTIDKNSMNIKLKLFCNILQGVGNYCPAIQKYNKILRQLINLNISVSSAVS
                     DTSPNDAESEEDDDKMAPSQAIADMRINTDLLSLILANKLAVLEGQSTTTHPPSASQS
                     TLDLQGMATKYILSDANQQESMPLEAFQFDASSYGFEDLFGYLDNNISQQ"
     gene            <49401..>50666
                     /locus_tag="FOA43_001974"
                     /db_xref="GeneID:62195375"
     mRNA            <49401..>50666
                     /locus_tag="FOA43_001974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922279.1"
                     /db_xref="GeneID:62195375"
     CDS             49401..50666
                     /locus_tag="FOA43_001974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778207.1"
                     /db_xref="GeneID:62195375"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR023444"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="InterPro:IPR036849"
                     /db_xref="PFAM:PF02746"
                     /db_xref="PFAM:PF13378"
                     /translation="MTALTSKTVVEFPRIKAIKTYLLQGKGIGGDYHNVAKGHWLVDN
                     YISNPMSKFEEYRASRTSWGINVLGSFCVEIETTDGTKGFATGFGGPIACWLVQHHFE
                     RFILGADPRDINLLWDKMFRASMFYGRKGVTMATISVIDLALWDLLGKIRNEPVYKMI
                     GGATREKIDFYCTGCDPEAAKKMGFWGGKVALPFGPDEGHKGLRKNVEFLRKHREAVG
                     PDFPLMVDCYMSLNVSYTIDLVKATQDLDINWWEEVLHPDDFDGYALLKRAYPNMKFT
                     TGEHEYTKYGFRKLIEGRNIDILQPDVMWVGGMTELLKIAAQAAAYDIPVVPHASGQY
                     SYHFVASQNNTPFQEYLANSPDSKSVLPVFGALFTNETVPTKGYLHLSQLDNPGFGLT
                     LNPKVKLIDAAGILDPAPEKPLKFEEKTN"
     gene            <51243..>51959
                     /locus_tag="FOA43_001975"
                     /db_xref="GeneID:62195376"
     mRNA            <51243..>51959
                     /locus_tag="FOA43_001975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922280.1"
                     /db_xref="GeneID:62195376"
     CDS             51243..51959
                     /locus_tag="FOA43_001975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778208.1"
                     /db_xref="GeneID:62195376"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="InterPro:IPR040079"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13409"
                     /db_xref="PFAM:PF13410"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MTAQIIAEQGPEVKDATAPYPFLYTWSTSNGARPMILAELLEIN
                     YYLHPVDLAAKEQKKPWYLEHNANGKIPTLASTDIDGSTTFVNESAAILLYLADKYDK
                     ERKYSYALGSKEYYEELEWLFFELSGFCPKKVQWKYLNNLQEKNQPAIDEQFDEMVRL
                     LRVIDTRLKSNGTGYLVGDHISPADITVYPWIRPGQTVGFEDNIKKLPYLKAWIETIG
                     KIPAVQNALDVNMSLQSRTD"
     gene            <53528..>55955
                     /locus_tag="FOA43_001976"
                     /db_xref="GeneID:62195377"
     mRNA            join(<53528..55430,55951..>55955)
                     /locus_tag="FOA43_001976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922281.1"
                     /db_xref="GeneID:62195377"
     CDS             join(53528..55430,55951..55955)
                     /locus_tag="FOA43_001976"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778209.1"
                     /db_xref="GeneID:62195377"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="InterPro:IPR037524"
                     /db_xref="PFAM:PF10528"
                     /translation="MFSALFLSIFLLFQETLVLGIPTSVQTTVTAQIKPGVGCSYGDD
                     VASESGFNAKFYSYPHSNTAIWGDSSDFDTSWLMSSYQEFGFITEVSHVTEPQFQTTP
                     LDTTTAELYGAEITVSNMTIELSGYFYARETGLFIFQLQAIDDAVLVWFGNGVSCCNS
                     SETDDTEPTIGAYWERNSDVNGAGVAYVYMEEGSYYPIRLLYNNWDGAASLLFNVLTP
                     TNVVIEDFSEYVYQFISIGGECSSSTASFPFSTITQTTGCTSDTYALETITTDTAGST
                     VTSTVVIVDEPDAPSICETGSTDSTTDSTESTDSNTESTESTDSTESTDSSTDSTNTT
                     TNSTESTDSTESTDSSTDSSTDSTDTTTDSTESTDSTESTDSSTDTTESTESTDSSTE
                     STESTDSTESTDSSTDSSESTDSSTDSTESTNSSIESTDSATDSSTESTDTTTESTES
                     TDSSTDSTNTTTDSTESTDSSTESTDSSADSTDTTTDSTGSTESTESTDSSTDSTDTT
                     TDSTESTDSSTESTDSATDSSTDSIDTATDSTDSSTESTESSIDPETEYTDSSTNPST
                     DPSTESIASSSNTANPSADSSTESTDSSLNSVDSSTDSSAESTNSRTDLTEKTKETKT
                     DILTTEVTITN"
     gene            complement(<56047..>57600)
                     /locus_tag="FOA43_001977"
                     /db_xref="GeneID:62195378"
     mRNA            complement(<56047..>57600)
                     /locus_tag="FOA43_001977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922282.1"
                     /db_xref="GeneID:62195378"
     CDS             complement(56047..57600)
                     /locus_tag="FOA43_001977"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778210.1"
                     /db_xref="GeneID:62195378"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="PFAM:PF05224"
                     /translation="MNDEFAQFFLPGLEFDDTLFTSLSRQPSIRSVSDNSEKPILITS
                     RTGSDDISVVDDTVFPDIRGVRTSHYSSLVPLEASEASPRTRQAVFHQDYDGGSAVKY
                     QQASSTSTSFPQDLWGLSFPPSQIYTPSSMTSISQWLGSDSRSPIGLHANDSNASIRA
                     LDEIGMPIYQTSPNQDSLAKNRSLSAKKLKNVTETSNKSESCHQKGNPLALKTVPPPS
                     VPQLINVSGEPVFFSASGNLDGRFYSSNKYLATSKKDEFPIACYRRNYIVLETVLEFS
                     DLPHVLICEDGSRCKVRSIKMSVSSSSNFSSSPVDLSLFINHKKSIKAPQGLQETLME
                     SSTIALDPSKGKQKIVLNRFQFKKATPNNGKRVIKDYYYLDVRIDLVVLGSDGIEKEA
                     SLTMLKSNAISVRGRNPSFYNDKMDIFIKEDEHGKTLRKRLSKPLVPQKVTEENKTPQ
                     NITLKIHSRYKYFPIKSNYYLPPLRAYYLPHSAAHREVKVDDLRLKRRMSNVPTYNFF
                     IRRKDKVTS"
     gene            complement(<57820..>59343)
                     /locus_tag="FOA43_001978"
                     /db_xref="GeneID:62195379"
     mRNA            complement(<57820..>59343)
                     /locus_tag="FOA43_001978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922283.1"
                     /db_xref="GeneID:62195379"
     CDS             complement(57820..59343)
                     /locus_tag="FOA43_001978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778211.1"
                     /db_xref="GeneID:62195379"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="PFAM:PF00349"
                     /db_xref="PFAM:PF03727"
                     /translation="MELTITKDIGNDQVIGGDQVVSVKQQEQEDLLSEDLVPSSALSS
                     ASNLSSSIEGEEATLDSMLGQIEMQFSRDNVPYLVEELYQELNNAYDGQSDRAMLSTE
                     TVAPSGLERGTFLAIDLGGSTLKVCVISLLGESKYRILARKTWEISNDRKVINLDFFR
                     MMCDCVEEVLKMGRFFDDQEIISTGISWSFPFTQTSPNNGYIYVVSKGYSLDSDTKGK
                     NLADLFSNAMLQEKGITVRVHAVVNDAVSVYLSGSYAHSCCLGLVLGTGTNASFVVGN
                     RVVNSELSFFGSCFASILAKNSIDRGVCSHYADIPLDNYMRTKYGVYQPLEYICGGRY
                     LGETFRLGVVQGASSGELFEDQFVELSQCSAFTTPYHLQTDVVSKISECSYIEAKALF
                     DERFALELSVEDHVKIKRLVDVLTDRAATVMASMLMACAKFVNDHFKGEVREDKIRID
                     FVGSLLQYYTEYRKSVEVVLDRFHEQLGLPAFELIHIDDSSILGAAVSAAAFKHLLS"
     gene            <59772..>60641
                     /locus_tag="FOA43_001979"
                     /db_xref="GeneID:62195380"
     mRNA            <59772..>60641
                     /locus_tag="FOA43_001979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922284.1"
                     /db_xref="GeneID:62195380"
     CDS             59772..60641
                     /locus_tag="FOA43_001979"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778212.1"
                     /db_xref="GeneID:62195380"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="PFAM:PF05721"
                     /translation="MPSTLPHKYHDEIVENGYTVIKQLLSRDEIEKFLKLSREEIGKA
                     RNGDWPFVRFNGKQFPPWDKPEDEPDIWGVTHLMHPKWGSVGKQFQELYTDEKVLNVV
                     KDILQTEDLNMELFNMLINPTKKDFDLRWHRDDVENSASDEKEMEILERCAFSGAQFN
                     LALKDDVNLIVVPKSHARPRTAEERQKLKFEPITGQLVVHLEPGDCAFYNPNILHRAT
                     YSTKRERVTLHGSYGNYKNGKNRARLVLQHGVADWLDQFEPTNNEINIMADRLKQVSE
                     QMKGKDLGYSLEG"
     gene            <61033..>62556
                     /locus_tag="FOA43_001980"
                     /db_xref="GeneID:62195381"
     mRNA            <61033..>62556
                     /locus_tag="FOA43_001980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922285.1"
                     /db_xref="GeneID:62195381"
     CDS             61033..62556
                     /locus_tag="FOA43_001980"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778213.1"
                     /db_xref="GeneID:62195381"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF05978"
                     /db_xref="PFAM:PF07690"
                     /translation="MSQIESETKSPAGTAVVDVPSSSDSLRVSETKRSIYDNSKWYNR
                     RIFGKLPPYSNGLSQIIMVSFVCFMCPGMFNALSGMGGAGLSSPSLANKANIALYSTF
                     ASVGFFSGTIVNLIGVRYALAFGGSGYSIYIASFLCYKHTQNQGFIIFAGAWLGITAA
                     TLWAATSTCNLAYPVEDKKGTYMFIFWSIFNLGGVIGSLIPLGQNMHNSSSTVTDGTY
                     VAFLILTIVGFVLALFLLPVKNVRRTDGSKVIYQKHPSFNGEMRELFRVLMREPWILF
                     LFPLFFASNWFYTYEQSDFNTTNFTVRTRALNSCLFWLMQMFGSLAIGLLLDFKKYSR
                     RSRGLIGWVVVFCLTQLIWGLGFLWERNHTRADVITSPIDFSDGSRYVGPMFLYMFYG
                     FFDAVWQCYAYWIMGAITNSARKAAIYAGYYKGLQSAGAAIAWSLDNDLKPYRAIYGS
                     TWGLLAGSLVIAFPILYKKIEETTPIEQDLKDSDQTLDEVIGSEEFQKKAISTGVDA"
     gene            complement(<62790..>66932)
                     /locus_tag="FOA43_001981"
                     /db_xref="GeneID:62195382"
     mRNA            complement(join(<62790..63549,63817..>66932))
                     /locus_tag="FOA43_001981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922286.1"
                     /db_xref="GeneID:62195382"
     CDS             complement(join(62790..63549,63817..66932))
                     /locus_tag="FOA43_001981"
                     /note="CAZy:GH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778214.1"
                     /db_xref="GeneID:62195382"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR004547"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018321"
                     /db_xref="InterPro:IPR036881"
                     /db_xref="InterPro:IPR036962"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="PFAM:PF00933"
                     /db_xref="PFAM:PF01182"
                     /translation="MSEEIESEEFVRDKIGKMLIAGFEGYEVTPDSQAEQLIRLHRVH
                     SFILGSKNFADAQQMKTLIQSLQDLARSERYDHPLLMAVDQELGCCNSMYDDEWLTQF
                     PGAMGMAATNDLDLIFKIGEAVGQELKAIGFSLYMGPVLDIVPKMASQLIGIRSFGSS
                     VEDVENYAGALARGLKKAGIATCAKHFPGMGTSFVDNLLELPMILENFQQLENFNILP
                     FKHLMSEGLVDAVHASGVAVPNIAPNEIHACLSPKIINKLLRGECKFNGLVISECLEL
                     EALCRSIGLGQGAVMSILYARCDMAMVCNDYLYQKEALSSLKKAYDSGGYELIFAESL
                     GRIDKVLSKLEWTPSIVMTPEILNIHRKLSARAYKASVTLIRDNQEALPLSRHFSKKH
                     ENKILLLTPLLSEIHPNAHHCLSKDDDSSLQKLLPGETVFREFGERLGNYRKDLNYEV
                     LHTSYTANGLTSMHESLIAHCQAVILVCAEAARNMYQIGVAKHVSLLCGGYRKLNGFM
                     KKPLIIIAATTPYDFLYHKGIGSTYLCTYDYTWNALSHVPAILFGDVKPTGKVPGNLN
                     RVEYEADSNEEGGPKFQSGNSNRDNSNTNSLGMILNDSPLTNLISDAEDRKQVLFAMK
                     EGDKSEVSSIGRSSPSPVLEASHHLRKRRKLKKPWLVEDFKLERDFTSLVLLLKNSGG
                     SDLQENINPEILETLRRFLQENNGERGHHFVVRNSTINILHGAIFTWLDRDGMNGRIL
                     FVLVDKAKRKQSIAEALHEHAIKYLTILKGCKTITLGSTFPLFNFFSGLLCKEIAENW
                     GSAYSPQTGKTKLSNSSLQILNFCRSTGWFTSRYPVSRVLPARKCILLLNLDKWMLSE
                     KLVKQLKVLGIRFEIAKDYEEIIELIKRKSFKISDDEAHFAELYTAAADYIAQEGLKQ
                     LKNTIIFKMIDVNTKALIGSVILYNTNSMLADWYPYVKTISKGKVNPMSCLTGVFVDS
                     SYETLKPVMKLGLICTGVSFVKQFRMQTVMLDNCEKSEIGELIDSGFELYSEYLSLLG
                     IKMSYEWIVKLELYNSSIEASNAVGDSIAAKINAFHPTDSKPFVLGLPTGSSPLKVYA
                     RLIELYQQGIVDFSNVVSFNMDEYYNLPPTNPQSYHYFMYSNFFDHVNFKRGNINILN
                     GMVENWQEECRRYEAKIKSYGKINFFLGGMGPEGHLAFNEAGSTRESITRRIFLVDST
                     VRANSRFFGGESEKVPKSALSVGISTILDNSDEVCIVVFGKAKNWALLQTLTKKPTSV
                     IPSTFLKTHHNTTIVADYEAIEGGNCSKI"
     gene            <67413..>68612
                     /locus_tag="FOA43_001982"
                     /db_xref="GeneID:62195383"
     mRNA            <67413..>68612
                     /locus_tag="FOA43_001982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922287.1"
                     /db_xref="GeneID:62195383"
     CDS             67413..68612
                     /locus_tag="FOA43_001982"
                     /note="CAZy:CE9;
                     MEROPS:MER0033184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778215.1"
                     /db_xref="GeneID:62195383"
                     /db_xref="InterPro:IPR003764"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF01979"
                     /translation="MAIIRFTNCKLCDEGQLIDHDLYICTRSGQIVEPRLSIDRVVDL
                     HGLIIAPGFIDLQINGCFGFDFSHYSTDENYEAGYDKCLKRLVKTGTTSLCPTMITST
                     AQNYSRILPFLGKEKRSDRTESLGAHCEGPIISKKKKGCHDVRNLKRPSSKEEFYQVY
                     GGQKTFQYMKIITAAPELEGFLELIPEITGNNVVYSIGHTMATFEQSLAAVKNGATMI
                     THMFNAMPQPHHRNPGPIGLEGLEDEGMCPYFGLISDGIHIHPTYINIIYNSNKERCC
                     LVTDAMNLIGLPDGEYPWEERFVVKKGRSLILKGTDTIAGSATEQAQCMRNLKKWCDI
                     GLAEAVKCVTNHPAKCAHVDDHKGFLRVNYDADLCVIDKDGNVKQVYKLGKKVYDERE
                     DILRGHL"
     gene            complement(<68763..>70475)
                     /locus_tag="FOA43_001983"
                     /db_xref="GeneID:62195384"
     mRNA            complement(<68763..>70475)
                     /locus_tag="FOA43_001983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922288.1"
                     /db_xref="GeneID:62195384"
     CDS             complement(68763..70475)
                     /locus_tag="FOA43_001983"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778216.1"
                     /db_xref="GeneID:62195384"
                     /db_xref="InterPro:IPR026841"
                     /db_xref="PFAM:PF14378"
                     /translation="MSHNTLSKTGYVLVAPFWLIWRIIVSGLNRRNLFGLAFNFFTNF
                     SPVMIWLFIFQHASLIPKSIRPQIHSKVAFLMDQYLFGDWFGELEKQAHPLHPQIATL
                     TSVVFGSFLIMIPLSIWYYIYYIRKINYNIFNWYDYLFHYKFEYINCTYKFRPTRLRV
                     IIPFLLPLMASIALNIDYLFASQDPANFTKTKDIIAWLCYVVLHVTVPILTAIYLYAF
                     RPPGTLKCFGFAIGLQNIVAVFTHLLIPMAPPWFTHMYGLNDTEHVNYNQEGYAAGLT
                     RVDSHLGTHLNTNGFHQSPIVFGSVPSIHSAVAFQCFLFLEFQSCSSYHFCKKWASTL
                     GQSTAISDDCEEALISKKPIHLLNLIKSASSSSDSNDCSTGASSSSNPSSSDSSDTWV
                     NSSDSDPSADPSCEDLTFSNYPDQIDEVDEVDDDNEDDDYDTSLEMPFTKELLSPVKH
                     SYSWLQGHLYTASEPSGWAIWKLLTHSAIISRFIGASFLMVQWWATMYLDHHFRFDLF
                     VGMLYAMVSYCIVDWLILQPRVMFNWCQIRLKNVDDKNNEAKTMGMRVFENQSFKWFF
                     DPFA"
     gene            complement(<72412..>74448)
                     /locus_tag="FOA43_001984"
                     /db_xref="GeneID:62195385"
     mRNA            complement(join(<72412..73066,73862..>74448))
                     /locus_tag="FOA43_001984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922289.1"
                     /db_xref="GeneID:62195385"
     CDS             complement(join(72412..73066,73862..74448))
                     /locus_tag="FOA43_001984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778217.1"
                     /db_xref="GeneID:62195385"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="PFAM:PF10182"
                     /translation="MRAFVLTSILAALAKASPIRNLVTRDTVDFVTGTYSQAIPVDAS
                     IECSSLDMTYKCGQDNYPCASGDISDVTDLGNNHYEITFTFASDDCIDISNLGEAKII
                     GIDSPESGTNLLLSRNSNVFKIDDACHWSATFVINGKQDGSQICTPSFTVQYDWFSGA
                     GVSTSEKSSWKYSGSYDYLLSCSTNNMGQSNGDWPVASESSSAATESSSKASETSETA
                     GTSYSTLTTVSSTVFVTTTCTIDTCATFTTTVPITKITTVPCSTSGEKSTSYITSTSI
                     GSAIITSTSSGKTFTTVVPITEVVTVPCDSTETTKITVYPTTINSTVNGESSATSTAV
                     VSAAVTSQPEAVTSAAPVSSSNSINPSTTVATSSSKSTTAAASTIASLTEFAGEAGAL
                     SPRFSSIIAFAFGFAALIIEA"
     gene            <77553..>79193
                     /locus_tag="FOA43_001985"
                     /db_xref="GeneID:62195386"
     mRNA            <77553..>79193
                     /locus_tag="FOA43_001985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922290.1"
                     /db_xref="GeneID:62195386"
     CDS             77553..79193
                     /locus_tag="FOA43_001985"
                     /note="BUSCO:EOG09340JMS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778218.1"
                     /db_xref="GeneID:62195386"
                     /db_xref="InterPro:IPR003150"
                     /translation="MSASLGITGQEQEQIHVFPLNPISTDAQESKFIENNRYLKNEHQ
                     FNYYNVPGANYTGPSERERLDLSFESGLDEEVTDSLSTLITISISNPLSLNLKTNYAF
                     LVNYLSIYFDCTVFDPSAENKDLNKSLDSALILRNLAQDIDNSQVISLNSKIAETILL
                     ILQNPIVMNDDFSNDHYEQCKELLRYTMDIVESISSYLAPAPAGNKLFLALIELFRVV
                     GDRSAITTILRSMSRMMYNSRKTGDAPDDVDDDILNRAVSYLVLSINDKNDNDELILT
                     SLDFLYQFVQHNRVDRLLSSYTRASILQSFLPKLLIYKLNYKTEFTQQMPVLKLIRRV
                     RDPVPEKPPVLPEILIDQLNAIPEPDRATSWLRCSFEGDPEGQVTQISLWRCYELQFK
                     PFISSKGLKLLPAVDFIKNVQHAFPDSAAMVINLPDNTKKFIIKGIQPRIKAVNLEKG
                     KLEALNSGSNNHRSREKYSKASESSQEPCPLFQYNFNDYLKLNEINISTSVLLKQIVS
                     SPAGIELFKGRRDDFIDRVMHVPNLLPYIHEVMAKLDY"
     gene            complement(<79238..>79879)
                     /locus_tag="FOA43_001986"
                     /db_xref="GeneID:62195387"
     mRNA            complement(join(<79238..79657,79874..>79879))
                     /locus_tag="FOA43_001986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922291.1"
                     /db_xref="GeneID:62195387"
     CDS             complement(join(79238..79657,79874..79879))
                     /locus_tag="FOA43_001986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778219.1"
                     /db_xref="GeneID:62195387"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="PFAM:PF02996"
                     /translation="MQHILQFKTQINKELDNLQGSFRALKVAQMKYKECYENVKSVNG
                     NPNQELMVPLTASLYLPGKIEDNDKFLIDVGTGYYVEKNSQEALEFFDGRLSKLTEDS
                     SKLTGLIKEKIQLVQSIDQVLRDKLSQQQQQLQKSGGSK"
     gene            <79932..>80906
                     /locus_tag="FOA43_001987"
                     /db_xref="GeneID:62195388"
     mRNA            <79932..>80906
                     /locus_tag="FOA43_001987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922292.1"
                     /db_xref="GeneID:62195388"
     CDS             79932..80906
                     /locus_tag="FOA43_001987"
                     /note="BUSCO:EOG09343OS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778220.1"
                     /db_xref="GeneID:62195388"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="PFAM:PF03834"
                     /translation="MEEKPEKSTEKPPSNATDTSSFSSILASVAKMRQEAGVEPVEGH
                     TKEMTNRPIKDHRPTFQPTSKVMGEQANRKLPAQVIFRGQSGKEASYEATKHVNLRKQ
                     TFSSIQVNKNQNGNPLISSLTDVSYQFNGRIHDVDYLVNSHCFVVFLSVKYHKLHPEY
                     IYHRIKKIGYNPNNKNMLRILLALVDVDNAADSMRELNKLCVFNHLTLIAAWSFEQCA
                     DYLTTLKQCEMNAGKTLIQGNLKRIDDMSDDSNYYERVVEVLTSIRSINKTDAVNLVA
                     RFGSFRGLCEQANEANLQEVPGMGKHKIEVLSKVIREAFVYTNEDETQ"
     gene            <82428..>84122
                     /locus_tag="FOA43_001988"
                     /db_xref="GeneID:62195389"
     mRNA            <82428..>84122
                     /locus_tag="FOA43_001988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922293.1"
                     /db_xref="GeneID:62195389"
     CDS             82428..84122
                     /locus_tag="FOA43_001988"
                     /note="BUSCO:EOG09341TS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778221.1"
                     /db_xref="GeneID:62195389"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR030654"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="PFAM:PF01565"
                     /db_xref="PFAM:PF04030"
                     /translation="MSELPEDIQKVVMPNRWHRTWAHTFQCLPQFYLQPDNIDQIVSI
                     VNHARKSRKSIMTVGSGHSPSDITMTRDYLVNLDNFNEIISENRSADGKYTDLTVEAG
                     IRVYQLNDLLAKKHLAIQNLGSISEQSIAGIISTGTHGSSPYHGLVSQQIVDITLVDG
                     MGKLVKCSPSENPTLFRAAMLSLGKIGLIVYVTIRTVPRYQIKSRQEVITFDTLLDQF
                     EKIWTSDEFVRVWWFPYTERCILWRASKTTEPISKPRPSWYGSTTGRLFYQTLLWISV
                     HLFPRLTPYVERFVFSRQYGTSETYGHGDIAVQESVEGLNMDCLFSQYVNEWAAPLTN
                     GPEIIRSLRKSIEEGRKTGDFFVHSPVEVRCSNTTCSNSVEPQNLSHRTTTSAGPIYG
                     NQLRPLLDNTPKLKWCPQDKITNSQLTLYINATMYRPFNTKSPIRRWFTVFEETLEAA
                     GGKPHWAKNFIGSSEAEEAAKRDAKLNGSNIQDSQMVGFKTKMNKWYGNDLETYQRIR
                     REVDPDGVFLSGIPWARRNGIVDEEEIERVEKWRADKSDKDEVDDDDEDDDGETQD"
     gene            <86710..>88437
                     /locus_tag="FOA43_001989"
                     /db_xref="GeneID:62195390"
     mRNA            <86710..>88437
                     /locus_tag="FOA43_001989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922294.1"
                     /db_xref="GeneID:62195390"
     CDS             86710..88437
                     /locus_tag="FOA43_001989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778222.1"
                     /db_xref="GeneID:62195390"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /translation="MWIIEYPISDEPHSEQRGHLLEESKRYIIGRSPRSDFHTEKKKI
                     SKVQFVVSFKNHDLVVDNKGKGKFDVNGDYLPNGKCYGFSKRDKEVKDLHFSFQSEPL
                     EFRIRYKRFVLNDRATVEELNSKGVNAEFSLDADQVSHYLIGSDDTMDTIMGIFRRNR
                     HLKLMTREFVESILIHVADLKDDFERNWPEQRDMIVFVVDDNDYERMKDIFAEESSVK
                     IRRVKDPGELASNTAVWKGTGRGFGTFEGLNVSEMTLIYDILRKEAEPPRKQTRRTIR
                     RPIRRPNAISGLQTMMNFDIGDDFKVIKLEDSAKSLDTTLQVVGDSQSEVEEDEIRTN
                     EEDIPTPRKTQFMKVDMTDIEKVQDKSELTTDSRSSELIKLEAETSDSLVKAFQGVKK
                     AKQIDAQQEKSLIESMDKAGTPGVKVVKFKVSEDEIQRGYKVYQPASYGVFSNPEWTN
                     RKEYSRFKKTAFPDGNPITDSTVKGIKMKMAEYKSNCIYGEDGKMSKAEKELLDFNSG
                     LEDLDNEFEVANKKRSGDVLGSRKKFKTNTALFVDSDSIEDDFEPSFRRKLQVVEEDD
                     VPTFRKRRR"
     gene            complement(<88452..>89258)
                     /locus_tag="FOA43_001990"
                     /db_xref="GeneID:62195391"
     mRNA            complement(<88452..>89258)
                     /locus_tag="FOA43_001990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922295.1"
                     /db_xref="GeneID:62195391"
     CDS             complement(88452..89258)
                     /locus_tag="FOA43_001990"
                     /note="BUSCO:EOG09344DAY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778223.1"
                     /db_xref="GeneID:62195391"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="PFAM:PF03998"
                     /translation="MAGFVHDIQKKQHRERAQPQKRKRLGFLEKKKDYRLRAQDYHKK
                     QAQLKILKQKAKNYNEDEYYHAMTTKKTDSRGILISEKDTEILSNDEILLLKTQDTGY
                     LNTMAQREAKKIAKELNDSSTFKSAGQHTVFVESRQEMDDFDAVKYFDTDPSLLYKRE
                     NRLRVRQLNGRVDETVGGTVGGTVDGIVDDSPIVGESGDAEGYSKEERDLNKIKKLNS
                     LQQRIQRQKKLRHLNSRLEFQKELMKGGNRKKIETKEGVTTFKWKNQRKR"
     gene            <89851..>90354
                     /locus_tag="FOA43_001991"
                     /db_xref="GeneID:62195392"
     mRNA            <89851..>90354
                     /locus_tag="FOA43_001991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922296.1"
                     /db_xref="GeneID:62195392"
     CDS             89851..90354
                     /locus_tag="FOA43_001991"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778224.1"
                     /db_xref="GeneID:62195392"
                     /translation="MPPTIDRLLLNDIWLDQPHAPSKLQSDLDVPALLETTLDVVEKI
                     ATLRSRAAKVSIIREIRTYIYDIVIFARNHRFVVGGIPTFVLEDFIQFVQVYATINGY
                     DYVIPEMVKLAAYKLLPLRIKMLKDPYNEPSMFYGSDPELVKQIVDKMDTRIIVEDIL
                     NRVQPPV"
     gene            complement(<90364..>92145)
                     /locus_tag="FOA43_001992"
                     /db_xref="GeneID:62195393"
     mRNA            complement(<90364..>92145)
                     /locus_tag="FOA43_001992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922297.1"
                     /db_xref="GeneID:62195393"
     CDS             complement(90364..92145)
                     /locus_tag="FOA43_001992"
                     /note="BUSCO:EOG09340UVV;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778225.1"
                     /db_xref="GeneID:62195393"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSISRTLTIPANPSTSRGIPVHLTYDAKSDRIAYASGKCIYLRS
                     VKEPSSCIQYPGHNYTTTVATFAPSGFYVASGDESGNVRVWDCASDDLILKGEYQILS
                     GRINDIAWDADSKRIVAVGDGKERYGHCFTYDSGNTVGEISGHTAQVNAVAIRPCRPY
                     KAATVSDDGGLVFLQGPPFKFSLSVRDRHKNFVRDVKFSGDGEYIVSVSADRSIVLYD
                     GKTCEFKRVFENAHDGGIFGVDWYDNKSFVTCSSDATVKRWSVDGELVNTWKVGQKLV
                     ENQILGVTRTKDYVIALALSGDLYYFDETHEDAVNVVYGHQKSITALAVTADKSLYTG
                     SYDGRIISWDLDTKKGSVIKGDPHTNLVAGIKSLGSSTELVSIGWDDKIKKIKAGEAV
                     TIKSLDEQPIQVASYGDEFAVITESCVNIFNTQGDLIKGSKLDYVPSCVEVSEHYLIL
                     ADSRTFRIHVYTKELEPKNEKSFPIMRAKPSFARISANEKYLAVGDSTGRIVCYDLEA
                     GSLVTSRWSFHTSRVNSISWNKDCDHVIAGSLDTDLIIYSVEKPARNIKLHNTHKEGV
                     SSVEWINETEAVSVGADACVKFWKVEY"
     gene            complement(<92260..>94329)
                     /locus_tag="FOA43_001993"
                     /db_xref="GeneID:62195394"
     mRNA            complement(<92260..>94329)
                     /locus_tag="FOA43_001993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922298.1"
                     /db_xref="GeneID:62195394"
     CDS             complement(92260..94329)
                     /locus_tag="FOA43_001993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778226.1"
                     /db_xref="GeneID:62195394"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR036465"
                     /db_xref="PFAM:PF02735"
                     /translation="MENTFLILDESPSMGDVFDDAVNYLIDLIISKVARGKKKDLVGI
                     ITVHDSTTSNPMNDRNPEEWLNCVIEEPKLFNWELLGKLYRDRFRLNPTNPGDCEADL
                     PRALAIALQYIADLNGNKRRKSAIHSIILVSNLDAECSWDGLIEPICSLALQYDVLIG
                     IVYFTKGGSQDSNPSFLTYQNNLESFTRLISILQKQSASIKGRVHESFVCSFDKAKDY
                     LRDYRMEPPKRITPVRTFNGEIRLCCDLNSIDLQNTLGDLRNLNDISDYMPKYDKWKD
                     PFSLSFMADGYPLTKDDVVNLTQDVGVNEEDSHFRVFPIHHVREHYVEEQTEDDTIST
                     KVIHDYALQKGYRYGSSIIPATSAIERQLEMLTYSGIDIISFTKKSQIPPWYYRGETI
                     LLIPTKDSSKKDLYAFNQLAQSMLSSGTLAIARVVQRTGRPAVLAALIPNVILTKNTK
                     YYLKKEDGSLKRTISQMESDEPKHYYGFSMVKLFFKEDEKIPILGKVSGLSEEEDGDK
                     NYPTREMVACMEKLVDAMDIDELNGIDDKKVTENLYIELNDFDTLPIPWKMGIDQESS
                     FKSLNKVTRQILSQNSPKTHFLQKVLKTVYHYQLEDAQEGDNLYDLVEKSKNGVVTED
                     EKTFFDLICEELCKTHDFIPHFGPEVEMEELKIFETDKVEKKVIIKEEVKEDELKSVE
                     ELLGYQA"
     gene            <94457..>95851
                     /locus_tag="FOA43_001994"
                     /db_xref="GeneID:62195395"
     mRNA            <94457..>95851
                     /locus_tag="FOA43_001994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922299.1"
                     /db_xref="GeneID:62195395"
     CDS             94457..95851
                     /locus_tag="FOA43_001994"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778227.1"
                     /db_xref="GeneID:62195395"
                     /db_xref="InterPro:IPR011990"
                     /translation="MQRLTNFTFRMNSRTGVYSFLRYQSSWIPKQLMNSDQRNAQVYR
                     DYYRRHTRNKRIGSYIRRTALGIVTFAMVMIIWQPWNPYSKAVSFNLRKALWAESDKE
                     DDYLKALDYYQRALDEAGKEKMEQLDPRYTGIVLKIAEMYEKMGMVDREREVYEKLAE
                     FLFGKLINDDVKDEWKDILIDRDLVVTTRLATLADKPRLKETMDNLLDRLIYCERRID
                     DKWPFLSNLGANEQVTIEEILDLDERIPRKQFIEKHSSSSPDSKRFLGRWYPKWPYFK
                     ENLIRSRDLYAMKEMADKRNDFSIELLKSNLIWMGLSQDYPIYIGTAICNLASAYYMK
                     SERHQLHIGQINRMIKAEEDPNELVNLKMVLKNEQREQEKSITESEKIYKKLIDKMGG
                     VEGARAYEDNAKLQACLCMALYSLGVIELSKDKNGQSKQYFTQAKNIAADAGLIQIVE
                     RVDKEMEMEMETTQ"
     gene            complement(<95966..>97100)
                     /gene="ASC1"
                     /locus_tag="FOA43_001995"
                     /db_xref="GeneID:62195396"
     mRNA            complement(join(<95966..96379,96570..>97100))
                     /gene="ASC1"
                     /locus_tag="FOA43_001995"
                     /product="G-protein beta subunit and guanine dissociation
                     inhibitor for Gpa2p"
                     /transcript_id="XM_038922300.1"
                     /db_xref="GeneID:62195396"
     CDS             complement(join(95966..96379,96570..97100))
                     /gene="ASC1"
                     /locus_tag="FOA43_001995"
                     /codon_start=1
                     /product="G-protein beta subunit and guanine dissociation
                     inhibitor for Gpa2p"
                     /protein_id="XP_038778228.1"
                     /db_xref="GeneID:62195396"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSSEDVVEVLVLRGTLEGHNGWVTSLATSPANPDLLLSASRDKT
                     LIVWQLTRDENHYGVAKKALKGHSHVVSDCALTPDGAYAISSSWDKTLRLWRLSTGEC
                     IKRFVGHNGDVLSVSISKSVRQFVSASRDKTIKVWNAIGECIETLQGHSDWASCVRCS
                     PSDNSIVLSAGWDKVVKTWDLTDGSLLADFVGHNGYISCITISPDGSLCASGGKDGVI
                     ILWDLSSRQILYTLNAGNEINALAFSPNRFWLCAATNSSIQIFNLQERSLKDELKPEV
                     AEGKTPRCISLAWSSDGQNLFSGYTDSLIRVWQVMTSS"
     gene            <97506..>97883
                     /locus_tag="FOA43_001996"
                     /db_xref="GeneID:62195397"
     mRNA            <97506..>97883
                     /locus_tag="FOA43_001996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922301.1"
                     /db_xref="GeneID:62195397"
     CDS             97506..97883
                     /locus_tag="FOA43_001996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778229.1"
                     /db_xref="GeneID:62195397"
                     /db_xref="InterPro:IPR019404"
                     /db_xref="PFAM:PF10280"
                     /translation="MTKDLSYIQKRLDSLHEIDKRIISFLDNMSEAVKDLQLAKQTND
                     NKKLTEFNKSVGYCFDDLSYTAIHLRREIKFLSDRMNSKADTDDFTMLPVQINKKATW
                     VNGAKMRQEIKEMNKTLSDIKED"
     gene            complement(<97904..>99418)
                     /locus_tag="FOA43_001997"
                     /db_xref="GeneID:62195398"
     mRNA            complement(<97904..>99418)
                     /locus_tag="FOA43_001997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922302.1"
                     /db_xref="GeneID:62195398"
     CDS             complement(97904..99418)
                     /locus_tag="FOA43_001997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778230.1"
                     /db_xref="GeneID:62195398"
                     /db_xref="InterPro:IPR012394"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="PFAM:PF00171"
                     /translation="MATINNINPSVDNIPIAVNRLRQSFFDRPVREISELRGQLSAIK
                     VGLDKHRDQLATALEKDFHRSVLETIVLEYSCISGEIDYLTKHLASLLKADGPDEKSS
                     LFSTLNMKTEKIPLGCVLIIVPFNYPLELSLSPLVGALAAGNNVALKLPYDKCPEFCV
                     ELTKMLLESVDPDRLIVVNGGIPESNALLDQQFDKILFTGSGKVGHIVMEKAAKYLTP
                     TVLELGGKSPTFLTCHCGNLKKAWKRILWGKFANAGQTCVAPDYLLLDDKIYDKAISV
                     MREVYKEMFPRINADVDYTHVIDQRAFDRLTGYLEKTKGKVIVGGGKDAASRFIEPTI
                     VTDVEFSDILMKEELFGPILPIIRYSDLGKAVDTVRLKHDTPLAIYIFSDSTKEQELI
                     KIIRSGGMCINETLMHAGCHSTPFGGIGQSGFGNYHGRYSIATFTHQRAVLKQRYWAE
                     FTVDIRYPPYNYAKVRKLLVLSKLPAVPCLSVWNILAYVVVLAVGMIVGHSYTN"
     gene            complement(<99755..>100492)
                     /locus_tag="FOA43_001998"
                     /db_xref="GeneID:62195399"
     mRNA            complement(<99755..>100492)
                     /locus_tag="FOA43_001998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922303.1"
                     /db_xref="GeneID:62195399"
     CDS             complement(99755..100492)
                     /locus_tag="FOA43_001998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778231.1"
                     /db_xref="GeneID:62195399"
                     /translation="MEELENQKPLGVDTFEQGDLSGKLCSYEVSSPDKYGCGDMMKQG
                     RSKYQLASLKTMLKEYNKDGDLIRVKIKEQIFKLEPSRREMKYRVDSALYDEMKQGCH
                     IENGKRENFVLVEPSQEVSHVENYKNGQLVSVEPARAHCHMSGKLDHAMLLPGDIFAV
                     RMSGKSDHDSGEISMFTIYLKNKLSQLEEPIDMSPDQWISDEIQVCVFIFVSLLVVGA
                     LACGFMTFIKQSWGYIRVREPEKGLHV"
     gene            complement(<100664..>101215)
                     /gene="IMP3"
                     /locus_tag="FOA43_001999"
                     /db_xref="GeneID:62195400"
     mRNA            complement(<100664..>101215)
                     /gene="IMP3"
                     /locus_tag="FOA43_001999"
                     /product="Small subunit (SSU) processome component"
                     /transcript_id="XM_038922304.1"
                     /db_xref="GeneID:62195400"
     CDS             complement(100664..101215)
                     /gene="IMP3"
                     /locus_tag="FOA43_001999"
                     /note="BUSCO:EOG0934446O"
                     /codon_start=1
                     /product="Small subunit (SSU) processome component"
                     /protein_id="XP_038778232.1"
                     /db_xref="GeneID:62195400"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="PFAM:PF00163"
                     /db_xref="PFAM:PF01479"
                     /translation="MPRQLKYHEQKLLKKVNFLEWKQDHGHRDAMVMRTYHIENREDY
                     HKYNRVCGDIRKLARKLALLSPRDPFRIKHEQLLLDKLYRMGVLSTASKISDLENKVT
                     VSAFCRRRIAVVMCRLKMAEAVSDAVKFVEQGHVRVGPDLITDSAYLVTRNMEDYLTW
                     VDSSKIKHNVLKYKNKLDDYSLV"
     gene            <101410..>102084
                     /locus_tag="FOA43_002000"
                     /db_xref="GeneID:62195401"
     mRNA            <101410..>102084
                     /locus_tag="FOA43_002000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922305.1"
                     /db_xref="GeneID:62195401"
     CDS             101410..102084
                     /locus_tag="FOA43_002000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778233.1"
                     /db_xref="GeneID:62195401"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="InterPro:IPR036789"
                     /db_xref="PFAM:PF00347"
                     /translation="MLSRIRGTQRSHLLIRGFSSTISARSHIGSSPVFLPEDVKLEMN
                     DFLIPRVISKGKESIRLSRLLTIKGPNGVVDLEIPEFLKIDQNEGRINVHVQKPEIKI
                     QRSLWGTMRALINNGVIGVAEGHMSVLRFKGTGYRVMLEKDDNEAEWVKMKIGKCDMQ
                     GLPIPKGIKCSTPTTTLLVLEGCDKQKLNQFAGRLKNMHPPEPYKGKGIYMNGEQIQL
                     KTKKVK"
     gene            <102330..>103688
                     /gene="HHP1"
                     /locus_tag="FOA43_002001"
                     /db_xref="GeneID:62195402"
     mRNA            <102330..>103688
                     /gene="HHP1"
                     /locus_tag="FOA43_002001"
                     /product="casein kinase I"
                     /transcript_id="XM_038922306.1"
                     /db_xref="GeneID:62195402"
     CDS             102330..103688
                     /gene="HHP1"
                     /locus_tag="FOA43_002001"
                     /codon_start=1
                     /product="casein kinase I"
                     /protein_id="XP_038778234.1"
                     /db_xref="GeneID:62195402"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MDLRVGRKYRIGRKIGSGSFGDIYFGTNIISGEEVAIKLENIRA
                     KHPQLEYEAKVYKALCGGVGIPFVRWFGTECDYNAMVIDLLGPSLEDLFNYCNRKFSY
                     KTVLLLADQLLCRIEFIHARSFIHRDIKPDNFLMGIGKKGSQVNVIDFGLAKKYRDPR
                     TYVHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLIYFCRGSLPWQGLKA
                     ATKRQKYDRILEKKMSTPAEVLARGLPVEFTHYLNYIRSLRFEDKPDYMYLRRLFRDL
                     FVREHYVYDYIFDWTVFKYKLHQQQQQQQQQQQKIVDNNADNTAAVATAANDDKKNIR
                     QPEGFAATSPVKPLLQQTQNAAVAVPDPAIGATAQSYRIQNYQIAQAQQAQQAQQAQQ
                     TQQAQESQPTQQVQLEQPVQQTQTQQQYYYQQQQQQQQQQQQQNRQDSPPQQSNVNPA
                     WL"
     gene            <103980..>105170
                     /locus_tag="FOA43_002002"
                     /db_xref="GeneID:62195403"
     mRNA            <103980..>105170
                     /locus_tag="FOA43_002002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922307.1"
                     /db_xref="GeneID:62195403"
     CDS             103980..105170
                     /locus_tag="FOA43_002002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778235.1"
                     /db_xref="GeneID:62195403"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="PFAM:PF00293"
                     /translation="MSSVYFGAKTSLNRFAFLRPNADFIKSVIEYSGTRLVFYLREPL
                     RNGFKILAHKSPDHPRIVYFPIDGSELVHEKMKQWAQMNAANSADLRLKTKITAVFLG
                     LDEEPGSADSPLKDESVDPKEVFQFQNHSGVPLFAVDITDNEELCHDIIGRLKDVEYL
                     ANIDDIMNLSLIDSSIFSYGKMYLDWLYRNQYCPGCGSRVIPIFAGSKLQCTNEAKET
                     DSRGNQVFKCPVRKTSVNNVCFPRQDPVVIIALRNSSSTKILLGHNARRKNLDEKFFS
                     CFSGFMEPGETIEGAVEREVWEETGFKLHEKIQIVKSQPWPFPCCLMVGCVGTTDPGV
                     DNEINIHLDKELDVCKWFDIDYVANLVYKRPTDGKIRLPYAGSVAFELIKMVIDDCKS
                     KGRL"
     gene            complement(<105173..>107125)
                     /locus_tag="FOA43_002003"
                     /db_xref="GeneID:62195404"
     mRNA            complement(join(<105173..105974,106299..>107125))
                     /locus_tag="FOA43_002003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922308.1"
                     /db_xref="GeneID:62195404"
     CDS             complement(join(105173..105974,106299..107125))
                     /locus_tag="FOA43_002003"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778236.1"
                     /db_xref="GeneID:62195404"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="InterPro:IPR036609"
                     /db_xref="PFAM:PF03815"
                     /translation="MIRHIVGSEDREDLLPRPESKSKDIELQPFTEQTNAADPSEEMK
                     RPSSTSDVVHLILDGPDNPSDEPPRFHSEILQRLEDIPRRLSLEIPFKVRVLVILGYY
                     LFWLLILRSTLSSYLGKVPYSTDKGGEKTKILSLACGDEKRIWKGQNDACGLNSRDCS
                     PRSLDIPSELIIRCPALCDIGSITYGAREVGDQTVRYENFYVGGGSDDGDAYTLPYRA
                     DSFPCGAAVHAGVVSPIFGGCAKLEFTGPQFHFDSVQPVHSSMSKSTKFDSFFPQSFR
                     SLLWYPLFWLGMLNNVTFDRLAVDRFTLKDIAAMPGSVTTTILLLLLILTGTVIQAHQ
                     LWKAGRLRNYIIGYCTLGLSIIGLSHIHGLQLRIHHYIIGLVLIPGTKTRGYTAFLFQ
                     GLLLGLIVNGVARWGFASIEETNLSLLRDDSAGRAEPPSFLGYTKKNNSITWTEVEFP
                     TTNKQTEKHPVLYSVLINDVEVYKGPDVSINIAELTKNNTEFGTLLTQAVGYHEEVQV
                     YIRIASLGRKGDQRSGYCDAETMEITQSQLKISR"
     gene            <107530..>108722
                     /gene="ARO4"
                     /locus_tag="FOA43_002004"
                     /db_xref="GeneID:62195405"
     mRNA            join(<107530..107535,107634..>108722)
                     /gene="ARO4"
                     /locus_tag="FOA43_002004"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_038922309.1"
                     /db_xref="GeneID:62195405"
     CDS             join(107530..107535,107634..108722)
                     /gene="ARO4"
                     /locus_tag="FOA43_002004"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_038778237.1"
                     /db_xref="GeneID:62195405"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00793"
                     /translation="MSDLRHMNTPIPQEYDDLRVVGYDPLIPPELLTQEIPLTKHAAF
                     TVIKGRKEASAIINRKDDRLLIIVGPCSLHDPKAAMEYVHKLKGLADQLSGELCIIMR
                     SYLEKPRTTVGWKGLINDPDMDGTFKINKGLRISRRLFVNLNETGIPIGSEMLDTTSP
                     QYLSDCLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGSLDVAMDAIQAASFPHH
                     FMGVTKTGLAAITITTGNKDCFVILRGGKQGPNYDPKSIAVAKSKLPEGRVLMVDCSH
                     GNSQKDFRNQPVVCASVAEQISNGESKIIGVMIESNINEGKQSIPEDKSQLKYGVSIT
                     DACVSWETTVKMLKQLSDAVKARRVKVAKN"
     gene            <108932..>110620
                     /gene="HIS7"
                     /locus_tag="FOA43_002005"
                     /db_xref="GeneID:62195406"
     mRNA            <108932..>110620
                     /gene="HIS7"
                     /locus_tag="FOA43_002005"
                     /product="Histidine biosynthesis bifunctional protein
                     hisB"
                     /transcript_id="XM_038922310.1"
                     /db_xref="GeneID:62195406"
     CDS             108932..110620
                     /gene="HIS7"
                     /locus_tag="FOA43_002005"
                     /note="MEROPS:MER0065588;
                     BUSCO:EOG09341F02"
                     /codon_start=1
                     /product="Histidine biosynthesis bifunctional protein
                     hisB"
                     /protein_id="XP_038778238.1"
                     /db_xref="GeneID:62195406"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014640"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00977"
                     /db_xref="PFAM:PF01174"
                     /translation="MPIVYIIDVESGNLRSLQNAVEYLGYETRFIKHGSDPALKKADK
                     LILPGVGNFGHFVKELRSRDFFDPLTKYVESGKSLMGICVGLQALFKGSEESPDVGGL
                     KFIDLRLKKFNDSNKSVPQIGWNCLEVPALNGKRQTLYDMKPDARFYFVHSYAAIVND
                     DQIAELSSQGWDLAISKYADEKFIAAVAKGNIFATQFHPEKSGAAGLNVIKAFLQQQK
                     VTSLPETQSQMQESSSKAIEVTPTGLTRRIIACLDVRTNDQADLVVTKGDQYDVREKR
                     AGGDVKSLGKPVQLAEKYYRQGADEVTFLNITSFRNSPIKDQPMLEVLRQAAKTCFVP
                     LTVGGGIKTVLDSDGTEVSALDIATLYFRAGADKVSIGSDSVKAAEEFIASGEHATGK
                     TPIETISRAYGNQAVVISVDPKRYYVADPVNFKYNLITTATSGPDGEKYCYYRVTSQG
                     GRKVHELGAYELCQACEKLGAGEILLNCIDKDGTNSGYDFELINQIKSAVRIPVIASS
                     GAGNPQDFVDVFKNTKADAALGAGIFHRGEYTVTQVKRYMRDHGMLVRIDETQI"
     gene            complement(<110684..>112138)
                     /locus_tag="FOA43_002006"
                     /db_xref="GeneID:62195407"
     mRNA            complement(<110684..>112138)
                     /locus_tag="FOA43_002006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922311.1"
                     /db_xref="GeneID:62195407"
     CDS             complement(110684..112138)
                     /locus_tag="FOA43_002006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778239.1"
                     /db_xref="GeneID:62195407"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="PFAM:PF00415"
                     /db_xref="PFAM:PF13540"
                     /translation="MVALSRKRKLASYAKSKAVSAKRARRSHSLEWLRASRMKVINKI
                     QSPVHVPMDFFIWGSGAMCELGLGPAAKTKEVKRPRLNPLLKKDEVGIVDFAPGGMHT
                     LALDKDNRVWSWGNNDMGVLGRDTSHAKEVLRDADASDGDDEDADLNEAESTPGLVEG
                     LPKEGKIIQLIATDNLSAVLLSSGEVYAWGTFRCNEGVLGFSRDVKVQKTPVRIENFD
                     NIVQLAAGKDHILALDTKGIVYAWGNGQQSQLGRKIIERTRMASLEPRSFGLKNVKFI
                     GSGEYHSFAITYEGKVFTWGLNQFGQCGIATNIEDGSIITRPTEIQELSDKDIVYITG
                     GEHHTLALSSSGEVYVFGRYDMKEIGIAKDKLPLDDCIKDARGAVRCLPVPTKLTTLP
                     PIKSVSAGPHHSLALTRDGIVFAWGFADTFAVGLGMLDEDVDRPTRISNTATKDHSIE
                     LIGCGGQFSASAGNRLDEKDVDDRKQKVDLFEES"
     gene            <112390..>113826
                     /locus_tag="FOA43_002007"
                     /db_xref="GeneID:62195408"
     mRNA            <112390..>113826
                     /locus_tag="FOA43_002007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922312.1"
                     /db_xref="GeneID:62195408"
     CDS             112390..113826
                     /locus_tag="FOA43_002007"
                     /note="BUSCO:EOG09342U6T"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778240.1"
                     /db_xref="GeneID:62195408"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="PFAM:PF05291"
                     /translation="MGKITTKEIRDKARHSPLYREITTADGTFKAINGKTRKTVVSNE
                     EDKEVTLDALSSRKILQLAREQQEEVEKEENIVEAVSKPRFRFVESEDEEEVNEDNEI
                     TDGEEEEEEYEQEEFVDEQDMKLFDSYFNKGSETQSKGEGMAGSFNLADKIMEKIREK
                     EAGSGEAENDAQGFSQREDRVFLPPRVIEAYEKVGESLSAWRHGKLPKLFKVLPTIKN
                     WEDILYVTNPEKWTPNVLYEATKLFVSNLPSNKAQKFVTMVLYPRFRQDIEDSEDHKL
                     NYHIYMSLKKCLYKPAAFFKGFLFPLIEDQCTAREAMIVASVLKKCSIPVQHSSVALS
                     WLLEQEFSPQSAVFIRVLIEKKYALPYQTIDDLVFYFMKFRVITDQNKDNIMLDEDEN
                     VDLSEQRRIREAPQLPLVWHKALLAFAQRYKNDITDDQRDFLMEVIRQRGHKEIGPDT
                     RRELLAGKKRAEKEASKAHEDDDIMSYF"
     gene            complement(<113913..>116678)
                     /locus_tag="FOA43_002008"
                     /db_xref="GeneID:62195409"
     mRNA            complement(<113913..>116678)
                     /locus_tag="FOA43_002008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922313.1"
                     /db_xref="GeneID:62195409"
     CDS             complement(113913..116678)
                     /locus_tag="FOA43_002008"
                     /note="BUSCO:EOG09341JTD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778241.1"
                     /db_xref="GeneID:62195409"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015359"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR037755"
                     /db_xref="PFAM:PF00168"
                     /db_xref="PFAM:PF00387"
                     /db_xref="PFAM:PF00388"
                     /db_xref="PFAM:PF09279"
                     /translation="MPIVRPNSNENSVPMPRVGSDSKEGNNSPVKQLLYKRLSFLRNK
                     KTSGTVIGNILVSTSSSYDSSVTLATSGSYDSTNDSSNSGDSSEDVNNDSSADEVSRS
                     MVHGFSSALAVISLPLTRSVVYTSSDSLGFPDEYFSRPLDRKNIPVEFLEPGFEMLRV
                     THRKKVKRFFRLDLEQSRLYWNSKASSFLEIEKIKSIRIGDEAKNYREEFKVSSQYCD
                     FWITVIYHNYAKSNNIKALHIIATSKRDYDQFLYTLSNLVYFRRQLQSSLYSAACSNL
                     FTKFHWNNKSSGMDRLDFEGVLKMATRLHIYVDRDFLLKIFKTEDRGGKEYLDFDEFK
                     RFVKTLRQRHEFASIFSTFSDSQQRMRKHSFERFLVEEQQEPVDGDDTVTHLFSKFSK
                     GKDYLSLDEFGSFLVSPYTMTFKTVVEDFSKPLNEYFISSSHNTYLLGRQFNGVSSIE
                     GYIRALQRGCRCIEVDVWDGENGPIVTHGRTFTGSMDFRLVIETIRKYSFITSPFPVI
                     ISLEIRCNQANQIACVCILKEILQDMLLPVRLGSLNPDSLPSPLDLKHKILVKVKRSK
                     SVSVANGILPSSTSSSFSEDSTSTSKITKIIPKPKKPVPIVPELGALALYTIGVKFRN
                     FSLPESKTLNHCFSFSDRTISKMLKEKTKFNAITKHNRNFLMRVYPSVYRFKSDNFNP
                     LTLWSLGCQIAATNWQVYDAGQQINEALFNVGSCSGYILKPEALRTNKERFRKTEDFE
                     SVLRFDKTSTLEVGIVSAQQLSKTKDMKVNSFDVYIEVELYSGKVIDFDARKGEGVHS
                     TTIGEPQIKTGSDNTNSNPCQHFDTQQIMDLGVPSAVFRTSIALKNGFNPIWNEYFRL
                     SFHTNQENLTFLRFLVKCNTPDHKDVLIGSHCCKLDYMKKGYRHLPVYDLQGEELIYS
                     SLFLHIN"
     gene            complement(116871..116943)
                     /locus_tag="FOA43_002009"
                     /db_xref="GeneID:62195410"
     tRNA            complement(116871..116943)
                     /locus_tag="FOA43_002009"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:62195410"
     gene            <119095..>121319
                     /locus_tag="FOA43_002010"
                     /db_xref="GeneID:62195411"
     mRNA            join(<119095..120181,120367..>121319)
                     /locus_tag="FOA43_002010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922314.1"
                     /db_xref="GeneID:62195411"
     CDS             join(119095..120181,120367..121319)
                     /locus_tag="FOA43_002010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778242.1"
                     /db_xref="GeneID:62195411"
                     /translation="MKTSILQILALTSLIQALPFPYVNKRHDTSDPCELPQPAQEDDC
                     EFNGNSYQWKKSCVGFDGNFNYKVDYSELQNNDNCNKVAVVAGGQTHTLLDRTSGVET
                     DKFSCQPEDDNNGNYCPPETYEVEACFGQHTYTHTVSNDHNCIPTTCSTATTPTTGPT
                     TGPTSDSTSCTTDTTPTTGPTTGPTTGPTSDSTSCTTDTTPTTGPTTGPTTTPTTGPT
                     SDSTSCTTDTTPTTGPTSDSTSCTTDTTPTTGPTTGPTTGPTSDSTSCTTDTTPTTGP
                     TTGPTTGPTSDSTSCTTDTTPTTGPTTGPTTGPTSDSTSCTTDTTPTTGPTTGPTTGP
                     TTTPTTGPTSDSTSCTTDTTPTTGPTSDSPTTGPTTGPTTGPTTGPTTGPTTNPTTGP
                     TTGPTSKSTSCPTDTTSTTGPTTGPTTGPTTGPTRGPTTGPTTGPTTGPTTGPTTGPT
                     TGPTTGPTSKSTSCPTDTTPTTGPTTGPTTGPTTGPTTGPTTGPTTGPTTGPTTGPTT
                     GPTTGPTTGPTTGPTRGPTTGPVTPHPSTSTHASVTTAYTTVTCSLEKCTTITIHPTG
                     STEIPSQSTPVVSPSEEKATSGAPSHGTSTSVHASAFTTVTCHNQECSTIVIIPTEAS
                     TPSTHTSSDTISASTSAKPTGSSTATQLSTFKGAGNPLKAPSNLLAGLGCLFLLI"
     gene            <121693..>122691
                     /gene="ARK1"
                     /locus_tag="FOA43_002011"
                     /db_xref="GeneID:62195412"
     mRNA            <121693..>122691
                     /gene="ARK1"
                     /locus_tag="FOA43_002011"
                     /product="Serine/threonine-protein kinase ark1"
                     /transcript_id="XM_038922315.1"
                     /db_xref="GeneID:62195412"
     CDS             121693..122691
                     /gene="ARK1"
                     /locus_tag="FOA43_002011"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase ark1"
                     /protein_id="XP_038778243.1"
                     /db_xref="GeneID:62195412"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MPKFQSTLGKSAHSWNPMGNPVGNATGTTNVTNNEPSSGTAESV
                     FKRLSTRHKSRTTLSFRKKWTPEDFEMGKKLGKGKFGRVYCVREKQSGYICALKVMSK
                     EEIVSYKVEKQFVREIEIQANLRHSNCLRLYGWFYDDKNVYLILEYAAKGELYQQLKK
                     CQRFDEARTSYYIYQVASALSYLHKKHIIHRDLKPENILMHFHNQVKLSDFGWSVYAP
                     QDRRRTTMCGTLDYLPPEMVEAKSHNEKVDVWALGVLMYELLVGKPPFEDEHSSITYK
                     RIAKVDLQIPHFVSTDATDLIKKLLRYDPAKRLSLQDLPNHPWITRNRSQWQKLRE"
     gene            complement(<122740..>124482)
                     /locus_tag="FOA43_002012"
                     /db_xref="GeneID:62195413"
     mRNA            complement(<122740..>124482)
                     /locus_tag="FOA43_002012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922316.1"
                     /db_xref="GeneID:62195413"
     CDS             complement(122740..124482)
                     /locus_tag="FOA43_002012"
                     /note="BUSCO:EOG09342HDK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778244.1"
                     /db_xref="GeneID:62195413"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MPPYKFGSYPSLKLPDEKSREGIARLVSKVDDFRELKILPEIRS
                     ALLQEIKAHTVLRSQNYINSDKKKKTEGELNGLIIRPTPIQTAAIKMINAKRSAGEFL
                     KVFTLAAETGSGKTWAYLAPLFQYLRLEDVKRGEEYVIVDRKEVGAEAEVDAEAEVNE
                     ADEVNEADVNEADVKAEAELNEADEVNAEAELNEADEVNAEAELNEADEVNAEAELNE
                     ADVKAGAEVNEADVNADSEAVEFAKKHKPTSHRRHRTGIRSIVLVPTHELVDQVYSTV
                     EHTEATLGTKLFKWDTDSNFKVFIQAFRQGIDVLVTTPPKLLSLTRYDSVRNPRALLG
                     SVKFCVVDEADTLMDESFVQDTYNVTKNMCNLNTLVFASATIPSQFNSTIHKLFPDAI
                     SVSTPSLHKLPKSIEFRVINASVSPYKGSKMKALAQTLYAIHCDGSERGFEKRVIVFV
                     NNKDDCEKVACRLHEKYGHDVVYISGDDTTDDRKAKVQTFIDPPKDLTDPERSVLKVL
                     ICTDLLSRGLNFTGIRNVVLLDVPHNSSDLVHRAGRTGRMNQSGRVFLIINDQDKSHV
                     KGLPKVLRNNRRLG"
     gene            <124873..>126747
                     /locus_tag="FOA43_002013"
                     /db_xref="GeneID:62195414"
     mRNA            <124873..>126747
                     /locus_tag="FOA43_002013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922317.1"
                     /db_xref="GeneID:62195414"
     CDS             124873..126747
                     /locus_tag="FOA43_002013"
                     /note="BUSCO:EOG093428MV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778245.1"
                     /db_xref="GeneID:62195414"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="InterPro:IPR031545"
                     /db_xref="PFAM:PF08492"
                     /db_xref="PFAM:PF17004"
                     /translation="MSSLTDLISQMQIFSASDSHSQVLQAGRKVLIQDAHNLGALKQC
                     LVALINMDKYEAALKMMDEYKELLKTDDSSDKLLLLEKAYIYYKTNNGAKLESLIPLA
                     KGIRGFQHILAQYYYRIGRNEDALKLYQILLQHPGAEESDLSVNETAILSQIKHEDSS
                     VSIPLMSRNAFGSYDLISNKALIKLFEHNYSESLQLLEKALKMAEETLKNYDSDSRAA
                     ELIPIHVQIAYVNQLLGNADKAEQILAQFDVTTVKDQVLKLIITNNLISLKDSDRCNN
                     NPALLYREMDLPSSLHNSLDRLTLPQTKILQRNELLLAQRAGKNLTDVAKRNAEKFPG
                     SDMGLALSTMEKTGIEFEDLDFENNVKKLFRYSIKHPEDLPFALLVCQISIAYGNLQN
                     AAILLENIVQHDEQVLFNKPAVASLLYYIYEKSDKKKSIIQLLNRLYDGLSMKKISNS
                     EEYKLLKFSAFQLLSIDAEKSKQLFAKIEGIEKEQVQKSALVEAILGGSAEHLPSVES
                     LVAEINTDSLIEQGMEPLMTKNVKGENTKPHSKVIKLKKTKRERNKPKKLPKNLSKKI
                     DEERWLPMKDRSYYKSKKSKHNKTQGGIADESLDINEKVIEKPQNGKKRKIKKKKGGK
                     "
     gene            complement(<126798..>127343)
                     /gene="NIP7"
                     /locus_tag="FOA43_002014"
                     /db_xref="GeneID:62195415"
     mRNA            complement(<126798..>127343)
                     /gene="NIP7"
                     /locus_tag="FOA43_002014"
                     /product="ribosome biosynthesis protein nip7"
                     /transcript_id="XM_038922318.1"
                     /db_xref="GeneID:62195415"
     CDS             complement(126798..127343)
                     /gene="NIP7"
                     /locus_tag="FOA43_002014"
                     /note="BUSCO:EOG09343Y66"
                     /codon_start=1
                     /product="ribosome biosynthesis protein nip7"
                     /protein_id="XP_038778246.1"
                     /db_xref="GeneID:62195415"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005155"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="InterPro:IPR036974"
                     /db_xref="PFAM:PF03657"
                     /db_xref="PFAM:PF17833"
                     /translation="MRQLTEEETKVVFEKLATYIGRNITFMVNNPDEPHVFRLQKDRV
                     YYVREDIAKLATAIARKNLISIGVCLGKFTKHGKFRLHITSLPYLAKYAKYKVWIKTN
                     GEMPFLYGNHVLKAHVGKMSEDIPEHSGVVVFSMKDVPLGFGVSSKSTIEAKNLQPTG
                     IVALRQADIGEYLREEDTLFT"
     gene            <127738..>129314
                     /locus_tag="FOA43_002015"
                     /db_xref="GeneID:62195416"
     mRNA            join(<127738..127743,127849..127856,127934..>129314)
                     /locus_tag="FOA43_002015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922319.1"
                     /db_xref="GeneID:62195416"
     CDS             join(127738..127743,127849..127856,127934..129314)
                     /locus_tag="FOA43_002015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778247.1"
                     /db_xref="GeneID:62195416"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="PFAM:PF01416"
                     /translation="MRTSGRALTDEGKPMFPEEKRKPKRKVACMIGYCGAGYHGMQIN
                     PPNKTIEGDMFEAMVEAGAISKNNSNDLKKSGFMRAARTDKGVHAAGNMISLKMIIED
                     ADIVDKINEALPEQIRFWGYQRVNKAFDCRKMCSSRVYEYLMPTYSFLPPRLNSPLYK
                     RVKEMQKKHSETIRVDEEGEKFWVDLNKKIGDAGITQEQLDQISEAGREGIPLTIPLD
                     IASRKVKQLSLEARQKFRVKQETLETLRKMLKFYLGSHNFHNFTNGKVFRDPSAKRFM
                     KNITVSDPFVIGQTEWISIKIHGQSFMLHQIRKMIGLASLILRTGCPIEKVREAFGPD
                     KVNIPKAPALGLLLERPVYDGYNEKLKSYGHEPLTFDGYTERMDTFKRKFIYSKIYEE
                     EEKEHTFHGFFGFIDFFTGTEATNNGLPIFDFITSGEIKEEVVGERRKDRNEEVEKAA
                     AGAAAAASEASQTS"
     gene            <130594..>132606
                     /locus_tag="FOA43_002016"
                     /db_xref="GeneID:62195417"
     mRNA            <130594..>132606
                     /locus_tag="FOA43_002016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922320.1"
                     /db_xref="GeneID:62195417"
     CDS             130594..132606
                     /locus_tag="FOA43_002016"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778248.1"
                     /db_xref="GeneID:62195417"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="PFAM:PF00501"
                     /translation="MGLITAVTLFAIAVIIGHRALPGVKSWWADFNYRYRVTNDLQLV
                     IPMGLQALRHVYQTLISHRFNQFYDIEKTCLSSKYGNKIALNYIQLKQGKKYQVDGDD
                     AFRIDRYTYHQMYDIVLRLSFILKNEYGVKKGDTVTIYFMNKPLFIFIWLALWNLGAI
                     PAFLNYNLKHNPLVHSVKLVNSACLLVDSNDCEEQFMETRDEILAAIPDLKIFYLNDQ
                     VLVPKLEDNSSPKYREQDSVRDSGVKAHHPALLVYTSGTTGMPKSAVNSWRKLFFAAY
                     LFTVPMQITEKCNIFTAMPLYHGTASILGVVPAFESRGTLSLGHKFSVSSYWAQVRLT
                     HSNTIQYVGEVCRYLVDAPKSEDERRWYGKVDLAYGNGLRMDIWTKLKKRFGIKAVGE
                     FYASSESPFATTCREVNGNGVGAIRNNGYLADRFLTKAMYTLVRMQKDDDNMIYRNAQ
                     GLCEEPAANEKGEMITKILNPRRIETTFPGYVNNNEATYSKVIRNVFHKGDAWVRSDD
                     LMKRDEIGNVYFVDRLGDTYRWKSENVSTTEVENEILALDDIEYCVVVGCKVKDHEGR
                     CGYIVLQTKRDNQETEEEKKELLDKLADRVFQHLPHFARPCFVRFDQIEMTSSHKISK
                     KRFRNPVLPAGPNGNQEIYYLDTKGKQYKPLNAELFEQIIKQEIRI"
     gene            <133014..>134150
                     /gene="ARO3"
                     /locus_tag="FOA43_002017"
                     /db_xref="GeneID:62195418"
     mRNA            <133014..>134150
                     /gene="ARO3"
                     /locus_tag="FOA43_002017"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_038922321.1"
                     /db_xref="GeneID:62195418"
     CDS             133014..134150
                     /gene="ARO3"
                     /locus_tag="FOA43_002017"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_038778249.1"
                     /db_xref="GeneID:62195418"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00793"
                     /translation="MQSSSHMFMENPHVGDRSRVEDWRITGYNPLTPPDLLQSQYPLN
                     PKCEKTILEGREKACDIINGKDDRLLIIVGPCSLHDPVAAVDYCNRLSKLSESLKKDL
                     HIVMRAYLEKPRTTVGWKGLINDPDIDGTFKINKGLRISRELFVKLTEKLPIAGEMLD
                     TISPQFLSDCFSVGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLSVAIDAIRAAA
                     HPHHFLSVTKPGVVAIVATEGNKDTFVILRGGKHGTNYDEENVKLAQAALEKAKTVKP
                     GEARIMVDCSHGNSQKNHKNQPIVAAEVGRQVSNGSTHICGLMIESNIVEGRQDVPEE
                     GGSDKLKYGCSITDACISWEDTIKVLNKLAESVRSRRKVVAATK"
     gene            complement(<134223..>135764)
                     /locus_tag="FOA43_002018"
                     /db_xref="GeneID:62195419"
     mRNA            complement(<134223..>135764)
                     /locus_tag="FOA43_002018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922322.1"
                     /db_xref="GeneID:62195419"
     CDS             complement(134223..135764)
                     /locus_tag="FOA43_002018"
                     /note="BUSCO:EOG093415FK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778250.1"
                     /db_xref="GeneID:62195419"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="PFAM:PF13091"
                     /translation="MFSTCFANTLHRFTGVVCHVERRAFCIKADNFTLSNYGSFNPQL
                     GATLHQLDSLAPRFEIKSSQIEILDHPDDFYTTLKNKIRAAQSRVFLSSLYIGNHQNE
                     LVACIADAMQKTPKLQVKILLDCLRSTRDSPDDSTASLLAPLVSRFGDRIDVRLYHTP
                     KLHGLLKMLIPKRFNEGFGLQHMKIYGFDDQVMLSGANLSQDYFTNRQDRYYIFSSKP
                     MSDYYLGVQDAVSSLSYQLLPADNKQKYLLRWNSSNKASEPLLNVERYIKDCNRVLNP
                     VLKSHCGSTLLELHETAPDTVVYAVSSFTPLLEPDFSTEKPAILRILSFLDDKSASFT
                     FTAGYFNMHRDILDRICHSQASGNIITAAPEANSFYKSKGVSRYVPPAYLYNAKKFLE
                     KVTKAGRGDKVRLLEWQNGIIHQPNGWSYHAKGIWINLPGESEPSITVIGSSNYTKRA
                     YSLDLEINAIVITKDSELKAKMKKEVDHLCKHTSVMTLKDFQRHDRHISPGVKVAATV
                     LGNML"
     gene            <135977..>137878
                     /locus_tag="FOA43_002019"
                     /db_xref="GeneID:62195420"
     mRNA            <135977..>137878
                     /locus_tag="FOA43_002019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922323.1"
                     /db_xref="GeneID:62195420"
     CDS             135977..137878
                     /locus_tag="FOA43_002019"
                     /note="BUSCO:EOG09341RSZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778251.1"
                     /db_xref="GeneID:62195420"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="PFAM:PF00383"
                     /db_xref="PFAM:PF00849"
                     /db_xref="PFAM:PF18785"
                     /translation="MTEKTKGRSLSPGSIESPAKMRKSSRGQSPQVDSHGFRRSQVSV
                     DAEKMSAYERMGGDGNRLNMDGFPKNKTIKQEDDDTDYIIDGSLRRVEPYYFTYMTHC
                     KERWRNKNILDVFSSEFRLFSRSYYEDTIKDGRVSINNEVANIDSIIRNGDLITHRMH
                     RHEPAVTSDPIKIVHEDVDYVVIDKPSGIPVHPTGRYRHNCVTFVLEKEMGIRAHPCN
                     RLDRLTSGLMLLGKNGKAADKISQKLKQRQVTKQYVAKVVGEFPSDNKGIVVDEPILT
                     ADPRLAFNIIDKEKGKAAKTFFKRLSFNGKTSLVLCKPLTGRTHQIRVHLQYLGYPIV
                     NDPIYSSPRIWGDNLGRGGDFNLKEVRSKLAQVGKTMASSSWLYPASDGEVLSEKKCE
                     ICHGELYTDPGPNDLDLYLHAFKYCSKTGGYQVEEKFRVKNLSSEVSRESTVSTGSPE
                     STVSTGSTGSIGSIGFTEPWSYQTELPDWALEEPRKYMALALDEAKKCEPTTTAFCVG
                     AVLVNGGEVLSTGYSRELEGNTHAEQNALDKYFLKTGKRDVPPGTELYTTMEPCSKRL
                     SGNLPCLNRILELKDHITTCYVGVMEPSTFVIKNVSYEDLTKNGISYIKVSGFEEEAL
                     KVAKRGHLE"
     gene            <138118..>138924
                     /locus_tag="FOA43_002020"
                     /db_xref="GeneID:62195421"
     mRNA            <138118..>138924
                     /locus_tag="FOA43_002020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922324.1"
                     /db_xref="GeneID:62195421"
     CDS             138118..138924
                     /locus_tag="FOA43_002020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778252.1"
                     /db_xref="GeneID:62195421"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /translation="MSSDSSSENLQACRLCHSIVYQFLNSSFDETLSQMDVDKNDTIP
                     SYYTPELHKETQTMVRNTLKIYEDVLNDYSMEELSISYNGGKDCLVMLVIYLAAIYEK
                     TREGSLINSVYINNEEAFEEQDKFLDNTVKYYGLDFIPIRSEMKEGFERYLEMKSQIK
                     AIIVGIRRIDPYGEKLNISQRTDNGWPDFVRIHPVLEWKTSEVWYFLKATRTEYCELY
                     DKGYTSLGGRNSTIQNPLLKQKDGKYLAAYMLDDDRNERLSRVKRREEKL"
     gene            complement(<139056..>140168)
                     /locus_tag="FOA43_002021"
                     /db_xref="GeneID:62195422"
     mRNA            complement(<139056..>140168)
                     /locus_tag="FOA43_002021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922325.1"
                     /db_xref="GeneID:62195422"
     CDS             complement(139056..140168)
                     /locus_tag="FOA43_002021"
                     /note="BUSCO:EOG09342LDX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778253.1"
                     /db_xref="GeneID:62195422"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /db_xref="PFAM:PF01016"
                     /db_xref="PFAM:PF18471"
                     /translation="MFNSFKASAFGRFTRQFRLSFVREAHKKAGGSKTHMQDSAGKRL
                     GPKKHEGQEVKRGQIIMRQRGTNWYPGTNVGIGKDHTLFALEPGYVRYYLDPFHPKRK
                     FIGIVLGKEDRLPYEHFAATHRRLGRRVIKNTVASQREEEYMSRKEQLIMPDIMKEKQ
                     ARDQKRAGKVAKFQNDLPKFVGDLSTEELAIAAQRMNAIDGFMRGGKSLEDGRFYATY
                     NYNYETDLSCRARKEISEAELESRKQEYAELAKKVDDKVMLDARFQLCKYLDAQQREE
                     RKKQDIEQLKTLIPDANKPVDKRVREKAMELIDDSCFSLSEQIHLKRRFLKPVLPESE
                     ELLGDDKTKHAIVISRMNYDTRRVDTIYRKKEGFLK"
     gene            <140421..>141599
                     /locus_tag="FOA43_002022"
                     /db_xref="GeneID:62195423"
     mRNA            join(<140421..140649,140815..>141599)
                     /locus_tag="FOA43_002022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922326.1"
                     /db_xref="GeneID:62195423"
     CDS             join(140421..140649,140815..141599)
                     /locus_tag="FOA43_002022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778254.1"
                     /db_xref="GeneID:62195423"
                     /db_xref="InterPro:IPR010750"
                     /db_xref="PFAM:PF07039"
                     /translation="MENSWDVVVSALQDSCNANEAMSLDNLSDPQLDTTKDSQAVEVD
                     KVLKHRDNLEKTRRIIETAVTNINGLIEIARSDEIGGSRGARGDSVVDGIIRASGENE
                     TTQTSNREDTKESTEPVVERVAETSKGPDIEDSTSEVPLRSAVTAPSPVIPAGPKGKG
                     KGKGKGKGKGPVSGQPRGPGGTSGPDSAGKGPSSAKKIGRSYYESAYNPNEPIFVGSE
                     VAFKPRQKNSEWIQCEVTRVNSEIKFEVKDPEPDEDNPRGQTFRAGWKDVILIPEDSQ
                     RLRNYPIGSRVLARYPETTTFYPAEVIGFKRDGRCRLRFEGEEEVGKETLVKRRLVLP
                     YAK"
     gene            complement(<141668..>143722)
                     /locus_tag="FOA43_002023"
                     /db_xref="GeneID:62195424"
     mRNA            complement(<141668..>143722)
                     /locus_tag="FOA43_002023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922327.1"
                     /db_xref="GeneID:62195424"
     CDS             complement(141668..143722)
                     /locus_tag="FOA43_002023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778255.1"
                     /db_xref="GeneID:62195424"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="PFAM:PF00249"
                     /db_xref="PFAM:PF13921"
                     /translation="MYDSRQYSKDPSHAYSEPQNLSGVPRSATSTNSNAFHSTAAFTI
                     SQPPGHPLGDSQGRASLGSENIKGRPQRYLQETQQVIHRENAREQLREDLQDSQQGNP
                     RGFTSRTMFSMAPLAASIPLASLAPATQISHITPVGVGPRGPLPHMDSLPSVSHMSSM
                     GSLVPPPPLGTQSLDTSFIRLNESTKSAPKSSFDISGTGVHGLSPSLSQNNVSDGGIS
                     NGNAYGANGNANGAGAGKPRRGPWSPDEDKQLLELVETFGGEKNLNWVKISQLLETRT
                     AKQARERYHQNLKPSLNKTPITFDEGKLIEQLVKKYGKRWAEIARHLNGRSDNAIKNW
                     WNGGANRRKRAATQAKSKGKVKVSGIRSEGSGNGPAESGGSRAGSVSGGSSGTGSSSD
                     GFSQTPHFNTGIFGGAAGAPGGSNSAALSALPPSLHLPPLRYGRSASVDMRATGATSN
                     LESLPVLRKHKLLDDYSSGSHRRHSAASINSLGSQGALALNPAFGFSALADGSPLSRL
                     SSRNSSITEYTPLSNLSSEGDSITSRRSSMLAAVQSAEPPSTTGQFRSPSFAPRLSVS
                     SASLGASLGAFSPRLQQQQPSITTLPPLSLAEQPMAQAPQLRKDIFKKNFSLHPVGSM
                     GVTAAAGATGAKDLGGNTKDAASNAFSVSTGSNNSTGSSTTSATTATTSQDDKMSISF
                     LV"
     gene            <144986..>145933
                     /locus_tag="FOA43_002024"
                     /db_xref="GeneID:62195425"
     mRNA            <144986..>145933
                     /locus_tag="FOA43_002024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922328.1"
                     /db_xref="GeneID:62195425"
     CDS             144986..145933
                     /locus_tag="FOA43_002024"
                     /note="EggNog:ENOG41;
                     MEROPS:MER0031610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778256.1"
                     /db_xref="GeneID:62195425"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF00561"
                     /db_xref="PFAM:PF12697"
                     /translation="MPRFSSVIPERILDYDIFRPRRISRPSRNSILVNPPPSQISANI
                     PPIIFLHGLLGHRKNNRTAARILANQLGTTLIVPDLRNHGTSFHSKPHNYRAMSDDIT
                     NLMDHLRDEVDFETNGVIVMGHSMGGKVAMVHALRFPDIVKGVVSIDNVPYMNPETSY
                     AEFEKFHLYLRYMHRLLESGSCRNVRQIEQALVKYVEPRRKVVSFLVNNLHKDPVTKK
                     VQSMVPLSLLNECIEDIMEFKMSDSGDLDDFSVYQDPLLILRANYSPFVGQDIHEHLI
                     REHFENYEIQSIDSTHWIVTENRGEFVKRVVKWVMDKFT"
     gene            <146039..>146989
                     /locus_tag="FOA43_002025"
                     /db_xref="GeneID:62195426"
     mRNA            <146039..>146989
                     /locus_tag="FOA43_002025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922329.1"
                     /db_xref="GeneID:62195426"
     CDS             146039..146989
                     /locus_tag="FOA43_002025"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778257.1"
                     /db_xref="GeneID:62195426"
                     /translation="MVSKLSFKGETKRKKHGHKKRKIPLLDSERFSVNNELVTLGEID
                     RNRLKRCNWTTAANYDDIKDGEPVLIAMERKDNLGVINVTDGDKVTISKESSLQVKSV
                     GECINFTNGASIDLANKVQRVEPTLPNQVLIAVDVENLVTNGDKNEHKVKYIALKDGR
                     SSSYLSHDPETHLLTLSKVLTDNEIFKLEHVPSARSNFSICIKANNDYKLIVTDQLVL
                     RVIEDPENLLDDLNNFNIRVQLVNSEPARKIIDLLNGENHNKDEDTEERVSSAVKELI
                     KAGIKVTNQVLRETKRAARENWLNEYIVELKEKTVTDRGV"
     gene            complement(<146991..>148004)
                     /locus_tag="FOA43_002026"
                     /db_xref="GeneID:62195427"
     mRNA            complement(<146991..>148004)
                     /locus_tag="FOA43_002026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922330.1"
                     /db_xref="GeneID:62195427"
     CDS             complement(146991..148004)
                     /locus_tag="FOA43_002026"
                     /note="BUSCO:EOG093447GD;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778258.1"
                     /db_xref="GeneID:62195427"
                     /db_xref="InterPro:IPR003738"
                     /db_xref="InterPro:IPR036590"
                     /db_xref="PFAM:PF02586"
                     /translation="MCGRYALPIEPQDLPAEFGKQNLAVDKVIDADKSTHHRYNIGPT
                     QIAPAYYIYTDNKKDKLQAKHILRYMRWGMIPKWIKSKDKMSNYPTFNARYEKIGENK
                     LWRTSVNQRCVIPIRGYYEWVKQTKPSKTTKQPYFIKRKDNKLMFLAGLYSRSILDGD
                     EVYSYTIITRNAPKCLEWLHDRMPVVLDPDSEDFSRWLDTGEKKKWNDVKDLLKIYDG
                     KNETLEWYKVDRSVGNVKNEDAKFVEPLVGIGEFFKVKQGPPEVKQEPLKVKQEPLKV
                     KQEPLKVKQEPLKVKQEPLKVKQKPLEAEQKPLEAEQKPLEAAQEPLEQPLKKRKLRK
                     KSL"
     gene            <148270..>149940
                     /locus_tag="FOA43_002027"
                     /db_xref="GeneID:62195428"
     mRNA            <148270..>149940
                     /locus_tag="FOA43_002027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922331.1"
                     /db_xref="GeneID:62195428"
     CDS             148270..149940
                     /locus_tag="FOA43_002027"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778259.1"
                     /db_xref="GeneID:62195428"
                     /db_xref="InterPro:IPR011990"
                     /translation="MLRNNNWGYLGRNLASLKRCLSTHNDLSKEPQLNQFQDPHRPPE
                     QFGSSNPGPVNKNTRGINNPNMGNSGVVPPVPSPKHGAFGIGRTVVGIASLLMVLGGG
                     TGLYRSYKAQSISDGGIEILQEALNHENKGNIDGAIEEYENFLKQLDNEGVEHTNSNY
                     LGAAVRIAELYEIEKRPDKALKIYKCLSLYMTKVITETDSEYLFGGGSEYNAAMTRSL
                     ALAVKYASMLPEDSNEEAKKVLLTNIVEAQKQVMEEYPPFITVLNENTNQNILAMIAR
                     DMEKKMSGKTEEQKKKQMHEAMKEPLELPIYTTDPMEENRLLGLFVKGWPPFTRSLIN
                     ARDLYANICIQDGDYAEAASSLTTNAVIIQRCFDHPARLSICLTKLAIVLQMMAETLT
                     DRLLQEKEQLQKEQQEQLEQQDQQGHPDSTDPPARIPQLELDGAKLDPNKLLTSALQM
                     QNPQIKEFVIQKTYKESERIFKRTILLTDKMKQQHMKNQVSELFKPALDKSEMVSACG
                     LALIGYQSGEYKDALKYLQRARVLASRLNANEYLEDINKWIDQVERET"
     gene            <150112..>151611
                     /locus_tag="FOA43_002028"
                     /db_xref="GeneID:62195429"
     mRNA            <150112..>151611
                     /locus_tag="FOA43_002028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922332.1"
                     /db_xref="GeneID:62195429"
     CDS             150112..151611
                     /locus_tag="FOA43_002028"
                     /note="BUSCO:EOG09341ARU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778260.1"
                     /db_xref="GeneID:62195429"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF09384"
                     /translation="MSSNRERIEPVRGATLPASTTPEQRYWRGFTNSQLVKEHNAVTH
                     IDFDHNKPHDFAVTSSTRVQIFSSKTRKVIKSFTRFKDTVYSGEFRQDGKLLVAGDGS
                     GLVQIYDAHHPRTLLVTIRPSSHPTHVTKFHPSISTQLLTCSDDRVARLYDISDTQKP
                     LASFGDHQDYVRSGLIVPGSGLVVTGCYDNVVRVFDPRSSSTNAIISFNQQAPVEEVL
                     SLNPTTLVSCGDNGIRCWDLAAGKCIQSLNNFTKTVTCLCDAGERGILAGSMDGHVKV
                     FDKTSINWEVKFGWKFGSGVLSCGVSPSHKHLVVGLNSGLLTIRTRKTEPKVKQGVKL
                     PKSHAFSRMIRGAEYHGESEHHILDDKASSGSNGKKLKQFEKDLNGFRWGDALDHALL
                     SGISRDLTVTCLEELKKRGKVHMALSGRNETNLEPLLTWCYKTIDDPRDVNIIADYLA
                     CIMEMYSDLIERQPVIEELVWNIQKKLGQEIKKCEEALQITGMLELLSA"
     gene            complement(<151663..>153075)
                     /locus_tag="FOA43_002029"
                     /db_xref="GeneID:62195430"
     mRNA            complement(<151663..>153075)
                     /locus_tag="FOA43_002029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922333.1"
                     /db_xref="GeneID:62195430"
     CDS             complement(151663..153075)
                     /locus_tag="FOA43_002029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778261.1"
                     /db_xref="GeneID:62195430"
                     /db_xref="InterPro:IPR021110"
                     /db_xref="PFAM:PF11719"
                     /translation="MASMASVHDGARDKLDNYLKSLKGEIKTWEIQNDGKTLSWNIIE
                     AKNPNMARKYKKYAKLKRLLKKSDSGDVDLEAVFHKWGESYKSEKREKGHKHRHGQKQ
                     KQKQKHSRGVPMTPTRQIKSIEKEEKVELTEDVEDDPIKGAGDSEIDELGPTPQLNGR
                     VLGIFDIQLRQQQSPVDDSPTKKVTVMSPKAESGISSSFKTPTKIEKPSMFRTPINSC
                     RKRLQFEAKMDETPQYLREVAQKVSILDYDGILSDLSDFSDVESDSDLSDDSNVNSMK
                     YDSSENPHVSPATQRLIEPSPIIRKHYKKSLYAMNEELKGLKNSLEKWREESIQEDSG
                     FGGELEPKKEEILEEVVVPVDRIAKYRNKVKTIKRTTRRVKMKTQGPENVEDELEGED
                     LQQKMKELANAGNRVKEKEVEQEDNDEKDEDEENTPQEVYVRKRIRTPPKKRKVNPLS
                     TNFVRLKINQHHGGWKRRRQ"
     gene            <153429..>155460
                     /locus_tag="FOA43_002030"
                     /db_xref="GeneID:62195431"
     mRNA            join(<153429..154302,154712..>155460)
                     /locus_tag="FOA43_002030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922334.1"
                     /db_xref="GeneID:62195431"
     CDS             join(153429..154302,154712..155460)
                     /locus_tag="FOA43_002030"
                     /note="BUSCO:EOG09343FKR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778262.1"
                     /db_xref="GeneID:62195431"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF04488"
                     /translation="MFPFSEKLPVEKNIWQIWRTSNISETDFPESCVPLVERWKDANK
                     EYEHHVLSLEDAENMVKSELGAISEITEALRLMPDDRVRLEFLKYLVIYIKGGVYADI
                     DTINIKPIKHWKLMNETSLVTGIMSDYNHIGWYNFFNRRMVLSNSIFVAKAHHPMLAQ
                     LIARITCICITQQKLITATNWTRVLGAYDINGDPVVQFTGPSIFTDVFFDWISANMGE
                     DEVVEMDEDDRMRLEDSEIIGPEGAKFSYRNVTGISHGVKVGNTAILPQISFNGFENS
                     YEEVIDDQERSTGYERFSAAQLVSPGAIPYVETEDTVKQRSPEARRLRRQLLGRPGVI
                     GVKRGMTCFYDNQGRRMPATVIEVDQCEVVYNKTLEKHGYYAVQVGCGYKKPENQTKP
                     MLGHFAQAKVSPKAAVSEFMVKDKAGLIKPGTELRADMFKPGQFVDVISTCKGKGFAG
                     AMKKWGYHGGPATHGASLSHRSMGSIGQNTTPSRVFPGKKMPGRMGNHEHTIFNLQVL
                     DVNGEKGYMLVKGGVSGSNGSFVRVRDAFKHL"
     gene            complement(<155490..>156371)
                     /locus_tag="FOA43_002031"
                     /db_xref="GeneID:62195432"
     mRNA            complement(<155490..>156371)
                     /locus_tag="FOA43_002031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922335.1"
                     /db_xref="GeneID:62195432"
     CDS             complement(155490..156371)
                     /locus_tag="FOA43_002031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778263.1"
                     /db_xref="GeneID:62195432"
                     /db_xref="InterPro:IPR004827"
                     /translation="MDHRQYFPMFSPESIGSSLLSTFDQQPQTPQPQTSLSTDLQSSK
                     DLQSSTLQSSTQLTAQTTFEDPSFSTSMGSEGEFSPVSADSSTGGTSGTSGASGASGP
                     EAALDRRKLTDNQLYQRRKAQNRAAQRAFRERKEGKLRELSAKLDMAESEKRELQKQL
                     QDLKQKNSMLDMENKLLHKDSTSPPQHLSPSNGSFAFPQFTREKFIEGSVDMNKHIWN
                     DDMLGSKRYDVDHTSLLTASAVWDYLVEFGKMNEEIEVDIPGIMNDLKGKEVCHGYGP
                     AYSLGLVTATLKKHIIK"
     gene            <157060..>159058
                     /locus_tag="FOA43_002032"
                     /db_xref="GeneID:62195433"
     mRNA            join(<157060..157184,157759..>159058)
                     /locus_tag="FOA43_002032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922336.1"
                     /db_xref="GeneID:62195433"
     CDS             join(157060..157184,157759..159058)
                     /locus_tag="FOA43_002032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778264.1"
                     /db_xref="GeneID:62195433"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF10236"
                     /translation="MSEEQKPVEPKVEEGAKDAVAEAKAGATVAKKDAEPVAKKVQKS
                     FNKKTSYDRGKRNRKGQGSEKSFVGLLKSSNFKEKAKDSEILDRLPAFNGTNLRLGEI
                     ARYDEESLRKMYISGSFKPLQFNELYSKPVTLIRSLETAKLAKFYSSCLSNQTSSTNR
                     MLITGPPGVGKSTILSQFQALALGTTGNAILLPISDAEALVDGSSDFKLNSVTGLYDQ
                     QMYAKTLLKKIIAVNKPYLSDLKLSEDFVPIYSTKKLQESQKLDKDTHSLLDLASIGA
                     THQTNSTYVFVKLLKELSSQKQYPVFITIDNISAFVQNAMTNYRDADNVPIHFQKFQL
                     ANTLVDYLSGDSTFVKGGIVASIRGSDKHVSNETIAVGLGLKQPNLYKKFADFDRQFA
                     DKLIKNGGINHLPVSKFSVDECQTLLSHMLGCNVIHNEYQMAEEVELLGQEEYITKLA
                     ERKYLISGNGNARLLVESCVLAYV"
     gene            complement(<159088..>160500)
                     /locus_tag="FOA43_002033"
                     /db_xref="GeneID:62195434"
     mRNA            complement(<159088..>160500)
                     /locus_tag="FOA43_002033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922337.1"
                     /db_xref="GeneID:62195434"
     CDS             complement(159088..160500)
                     /locus_tag="FOA43_002033"
                     /note="BUSCO:EOG09341JWH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778265.1"
                     /db_xref="GeneID:62195434"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /db_xref="PFAM:PF01331"
                     /db_xref="PFAM:PF03919"
                     /translation="MPPMLDRTVPDMPGEAVSEEVSNYLKTKVSQILHTRFNQFPGSQ
                     PVSFTRDHLYHNLMERDYLTCEKSDGLRVLMFVLINQDTGEEGTFVINRENDYYMVPG
                     FHFPRSSHNFDASHNGTIVDGELVYSKNPNTGVREVRYLIFDCLAMDMVSVMHKNLWK
                     RLYHAQHEFHKPYMELRKAFPEACSHFPFKLDFKNMTQPFKIDKIFREMKNLTYVSDG
                     LVLTCCDSPYAPGTDNLLLKWKPSEENTIDFKISLRFPKFVDEDLPEHDPNREYPNYD
                     AKPEFELCVWKGGNDSHENEGVEDNIRRNGGEYKNNFGFYDDWHVHLEVTDDEWQSMK
                     ESGESFNGRIAECRRTKDGKWKMLRWRDDKLNGNHIHVVLRILKSIEDSVTKQELIDA
                     EPEIKRRWMEREEAKKSHQPVQQVKPEKKPKPIQDDIPHYTESDSHSNDDEYYESDGF
                     EEAPKFSQPSGEPQVKKQKV"
     gene            <160854..>165113
                     /locus_tag="FOA43_002034"
                     /db_xref="GeneID:62195435"
     mRNA            <160854..>165113
                     /locus_tag="FOA43_002034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922338.1"
                     /db_xref="GeneID:62195435"
     CDS             160854..165113
                     /locus_tag="FOA43_002034"
                     /note="BUSCO:EOG093402J2;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778266.1"
                     /db_xref="GeneID:62195435"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR034732"
                     /db_xref="PFAM:PF01426"
                     /db_xref="PFAM:PF13832"
                     /translation="MTDETMLTPSRRPRRRTTLNVDYREKKETDIPLVRSGSKNNSHA
                     FDNHNHNHHHTPTQSRSYSPEYISVDEVVPYNWQPSLTADTKFNYIPNMKGALVHENT
                     LTLKDGTVVNKGDCIYMICEPPTEPFYVATVTGFVNKGEDGNAHGSKIAKVTSKGNQV
                     TGLSSGSSSGSSSGSSSGSSSGLSSGSSSGSSSGSSSGSAKNFMFEVLWFYRPRDIGR
                     HSTDSRLLYATVHKDLCPIQSFRGFVTVKHVSEIDDLDSYKQQHNHFYFDKLYDRYMM
                     KTYEVFPTKKMTNLPPSYYKALNKRFAFVFLETGHGEDFLAEPQNCDKCHQWCPVSDS
                     IQCFQCGKSYHLVCLDPPILTKPKRGFAWYCASCMKEMEEELDAKRGNLLESSLPSQI
                     VANIEKEKQEAEAKTEAEEEEENPLKETGSLKKLHHLASPKYEQIAIQFLEKDKNLSF
                     EQRRRLEEWPWRYLGVHVRLEDAMDVQDRPYPRASSRLGSKYQCTDIPDWYEQVVKYY
                     DSSEAQSLKNKRKNTKNGVRRGKSSLSSSSSTSLSSAITGTARFFEEDSLAQRKMPIP
                     SKYEHVDPKEFPGWLQPRPKGYFERGGEETATLMWKMPQEDDQVDKYIKECEPIAKSL
                     GLLPNTPNFVDSLLKIYMDHRYDKELSIPEVKKLTRKTLKEPDFSEEEIKRFEDSVKV
                     HGDELYPVYRDVGTQSSAMVVRFYYLWKKRKNGHLIWDNFPYRPKNRLKYIKNTELDL
                     DDAEDDAAYSTSKIMKKEVRFECLFCHTTHSVEWFRAPGANLPKSNKELCRGLCYRCC
                     RLWRRYALEWDSPDELMKKKAQRGNGWWRKQEEELVADCNKIVAAREGYDKRPRKASA
                     NNILQLEGLKEVTIDRKQPRKRSSATGMKRASFSLSLSLSSGPSVQSSISSSGATKKR
                     RIGGAKREASDTIASAGETFEVTLPCADKRNKKKRKAKEEPTGGSVGRRPRKKRARSP
                     SEDSLFRQMSSRYDSKYEIFNPFMNRRVEDMPLPQTRSAMRDISTLWRLYENSKHRTR
                     PSSADAKQKRPLFEAISRPCCVCREFGSLDEMIICSNCGMNVHASCYGIDLGHVKLER
                     PAYLYKWHCDPCSNDIHPLVSTQYVCCLCNARESDHDGALRGDLMSVPDALKRTCSGK
                     WCHVGCAVFTEGVTFGESESLQPVYGTEVVNFANLPHICRICGGNSGGLVNCRACGRS
                     VHVTCCQDTPGFFLGFIIEERTELNSGELCVSVDLDVGTVVGVPVPTVICSHHFNGSD
                     RTNFRGIRLFKMRAMVRVSGKREKIPLIRAYCREMKQTKNPLSGGELNRLVYATIEKV
                     VGEKSPVETQQLRDLPTPECVYCHNNHTLQWHEDGEDRICHQCYVRKQNNTELSDEIP
                     DLSQVNNQQLDGTKFGVPRLNDRISTNRNGSTKISIKDILW"
     gene            complement(<165905..>166864)
                     /locus_tag="FOA43_002035"
                     /db_xref="GeneID:62195436"
     mRNA            complement(<165905..>166864)
                     /locus_tag="FOA43_002035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922339.1"
                     /db_xref="GeneID:62195436"
     CDS             complement(165905..166864)
                     /locus_tag="FOA43_002035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778267.1"
                     /db_xref="GeneID:62195436"
                     /db_xref="InterPro:IPR021150"
                     /db_xref="PFAM:PF03981"
                     /translation="MLSRMFSRTSRLRSLTRVSQISVRYKSDGISPRAIARRSSLPNI
                     PNPDTPNKDIDPKNKLEKPEYETGGEVTMPGWKKSFGEALVSVFHIDMDQIRASSISG
                     SKYYYMCKDQALQFKDDQLSESAVFWYNTLGLPRTFAQWYQITVLHVWMLFVRMRSMP
                     FKVGKNYQQKLVDKLFKDIELRLSEEMNVLSGRIRDMYLKDFHSQMIGMVCAFDEGFA
                     SESDAYLAYAVWRNIFNGDKNVDIVKLEAVVRYVRMQLYVLDKISDRAFGFGDFEFVA
                     PSETVDPLTAEEEHQLKLATKNKYEPMDRILPPSQRSKLSIDE"
     gene            complement(<166984..>168633)
                     /locus_tag="FOA43_002036"
                     /db_xref="GeneID:62195437"
     mRNA            complement(<166984..>168633)
                     /locus_tag="FOA43_002036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922340.1"
                     /db_xref="GeneID:62195437"
     CDS             complement(166984..168633)
                     /locus_tag="FOA43_002036"
                     /note="BUSCO:EOG09341N16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778268.1"
                     /db_xref="GeneID:62195437"
                     /db_xref="InterPro:IPR013855"
                     /db_xref="InterPro:IPR013873"
                     /db_xref="InterPro:IPR013874"
                     /db_xref="InterPro:IPR038189"
                     /db_xref="PFAM:PF03234"
                     /db_xref="PFAM:PF08564"
                     /db_xref="PFAM:PF08565"
                     /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKNSFIRWKQRDIHEKRAQ
                     RDAQMKGLMIQREMYIQLTKRVNKILENLNYEQISDDSVRNEYVNEKFDPKERCTLEE
                     DSNSPTYNEMVEDLFTQIKDGLKKEGEDINDGALIVQKVKEHRSKIEGVLKQIDPKLN
                     ELEEEKHVHITSDDYHVGFNSSFINKGAGQAEKTGQAEPSGHAEKTGQAEPSGQAEPS
                     GHAEKTGQAEPSGQAEPSGHAEKTGQAEPSGQAEPSGQAEPFGQAEKTGQAHQAAPSG
                     QDDSGQLPSKPFSQLDELECLPETMIFSKIPQDSLKRSGAFIKNHLYLACEQQKDSLM
                     MKAFDSQLSGDTKRTKQIVHQALLLQYLDDLFRGAAANHSAQRKEQLVDMFVEKMSDA
                     NTPAYGVFMGDLDKMYKHIVSRCEVIKQEEEEGERKDKPQEEVEQIQLRSVDPGSELV
                     VELPKQDTEEYKNFETLPKEMQEALKTKSLDEINKVFAEMSVEKAEQVLDIFDKCGVI
                     QVQALLDNEDQFNELKKEYEGGSVSVSSGEKNAPSSLDIVD"
     gene            <168853..>169779
                     /locus_tag="FOA43_002037"
                     /db_xref="GeneID:62195438"
     mRNA            <168853..>169779
                     /locus_tag="FOA43_002037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922341.1"
                     /db_xref="GeneID:62195438"
     CDS             168853..169779
                     /locus_tag="FOA43_002037"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778269.1"
                     /db_xref="GeneID:62195438"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR036638"
                     /db_xref="PFAM:PF00010"
                     /translation="MDFLNLNDLDETTPGSTGSAGSPTQLTQLDSEDIDFSSFLDTPH
                     SQSRPETSPDAFVGSLPTQHTTMNDDFPSNYADNLSSSYTVGRSLHSAASPADNIRAQ
                     LSRALKPTTTNEASTPGGSNSIPTPSSVTSKSRPKRQSVASSAAANSPSSPLSQQPQL
                     QPQLQPQLQQPQLQPQLQQPQLQLQLQQPVDRKRRDNINERIQDLLRLVPRNSFFDSK
                     DKSFGTKDGKPNKGQILSKAVEYINWLQQRIDENNRKEVELSIKLRNLEIANNVPVAD
                     RMNLLHTSAEIGLSQIGVGPLAEDHEDKEFKK"
     gene            <169937..>171658
                     /locus_tag="FOA43_002038"
                     /db_xref="GeneID:62195439"
     mRNA            <169937..>171658
                     /locus_tag="FOA43_002038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922342.1"
                     /db_xref="GeneID:62195439"
     CDS             169937..171658
                     /locus_tag="FOA43_002038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778270.1"
                     /db_xref="GeneID:62195439"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /translation="MKSVSISCYLDPKGQLLAAVVSGHGRNEIRVLSIEKLEQLESKI
                     EFQAEEKVQCVRWIPRGSTKSVGKNGSKKRKQGGKEVKEGSSEYSYLSILLTTGEILV
                     YSPLTKEITNKMSNESPLSCICYGGSESTIIGFDPANSTLKKYNLFDSRPLDTSSIKL
                     EKDISFIELINDRELVLASSNIHLYNEEEGQTVFTIPAPKAHQSPISQLVKSVKNDRL
                     IAASRSNDLTINIASLDTGKLTTTLRCQGRVMSLAVTQSNGVELLLAVTDRGCVEIFK
                     DAFDQKSRKQIRCDAVLKSSTFGFTDIVVEATGYRAVYFDNFKIKVKLLEISDLGELE
                     GEVEVDLADTEGDANGANGANGASVNGADTNGAATTTTTTSHIDSTDSDNSLLDSMPE
                     IEDFQQLYEQIVNHLDNHEVLEPLLVKNCGISRSTTYLFSNSEALKLVKIIVLLLSEQ
                     SKYSADLGKWLRWLLLCKGSLLVKDSECVELLKLLKSTLTENIKLLPNLISLQGRLSL
                     LQSQLKLREEMIHKEQIEEQNEEKIEAEADAEQDAIDGSVVLHGENDELEDVKVDIND
                     EEVEDDD"
     gene            <171902..>172522
                     /gene="XPT1"
                     /locus_tag="FOA43_002039"
                     /db_xref="GeneID:62195440"
     mRNA            <171902..>172522
                     /gene="XPT1"
                     /locus_tag="FOA43_002039"
                     /product="Xanthine phosphoribosyltransferase 1"
                     /transcript_id="XM_038922343.1"
                     /db_xref="GeneID:62195440"
     CDS             171902..172522
                     /gene="XPT1"
                     /locus_tag="FOA43_002039"
                     /codon_start=1
                     /product="Xanthine phosphoribosyltransferase 1"
                     /protein_id="XP_038778271.1"
                     /db_xref="GeneID:62195440"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="PFAM:PF00156"
                     /translation="MPLPEKYYVSYNCVHKLCKKSAEELLERIGKPDLIIGIGGGGFI
                     PARILRTFLKHDGEKNIPIQAIGLSLYEDMGNQDTIGTEIVRTQWLDFGALEKNFDSL
                     IGKNILIVDEVDDTRTTLHYALSELYKDINEKAKSLGRDIHDTKFSIFVVHNKMKAKR
                     ADIDESMMNGGVYLSGEDVPDKWIAYPWEANDIDDHTRRAVEQGHD"
     gene            complement(<172573..>174477)
                     /locus_tag="FOA43_002040"
                     /db_xref="GeneID:62195441"
     mRNA            complement(<172573..>174477)
                     /locus_tag="FOA43_002040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922344.1"
                     /db_xref="GeneID:62195441"
     CDS             complement(172573..174477)
                     /locus_tag="FOA43_002040"
                     /note="BUSCO:EOG09341VNE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778272.1"
                     /db_xref="GeneID:62195441"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="InterPro:IPR022092"
                     /db_xref="PFAM:PF12325"
                     /db_xref="PFAM:PF12329"
                     /translation="MVPESEMGEARIGEVRASEDDEETSGILYAGEIDEVDDIVGKYK
                     KKLTLQERLELAAKKGGKGADKKHRKKDRSMSPQSDGSLMKTKEEDGEGMSGRELSKS
                     VFQKKLDEKQKVIDELMEEGTKLSVKEVSLTQTLKKMRQRANDNESELEELRKKNGNM
                     EQIIKEMNREQVQAKEDRDMRMKLQKRVLELEEAVRKLAEERAAAGDIREELSQVKRD
                     NLELERKLKRLQVDYDEKAGKVKQLTSQLHRETDEHKSLVKDSKEEIKRLEEKMETLR
                     IQSEASRLKESKVVDNSSLDLLQAQYTLAQENWKMIESGYQKKIADMEHTVEIFKQRD
                     LEYSKKVKTLSTDVKTRTNDISELMDTENSLRDRLIECEKELALAKASNDALSQSYEF
                     EKADFEQKMQKLVDEKTQLGETLKLRTDVLNDSSQNTNFPPSFYLNDLSSPPIFKQKR
                     RSISSTNISFGESAATPTATKSSSQNQLHLNTSSFSPIQSSRGSTEDDGEVSEPTESS
                     PYAGAATNIRLVSRMSSRVRRLELEIFSLKEENSDLTKMKQEASKEILKLLKDAEQAR
                     QYEVKLADCEAELKDVSKNYEATLELLGEKSESCSELQADVADLKDLLHQQVQQMVEM
                     QKSIDRLNST"
     gene            complement(<174667..>175560)
                     /locus_tag="FOA43_002041"
                     /db_xref="GeneID:62195442"
     mRNA            complement(<174667..>175560)
                     /locus_tag="FOA43_002041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922345.1"
                     /db_xref="GeneID:62195442"
     CDS             complement(174667..175560)
                     /locus_tag="FOA43_002041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778273.1"
                     /db_xref="GeneID:62195442"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="PFAM:PF00134"
                     /db_xref="PFAM:PF08613"
                     /translation="MSEAEVLDVFLNSPVTQDMIHHLVNVTLQILPCESSKTITQQLP
                     SPPNSPPVFKTKSLPSLMTFISKLVRYTNVYTGTLMATIVYMNRLKSRLPQDAQGVAC
                     TRHRIFLACLIIASKYFNDSSPKNKHWSRYTDGLFRKEDVNLMERQLLMLLDWDLKVE
                     TDELTAVWKRFLDPIRLDLRRQSRMRNSLARGTLVNSTQTISMPKQRAKDTHATVSRR
                     SSFSSTFSNTEETHSRNSSVSSISSNGSSYSSGKYVKNANYCHSVGCGGPVLMSNYLD
                     TCAIREQQQLNDLMRQYCSYV"
     gene            complement(<175949..>177205)
                     /locus_tag="FOA43_002042"
                     /db_xref="GeneID:62195443"
     mRNA            complement(<175949..>177205)
                     /locus_tag="FOA43_002042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922346.1"
                     /db_xref="GeneID:62195443"
     CDS             complement(175949..177205)
                     /locus_tag="FOA43_002042"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778274.1"
                     /db_xref="GeneID:62195443"
                     /db_xref="InterPro:IPR018961"
                     /db_xref="PFAM:PF09350"
                     /translation="MGHLKGFVRKIHSGSKKKSASSSLNQRLQQLQEDAYLSNPRLGE
                     RLEEAIRNQPGNPSSEYQPENPSSGPEYQPASSISKLPSYADKQTREIATSRPWTGEI
                     SAYDISSRYKSESRDKPKKVNRQEKLHNAREDVLDYRLSKHEKKSREGDADDGWRQMY
                     KERLLGPTMLVSDTFAGVDSGIKSLADQKIMEAQRRGDFKNIKRGKPLQKGYTNTNAF
                     IDRTEYHLNRIMKEQEAIPPWIEKQRSTEVEIEHFRRQLDKAWTLRAVRLVEELFPGL
                     DKEAVLNKMQEYASSGGVELRSKEWEDREKKTYLTFKVRKLNDSIRGYNLQAPLASQK
                     LYLNEDNEVQDCYKRVNPRIVAEYKKIKMKSNGDDNAKGPQSERRWKPFCGALGRTKI
                     PQRTNIPQMPVEPLSQMFWKLFKGDH"
     gene            <177805..>178320
                     /locus_tag="FOA43_002043"
                     /db_xref="GeneID:62195444"
     mRNA            <177805..>178320
                     /locus_tag="FOA43_002043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922347.1"
                     /db_xref="GeneID:62195444"
     CDS             177805..178320
                     /locus_tag="FOA43_002043"
                     /note="BUSCO:EOG09344GVZ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778275.1"
                     /db_xref="GeneID:62195444"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="PFAM:PF01284"
                     /translation="MISYGDLSLRAVNFIFLIIVLGLSGSLAATTVYQSNPQVNFCVF
                     AAAWALLTSTIYGALAYFISFLASPLFLVIFDFLNFVFTFAAATALAVAIRVHSCSNS
                     TYLDNNNVAQGSSDRCRKSQATVAFLYFSFFVFLFSLVMQFLNLGKNGIFGSSYSGKS
                     ARTGVPTMAQV"
     gene            complement(<178438..>179607)
                     /locus_tag="FOA43_002044"
                     /db_xref="GeneID:62195445"
     mRNA            complement(<178438..>179607)
                     /locus_tag="FOA43_002044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922348.1"
                     /db_xref="GeneID:62195445"
     CDS             complement(178438..179607)
                     /locus_tag="FOA43_002044"
                     /note="BUSCO:EOG093439FR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778276.1"
                     /db_xref="GeneID:62195445"
                     /db_xref="InterPro:IPR031336"
                     /db_xref="InterPro:IPR038103"
                     /db_xref="PFAM:PF05179"
                     /translation="MVSAVVTLRSAIKAKKPLTLLPEGSDISGAQQLVIGDQAISLDE
                     ETGFTNEEDKVNETLRAIYQSWLHRDSNTTDYFADCEAKKIPVISFMERTELISYLSG
                     ASEKCEHLKGEEEKEDNEEQKKRGAKSDKTAGGKRQKIIDSDPFLKLVLSNEREVVDH
                     NKALRGSKLVDFSNVAKECEYKIIRPLKKSSSKSGRYHRHGADGVSGAAGVAGAVGAV
                     GAGSQSLSAILKHKDPIIILSPSASALINMGNVKSFLEEGKFIDPSSENNSVSMQKIV
                     RNSKLFNKKIKFVVVNDVDKFFTKPEHWDRVVAVFTTGQQWQFKNYRDSKPNALFQKV
                     KGFYVHYNGDPIPESIETWNLEVISIERSRRFKDRQTSEYLWEMVEKFMASRGYK"
     gene            <179836..>182331
                     /locus_tag="FOA43_002045"
                     /db_xref="GeneID:62195446"
     mRNA            join(<179836..181230,181519..>182331)
                     /locus_tag="FOA43_002045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922349.1"
                     /db_xref="GeneID:62195446"
     CDS             join(179836..181230,181519..182331)
                     /locus_tag="FOA43_002045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778277.1"
                     /db_xref="GeneID:62195446"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="PFAM:PF04109"
                     /translation="MSGDLPKPTFLSRIFGANSNPGEDPLLNDDNIDLQYGDTSLEST
                     QSRQSSSENAETTNEVHLGHSAVIQSASDSSASSDEGSVSSSASLRRFDPQKQAIRDQ
                     IQSEYEENMLDVVPQSLLMDEGKVQGRKSAVPLNQNITGSHLGSRLGEKALEFARSSI
                     QFTHRRRDDEETAIEMRSLGGGTGGLTSKVPMLSPTERALWIWSNVTNLDRFLQDVYR
                     YYIGNGLQCIILTQTCDLAIIVFVVWLSSFMGNCIDYDKLLNGGATSFDQVRVDKCYS
                     KISLGQKCFYYILLAVLAVRVRNCIHEFKDFREIKLFFNCLLGISDDELQTISWPSIV
                     KKIMILRDQNTNALASGRKMDDDDDDDLKSKKRLNAHDIANRLMRKDNYMIALFNKQV
                     LDTPLKLPLLDSYFLTKTLEWNLKLCIFDYLFDTEGQLKKSVLSEHSRLSLSHNLGRR
                     FQMAGLFSIVLTPALNFLNFEITSGHTVLFYMSAFGALFTICKSSILDDNSVFDPEAS
                     LRYVAQFTHYLPSSWEGQYHTENVRSQFCRLFNLKVVLVLKELTSMIMLPYLLYFRLP
                     DASEKILDFFREFTIHVDGLGYVCSFAMFNLDDNKDKPGTMYIGRSGKWDREELKSGY
                     YAANDDKMVKSYLYFLESYGEPVTKRPQAHVTSTPRSTSTTPAVRRRQLDHMEDTTAG
                     LSTDSKNYLNNARNSMLLGDSVHTQQRNEAKLADSGGVLGLLNQIYKHQPRET"
     gene            complement(<182336..>184579)
                     /locus_tag="FOA43_002046"
                     /db_xref="GeneID:62195447"
     mRNA            complement(<182336..>184579)
                     /locus_tag="FOA43_002046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922350.1"
                     /db_xref="GeneID:62195447"
     CDS             complement(182336..184579)
                     /locus_tag="FOA43_002046"
                     /note="BUSCO:EOG09341Q12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778278.1"
                     /db_xref="GeneID:62195447"
                     /db_xref="InterPro:IPR007276"
                     /translation="MSRGKREDARSKSRTVGKPGISKQIGQERRKVEYEARTARKNKS
                     GGIIDKRFGESNKEMTNEEKMLERFTKERLAHASKYSLADDEDSDNDTLTHSGHSLSG
                     KVQKDEGDEGEFFSKKREIDENETPPDQPARKKTKAEVMKEVIAKSKYYKHLRQEEHA
                     KLQHQVSELDENFNDVMTDLKDTTKKATPTSKEEKTGIDIAYDKKVKQVQLSGRAAPA
                     DRTKTAEEIAQEKKENLERLENQRLRRMQGELENQEEHADDLDDEFWAGSDEDVANGL
                     AVNAEDAPVSAEDLTDTTLGDSSATITIGGKVIRFGSTDTGLICPQKLDEFLGLVGDK
                     SYEEVIPLIKQVFKKYQPKLREGNKEKIGVFIGVLIDYILKLEDDGCKEANKSQYIHL
                     MEFSIKLIRDLSEKFPEKLLDHFRTHLQSAQDRIESRDHHKYPLRSDLVLYTMVGRSF
                     STSDMYHLIVTPALVLLGESLEFMKIDKHITDLFAGIYICDLLIQYERIAKRIVPEVI
                     NFLERVLLTLVQDPDKILHSEKLATCVKQPTRTKFTLSIETELPADLQTLSLSNWMDV
                     SQSQCASLLLKTVSLLDQYVSLFIETSSFIEISTPFVVLLRHMVVYHASTPLIPSLLK
                     KIENIRRIASNEREPLQLQSHRPLSIPTYAPKFEENYNPDRKFYDPDRTRQEVGKLQH
                     QIKEEKKQNMRELRRQTEFEARAHINEKKEEYKKYHEKMAKIVNSIQTQEGTAKNEYE
                     REKRRRK"
     gene            <184955..>186274
                     /locus_tag="FOA43_002047"
                     /db_xref="GeneID:62195448"
     mRNA            <184955..>186274
                     /locus_tag="FOA43_002047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922351.1"
                     /db_xref="GeneID:62195448"
     CDS             184955..186274
                     /locus_tag="FOA43_002047"
                     /note="BUSCO:EOG09342UOC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778279.1"
                     /db_xref="GeneID:62195448"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR020841"
                     /db_xref="PFAM:PF00109"
                     /db_xref="PFAM:PF02801"
                     /translation="MSNKVVITGLGLVTPLGVGVNRSWANLVASKCGIVSTTTLPNAD
                     EYKTIPSKVVGWVPKGPKSNGGWDSSEYFSPREIRRLPPFIQYAIVAAKEAMHDANWS
                     PHSEHDKVRSGVSIGSGIGSFEDIYKSSIAFHERGYRGTQPLLVPRILTNMAAGNVSI
                     YLGLKGPNHAVSTACATGVHCIGDAVRFIKDGYADVMIAGASEASVHPLALAGFARAK
                     SIVTKFNDEPAKASRPFDKDRSGFVLGEGAGIVVLESLEHAVKRGAQDKIYGVVSGYG
                     LSGDATHITTPPPDGDGARRAMQMAIERAGLKPGDIGYVNAHATSTLLGDRAENHALE
                     TLFGEERPDLAVSSTKGAIGHLLGAAGSVEFIFAALAIHRRVLPPTLNCDHPGEQEDD
                     DKNDFIFNYVANEAQQLADDYRLDHVLTNSFGFGGTNASLCISKYHE"
     gene            <187371..>188528
                     /locus_tag="FOA43_002048"
                     /db_xref="GeneID:62195449"
     mRNA            <187371..>188528
                     /locus_tag="FOA43_002048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922352.1"
                     /db_xref="GeneID:62195449"
     CDS             187371..188528
                     /locus_tag="FOA43_002048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778280.1"
                     /db_xref="GeneID:62195449"
                     /translation="MVPVISLYYVALAIFAVLFANFNPYLTLPEAANKVSGYIESSTY
                     SLQHNYAKKHGIDHGWADAPYVREARLYCRKFTQSECVKAVIGHVNCIWLRLTTYLVA
                     QYDKLLSPYVSSGLKVIKPYAELAAQKMTPVIELLKPYYVSFKETVKSCNPPIIKVWN
                     QFGGIIRPFLEELHGNVVVMRGWIVLQYQKYLEGYVNLFSEYYQKHFGFVNTWCDENV
                     VPWIKQNGQLLTGIGMVLALASVFPLVIRLLRAITQDAYSMGNGVNTMYSESREEEEQ
                     ERTTDSRETTPSASHRTQRSFKYSQKVSQTDEEEKFQTQLITEEQGSYEVTSDILSSN
                     DPMSVRSLARSLGPALSPDTELTESKWTSVNSNHRSTSAAALAAAAAATRR"
     gene            <188730..>188909
                     /locus_tag="FOA43_002049"
                     /db_xref="GeneID:62195450"
     mRNA            <188730..>188909
                     /locus_tag="FOA43_002049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922353.1"
                     /db_xref="GeneID:62195450"
     CDS             188730..188909
                     /locus_tag="FOA43_002049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778281.1"
                     /db_xref="GeneID:62195450"
                     /translation="MGNPEGGYTTQPMNMPQQQQSQDKRSGLTKFWGIIKKIFNAVIF
                     GFGFTIGSKIANAIF"
     gene            complement(<189001..>190916)
                     /locus_tag="FOA43_002050"
                     /db_xref="GeneID:62195451"
     mRNA            complement(join(<189001..189079,189154..189183,
                     189259..>190916))
                     /locus_tag="FOA43_002050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922354.1"
                     /db_xref="GeneID:62195451"
     CDS             complement(join(189001..189079,189154..189183,
                     189259..190916))
                     /locus_tag="FOA43_002050"
                     /note="BUSCO:EOG09340QSU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778282.1"
                     /db_xref="GeneID:62195451"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="PFAM:PF08637"
                     /translation="MSLLLDRLLATCDLEELNNRTLVVVSRLDDCDNLDSSSLIVKQI
                     FDDLYPSFKPFVTKYTKRKELIHKHDAEIDSFDATRTVSVSALNHVSLALRQLNQMHN
                     ASCAISELHPLAKELEDLVLIYSLVTILLSLGQLLIDVTLPLSDDIEYFDTVLNSRLN
                     LTVYTLQTFPSNLVNLAVQLFRLVSEEHHGMISIPQGLPKSLEYLYIQWSRWIVPLPS
                     VIVNNMTSFIHSPSTYMIRKQRSSHLLAKSVIASSIGLPFIFSVSQLTRKRKALLDLK
                     ERNVWRLGFLVDELISTFGLDNQLIDLDYSVISKLNDFLGDDKDSLSIKPSSGAAVSL
                     LYDIVSKKYPLFRRNLKITSSQRPSWITRYWIVALLGSMYIPNLVTSVFTNRQAIVSW
                     IKINLIDTVIGFWKNWILQPLQNVLKTIRHDDDSRIAVMSKQSLNSDLDSLEQMVVDY
                     CIDNYPSFHDASLSSDEKGALIDQIKYQVKSGDMHMVMKIYEDNVKAPVKSLVSGSML
                     RNLLIQIQKTKVDGAVALAGIDKIIQSQELVFGLVAASPACLFVCLVKSMAALERIDK
                     HEKEWKVCITYLPKERLDPRLE"
     gene            <191259..>193832
                     /locus_tag="FOA43_002051"
                     /db_xref="GeneID:62195452"
     mRNA            <191259..>193832
                     /locus_tag="FOA43_002051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922355.1"
                     /db_xref="GeneID:62195452"
     CDS             191259..193832
                     /locus_tag="FOA43_002051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778283.1"
                     /db_xref="GeneID:62195452"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="PFAM:PF00939"
                     /db_xref="PFAM:PF03600"
                     /translation="MKFSHSLQFNAVPEWSSKYINYSSLKKIIYTEQRNNAEILNTAH
                     ETEQPAFVPNNDPSNPINIFIKALNNELAKVDRFYTIVEKDLYLQYTSVIEELDEFER
                     GFPASDNEDFARIELRTLIDSLRPEMYRDNTSKLGSSSSSRIGGSATPPAAPTASAAS
                     AAPVSAKKNCDTATALKDSTALSPSMLSPDAFCNSSSNVNTEFPKASEDKRLSRKRSL
                     PTLFDDDDFKLTFLEALKMEKRKPLSEIFVRLSELKSYVELNRVGFGKALKKFDKVMF
                     SSIKEDYLASLSSRSYIFKQSTLDKLNLNIGDTVRLYSIFTGGNLDLAKEQLRSNLRE
                     YVVWERNTVWRDMIGMERKSHAAYAKHTKLGEDELSGGNEKFEIPLGAGHRLSVPKQL
                     LSSNVLEILIVSSITALLLIVSPFEDEQQAHCFAVVVCASLLWATEAIPLFATSLLVP
                     FLIVVFDVLKDAETGEPLDAVEASKFICSTMWSPIILLLLGGFSLAAALSKYNLDKIA
                     CTFLLSKVPQHPVYVLGAIMFVSTLVSAFVSNVAAPVLMYSVIRPVLSTLPEGSSFAQ
                     ALVIGIALASDVAGIVSPIASPQNVVALQSMDPAPNWIQWFTVSIPVCTCAIMLIYVF
                     LLFNFDFKGTTMVPIKGTNDKFTWQKFYVIFVSLATVALWCMASLLQEYIGDMGMIAI
                     ASMVAFYAPGILSADDFNNYPWTIVMLAMGGLALGKGVTVSGLLDTIAKLIQEKLADK
                     DLFTVLSIFGIIVMVTATFVSHTVAALIIIPLIQEIGKSLPDPHPNLLVMATAFLCSS
                     GMALPTSGFPNVTAIGLRDSVGNPYLTVGTFIKIGGVASIFMYLVVIFVGYMIMKLLN
                     F"
     gene            complement(<193840..>195258)
                     /locus_tag="FOA43_002052"
                     /db_xref="GeneID:62195453"
     mRNA            complement(<193840..>195258)
                     /locus_tag="FOA43_002052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922356.1"
                     /db_xref="GeneID:62195453"
     CDS             complement(193840..195258)
                     /locus_tag="FOA43_002052"
                     /note="BUSCO:EOG09341OGJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778284.1"
                     /db_xref="GeneID:62195453"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="PFAM:PF00485"
                     /db_xref="PFAM:PF13238"
                     /db_xref="PFAM:PF14681"
                     /translation="MAEQHSTSLTQLATRYIPPWKSPYIIGIAGFSGSGKTTVAQKII
                     QEINEPWTVLLSLDNFYRPLTKEQSDMAFVNEWDLDRPEAIDMDMIYDCIKSLKEGKK
                     TKIPVYSFAKHARTGQYITIYGANVIIIEGLYTLYNPDLLKFMDCKVYVDTDLDICYT
                     RRLLRDMAERGRDLSGIIKQWDSFVKPNSVRNVRPTMQNADVIIPRGSDNTIAMDFLI
                     EHIRRQLDAKSAEHLVQLKALGNEIRPIDLSKVHVLPSNNQIKVIKTILLNRDTLNDD
                     FIFYFNRVASTLITHALDFVEYVPHLDDPPQPVITPTGAVVKDTIFIKNEIIAVDIIR
                     AGDCFIPSLKKIIPGVKVGKLLIQSDSRTGEPHLHTEKLPDLNKNCNVLLFDAQIISG
                     AAATMAIKVLIDYGVQESNVIMCSYLASETGVRRITNAFPEITVVAATLSHSNHSLKE
                     VDHDTDSWMANRFIDSRYFGTD"
     gene            <195416..>198163
                     /locus_tag="FOA43_002053"
                     /db_xref="GeneID:62195454"
     mRNA            <195416..>198163
                     /locus_tag="FOA43_002053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922357.1"
                     /db_xref="GeneID:62195454"
     CDS             195416..198163
                     /locus_tag="FOA43_002053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778285.1"
                     /db_xref="GeneID:62195454"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /translation="MSNRFKRRKKDDDRSEWTVEDVKEETKIQSEDIEKELQSEDIEK
                     ELLSEDVEKKLLSEDVEKELLYGNNISLETGTDRKEEQEDVDFSELRKVARQRYLTDR
                     EKKQMILLESELKDYERDIEKIGWDNLSGKERKEYSLKKQVMTIFNRRRKIEEEELTG
                     HGEGFQIQNDYITSEGRIDTKRKRQALYGRREGGIGYEVKEMTAEKQITGFTHLKDES
                     HKIPEKKYEYVFDKSQKVEFSMDGDDEEIEDAEKFRLEAKIAQEEARVKSIEQTRKSL
                     PVYKYRNQLIDAVKKYPVLIVVGETGSGKTTQLPQYLYEAGFAKGLRIGCTQPRRVAA
                     TAVAVRVADEVGTKLGDRVGYSVRFDDKTTDKTVIKYMTDGMLLREFMSDPDLSGYSV
                     MMVDEAHERTLHTDILLGLLKEISTQRADFRLLISSATMDAEKFSAYFNDAPIFNIPG
                     RRFPVAIHYTMQPEANYLHAATTTVFQIHLSQGPGDILVFLTGQDEIETMATNLRNTA
                     EKLAGQMPLELIVCPIYANLPPEKQKLIFAPTPKKSRKVVLATNIAETSLTINGIAYV
                     VDSGFVKEDIYSPATGMQALTVVPCSHASADQRAGRAGRTGPGKCFRLYTKWAFSHEM
                     PASSTPEILRANLSGVVLQMMSLGISDLIHFDFLDAPAPEALIKALEQLYALGALNEK
                     GELTRVGRMMADLPCDPMLAKCLITGGDLKCCKEVISVVAMLEESGALFYKGAEEAAN
                     SVEKFRSRSKAKLGGDHLTLLEIWQEFVEAGFSVQWCRDNYLQYRSLNRARNVRNQLE
                     KLCRRLGLEEGEEESGKIEDEDDKDRKRIRVMKSITSGFFSNAAKLSRSGESYQTLKK
                     HQSVWIHPSSALFKMKPPVRLVIYNELVLTSKEFMRNCMPITEKWLKEYAPHYYGRSR
                     E"
     gene            <198212..>201627
                     /gene="PFK2"
                     /locus_tag="FOA43_002054"
                     /db_xref="GeneID:62195455"
     mRNA            join(<198212..198219,198702..>201627)
                     /gene="PFK2"
                     /locus_tag="FOA43_002054"
                     /product="phosphofructokinase beta-subunit"
                     /transcript_id="XM_038922358.1"
                     /db_xref="GeneID:62195455"
     CDS             join(198212..198219,198702..201627)
                     /gene="PFK2"
                     /locus_tag="FOA43_002054"
                     /codon_start=1
                     /product="phosphofructokinase beta-subunit"
                     /protein_id="XP_038778286.1"
                     /db_xref="GeneID:62195455"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="InterPro:IPR035966"
                     /db_xref="PFAM:PF00365"
                     /translation="MQLVDPLFNDTPFVVFYAPTKRLYNETVHFYSEVLSFQTVPIES
                     PKDDANFGGEIGAGPDASCWLSSCPETPGDSATIQLLLDSKKAASEDRIQAVTDNLLS
                     HKMKRDWRTLQSAVCFETTELNVLIARLQAEGCEYQIRPSELDPFEVYVVDPLGSLIG
                     FSGLKNAFGVSSNTRHSSKNSLNVTGMMSTAATSEASTPLAQALASGIAQKRRNIAVM
                     TSGGDAPGMNANVRAIIRAAIYKGCHAFAIYEGYSGLVKGGPEYIREMKWHNVRGWLS
                     EGGTNIGTARCMEFKERWGRVAACKNMINAGIDALIVCGGDGSLTGADLFRSEWPSLI
                     KELHEKNEITQDQYDNYKHLNICGTVGSIDNDMSSTDATIGAYSSLARICEAVDYIGA
                     TAKSHQRAFVVEVMGRHCGWLALMAGISTAADYIFIPERPSSRKEWADHMCEVVGKHR
                     ARGKRNTIVIVAEGAIDINLNPISCEDVKDVLVNRLGLDTRITTLGHVQRGGSAVAYD
                     RNLATLQGVAAVEAVLDGTPDTPSPMIAIAENKIVRRPLVEAVKLTKSVAQAISEKDF
                     DKAISLRDSEFTEHLHNFTAMNNADFEEPTLPAEKRKRFAIINVGAPAGGMNSAVYAF
                     ATFCMSRGHVPYAIHNGFPGLARHEAVRSLNWLDIDGWMTLGGSELGTNRTTPEDSDM
                     GMVAYYFDKYHFDGLVLIGGFEAFVSLSQLERARANYPAFRIPMVLIPATISNNVPGT
                     QYSLGSDTCLNSLVDYCDSIKQSAAATRNRCFVVECMGGNCGYIASYTQLATGAVASY
                     VPEEGMSLEQLEQDIETLKVSFGNDKGKEKSGRLLIKSANASKVFSAPVMAKIINSEA
                     RRRFDAKTAVPGHVQQGGIPSAIDRSRSARFAIRAIRFLEEHYDEIASSESSLGEFIE
                     SETASETACVLGIESSHVKFHSIRKLYDYETEAGKRARKRIFWQDVRDISDMLTGRVR
                     VKASS"
     gene            complement(<201700..>202917)
                     /locus_tag="FOA43_002055"
                     /db_xref="GeneID:62195456"
     mRNA            complement(<201700..>202917)
                     /locus_tag="FOA43_002055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922359.1"
                     /db_xref="GeneID:62195456"
     CDS             complement(201700..202917)
                     /locus_tag="FOA43_002055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778287.1"
                     /db_xref="GeneID:62195456"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF01399"
                     /translation="MPQALELARNITKDYSTQQIIDLIRIQISEGATIECICGLMECL
                     RIRSSSKMDLDPLYECLDEMGAVASNYRSVCLVLMAQLALEVSCNREQARQLLSKVNP
                     LKLQKIPPVFIVRCYLLKSATTDSSDLTQKDKMLCKGLAHFNRCKDAMSEDQRIRLGF
                     KLRFQRCRVLLEEQKYTECLSLSIDILESYSENPGYFAQSSMFENNLHNVVSLLLYVP
                     YCSAKVNSLKRFADFIGCDCNSSQAGSNQALHQALHQWLDAHLTSDGLKTLLCKLTRG
                     QIVRLDVEGLMECLRTLFADEEKFQQVYRNILEADVVSISKKFSNVKLELMKQLIGLT
                     NVNHENCLEDDDRLFNVIVELILDRKINAKLDEVEKVVYFSERLQPEWKSRVADMLVS
                     VDKVYERINAEAD"
     gene            <203349..>204005
                     /locus_tag="FOA43_002056"
                     /db_xref="GeneID:62195457"
     mRNA            <203349..>204005
                     /locus_tag="FOA43_002056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922360.1"
                     /db_xref="GeneID:62195457"
     CDS             203349..204005
                     /locus_tag="FOA43_002056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778288.1"
                     /db_xref="GeneID:62195457"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="PFAM:PF04622"
                     /translation="MNFLKWAVVPVAIFSILNFLFYYWLPSHYVFDKHVLQRLSQESI
                     ADHPDGNVTAIFYELQQKLSEEYGSDLINDFNTDDWFFNNAGGAMGQMFILHASITEY
                     VIFFGTAVGTEGHSGVHFADDYFTILKGHQYAALPNQFERSEFSPGDQHHMPKGVRKQ
                     YGMEPESYAIELAQGWIPAMLPFGLLDLFTSTVDLQTLYETVWFTAKHMVKNLLYGKF
                     "
     gene            complement(<204959..>205972)
                     /locus_tag="FOA43_002057"
                     /db_xref="GeneID:62195458"
     mRNA            complement(<204959..>205972)
                     /locus_tag="FOA43_002057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922361.1"
                     /db_xref="GeneID:62195458"
     CDS             complement(204959..205972)
                     /locus_tag="FOA43_002057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778289.1"
                     /db_xref="GeneID:62195458"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00056"
                     /db_xref="PFAM:PF02866"
                     /translation="MVKITVLGAAGGIGQPLSLLLRLNSKVSELALFDIVNAQGVATD
                     LSHIPSTQKITGYGPKSKTDITQLQAALKDADIVVIPAGIPRKPGMTRNDLFKINASI
                     VKSLVHQAGLICPNAFICVISNPVNSTVPIAVEELKTLGVYNPSKVFGVTTLDNLRLE
                     EFLSLSIKRATGKTVTPAELRGDVISIGGHSGSTIVPVLNSWARNLSSEVYDSLLHRV
                     QYGGDEVVKAKQGRGSATLSMATAGYRFVSHLIEALTGDSVVDEVAYVKFDELPGQVP
                     DIVADNVSYFSLPFKLGKTGVKLITFPHSLSDKETGLMAVAVNQLKDEIARGVNFVHP
                     SKL"
     gene            <206311..>206979
                     /locus_tag="FOA43_002058"
                     /db_xref="GeneID:62195459"
     mRNA            <206311..>206979
                     /locus_tag="FOA43_002058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922362.1"
                     /db_xref="GeneID:62195459"
     CDS             206311..206979
                     /locus_tag="FOA43_002058"
                     /note="BUSCO:EOG09343KBK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778290.1"
                     /db_xref="GeneID:62195459"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="PFAM:PF03232"
                     /translation="MSLILRRFASRAASGAKYMAAKPVNGPTHDALSKAQKAYLDRVI
                     RVDQAGELGADLIYAGQYVIFGHSKELRPVIRHMWDQEIHHHATFDALQKGLRVRPSL
                     LTPAWKVGAFGLGLVGGILGKEIAMASTEAIETVIGGHYNTQLRVLANNFNDRKDLKT
                     GENTDSAEIANIKKKIATFRDQESEHLSTAIKYDAQKARPHWLIYETVKLLTKTAVWT
                     AERV"
     gene            complement(<207004..>207591)
                     /locus_tag="FOA43_002059"
                     /db_xref="GeneID:62195460"
     mRNA            complement(<207004..>207591)
                     /locus_tag="FOA43_002059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922363.1"
                     /db_xref="GeneID:62195460"
     CDS             complement(207004..207591)
                     /locus_tag="FOA43_002059"
                     /note="BUSCO:EOG09343UKD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778291.1"
                     /db_xref="GeneID:62195460"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PFAM:PF00036"
                     /db_xref="PFAM:PF13202"
                     /db_xref="PFAM:PF13499"
                     /db_xref="PFAM:PF13833"
                     /translation="MGQKTSKLRKDDISGLKQETKFTTREIQQWYKGFTRDAPSGRLT
                     REDFIKIHEQFYPFGDPTEFATISFDAFDVNQLGYIDFKDFITSLSIASRGSMSEKLK
                     WAFRMYDRDRDGYIGYEDLSTVVKSIYKMIGTQCVRFRNEEITAESRVDRIWQAFSKR
                     LEEKETQNISLAEFTDYKRLDPEVLSSLSVYNDLV"
     gene            complement(<207734..>209275)
                     /locus_tag="FOA43_002060"
                     /db_xref="GeneID:62195461"
     mRNA            complement(<207734..>209275)
                     /locus_tag="FOA43_002060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922364.1"
                     /db_xref="GeneID:62195461"
     CDS             complement(207734..209275)
                     /locus_tag="FOA43_002060"
                     /note="BUSCO:EOG09342L01"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778292.1"
                     /db_xref="GeneID:62195461"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="PFAM:PF02535"
                     /translation="MNQGWLIVALTSLTTICGCLVIYTDVVYKTLFPARYKKKPFHIA
                     NNTPFLVCSLSLSAGCLTFVSLNKLLPTGIKYLKEVPSLRRDPRLLKGSAFACYVAGI
                     ACCSLLNVLVHLFTSESIVHCVHEIDSPEGHHHQYIHESPHDEHDDHHVHEDDECFHS
                     DDIETCSGNHIDINKLQVQRKAETPRTTEGSTSSSTNPDLTILAGPEAEPELVENCNE
                     TTPLTTVYKPVAMGRGISVVDLSLKALKGEKMEGDCYGDMACCCEEIACKHHLHQHPN
                     GKGLHFCIFPSTENQIFFEQDNGEMMRDNAELVKKFPELEIRSPLIKDTVNYQTTTNS
                     SMRRASTNEHHEHHHHHIKTPLARLLSIGVQTTLAITMHKFPEGFIMYSTSQADSRLG
                     WTIFLSMFIHNFVEGFTMTLPIYLALDSRWKALLISGSLGGMAQPIGALIGYFLFRHN
                     GVDVDDPFSMMLIGCLMALTSGFLTYIGLQMLTSAVSFGGRQETVLKWTISGVCLIFF
                     TNVLM"
     gene            <210218..>214042
                     /locus_tag="FOA43_002061"
                     /db_xref="GeneID:62195462"
     mRNA            <210218..>214042
                     /locus_tag="FOA43_002061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922365.1"
                     /db_xref="GeneID:62195462"
     CDS             210218..214042
                     /locus_tag="FOA43_002061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778293.1"
                     /db_xref="GeneID:62195462"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MPSTDSSSSSSKSPVLVNEFELADTPNTNYSKECSTDDNDLDSI
                     EKGSFMQLFYYLERKDSLLIFVGLLSTGLASLVPVATTFMISLIFTHFTDFVSGKYSS
                     LYSPLRDLKYVCIGIALIGVGSTIFSWIQASIFCILAERQQTRCRLALYTSFLKRDLE
                     WFSKGSQDLNGELIQLNRSIEEYRSAIGEFSAVLLKSIFTVIALLITSFTICWRLTLL
                     ILVTVPIMGVSVFIFGHFTDVWAQREDKHTSEATSILDWNLSCYYWVKVVFFHREEAL
                     KFNSILCKNNRAYNKFNLYSSCASSLMKVFSLMLFVQSFWFGSFLVRNHYNNSQEVLS
                     AFYACINIAVTFSSISMMMVILQKGYVSFQKILKYSKFPISDAYQKDSFRSFVPSIPL
                     HNEIALHNVNFKYTSRNSHQSILDDVTMTVKSGRITFLVGKSGSGKSTIGSLLLGLYQ
                     SESGKITFGGHDISKLDKLWLRDQITFVEQFSPIFEGSIKENIIMGDPTLFGSPQDVI
                     ERRVGEAVKMACLEPLIQSLPLGLDTPVGTGDKAFQPSGGEKQRITLARGFIKNSSVL
                     LLDESFSAIDIIQRKQLMKTIRQSYQGKTVLVITHDLSLINEEDEVYLIDGGRIKEHG
                     AKKDLLNQEGLFKTLEGFSLDSRNEKKHTSTKHNSHVSFQSKPAMDGSDLESQTSDKK
                     NEKVNLSLIVQFLSQSLSIKLRLAYLCGVVLSVCRCILTPVFSFCVSKLITGIVPQDS
                     SGLTDEHYQMKWSLILIGIALSDGICLLFARLLTGSAAERLVEVTRYRSFVKILNQDM
                     TWFQECRKTEISTLVMNDTRDMRTVFSGCVDSIIGGIVIFFLGVIWAATIGWKLALVG
                     LSFFPLFGILGIVASLFSKKSENNYKDSIVPVEEMVDETVSVMKSVVCMNLQKYMVDQ
                     FEAKLAKMLHMGVKRSIVLGMSISLTPLIVCLVQSILFYYGLKLVVTNHYNLVQTMQV
                     IMLIMFSTAFSASLLGSLPSFHRGMRVAGKIDDILKLPDDPNQTTGYLTPLLTTVDTS
                     NVFNFSNIYFNYPQLENRTVLKNLQLQIPKHSITCLVGRSGCGKSTIVSLLLRLYTAQ
                     EGQVDISGYDVATIKLEHLRKNLAVVPQQHFFVEASIRDNLLYGSPVAVSIDDERIFE
                     ILRLVGLDQFVLSLECALNTKIGGDSKNMVVSGGQAQRLCIARALLRPSKILILDECT
                     SSLDPSNADLIMKLLLKLRSQISIVMVTHKQEMMKLSDKICMIVHGKVEEQGTYDELV
                     GKKHSFYSFLNS"
     gene            complement(<214081..>217146)
                     /gene="UBA1"
                     /locus_tag="FOA43_002062"
                     /db_xref="GeneID:62195463"
     mRNA            complement(<214081..>217146)
                     /gene="UBA1"
                     /locus_tag="FOA43_002062"
                     /product="E1 ubiquitin-activating protein"
                     /transcript_id="XM_038922366.1"
                     /db_xref="GeneID:62195463"
     CDS             complement(214081..217146)
                     /gene="UBA1"
                     /locus_tag="FOA43_002062"
                     /note="BUSCO:EOG093409VB"
                     /codon_start=1
                     /product="E1 ubiquitin-activating protein"
                     /protein_id="XP_038778294.1"
                     /db_xref="GeneID:62195463"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR032418"
                     /db_xref="InterPro:IPR032420"
                     /db_xref="InterPro:IPR033127"
                     /db_xref="InterPro:IPR035985"
                     /db_xref="InterPro:IPR038252"
                     /db_xref="PFAM:PF00899"
                     /db_xref="PFAM:PF09358"
                     /db_xref="PFAM:PF10585"
                     /db_xref="PFAM:PF16190"
                     /db_xref="PFAM:PF16191"
                     /translation="MTEKMQVDPKPIDEGLYSRQLYVLGKEAMQKMAKSKVLIIGLKG
                     LGIEIAKNVALAGVKSLDIYDPTIVTLPDLSSQFFLRQDDIGKSRAEASLPRLAELNS
                     YVPISIINELTENSIAQYQVIVATETPLARQLEINEITHAKGIRFIAADVRGLFGQAF
                     VDFGDSFVVFDKDGEEPKTGLISDIETDGTVTTLEATRHNLEDGDYVNFSEIQGISKL
                     TDGSVFKVRVLGPYAFKIEGFDKSWGTYIRGGVFAQVKVPFSIKFGKLVDQLVHPEFV
                     QSDFAKFDRNEQIHLGFRALHLFQGSHSGELPRAHNEEDAEELVNITEKLAQSNVDLL
                     KGTSLDTDLIKELSYGSRGDLPAMNAFYGGLIAQEVLKACSGKFGPLKQWLYFDSLES
                     LPESKEYQRTQETCKPINSRYDNQIAVFGVTFMKRVANLKIFLVGSGAIGCEMLKNWA
                     LMGLGSGPEGKIFITDNDSIEKSNLNRQFLFRNYDVGKGKSEMAAKAVSVMNPDLAGH
                     IDTRIDKVCPETESIFNDKFWENLDFVTNALDNVEARSYVDRRCVFFKKPLLESGTLG
                     TKGNTQVIIPMLTESYTSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFEGYFHEAP
                     ENVNQYLTQPNFVQSVLKQSGDVKGVLETIDNYLSRERPYTFDDCIRWSREQFEQKYS
                     YDIKQLLYNFPKDAVNSKGEPFWSPPKRAPTPLEFDIDNQDHFHFVVGGANLLAFVYG
                     LKGDEGSADKARYSQVISKMQITPFTPKTNLTIQVDENEPDPAASIAHDQSELEKLSS
                     SLPTPSSLAGYRLNSVEFEKDDDTNHHIEFITSASNCRALNYDIEPADRSKTKFIAGR
                     IIPAIATTTALVTGLVCLELYKVVDGKMDLEKYKNGFINLALPFFGFSEPVASPKGKF
                     NNKEFDRIWYRFDVYGNMTLEQLLKTFEEKEGLTITMIAYDVSLLYASFHPPKKVKER
                     LPMAITQLIETVSKKSVPSDKKNLVLEICCEDKNEEDVEVPFVCVHLGN"
     gene            <217379..>217825
                     /locus_tag="FOA43_002063"
                     /db_xref="GeneID:62195464"
     mRNA            <217379..>217825
                     /locus_tag="FOA43_002063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922367.1"
                     /db_xref="GeneID:62195464"
     CDS             217379..217825
                     /locus_tag="FOA43_002063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778295.1"
                     /db_xref="GeneID:62195464"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="PFAM:PF07956"
                     /translation="MPTDKTQVKTFYPKTPVEFSSSLLAELDNTNESNYTRQQYVKQY
                     IEKEVAERLKELESDKRVKFDDALKKSLLKSNKDTDNVVSVASLNGKLDQTYTKLKAL
                     NEFHPMRTPQVEKAEKKVASCLKNHKGEPLNCWQQVEQFKKLASSL"
     gene            complement(<217831..>219294)
                     /locus_tag="FOA43_002064"
                     /db_xref="GeneID:62195465"
     mRNA            complement(<217831..>219294)
                     /locus_tag="FOA43_002064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922368.1"
                     /db_xref="GeneID:62195465"
     CDS             complement(217831..219294)
                     /locus_tag="FOA43_002064"
                     /note="MEROPS:MER0001882;
                     BUSCO:EOG093429E9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778296.1"
                     /db_xref="GeneID:62195465"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00240"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF13423"
                     /translation="MGAVKVIIRNAGKTYPIEVNLEEPGVSFKKQIYEATNIPLERQK
                     VLLKGGKLRDDSDLNKFNLKENQSIMVLGTPLEQKLEKPKERVQFVEDLSKEERDFNP
                     NDTPSGLINLGNTCYLNSSLQTLFDIKEVRDDLGKMTANPLESASSDKTLVFHMKELF
                     NKMENKKQKVTPLNFLTSLRLTFPQFSERGEQGFYKQQDAEEAYSQILNMLLGRFPDL
                     RNYFEIHMKTSTKCLEAEEAVTSGHEESMKLSCHINIHTNFLKDGLQNDMKEKIEKHN
                     DSLDKNCVYEITRTITRLPKYLTVHFVRFFWKRETGKKSKILRKIQFPFELDVTDLLD
                     ESVKEDKIKARESIYKVEKANEEEKMTFKKAKPSQKLTSREQYAKRREELAKMKKKWS
                     ENFAKALPTSYEALSGENPSPLYGLNAIIAHQGSSADSGHYQAFIRDPEDLEGDRWYK
                     FNDDKVSVVNREKIQSLAGGSEGDSALILIYKGVGLD"
     gene            complement(<219551..>220879)
                     /locus_tag="FOA43_002065"
                     /db_xref="GeneID:62195466"
     mRNA            complement(<219551..>220879)
                     /locus_tag="FOA43_002065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922369.1"
                     /db_xref="GeneID:62195466"
     CDS             complement(219551..220879)
                     /locus_tag="FOA43_002065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778297.1"
                     /db_xref="GeneID:62195466"
                     /db_xref="PFAM:PF18097"
                     /translation="MPLPFNKLIIPLYLRPVKSCFELYRKYLGEALKSNNGKLITLAY
                     LFGLRTTQVLMEIYERLDDQDKQKECSEITEKIVRSLEKIKKKEMAEYSKTKKGRKGN
                     GFIEIINDEDKGRLFLNKWCLMKLKEVDEIFKNGAIDGSTLETLVDVSVGMQVSLEMY
                     VDGEKEEKEEEEEKEEKEEKEEKEEKEEEKKEIESLDDAGEKLGELVISLPALFLAKS
                     FDKNPNLSREDLQVKITWCNYHIKRILDCFKKGEDPNEDLPGLLSQPPVKQDTISQEE
                     IDKVISEVQEMDISDESDYNDDDYYYDSEQEEYLRKVSLPDIPKISEISEKKVPKEEE
                     EEEEEVRSPVSTVSPATRHPEPSLASFVAEKASRDHPTTSLKPVDLETLERQLSYQDI
                     LHSASKCCKFAISAIEYEDIPTAMEELKESLKLLQEYRDKFDPDHVTKIT"
     gene            <221484..>222269
                     /locus_tag="FOA43_002066"
                     /db_xref="GeneID:62195467"
     mRNA            <221484..>222269
                     /locus_tag="FOA43_002066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922370.1"
                     /db_xref="GeneID:62195467"
     CDS             221484..222269
                     /locus_tag="FOA43_002066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778298.1"
                     /db_xref="GeneID:62195467"
                     /translation="MSTMLSEEEQFLLLPKAIVNPARASVYERLFFRLKEDSMLCSSI
                     ENNPDILLKLIEDYAPSQSSVDQRREQYSEIVQRFSEGNPACVLYFGVEEDCGYSIIY
                     LSKEFARIKPDVRVYAVYDITRISRRDLLMVNLLMKLSGIKQIQIFDAVSTLESFLAD
                     LNRNHRFEWVILNHENNTKDIDNVKMLETLSLIQPRMTMLKVNDFSDEGDDLETYLLS
                     TPMIKRLYSMEFSVSKYLGRWNLLYDKVSDMPKLYKCTEFLDS"
     gene            <222752..>223813
                     /locus_tag="FOA43_002067"
                     /db_xref="GeneID:62195468"
     mRNA            join(<222752..222757,222803..>223813)
                     /locus_tag="FOA43_002067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922371.1"
                     /db_xref="GeneID:62195468"
     CDS             join(222752..222757,222803..223813)
                     /locus_tag="FOA43_002067"
                     /note="BUSCO:EOG0934205T"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778299.1"
                     /db_xref="GeneID:62195468"
                     /db_xref="InterPro:IPR002259"
                     /translation="MTKQKGVDYSFRLKLGCFIQVIVFFSMTLSVLLPKNWTHFYFAF
                     VMFNVLISAVGACLAQVGIIALVNIQGSLYANANVVGNALAGVLPSVSMIVAVLTNGH
                     DTQNRAYEAAKYFLTSVAVTLTSLILLVVMERAESYSTSSLHANDESCDTSTTEYVSF
                     HHLWSLLGLVETTIIITFSITLAFPIFASAIESPTVDKKVFIPLVFLIWNLGDLTGRI
                     VCAWPFFVLKTQSKMIGYSLLRLLFIPLFLGCNIRGHGSGWIDDFFYILLQFLFGFTN
                     GQLFSSSFMLIGQLLRTEDEKKAAGGFTALVINVSLLLGSIMSYLVVYMIGGRVSPKS
                     FLFV"
     gene            <224072..>224548
                     /locus_tag="FOA43_002068"
                     /db_xref="GeneID:62195469"
     mRNA            join(<224072..224080,224147..>224548)
                     /locus_tag="FOA43_002068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922372.1"
                     /db_xref="GeneID:62195469"
     CDS             join(224072..224080,224147..224548)
                     /locus_tag="FOA43_002068"
                     /note="BUSCO:EOG09344N6A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778300.1"
                     /db_xref="GeneID:62195469"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR035903"
                     /db_xref="PFAM:PF01521"
                     /translation="MQTYSEHNGLPLFMGITNEASQQLNKIAKQDNEPNRALRISVES
                     GGCHGFQYVFKLTDTGEYNAEDGGDTLFIRGGAKVLIDKTSLEILRDSKVDYVHELIG
                     SQFKVVDSPYSKSSCGCGSSFDIDFDKLEAAGSS"
     gene            complement(<224595..>225530)
                     /locus_tag="FOA43_002069"
                     /db_xref="GeneID:62195470"
     mRNA            complement(<224595..>225530)
                     /locus_tag="FOA43_002069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922373.1"
                     /db_xref="GeneID:62195470"
     CDS             complement(224595..225530)
                     /locus_tag="FOA43_002069"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778301.1"
                     /db_xref="GeneID:62195470"
                     /db_xref="InterPro:IPR025204"
                     /db_xref="PFAM:PF13092"
                     /translation="MSRIFLNQNYRLFKVRPLPKVLDEQLPDSDSYVSSIVDTLCNDE
                     YGDNPFLTDLKRQLASTILTNEMYKTENLTAAASSLIPLNSRLYSNGRSTNDKLNIVE
                     ILHNLRLRKKINHVIYDQVKIKVGHLRFQFLDLIPVQIFIFIEIEPTEVLLLTKALPK
                     MQNVIAHYLVNQLGCLFEPLKLSDEFLRSTVDTSVKLANRHEDIGGMELMFSSIQTKG
                     NALNSIALNVESQDIAKFMDRKGFMHNICEYMQTETSIDFSQLALTRLRSELFLLGAD
                     GRLRLSSLLSFRSDPEKFADDRPTIWALLMLLYRQ"
     gene            <225736..>227697
                     /locus_tag="FOA43_002070"
                     /db_xref="GeneID:62195471"
     mRNA            join(<225736..225743,225768..>227697)
                     /locus_tag="FOA43_002070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922374.1"
                     /db_xref="GeneID:62195471"
     CDS             join(225736..225743,225768..227697)
                     /locus_tag="FOA43_002070"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778302.1"
                     /db_xref="GeneID:62195471"
                     /db_xref="InterPro:IPR031370"
                     /db_xref="PFAM:PF17096"
                     /translation="MSTIMHGAAGAAKATGRATKSVAKGGYNTYKAHQNPAQNNQTSY
                     YNKSERDSNEDPVPLRSLQDPHTFPAPPKHRDIGEGSQVPQGHPGSFQPQQFQQPQQP
                     QQYQPPQQPQQPQQPSYQPQQPQQFQQPYYQSPQQPQQQPYQPQQPQQPYQPQQPQQQ
                     PYQPQQPQQPQQPYQPQQPQQQPYQPQQPQQPQQPYQPQQPQQPYQPQQPQQPYQPQQ
                     PQQPYQSQSQQPYQPQSQQTQPQPQPQPPALQPRPSYEPAQWSQVPQLPTANSYQRLP
                     AQLSVQPPQPQSMSSYEQPPQQLPSRPPSYSSVGISPPPRTPSIPSDQLSYTNPYYKP
                     TQPVQPVQPVQPVQPVQPVQPVQPVQPLQPVQPVQPVQPVQPVQPAQPVQPAQPNQPL
                     FDPRTPSSPPNKFHEVIEEPKFKTGLMDFDISKFGAPPPKAYRNVDEERHMRHLEEEK
                     IRQEQIRRDAMERAHESLGIAQKTAQNQYYQPHSFQSSSISPSSSGPAAPSVAPDASR
                     LEPPLKPPRRASSVISASSTLSPRSSHPLLQPSAPSSAYTDTKHPVIAAVAVPVASKP
                     VPPLGPRPSVSPYSPSSDDLERQAAGKKKRSPPPKPAKKPSLKNFHSPSPITVSAPAT
                     SAKGSHIKELQARLGNLNLDQ"
     gene            <227985..>228647
                     /locus_tag="FOA43_002071"
                     /db_xref="GeneID:62195472"
     mRNA            <227985..>228647
                     /locus_tag="FOA43_002071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922375.1"
                     /db_xref="GeneID:62195472"
     CDS             227985..228647
                     /locus_tag="FOA43_002071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778303.1"
                     /db_xref="GeneID:62195472"
                     /translation="MSQLITINRNDYKSVNNYIRQAFREMTKKKTRQLLTAYYDWLRN
                     DPVEDAQALPLKAMDRTTSMKKGKTDILVFNETYIALLLPFVRKYRAYCEPLLDIAAD
                     MKDLNKKVDGHITFGNTLTERDMRLLRSIFRLVRGTKGCINVIKPVKREREQEQKQEQ
                     KQEQEQEQEQKQKQKQKQKQKQEQKPMEPLSAHIVPDSLIQDLQNKLNGLVVSVEIIK
                     ST"
     gene            complement(<228651..>230120)
                     /locus_tag="FOA43_002072"
                     /db_xref="GeneID:62195473"
     mRNA            complement(<228651..>230120)
                     /locus_tag="FOA43_002072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922376.1"
                     /db_xref="GeneID:62195473"
     CDS             complement(228651..230120)
                     /locus_tag="FOA43_002072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778304.1"
                     /db_xref="GeneID:62195473"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MPDRTYRAEQFELHEQLGRGAFGVVYRGFDRVRKIDVAIKQVDL
                     ESSDEMDEIEQEIRMLSTCHNDYITKYYGCFLKGFKLWIIMEYLAGGSCSDLLEAGPF
                     NESTVGLILTQLLHGLTYLHSNGKIHRDIKAANILVGSDGQVKIADFGVATQLSNNLS
                     KRNTFVGTPYWMAPEIIKHKEYTFTADIWSLGITAIELAYGKPPLSQYHPFDVLFRIT
                     DDLPPTLGSNFTTEFNDFVSQCLNKDSTKRPSSVELLNHRFIRKYARSDRRVLTKLIE
                     KKISWDLETGNMDKKYQQAQHAPQSLVQTPDNLFDLGTITVDPKTLGHISKESSLKPL
                     EEQQTLKIVPQSPIKRSTGLSDEDSHDLRKEMSRILNQSFNKISHKYNLSTYEYDNLV
                     KFEDLIMNSLFLDQDSKYREVFTKFFKLVLKRVMRSENSKLKERILPRYYVNMEHEWQ
                     NLVLKDKEKEKEQGTESNRDEVEELLLTRWAESMLDRKP"
     gene            <230232..>231392
                     /locus_tag="FOA43_002073"
                     /db_xref="GeneID:62195474"
     mRNA            <230232..>231392
                     /locus_tag="FOA43_002073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922377.1"
                     /db_xref="GeneID:62195474"
     CDS             230232..231392
                     /locus_tag="FOA43_002073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778305.1"
                     /db_xref="GeneID:62195474"
                     /db_xref="InterPro:IPR039204"
                     /translation="MFGCSLRSCALGLARALRPALGSSLRLAPALRPTHSLSDADIDS
                     FILEKNLLPRITAASQGGNIAKSGLRCIVFDHQGHFQKIPSVEERVQLMNSRDLLPRD
                     LRKIDKGYDDIVPSILIRENSILLSILHIRALIKADSVVLFNYDGSYSNKEFIKSLSE
                     KLRNDSHDKLHYEVRALEAIFIDALDNLNSEMRVHVSIVNGILKELEDEVDLAKLKYL
                     LMVSKRLQQFQQKATLIRDLIDELLDQDDELAELYLTEKMEGLPRSTHDHQEVELLLE
                     SYSLHCDAIVQTVENSISDVKTTEEIINIILDSNRNDLMLLGLRFSAGLMSFGSILFP
                     AAVYGMNLQNFFEQNSLLFSLVIASSCLGAFLLFRGAIKKLTRLKKIQIMKP"
     gene            complement(<231421..>232896)
                     /locus_tag="FOA43_002074"
                     /db_xref="GeneID:62195475"
     mRNA            complement(<231421..>232896)
                     /locus_tag="FOA43_002074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922378.1"
                     /db_xref="GeneID:62195475"
     CDS             complement(231421..232896)
                     /locus_tag="FOA43_002074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778306.1"
                     /db_xref="GeneID:62195475"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MATYTQPTKQLRPWSHATHSSHSSVSPDRSGDSRHDSKQDTHYD
                     THPSYQMSHLEDYEIMQQLGKGTFGLVSKARQRSTSKLVALKKFIVHDRKDGFPITSF
                     REITIMKKLHHLNVLQLIDMVHERTSTSKAIGFFYTVTPYISSDLNGLLNNPRVVLTV
                     PQIKCIMKQVLQGINYVHGQNYLHRDIKTANILLDFFGVVKLADFGLARVYHGIPPVN
                     AQSPPGGGIYEYTSLVVTRWYRPPELLLGDRKYTTAVDMWGIGCVLGEMYKKKPILEG
                     DSDLDQADRIFRLVGAPTEESFPHYREINRNEVNLEVSYERTLEEEYSGLMDKDSLSL
                     FAGLVELDPEKRFNAQKALNSSFFSMEPLPCKPEELPKFEESHESDIKRFKQEKHDIS
                     SSAPTESLNHSRYGAGQVEMYRNGEAPPNYRGSWTGARGGWRDRHRGPPPSQNEYYSE
                     DLPSSKAHGSDLYGAEEDQSFGAMKRFLHHENGEKTKRPKK"
     gene            complement(<233037..>234602)
                     /locus_tag="FOA43_002075"
                     /db_xref="GeneID:62195476"
     mRNA            complement(<233037..>234602)
                     /locus_tag="FOA43_002075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922379.1"
                     /db_xref="GeneID:62195476"
     CDS             complement(233037..234602)
                     /locus_tag="FOA43_002075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778307.1"
                     /db_xref="GeneID:62195476"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MQRKSPSKKNSSELDLNILSYLKSTTSKASEIVPQTSRTYNLQS
                     LKIDLNRIKQLIAQNTQTRSSILADATNQDLIHSHASADKISDSDYQLFQGIKDCSDL
                     SLSLDECQDYVQCYRYIASDWTFKQLLSLISNHPNIYVAAQVLAQLRDLVESDISQSS
                     SSDKLAVKRSQLTQCFVSCNLPQLLSNFLQRKDRENDDSVITCLTVLVDLCNYPDSLY
                     EILVACDKLNDQVYQMCKVSSASQVTLVNQYAMEYLNVLLTDSRNTKGFPSHDLVDQL
                     LVSLSKFLKVQLSSITPEGREYVENTILLLSFLVSTSDQCNSQFIADEGIELMLMMVS
                     SEDSRWHTKTGFKILDSACTKTEIASILVEKGILKPVFQSINYRKLPQKSTSLNIYLL
                     DIIGRLFKYLPFDSDDRLRLLNKFMNKNYKNFNKLMKYKKIVDTADDLDETLMVACSA
                     LINTIIAWISIDDIVPVEKVMNIFTDSGLTISSNLIEPLHDTYQILLGETGTENDDTE
                     VLKDLYQALSSRY"
     gene            <235256..>236707
                     /locus_tag="FOA43_002076"
                     /db_xref="GeneID:62195477"
     mRNA            join(<235256..235835,236667..>236707)
                     /locus_tag="FOA43_002076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922380.1"
                     /db_xref="GeneID:62195477"
     CDS             join(235256..235835,236667..236707)
                     /locus_tag="FOA43_002076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778308.1"
                     /db_xref="GeneID:62195477"
                     /translation="MDKLIFPNATFAVTEVLFNAVDVIKGVFLRPSGSSKTLKETVVC
                     GDLFHANVKIDLIKPLSMTCHACAVDEFEYDFTSTNPFNWDLQPFSVDGSGPSGSAPS
                     INYIGGGKEYTTNSEKAHHVSHRAATVAEIFDDSAEEPEEEEKDDDSKEKHKQEPYSY
                     VSCSSVSCSSDVPSLRDYESDEYVLDEEMKMHLETNECPAMVTKYK"
     gene            complement(<236835..>239144)
                     /locus_tag="FOA43_002077"
                     /db_xref="GeneID:62195478"
     mRNA            complement(<236835..>239144)
                     /locus_tag="FOA43_002077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922381.1"
                     /db_xref="GeneID:62195478"
     CDS             complement(236835..239144)
                     /locus_tag="FOA43_002077"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778309.1"
                     /db_xref="GeneID:62195478"
                     /translation="MSREGSFVDDASSLTSANQLYSPQLSSRGRYRHAGRPMLRRPRL
                     MPGFRGPPDGSPDGPSYWSPGGPPRWPPGGPPRWPPPPGGPPGGFRGPPGGFRGSPGG
                     FFGPPPGEFHGPGGPLDGHPGGPPPPPRIPGPPEHWGDRGPWGHNPWGSYYYNPPMPP
                     HMPPPSAPPPPPYDYGRFYDYDRPQTISEQPAGLEQPAQSYHSSQSSVTSSSATIPLF
                     ITEEGLQKVDMPCFNTVCHLIDLYYRYVNPSYMVLPNRKLLVDYLSISPLCICLLSTM
                     FKISSRYCSPDAVEDPKYLDQGFWAGQIERYGVSLAGFERLAAYILASQRGKDDHLEE
                     CAKLVKFYRFVDCTSCKELADIEQFLNISTPAQIIFREGFIRMLWNVYKFQVFRRVSF
                     SSPYLKGKGTFEFPSNLELPMPDTDYYTRSSRTGGFKKDYRSLAKISRINFKDPVNEP
                     IYDSSAIVVACHLLELVIDLVDDYKNMPEDEFDQTYNDFTSQLHKLRYLSMNAPFKVS
                     PGNKMALNSNNMLNALVCDLSLIILGTMKLPSNVKLPVNSGSHGLLACKDIFGVPSAS
                     HHVLQSLSSDDIDGEKQWESYFMALNAAFDIHTLIRLGEGIAPPSLDQTTRFSTSIEP
                     RAADVSAFSSVSQDSETWLQYPSFTLVIVIHCISILSTLCVFGSRNGIEAEETPSGIE
                     LKVSNSSKCRYAKTIAPVGLNPEHRLASLGEQLKKAADEKVSSSVLGYRMIEDINRYL
                     EASGKYYEDVSNAKSQVDELLEQLHKEVF"
     gene            complement(<239832..>240320)
                     /locus_tag="FOA43_002078"
                     /db_xref="GeneID:62195479"
     mRNA            complement(<239832..>240320)
                     /locus_tag="FOA43_002078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922382.1"
                     /db_xref="GeneID:62195479"
     CDS             complement(239832..240320)
                     /locus_tag="FOA43_002078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778310.1"
                     /db_xref="GeneID:62195479"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="InterPro:IPR036714"
                     /db_xref="PFAM:PF03937"
                     /translation="MFRFRNIRLFSTTYTRASSKIHTPQKPLGEIQGKPVKNYYVDEN
                     NNVVIKVKPLLRTNEPVENKRRRLLYQSRKRGILEADLLLSRFADKYLSTMTEADLNE
                     YDKLLDEMDWDIYYWATKNYEITPLPDRWKHSKVLTMLQKMSKNPGKEILRMPDLEER
                     KN"
     gene            <240561..>241217
                     /gene="HIS3"
                     /locus_tag="FOA43_002079"
                     /db_xref="GeneID:62195480"
     mRNA            <240561..>241217
                     /gene="HIS3"
                     /locus_tag="FOA43_002079"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /transcript_id="XM_038922383.1"
                     /db_xref="GeneID:62195480"
     CDS             240561..241217
                     /gene="HIS3"
                     /locus_tag="FOA43_002079"
                     /note="BUSCO:EOG093441HI"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="XP_038778311.1"
                     /db_xref="GeneID:62195480"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR038494"
                     /db_xref="PFAM:PF00475"
                     /translation="MARFAHVKRITNETQVQIILSIDGGPITLEESLFEGSSDKEHAL
                     QTTGSQTISVNSGIGFLDHMLHALAKHSGWSMIVECIGDTYIDDHHSVEDIGIALGEA
                     FNKAMGSVRGIKRFGVGFAPLDEALSRAVVDISNRPFAVVELGLKREKIGDLSCEMIP
                     HFMESFATNARITMHVDCLRGFNDHHRSESAFKALAIAIREAISYTGGDEVPSTKGVL
                     "
     gene            <241712..>242773
                     /locus_tag="FOA43_002080"
                     /db_xref="GeneID:62195481"
     mRNA            <241712..>242773
                     /locus_tag="FOA43_002080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922384.1"
                     /db_xref="GeneID:62195481"
     CDS             241712..242773
                     /locus_tag="FOA43_002080"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778312.1"
                     /db_xref="GeneID:62195481"
                     /translation="MASPDIDDLFKEAGALGVYSYYYQANRDNFHEIRLRSPIKSPGR
                     LTPTPVRSTGPRTPVVQQAPVALASAPLASSPPPPLPQVAPIDHLNHCLNTIVGKDKS
                     SKIIIYLLRLLTSLPTSFSSPLLRQLFLRSQGIIKGLGLYRQILRSLGVPFHLVRLTR
                     MIRSSAIIVNNSKLGTPIRTKQLLNYWFNWDVITYLSSFYYAWADESLLLYNLGVLQN
                     HELSHYHKLCSKHELLAWFAITVVGLRNDFAKYDDLLNRENAIKINFQVKERAHRLLS
                     LSSGSPSTITKFATAYSSQLAEISKEKRILMVDIVRLSSDLIYDSVYVFHRPMYQPLH
                     LSLGLASGILGFYKLWLSY"
     gene            complement(<242791..>243366)
                     /gene="RPL9B_1"
                     /locus_tag="FOA43_002081"
                     /db_xref="GeneID:62195482"
     mRNA            complement(<242791..>243366)
                     /gene="RPL9B_1"
                     /locus_tag="FOA43_002081"
                     /product="60S ribosomal protein L9B"
                     /transcript_id="XM_038922385.1"
                     /db_xref="GeneID:62195482"
     CDS             complement(242791..243366)
                     /gene="RPL9B_1"
                     /locus_tag="FOA43_002081"
                     /codon_start=1
                     /product="60S ribosomal protein L9B"
                     /protein_id="XP_038778313.1"
                     /db_xref="GeneID:62195482"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="InterPro:IPR036789"
                     /db_xref="PFAM:PF00347"
                     /translation="MKYVSSVQDINVPKDVTVSIQSRFVKVVGPRGTLTKDLKHIDVT
                     FVKVSKDLIQVHIHNGDKRHVAKLRTTKSLISNMITGVTVGYRYKMRFVYAHFPINVS
                     VADEDGQEFVEIRNFLGEKRLRKITVPEGVKAEVSKAQKDELIVSGNSVEEVSQTCAD
                     IQQICRVRNKDIRKFLDGIYVSEKGNIVEEM"
     gene            complement(<243673..>245214)
                     /locus_tag="FOA43_002082"
                     /db_xref="GeneID:62195483"
     mRNA            complement(<243673..>245214)
                     /locus_tag="FOA43_002082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922386.1"
                     /db_xref="GeneID:62195483"
     CDS             complement(243673..245214)
                     /locus_tag="FOA43_002082"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778314.1"
                     /db_xref="GeneID:62195483"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="PFAM:PF06398"
                     /translation="MSDDDITMKEASEAHQVDATATSTNPLSRISSTSSSLASATTTP
                     QIKVNDSEQITAKFTGVKNPSHQRSGSKSGAPSSIQVQSSPLLSSTPPTISKSLIKAY
                     PYLIFANKILSILTWTDDNAFLPISLVLFSILLILYFENVITYLGHLLPVLALAHFTL
                     ICAYVEAQQEQHSTLDDIVHCMSTLSNKCEQLLAPLTSLSLTAYDLKRLLFTTVFLSP
                     IHIIVSYFLLPPKTIICTTTVFLLTYHSQWSRVTRRLFWKSKTFRLLCFYLTGLDFEQ
                     QQHSGKSTIFNYAVEKTNQKLKEVTQKATGGGRNGPVRFSYVLYENQRRWLGIGWTPN
                     LLSYERTPWTDEFLNEADSPDNFELPQLNDDSGMYWRWVDKTWRVDLTNDGSIQLSST
                     KSKTTADPKPDEGFIYYDNTWKSPTTEDSFSKYTRKRRWVRTAELASTKNSSTIGSVS
                     ALDGVSIPKSTPIGDVQNVTAIGDISTKVKKRKSLRFGANPTVLEGADDKTVNVDDMT
                     LKKDQ"
     gene            complement(<245348..>246661)
                     /locus_tag="FOA43_002083"
                     /db_xref="GeneID:62195484"
     mRNA            complement(<245348..>246661)
                     /locus_tag="FOA43_002083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922387.1"
                     /db_xref="GeneID:62195484"
     CDS             complement(245348..246661)
                     /locus_tag="FOA43_002083"
                     /note="BUSCO:EOG093435SD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778315.1"
                     /db_xref="GeneID:62195484"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="InterPro:IPR040450"
                     /db_xref="PFAM:PF02270"
                     /db_xref="PFAM:PF17683"
                     /translation="MSEIQAESDQVQVKTEPSVIADSPTEVSNSNTENLPGNDREDSP
                     DSSIAYDEDGMPVPNGIEDVKEEDLHEGGESLNLDLSRAGNQVWLVKLTPQLADIWKN
                     NSFLDGQDLGQIKIQKGTSPPKIFLDLNDKMPEHSNVDKEYQLRLTKQVVENEYIFNE
                     TEFDHFKHRLMYRTQVVDMPYQPKLRSMNNEALNHAATWTRRTKPSQRELPESGMGTT
                     RIQSNRRHSRFKKFVPYAKTIPKKTQMVGKVVHECQVIPARLASNNKLKLVAQKRRLA
                     HMVKKRRINYLKNANTGILQGRAGPNIHTGATITLSRDLAAKKEAAKSEGRASRMDKE
                     VLMKILFDLFNKYDYWTMKGLKEKTNQPEAYLKECLENIAVMERKGPYALKYRLKEEY
                     RKSREVERKAQQGFDLDDIDLDKRDDDDDNDDDDDDIEMEDVANI"
     gene            <247909..>248769
                     /locus_tag="FOA43_002084"
                     /db_xref="GeneID:62195485"
     mRNA            <247909..>248769
                     /locus_tag="FOA43_002084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922388.1"
                     /db_xref="GeneID:62195485"
     CDS             247909..248769
                     /locus_tag="FOA43_002084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778316.1"
                     /db_xref="GeneID:62195485"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PFAM:PF07716"
                     /translation="MVKTKSSPAPITPVVLPNGKIGTLPPRKRARTKEEKEQRRIERI
                     IRNRRAAHTSREKKRRHVEQLEKYAKQLEQCIARFSDTQSQLVGIQNQLVFKLDDAGI
                     DYTDIDLDLKLANCVDRPDNLDLDTSSRPIKRQKSNPKEESPMDSPLSEIPSPPFEAG
                     LKAEKDSQSSESTQSDVSTQQFQGIFTPPPSTSSSKFKLDENDILKQDYSPLFDDDDI
                     FMPQEKLEADNSLKLFEQNIAGNEAEEAVESKMALGLLDQSSDVFHPDNMDYLNCLND
                     VHHSAVMMSL"
     gene            complement(<249194..>249506)
                     /gene="RPL38"
                     /locus_tag="FOA43_002085"
                     /db_xref="GeneID:62195486"
     mRNA            complement(join(<249194..249424,249501..>249506))
                     /gene="RPL38"
                     /locus_tag="FOA43_002085"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_038922389.1"
                     /db_xref="GeneID:62195486"
     CDS             complement(join(249194..249424,249501..249506))
                     /gene="RPL38"
                     /locus_tag="FOA43_002085"
                     /note="BUSCO:EOG09344SO2"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_038778317.1"
                     /db_xref="GeneID:62195486"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="InterPro:IPR038464"
                     /db_xref="PFAM:PF01781"
                     /translation="MAKEITDIKQFVELARRADVKTATVKTNFKLNARGKKFKQTKFK
                     VRGARYLYTLIVDDATKAKKLVQSLPPTLTVTEA"
     gene            complement(<250422..>253043)
                     /locus_tag="FOA43_002086"
                     /db_xref="GeneID:62195487"
     mRNA            complement(<250422..>253043)
                     /locus_tag="FOA43_002086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922390.1"
                     /db_xref="GeneID:62195487"
     CDS             complement(250422..253043)
                     /locus_tag="FOA43_002086"
                     /note="BUSCO:EOG09340CII"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778318.1"
                     /db_xref="GeneID:62195487"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF07569"
                     /db_xref="PFAM:PF09453"
                     /translation="MDGKRLASGGLDGKIRIWSIETLRKYAKLLQNSGNDDSSAVKTD
                     PEECRELSSMSRHTGAVTCLRFSPNGRFLASGSDDRILLIWEHDEDTSRLLLQNQQQG
                     LGNGLGSENTELEHWTVRKRLVAHDNDIQDMAWAPDSSILVTVGLDRSIIVWSGTTFE
                     KIKRFDIHQSHVKGVVFDPANKYFATCSDDRTLRIFRYRRSSPTDFSFSVESVVTNPF
                     KNTPLTTYYRRCSWSPDGQYIAAPNAVNGGMCSVAIVKRGSWKSDISLLGHELPCEVC
                     SFSPRLYQIDGSGQKEPELTTVLVTGGQDRSLVLWDTASAVPLVVAHDLCMKTITDVA
                     WDPSGQLVFLSSLDGSVTAVFFDQGELGRPIPLDQNSAQLHRYGADRESMYFPESVEQ
                     LQLEEAATKFSESHPAHKRMDKLMGDQTHEGFVSSGFPSIPSTANIMVNTLVPRSKKH
                     PNRRLPVTVSKKKPILTASSQKVQITKSGKRRLTPMLISTTSAVTKPTVASQKKHPKS
                     TPKFLSHPSLRMPRLGLQTMVSCIRDNLIYEKSKGLEDSSETDIDHITGAQAGPKKRS
                     SSRSQYSRRKRSVEYPSYMTSCITTPFTVFTDMKNQPSIILQQKPDSNGDPFGSVMEI
                     RNESDERDGNNGSTFDEFDSISKLFVTNGQKTAFQYFKNDKVTNVTESKFGSVDYWAL
                     STDKGSIIILSKTGRQLRPSIELGSSLTHLISRENFLLTVTNNGLVYSWDLESGKIIL
                     EGVSLAPIVNQFAQFEHHKHKFENNAKILELHLFKNGLPLILLSNDYIYLFDADLCCW
                     VNVLEPWYLQTLSYDELKQYMNSSNRLLRVLGARILGERNGLRTKTSQCSETIHSCAT
                     KSFAFIQKCFQERAENN"
     gene            complement(<253380..>254810)
                     /locus_tag="FOA43_002087"
                     /db_xref="GeneID:62195488"
     mRNA            complement(<253380..>254810)
                     /locus_tag="FOA43_002087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922391.1"
                     /db_xref="GeneID:62195488"
     CDS             complement(253380..254810)
                     /locus_tag="FOA43_002087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778319.1"
                     /db_xref="GeneID:62195488"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MITDLHHFLSEEAKSRRPSPLKVAFKYYGQEGLVFLGGGLPMSD
                     YFPWEKIVAYSPSAPFTGSAGIAEKPSDTGKATITELKKQKVESYDIPLARSLQYGYT
                     SGQPELLDFVKKHTEIIHHPPYEEWDAITSIGNTEAWDSTLRTFCNAGDTVLFEEYTF
                     PSAVETANALSVSFAPVHMDSYGIVPEELEKLMANWDSSKPKPKLLYTICTGQNPTGS
                     SLSDERRKQIYKIACKYDFIIVEDEPYYFLQMGEYDAKADATKMKTPTHEEFLNSLVK
                     SFLSMDLEGRVIRLDSCSKVFAPGTRLGWIVAQKDILERYVRLHEVTIQTSSGFTQSI
                     VAGLLGRWGQEGFIDWLIGLRKEYAIKRNFTVHCLDKYMPKIVSYTPPVAGMFFTVSI
                     DASKHPRFATEYDSDPVKVEDAVFNRALKEGSLMIPGSWFRSPNFEIKDDTFFFRGTY
                     AAVDLEKLDLGLERFGKAIKEVFEIE"
     gene            <256758..>257855
                     /locus_tag="FOA43_002088"
                     /db_xref="GeneID:62195489"
     mRNA            <256758..>257855
                     /locus_tag="FOA43_002088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922392.1"
                     /db_xref="GeneID:62195489"
     CDS             256758..257855
                     /locus_tag="FOA43_002088"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778320.1"
                     /db_xref="GeneID:62195489"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="PFAM:PF11559"
                     /translation="MNSSQEPQKTPQRATHEPRDTPQDTLQRSSHHPNQMALVDSIRD
                     GARVINDKLIAKGYLSSRPDKHKGILLISLDKSQLIKPYEDVIVKEEALENDRKIINT
                     VYSLLDTVEMSTRCLESKNKAVDETKGEVSKLNSEIYKLQRQLGVKDKEIQSFKQNNL
                     RQSIDMKTMKVKVSNLNKKNKEWEHNFQLYSAEVDRELRRNEIEMDDLSNKLQRRKRG
                     RSESQLGRLDDSKVSKRRRMELRGDPRGDARSDPPNPSSPRIESSLESLIDENNRLRA
                     EKEAVLCFSDNIYTFLKKYNDLSFDLRMNMKRTQVPQVPPVPLSFIPSKEDVMHFDAT
                     KSDLSALDSRFVDLMGQIETERSEDTFRFKR"
     gene            <257969..>259744
                     /locus_tag="FOA43_002089"
                     /db_xref="GeneID:62195490"
     mRNA            <257969..>259744
                     /locus_tag="FOA43_002089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922393.1"
                     /db_xref="GeneID:62195490"
     CDS             257969..259744
                     /locus_tag="FOA43_002089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778321.1"
                     /db_xref="GeneID:62195490"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036047"
                     /db_xref="PFAM:PF00646"
                     /db_xref="PFAM:PF12937"
                     /translation="MDRYGERMVEVVPTAPVVASPVELSPVAVAPSNWLASLPTELLI
                     IIFSHLDPTSLRRIALVCKSWYRLTCDNIVWRQIFRVRFPLVGETFTSVIRTAFWRQE
                     LICRETLIKTWYRGRATRRTYTLAQALGQVSDCYADFLRDRFVAFDANSGRLAECRMA
                     SGHGVSAESCSIPGGTTAYSTGRHFFLFGRWDGAIFGSLVDHKNILLNGLHQFQPDKH
                     SSMVTAAHVCPGELGKPGYVGAFTGDQQGNVFGWDLREGKCLVKVAVNSSAIVKISSD
                     GRSNLVVLSANGDLNHVTGSFQRRSQTTKICTFLTTPSVNQANSVSINMLVDYGGGNV
                     VLFDDLKLEIYSFVGSRHVLQLQPGEQIFRASLEENQHRYQKKDDKLVGGDPLFMAVL
                     LRSGTVLVVNVRETEYHVIPATRFVPQMVGQLPPDDTLPPVCAVTLNALVILVGSRDG
                     RVEMYDIVTGDFCRKVSERVGKRILANSIGRAESIPVSRILIDEKLAAGVVVLGPIVQ
                     FFKFGDFYKELENGRGGRKSYSKEKKRSVDEVQTRIDDYEYQRDQRDREYDMFIKYNG
                     EGAGDDPEEEQLELALALSASIQDR"
     gene            complement(<259750..>262011)
                     /locus_tag="FOA43_002090"
                     /db_xref="GeneID:62195491"
     mRNA            complement(<259750..>262011)
                     /locus_tag="FOA43_002090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922394.1"
                     /db_xref="GeneID:62195491"
     CDS             complement(259750..262011)
                     /locus_tag="FOA43_002090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778322.1"
                     /db_xref="GeneID:62195491"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF01529"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13637"
                     /translation="METCELDDMRAEASKAEVRAQNDSAESIDDSSIRALRGEMGGSM
                     SETASMSETAPMSEPGEPGNPLPTTPIQQLMKAAQQGDIETLSSLLESHQVSANDHLE
                     DNVSALHWCAINNKLSAMKYLVSKGADIDYVGGNLNATPLHWACRYGLVYIADYLISQ
                     CQANYSLKDAQGFNCVHLSVHSSNIMMVIYITRFTDLDIDTADPNGRTALHWAAYQGD
                     TLSVEYLLTLKPSINSVDELGFTPFHWCLVRQLKYIMIKLINAGSDLHRTTNDGKTCW
                     DIAHDMNCSSQLTSALYECGYNKDLSKSQSRWLSKSSAKIITFTSPYITLPLSLWVLS
                     RVNLLLGLILTAGIQALQMALLTRIILPVYNRKSDPLLRTPFFAGVFSATSVWCIITW
                     LFVLIPYTFFDRSFTNFLFLVGATIVVISFIKAMRLDPGYIPKETNSKNIQSTIQALI
                     SSRKFDARNFCVYTMIRIPLRSKYSHSKDLYVARFDHYCPWVYNDIGVRNHKVFLAFS
                     VTLSATIFFYLTLTAKYFDELDLPDQVEHSCSILSEDLCSGFHGSPFIFFLMIWASCQ
                     QIWLLMLILVQVFQISRGYTTYEFTNKHNSSHMRASSFSSIPTDEPRAEDAPQEPQEP
                     QTSQTPQTPQTPQTQQSEPTSCSPRLLRKLLCLPSFFINSKISRVLGLNQFTLISNDF
                     IRHRRVSDENRFNYGFKTNWLNFLFVRSDSEPYGLETLFRIPKAGEANLGDAYVDYYK
                     LYEPPINARYSRV"
     gene            complement(<262152..>263672)
                     /gene="PYK1"
                     /locus_tag="FOA43_002091"
                     /db_xref="GeneID:62195492"
     mRNA            complement(<262152..>263672)
                     /gene="PYK1"
                     /locus_tag="FOA43_002091"
                     /product="Pyruvate kinase"
                     /transcript_id="XM_038922395.1"
                     /db_xref="GeneID:62195492"
     CDS             complement(262152..263672)
                     /gene="PYK1"
                     /locus_tag="FOA43_002091"
                     /note="BUSCO:EOG09342A03"
                     /codon_start=1
                     /product="Pyruvate kinase"
                     /protein_id="XP_038778323.1"
                     /db_xref="GeneID:62195492"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="InterPro:IPR036918"
                     /db_xref="InterPro:IPR040442"
                     /db_xref="PFAM:PF00224"
                     /db_xref="PFAM:PF02887"
                     /translation="MSSSSKLNWLVNLDIQEPRGKKNLRRSSIICTIGPNTNSVEMLT
                     KLRKAGMNIARMNFSHGTYDYHQSVVDNARKSEQIYPGRPLAIALDTKGPEIRTGLTV
                     DGKDWAIKAGHEMIFTTDDAYAKKCDDKVMYLDYKNIANVIEKGKIIYVDDGIQSFEV
                     EEIVNSTTLKVKSLSDGVIASTKGVNLPNTDVDLPALSAKDEKDLRFGVKNHVNMVFA
                     SFIRTAEDVRHIRKVLGEDGKDIQIICKIESQQGVNNFDEILKETDGVMVARGDLGIE
                     IPAPEVFAVQKQLIAKCNLVGKPAICATQMLDSMIHNPRPTRAEVSDVGNAILDGADC
                     VMLSGETAKGAYPIEAVTMMAETALLGEHAFPYVEHYTEVRDMTPKPLGTTETIAVSA
                     VSAVVEQSVKAIVVLSTSGTTARLCSKYRPSCPILTVTRNPNTARYCHLYRGVYPFVY
                     TGARDENWPQDVENRIQFALKNAIELNIVKKGDGIAVIQGHTRGIGHSNTMRILKA"
     gene            complement(<264114..>267518)
                     /locus_tag="FOA43_002092"
                     /db_xref="GeneID:62195493"
     mRNA            complement(<264114..>267518)
                     /locus_tag="FOA43_002092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922396.1"
                     /db_xref="GeneID:62195493"
     CDS             complement(264114..267518)
                     /locus_tag="FOA43_002092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778324.1"
                     /db_xref="GeneID:62195493"
                     /db_xref="InterPro:IPR013136"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="InterPro:IPR028941"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="PFAM:PF02791"
                     /db_xref="PFAM:PF10537"
                     /db_xref="PFAM:PF15613"
                     /translation="MVLFKRKQVEFVPPPSIPNEFDPDQPVWLIPETGEWFIEYEDYL
                     RRMSYYKIKKFVCETSGNSNFTYFEALKVERNELRLMETKFPDPIKEPILRYVSFSTV
                     PRIDVMVDDVYTRFKEDFFPGDQVIVKGPHEKFRGIVREKARFNPIQLPDGTVRDGYC
                     SYRVLLETNEEITVNDSSRMSRERNTFTKWFVKSFLKMSLTRANRSGAPWVLKETIAQ
                     KYRIPLEYPAELRHFEAELAAENDDTNKSRHGRLYVDDSSVVQEPPATSTLAFNLFDD
                     VKETPPTGSEQENGRNLQEWKDKWYEVLQKATAYFDDLTDEEIDPDLLHKVESMFEFA
                     GVTRMDTFVPGKVNFYITPRTYSSRVHYEFDDDFSSVHLHKIKVWHYEKCIRFFKSIN
                     ITPRKIEQARLLAQMPGADIADVKRLIIANRNYPQSAIQQKLPVESQNFLNKLPTIHQ
                     QHQRHANKPTKPPSPIEDLDLAFTGYTPSQTSHWKYLEAEFGDPSILLGIWIFMNMYN
                     KALIIDNFTFDDFCTALKWRDQEEPCQLLLEIFCSLMTALTDETGHLALTIPEELIEE
                     DEEKEEKVKTKPEKSDTVEEEDHSDEITHNAYAIIQYRRISWKERLRKRQFKNGGWLI
                     ILLGIFSLVDYIPDYMDTINEIDCILAPGDYKPTHVTVENNFYESLSSELRVKALDIL
                     VSLLLNSSIIRDYIDKVAEDSSNLRRERFELIRQLKTKLEEAHDVQKLVTEALEEIDT
                     TEIEKKLQQEKPEEVGKPETEQKPRRRGGRPSLNYIPPEPTELEKAVCLSHPEFLKLI
                     KERSEKMKVIKKSKVKRKEIERQLNELNIQRMRYIGRDRYFNRYWWFERNGLPNLGSS
                     VDEEGEGEGEGEDNEEEANDEEGDDDDEDQYISETYLMGRLWVQGPTDSDRKYHLHFS
                     DEEMKVFEEKARGAGGAGGADGAVTGDTGHLSALERKVIEEGKDVLVGSSNWRFLDTV
                     EDLQKLIMWLNVSGIREKGLRKEIVDLQELIKNSLKSRAAFLGIGMKSDKQLELEREI
                     TENKGEAERKRKFQELEERDIKRAKRGSRPAERIAKRQELRRHEKELEEKLEAREKLG
                     ELSGNRDRDNALLWVNSSALEQLQHTHYEGGKALKKTGKKKKRGRR"
     gene            complement(<268138..>268947)
                     /locus_tag="FOA43_002093"
                     /db_xref="GeneID:62195494"
     mRNA            complement(join(<268138..268865,268941..>268947))
                     /locus_tag="FOA43_002093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922397.1"
                     /db_xref="GeneID:62195494"
     CDS             complement(join(268138..268865,268941..268947))
                     /locus_tag="FOA43_002093"
                     /note="BUSCO:EOG09342SHM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778325.1"
                     /db_xref="GeneID:62195494"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF02630"
                     /translation="MARGEEDYTKMTIKRSPVEFLTWKSLVLFVTVGVGMTWLFKEQK
                     KKIELRKEAEMNRGVGKPLIGGPFDLVDMNGNRYTSDNLKGKFSLIYFGFTHCPDICP
                     DELDDMGEIIDGLKKKHHIEFQSLFITCDPVRDSPEVMKDYLADFHPEILGLTGTYDN
                     IKKCCKAYRVYFSTPRDVKPGQDYLVDHSIFYYLMDPEGQFIDVLGRNYDVNGAIEKI
                     KDDVRAYEPSEVRSKKKDGWFGFLYK"
     gene            complement(<269442..>270638)
                     /gene="OLA1"
                     /locus_tag="FOA43_002094"
                     /db_xref="GeneID:62195495"
     mRNA            complement(<269442..>270638)
                     /gene="OLA1"
                     /locus_tag="FOA43_002094"
                     /product="Obg-like ATPase"
                     /transcript_id="XM_038922398.1"
                     /db_xref="GeneID:62195495"
     CDS             complement(269442..270638)
                     /gene="OLA1"
                     /locus_tag="FOA43_002094"
                     /note="BUSCO:EOG09342BRQ"
                     /codon_start=1
                     /product="Obg-like ATPase"
                     /protein_id="XP_038778326.1"
                     /db_xref="GeneID:62195495"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031167"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF06071"
                     /translation="MPPKKGKHGEEEAKLLLGRPGNNLKSGIVGLANVGKSTFFQAVT
                     RSPLGNPANYPFATIDPEEARVIVPSTRLDKLYEMYKPPKKVPAFITVYDIAGLTKGA
                     SKGEGLGNAFLANIRAVDAIYQVVRCFDDAEITHIEGDVNPVRDLDIISSELRLKDIE
                     FSNKHLESVLKVAERGGQSLEVKKAKEEVEIVKRVIKLLEDGQRVANREWNAREVEVI
                     NSMLLLTAKPCIYLVNLSERDYIRKKNKWLSKIKAWVDEYSTGDAIIPLSICLEERLS
                     HLETDEDREVEEKKVGAKSALPKIITAMRKNLHLISFFTAGETDEVREWTVREGIKAP
                     QAAGVIHTDLMRTFILANVMKYDDLVELGSESNVRAGGKLLQKGKDYVVEDGDVIYFK
                     AAAGKS"
     gene            complement(<270796..>271805)
                     /locus_tag="FOA43_002095"
                     /db_xref="GeneID:62195496"
     mRNA            complement(join(<270796..271025,271208..>271805))
                     /locus_tag="FOA43_002095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922399.1"
                     /db_xref="GeneID:62195496"
     CDS             complement(join(270796..271025,271208..271805))
                     /locus_tag="FOA43_002095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778327.1"
                     /db_xref="GeneID:62195496"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MTLISEIQGKKPNELNKEQTVLVEFDKKNKEWFIEDPEEKQRYK
                     YQEILERWIPEEEINKSEQNEVSRLIKRQKREKVAEMKREKNVQKKPRKNRSVYISGL
                     SQNTTIEEVKEKFSRCGIIAQDLRSGEVKIKMYENKEGQFKGDCLVEYFKEESCGLAI
                     EILDGSKLRPDDKEPMKVSQAVFKEEAEEEEEEEKEEVREDIRQDILEGCQEIGQVDD
                     VIIYESEKEGIIRVRFKEKEGAKGCVKRMNGRYFGGKKLVAQLWDGEKYRIDDTTSK"
     gene            272045..272117
                     /locus_tag="FOA43_002096"
                     /db_xref="GeneID:62195497"
     tRNA            272045..272117
                     /locus_tag="FOA43_002096"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:62195497"
     gene            <272205..>273140
                     /locus_tag="FOA43_002097"
                     /db_xref="GeneID:62195498"
     mRNA            <272205..>273140
                     /locus_tag="FOA43_002097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922400.1"
                     /db_xref="GeneID:62195498"
     CDS             272205..273140
                     /locus_tag="FOA43_002097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778328.1"
                     /db_xref="GeneID:62195498"
                     /translation="MGNSGSKSVRQLGREVGREVSSGLKKNIKEDYLKKDDSKKKDYK
                     LDHPKIFTKRPEEDPEMDDVKRSKFFQEAIKMGIVKVEDKKVKRQYDGNNVSLELIKN
                     RKEMEKEYEDLMVSEEKIKYDIPKRFLSKEQIGRINKRRKKVSNTFGLIDGGDLTKLI
                     KTLKVEGQEAFEELGQEKESSKESLQLLKLFIERGLIDLPSNKVTLMRKVDVDGKISR
                     EKFVVVKDDWVKEARGIRDLEEPKEPKEPEEPKEPEDQGEPKKPEDPTDFKDLKYPKE
                     SEEILDQFKKLEDLIKDEKPKPKDKQNTHEMKRYL"
     gene            <274210..>274836
                     /locus_tag="FOA43_002098"
                     /db_xref="GeneID:62195499"
     mRNA            <274210..>274836
                     /locus_tag="FOA43_002098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922401.1"
                     /db_xref="GeneID:62195499"
     CDS             274210..274836
                     /locus_tag="FOA43_002098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778329.1"
                     /db_xref="GeneID:62195499"
                     /db_xref="InterPro:IPR024602"
                     /db_xref="PFAM:PF06148"
                     /translation="MTIVDPSVILLQNYKYWSLDDLSDGLDQLLKEVDGDLVDLVNSN
                     YLRFIDLGKSLDGSLDMTHDIKIDVANYIRRVKGANRQIDIDSKDIVEAVKYKRRLCI
                     LKRVTNIALLVDEQMETFIRINKRDEDDQLPLNHLTALYFSINKQYAEILKMINTGEL
                     ITTLSRKMSSLQMEFRSLVGDELKIEREKDDKERMFELIKLNEVIREE"
     gene            complement(<274918..>276279)
                     /locus_tag="FOA43_002099"
                     /db_xref="GeneID:62195500"
     mRNA            complement(join(<274918..275707,275870..>276279))
                     /locus_tag="FOA43_002099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922402.1"
                     /db_xref="GeneID:62195500"
     CDS             complement(join(274918..275707,275870..276279))
                     /locus_tag="FOA43_002099"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778330.1"
                     /db_xref="GeneID:62195500"
                     /db_xref="InterPro:IPR035189"
                     /db_xref="PFAM:PF17235"
                     /translation="MLGSRFFKDYSENYLTPREFQDKARKDINKHVQQIRERGGFETA
                     PRRKIPGLKRGPVRPYTGTGSTGPVGPVGPTGLIGPTGPMGSMGPMDPTPTNSIGSSS
                     NSNSLTMPYGSSPLRKAVSIDSSDASSIDSSSSQGTAPSVYANVARECAGASGSVGAV
                     TGPLTLAESLPKDFSDYYAQDFDVERFSNGRPVFTRRNLKSWELNDIRSLLIYPEMKP
                     EWFGKIPQVASPYPNLSFKLQVIPLQCTDEEFVQYLSESEIYRESKFDVQFRVTTAQY
                     IVEKARVRPRSILETNFGVPQEAFDSRTNLVGEVQYDAYFKFEWRNVIENYMLNLGIE
                     NQCRLEFKEQTNKFKRLNKHKVQYAGSEDLYKKVLVHNKATLNDETKTKIWHDVQKSV
                     YSRLGMV"
     gene            <277053..>277522
                     /gene="REX4"
                     /locus_tag="FOA43_002100"
                     /db_xref="GeneID:62195501"
     mRNA            join(<277053..277058,277130..>277522)
                     /gene="REX4"
                     /locus_tag="FOA43_002100"
                     /product="3'-5' exonuclease"
                     /transcript_id="XM_038922403.1"
                     /db_xref="GeneID:62195501"
     CDS             join(277053..277058,277130..277522)
                     /gene="REX4"
                     /locus_tag="FOA43_002100"
                     /codon_start=1
                     /product="3'-5' exonuclease"
                     /protein_id="XP_038778331.1"
                     /db_xref="GeneID:62195501"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="PFAM:PF00929"
                     /translation="MDPRHSVTDWRTWVSGITPKSMKKAIDFEDAQKLVTQIIKNKIV
                     VGHDLKHDLDSLCLNHPKYLTRDTSKHPPFRHKYSAGKTPSLKKLTKEILHQDIQTGQ
                     HSSVQDAKATMLIYQTDRLEFERLAKIHYS"
     gene            complement(<277567..>286044)
                     /locus_tag="FOA43_002101"
                     /db_xref="GeneID:62195502"
     mRNA            complement(join(<277567..285929,286038..>286044))
                     /locus_tag="FOA43_002101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922404.1"
                     /db_xref="GeneID:62195502"
     CDS             complement(join(277567..285929,286038..286044))
                     /locus_tag="FOA43_002101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778332.1"
                     /db_xref="GeneID:62195502"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="InterPro:IPR036865"
                     /translation="MLQQKVKREQRASGKTSTGQASTGQAAQSTRQSLRAHQSQASHG
                     AHGAHGAHGTHGTRESPRESPRQHGERASGGIPSPVGGVAASPVVEVGPPVVLGGSPV
                     VLAGSPVVSGAPQAHPPVAFISSICSRIELSLPLRSGYTLGQLDVDPSFSQARSHLVH
                     LATLSYLDSTLVQLFDLLKRIIDTTTDRNSIPISILRSIYVVLDIVLSIINALWDSAV
                     NNIPSNVKIYRDFGINAAPSLVNSAVYATASPKPVQSATVASLLPLLVDIRTDQAIIL
                     QLDSISDSPTTSAVAASLSMHFTDPTRAWLINSIDSTVSSICKYLAASNPDEFYAFLR
                     SKFHLLNIESIYIPSVDLFGMICLQNDNFIAHLGLIADIIKVSRRQSQIALLLSYFAD
                     GIFCWATYRTSDFLQAQSLEAVNHSVDPLFDLLFRSLDFKFYHKAATNILASMLLLLP
                     QQFTKYLDSEKPQKTTFGLKKPAVFKATTCKQRFILDFVHVLQHHPTSAPFLTRLMLV
                     GCIISTYDASNPVATFTWHILDGIRSDLVLAEAGDPSIDLPVDGHLLLGLQRDLFAIS
                     MMMDPVSVTKRIVKLGSHSKSAVRQWLPVVGGLRQLIEIPVLSVEMFPYLQTASPVIL
                     QVIHSLAEDTDVNNDAPDDLATSETTTNDSTPNDNVGSSVISLDEALKTDSNSITGTT
                     KRLTRKMKESIIGSTTSMPSSSASIQVNSSTSIAGEPSVISSHSMKSSASVVSSVYSM
                     PEAARSVLSDSFHIYKICPFMFYTYSVDSSHPTDYVALERTYIPFLAPISLLLVDSDA
                     DLSSSVEAFLLSFPLTIANDSSSASLLGYLVSAIAVDSVCQISVLPTIDQAQREHLIK
                     LISQLVNLVSRYTSTEKLVDSLNDEQVRKYHLSGGCNRLMNNFERALFLGLLSDSVDT
                     IRVSRRLLQAYLMIISSEFHLRMCFSHDNLPLVKNIIRGKLPTGRLAIRKKLRDHMCT
                     LMEPTSTLLDVWNIIYSKISSASHIEEVMEGQNELDLLDSLDSNAFVTSDDYGEYVAS
                     LGGIIMAPSFASDSRQPSLQHKLMMFLDYSLLSLFSSDAKRREHSREVLCVSVHPLLC
                     GLILDLVEKHLERFESALSKKQYNLCELYINVLRAICQIDVSNGLFFHSTQLWSINCR
                     LLSLMNFVVSRPGFLRLKLKFCKLQVMFLSKIDDLSLRGNIFKKNEYARIAANYLEDS
                     FEVPPDEDVESESARATSGKVLSFGVGPSKPLYTALQLEELQDLHLNIKVEASTMLKI
                     VFHRLPLDTPIHSAKEDKLAAGVIFSNYFNIFVRILERMNGPNTNGSKPQQASTALPQ
                     SLASSLQMQSIIHNVIQALVNLLSSNSEIGLNYSLPLGYHHDSLIRVSFINVFSKIIQ
                     DVYAPKIDVAKQSLQKLSRILFFGKPALLLSAVEVCPRSEVDAFANALLQVTDNEQKK
                     LSILTGLLRFEILNVGHSVEILRSNTVATRMVALYSRSEAAVYIVKTLRSPLEELVES
                     GEYFEIEKMDSLNDQEKMYNVELFMKYLKLVVDSISLSLEMIPHGIRVISKVIFDTAS
                     VHFPQSKYAALGAYLFLRLYNPAIVSPDQAKIVESNDVRFKRSVIQIARTLQMLVNDV
                     LPTSKFPSLRSKAGEIAEMNRQIAQFMDFVVAVEDDDPADVQVEFNYNAGIRFFHTFF
                     YDHWMEIRSKYSLKGGGKLYEDSKEDKIKNIKQVDSLLCVLGLPERIKGYQIPVSIKN
                     DKSEKGILLYDFMSRSSLKDSNPGDSLRVLATKDGLPLVVVRLAQVPENLSNDTMIYR
                     LIQSLSGYWEQPYCFLIDCTGYTDVERFDSLFSLYCSLIPPAFRINCKRTYYFNVTPQ
                     FYRCLRAFGYSMPDSIEFRFLSSDDDSKTIMTSGLVSYSNQVSNDARVVFHDVSLYQA
                     EARRFVPVKLKVGNRYVQIFSGQPQRLKLGSRMRLVKTVEVYKVRDMDEIAASNITGV
                     FNELSMVNSATGERLILASPKKVEIMRTLYFSRARNYQEDISDESQESGEMSLELSIG
                     KLINMSFSGLLYSSDSIRNASFALLASLTKLFHFSVGRKIETVDGVTFPFGEVNYISS
                     VSAEMAKNHPTLTYAVLRGFFEAFDDASLQNKSSIVMYIGPWIKNLYKYVYLANSSKG
                     PARTADLVCRFVRSSRDSMRVTQAFMYFIWSQISLEDQLVEVIINEIVAAAIDHEAEG
                     HNWTEITRFWPLTPTIEVCSFLLRRLREKSYTLSINESEIEVHTTWIETTVMARFLAY
                     LVFDSLLFVQTFLSDIFYVATIYMDCGPLEMRRCMSNLLIRTFHSYLSHEGLSEKQRD
                     SIRSQIELLNGARFRMLFGLTREDNDEMFNQTSLPGGEMINRANAVSTLCDLLVGFIK
                     SFSSVEDCELKLIKCSSYVMNVAFDSNSQLQGQAILVLGSLTKEGIDSILVGRFLGLL
                     LETFDRVTSSIGQSKKHFSLLICVMHAFSRALDGVRSDSSFLPRFFWLSYSMLFLDNA
                     MFYYYGLKFLRSILTKMSEHLEKLRKEEPESKAMTIGDYVNKYRDAFDPVLREYEALN
                     GITFSTRYFDAIMVCLCAKGLTVPFCHRSSLETMETLLKVRYAEGAPGYSTYLFYIYI
                     MSSSNEEMVETMKRCGVSSDSPMYTFSMGTKMPKVVSEWYSMSSPNAIACCLSALKYF
                     RSQKVNEVTSSRALMLFGAMEEQRPDQVYGLWDEFSGVLQGFIENSSTTYLLEMSLDV
                     VSKMMENTESEKHDEYQKNAWKTLEDADLMGLKELGFSSEDTFNGDMSEEAFETLKKR
                     SSYISKMIGTLRTLSVQDE"
     gene            <286149..>287910
                     /locus_tag="FOA43_002102"
                     /db_xref="GeneID:62195503"
     mRNA            join(<286149..286152,286445..>287910)
                     /locus_tag="FOA43_002102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922405.1"
                     /db_xref="GeneID:62195503"
     CDS             join(286149..286152,286445..287910)
                     /locus_tag="FOA43_002102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778333.1"
                     /db_xref="GeneID:62195503"
                     /translation="MDIDQFFDDQNIPETGWTPYINKIFGSTTPSNAAASHRASPSQH
                     RGGDARRRISRVSTPGAGVASANTAASTASVTSASAIASDILYGQSTRLFSSPHIDPS
                     WTSSFQPPQESFSSLRTPIADKSFRVSDYLFDTPSFLAQAEEIYPDKENDPMLGAFST
                     PSSNKTFRFFKTPKQAAFGGGPAGPPGTSALGATVPAVPAVPAVLGAIGAAGAVNGIY
                     AASSSYGGFSGNLSGLSASGFSSALAASLSASPTTSAFIYKTPMKRSALSNIDPNIGV
                     ADAASVNVTKVDTDAAAAAVAASSTTNTANAANLDSSPSTILLTSTIKKEAGNKLNSI
                     ENSPTPATKSHLKKPPCQLVRSNSALEPAMGLFHDGVDSRQSGARSSQLPVMATFNST
                     NFATGSRKRRNAGHLAAGNDVGSKFQIIFADMNTLRASYSGRGGKKSRKNSKKSLSRY
                     KTVPTMLPSSASLKVPLKVPPEVPPEEPLEEPSRKQRRG"
     gene            complement(<288111..>289221)
                     /locus_tag="FOA43_002103"
                     /db_xref="GeneID:62195504"
     mRNA            complement(join(<288111..289141,289197..>289221))
                     /locus_tag="FOA43_002103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922406.1"
                     /db_xref="GeneID:62195504"
     CDS             complement(join(288111..289141,289197..289221))
                     /locus_tag="FOA43_002103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778334.1"
                     /db_xref="GeneID:62195504"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="PFAM:PF00241"
                     /translation="MSSQSGITASQSLLDSFKQFTLSNRRFFGMRIVGESIEAVNEFD
                     SVGSDCGRSLSHDFDSLHTRLSDTDPMYLVVRRSDVSNGAAYIFISYVPDAARVHDKM
                     IYAASKNTILRNLGSQRFQPILFINSANELSGEGWRQSEISERAAERPLTEAERSLEK
                     MRRDEAVLTGTRKQRLARNEARGVSFAVDAGLKRALDEITAGRNVDGGEGGESGECGS
                     GFLVTALIDGEELKLAAQTTFADIRRNLIKALKSDEPSYNVVLWNGRYFFIYCCPSGS
                     KVRDRMKYAANRLAFSKSIEQTGVELKVIEVGDPDEIEMSVFEAEDMEVKQDELRERG
                     GKVGGLKFAKPRGPRRR"
     gene            <289726..>291402
                     /locus_tag="FOA43_002104"
                     /db_xref="GeneID:62195505"
     mRNA            <289726..>291402
                     /locus_tag="FOA43_002104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922407.1"
                     /db_xref="GeneID:62195505"
     CDS             289726..291402
                     /locus_tag="FOA43_002104"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778335.1"
                     /db_xref="GeneID:62195505"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="PFAM:PF00536"
                     /db_xref="PFAM:PF07647"
                     /translation="MALLSPPSSRYAFEPSLTTSAIPPISVNSSAASAASATGSASVS
                     ATSTVNGGPYDMPPFEPKTQALLQNFTVDLRTFTNWISNLKLEQQKTVMDVFLDSLPD
                     AVVKYVYEKAANAAGSADLNSANVAAAGAAGTAGTIKFSPPMSSAPIQPRTRPVSPLL
                     MLNGDSFGGPGSAEAANSPLFSSILRSPRLTAIGSPAGISSPSGIASPMRIGSPVMAS
                     LMEFASPIARPQSAGLTHTSNTANAAGAPGAANPAIGAGSFYNNRANAAANSFYGGAI
                     SPLPTTPSAQPLFRVFSSDLDPTGFQRRTRDFFEDGSNADVGAQQFGLTSTTDFAGQN
                     AFKLNHSLKTITRKQPLQSQAPQAPQPPQGPLQSQLVQRTVPQSPTGISDGGGGGGGD
                     GGREADPLDSNDRGRAGLAGRSTTGIQTAHSALARAGQSLSVPPISRLKRVEHSSIES
                     SGVGVGAGRAATSEEAPGGASGGISISPPSVVKSAAPQDIASRRLLENIPLWLKTLRL
                     HKYTENLKKLQWKQMIELSDSQLEQLGVSTVGARNKLLKSFAYVKENLHE"
     gene            <293551..>294108
                     /locus_tag="FOA43_002105"
                     /db_xref="GeneID:62195506"
     mRNA            <293551..>294108
                     /locus_tag="FOA43_002105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922408.1"
                     /db_xref="GeneID:62195506"
     CDS             293551..294108
                     /locus_tag="FOA43_002105"
                     /note="BUSCO:EOG093440XY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778336.1"
                     /db_xref="GeneID:62195506"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR017453"
                     /db_xref="InterPro:IPR033753"
                     /db_xref="PFAM:PF01597"
                     /translation="MISLTRTSCQLLKRSAIAMARRPMVLRLPSSARFVSTSANKLNP
                     KSIVSTYSDGPVSLKFTPEHEWVSIHPDGTTFVGITTYAADALGDATYIEVPSDLLNE
                     QVTKGDTIGSVESVKSASDIYSPVDGEITDVNDALEDKPAMINEDPMGDGWIAKIKAQ
                     DGFKGDELLSEEEYVKLLEDAEDEQ"
     gene            complement(<294220..>294621)
                     /locus_tag="FOA43_002106"
                     /db_xref="GeneID:62195507"
     mRNA            complement(<294220..>294621)
                     /locus_tag="FOA43_002106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922409.1"
                     /db_xref="GeneID:62195507"
     CDS             complement(294220..294621)
                     /locus_tag="FOA43_002106"
                     /note="BUSCO:EOG09344HKP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778337.1"
                     /db_xref="GeneID:62195507"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="InterPro:IPR036065"
                     /db_xref="PFAM:PF01722"
                     /translation="MAFSSSKRVHSELPEAPGCGHHESSEVKEKVEDRREVGPIEKSI
                     VDKIQEEFHPSHFEIRNDSWMHQHHRAMQGAKNMKESHFSMVIVSDKFRELKSLPSRH
                     RYVYKVLEEEMVNRGVHAIQMKTKTVEEFTD"
     gene            complement(<294869..>295660)
                     /locus_tag="FOA43_002107"
                     /db_xref="GeneID:62195508"
     mRNA            complement(join(<294869..295641,295657..>295660))
                     /locus_tag="FOA43_002107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922410.1"
                     /db_xref="GeneID:62195508"
     CDS             complement(join(294869..295641,295657..295660))
                     /locus_tag="FOA43_002107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778338.1"
                     /db_xref="GeneID:62195508"
                     /translation="MVKQAFNDDDFKSKAKEAYQSFGSGGNKNDSNSGNSNSYGNDET
                     YGTSLNDKERATNNDSYSNRNDNSYGGSLNDNERTNNNDSYSTRNDNSYGTSLNDKER
                     ANNNESYSTRNDNSYGNESNDNERTNNNDSYSTRNDNSYGNESNDNERTNNNDSYSTR
                     NDNSYGSSSNDNARSNNNDSYSTRNDNSYGNESNDNARSSNNDSYSNRNDNTYGSNMN
                     DSARSNNNDSYSNRNDNTYGSNMNDSARSNNNDSYSNRND"
     gene            <296336..>297571
                     /locus_tag="FOA43_002108"
                     /db_xref="GeneID:62195509"
     mRNA            <296336..>297571
                     /locus_tag="FOA43_002108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922411.1"
                     /db_xref="GeneID:62195509"
     CDS             296336..297571
                     /locus_tag="FOA43_002108"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778339.1"
                     /db_xref="GeneID:62195509"
                     /translation="MTSTSTSIRFLEKRFHEVTGDDSSFWSVFVEPLSAGWILRTREK
                     DTISLPIKTQFWVKRVKCHGDERAREMVGEAINVVFGQLNVEHADTIIELDLDQDQKK
                     VVETWLLFKRTMYNGIVTWVNDKKIQPTEEILKAKLILENLEKDKLCFGIYTALRDSV
                     VKEFLRDYQTTKQECEITKIPFSMKASKKKTGSKLLILNSMWNQCNGFFDTVLNPTKL
                     SPSQSLPKVFPGNTFLICKSSKYYLQIPAFGQKQSLKLHAKENSYVVLNPGKDNFSTC
                     IGSDCYITIFGGEGFTPDPSESMYNKVARYLCEHYDHIFVPMEEYQQQFLNILRDKAG
                     QFKQLTTVTMVERCQLPFTCSSCGNIGKAIEEGQIFACHRCRLQCSSEENEAKNSLLR
                     QINPYVSQVVKEVLDEYGN"
     gene            <297810..>299576
                     /locus_tag="FOA43_002109"
                     /db_xref="GeneID:62195510"
     mRNA            <297810..>299576
                     /locus_tag="FOA43_002109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922412.1"
                     /db_xref="GeneID:62195510"
     CDS             297810..299576
                     /locus_tag="FOA43_002109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778340.1"
                     /db_xref="GeneID:62195510"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF12894"
                     /translation="MASPNHRIVFGNTSPNLINQSTNSIFNGKKLKSPDFKVVDSDWT
                     SLPPPSATATESTLSSANFQKLSLRHNSHSGSSQSGSKSRSRSHSRRNSRSSLNFLFG
                     SIDKDKSVGKDTRSELLTLPHNRHRSHNDIFETRSNGNTSPKRLRRSNTSELLDRFIP
                     SRHTTSGKMSLGDVDLKSCALPIDHLACQTSKIYQNTVAEACGLEVGERILQFQPCMP
                     EREVSCTTATGTTTTSGVNMSTSASNSTTNAFGGMLSASAVQSRLKKMPTCPQKVLDA
                     PCFVDDFYLNLIDWSNSNVLAIALSNSVYCWNAETGDIDQLTESSCPICSVRWSEDGY
                     YLSVGLEDGSIEIWDVETSEKLRSMLGHDSRVSSACWNQHLLTTGSRSGQLFHHDVRI
                     QQHQVADLVGHTAEVCGVEWRSDGLQLASGGNDNVVNIWDARASTPQFTKTAHTAAVK
                     ALAWCPSHTSLLATGGGSACKKIHFWNTATGARVNTIDTESQVSSLRWGYSNGIGMEI
                     AATHGFPNNDISVYAYPALQKTGVVIDAHESRVLASCLSPDGTTLATVAGDENLKFWK
                     LFDYVINKDDELTGKGMNKVIR"
     gene            <299816..>300595
                     /locus_tag="FOA43_002110"
                     /db_xref="GeneID:62195511"
     mRNA            <299816..>300595
                     /locus_tag="FOA43_002110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922413.1"
                     /db_xref="GeneID:62195511"
     CDS             299816..300595
                     /locus_tag="FOA43_002110"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778341.1"
                     /db_xref="GeneID:62195511"
                     /db_xref="InterPro:IPR016181"
                     /translation="MAKVEILTFKDYKKAARTLLKAFDDDNVDRYLTRHLEDQPELKE
                     KCDLLLYEAYVYSHMLKGMVVGVKGDDSENKDSFETVSIWVTPDTRDIDDYITMLRSG
                     YAKLAWLTGAEGRRRVFHDMFRTLAENLDDIMAVDPDRDNMWTLVYLGSTPKARGHGN
                     VRAIMDYMFKNYIDPKDSITYLESSALRNVPIYERFGFRCVADEWLGDKNATIDKARM
                     DVMIRGPKGKKWKFLEETRKRRGYVIPDESGEEVGKQEVTK"
     gene            <300658..>303027
                     /gene="RCD1"
                     /locus_tag="FOA43_002111"
                     /db_xref="GeneID:62195512"
     mRNA            join(<300658..300663,301861..>303027)
                     /gene="RCD1"
                     /locus_tag="FOA43_002111"
                     /product="Cell differentiation protein rcd1"
                     /transcript_id="XM_038922414.1"
                     /db_xref="GeneID:62195512"
     CDS             join(300658..300663,301861..303027)
                     /gene="RCD1"
                     /locus_tag="FOA43_002111"
                     /note="BUSCO:EOG093435L1"
                     /codon_start=1
                     /product="Cell differentiation protein rcd1"
                     /protein_id="XP_038778342.1"
                     /db_xref="GeneID:62195512"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF04078"
                     /translation="MKSQLQPQLQSQLQSQLQSQLQSQPQSQPQSQPPQQPNNLLLSQ
                     QIQAAAAVAAAVNQQQGHTKMSPMATFSTPGAGGVPVPTGPAPLMTQNGSSNRTSSTN
                     TPVAAPVITAKQSPSPVKALNDEKVYSWIMELAYGPNKEQALLELGKKREYYDDLALV
                     LWNSFGVMTALLEEIVAVYPYLSPPNLTTPASNRVCNALALLQCVASHPDTRTAFLNA
                     QIPLFLYPFLNTNSKQRPFEYLRLTSLGVIGALVKNDTPEVIQFLLTTEIIPLCLKIM
                     ESSSELSKTVAIFIVQKILMDNSGLAYVCQTYDRFEAVSNVLKLMMDQLVANPTARLL
                     RHVIRCYLRLADNPDARVALKERLPNSLRDDTFETVLADDTASKNNLSQLVYAIMQ"
     gene            <303213..>306047
                     /locus_tag="FOA43_002112"
                     /db_xref="GeneID:62195513"
     mRNA            <303213..>306047
                     /locus_tag="FOA43_002112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922415.1"
                     /db_xref="GeneID:62195513"
     CDS             303213..306047
                     /locus_tag="FOA43_002112"
                     /note="BUSCO:EOG09340H16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778343.1"
                     /db_xref="GeneID:62195513"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="InterPro:IPR032154"
                     /db_xref="InterPro:IPR037067"
                     /db_xref="PFAM:PF01602"
                     /db_xref="PFAM:PF08752"
                     /db_xref="PFAM:PF13646"
                     /db_xref="PFAM:PF16381"
                     /translation="MSTSTYKRFEDPESGSLPDKMTVYQECLQAFNASPIKAKKCRAL
                     LSRLLRLLYNGETFQKTEATNLFFSVSKLFHNADPSLRQLGYLAIKELCSISDDVLMI
                     TASIMKDIQGAEPVFKPDAIRTLSRVLDGSTIHAAERAMRNCIVDSNQAVCSAALVST
                     YHMLPVARDVVRRWANEAQEAISASKTLVRSPYTTHDNFGASARLPQSTYFHQYHALG
                     LLYHLKKQDRMAMLKLIQQLTSRQSLQSSFAVLQLVRYVASMLQEDTSGQLAQQFWPL
                     FNSWLNNKSEMVELDAAKVVLAPSSRFNQEQQLKAITTLQELLSVPRTVTRFSAVRLL
                     SRVALADPEMVRACNSDLESLVNDPCRSISTYAITTLLKTGNAQSVDRLVKTIAGFMG
                     DISDEFKVVVVEAVRTLTLKFPEKHSSLLVFLGDALRDEGGYNFKNSVIEAIFDIVKF
                     VPDAREAALELFCEFIEDCEYTELAVRVLHLLGEYGPKAKKPSLYVRHIYNRVVLENS
                     IVRSSAVIALSKFALVGDKQLTASIRILLQRCLQDVDDEVRDRTALSLRLVEGAELKS
                     STRARALLQPETRFSLAALEQQLCRYVRSKDKTSFSQAFDIKVVPRHTEEEILATEYK
                     AKIAVEDDMASMSTQAKMETITSKNEAHILSTEGGRSSSKPVAASDLAARSNLLQQQY
                     SQELSGIDEFQDYGLLLHSSGVVELTERETEFIVTAVKHVFKEHIVIQYNVENTLKDI
                     QVEDVTVMTQLDTDDYKEETAVPAAMLKPDSSVCVYVSFSRPADHRMVLATMTNSLAY
                     VSKDVDESTGEPASDDEGFPDEYQIEDLAITPGDFVTPCFTGSFTSSFDGLNNEEVAV
                     YNLGRSEENPLAKVVKRLSQSMSMTPLEGSDMVDSSASHTLKLFGKSINGDKVAALVK
                     LVSSSKGVMMKTQVRSSDSELAQMLANQWE"
     gene            <306853..>307435
                     /locus_tag="FOA43_002113"
                     /db_xref="GeneID:62195514"
     mRNA            join(<306853..307378,307395..>307435)
                     /locus_tag="FOA43_002113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922416.1"
                     /db_xref="GeneID:62195514"
     CDS             join(306853..307378,307395..307435)
                     /locus_tag="FOA43_002113"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778344.1"
                     /db_xref="GeneID:62195514"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="PFAM:PF12400"
                     /translation="MSILGGHNGGYSDRASTSAYYLKKPPELYDNPCDYYFLNILFDT
                     TIGIPILWGLLYVIYRLAQKSGIEGIGSGEYGSPAKIGNYFKQLGLYFVGLLSMKLII
                     YITLILCPFLVHFAVWILSWSDSIPNIQVIFVMMIFPLIMNSFQYYVIDNIIQSPQYY
                     KTNRKVMEEGLEGNEFDGIQSDHNDNTK"
     gene            <307676..>309304
                     /locus_tag="FOA43_002114"
                     /db_xref="GeneID:62195515"
     mRNA            <307676..>309304
                     /locus_tag="FOA43_002114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922417.1"
                     /db_xref="GeneID:62195515"
     CDS             307676..309304
                     /locus_tag="FOA43_002114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778345.1"
                     /db_xref="GeneID:62195515"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR018299"
                     /db_xref="PFAM:PF00245"
                     /translation="MPTKGSAKSPYRGLVISLSLLLVAFVLWFSTQLAAAAQWPQGTP
                     LDLSSPFTSKKNIIMMVTDGTGPASINMARSYRQYRDNLNYDDLLELDKHFIGSSRTR
                     SNSSLITDSAAGATVFSCGLKTYNGAIAVDPLKNPRGTILEALKLKGYKTGLVVTTSI
                     TDATPAAFNSHVDYRFMQSLIANQQLGFNTTLGSMTDLMIGGGRCFYLPGNSVGGCRD
                     DNRNLIEEAQKLGFNVATSKKEFDSWQLGQNVSLPMLSLLAYYNIPYDLDRDEEKYPS
                     LEEETITALNVLSNSTRDSNQGFFLMVEGSRIDHAGHQNDPAAQVREVLAYDKAFKAV
                     IDFADSSDVPTYIVSTSDHETGGLDVGRQITKSYPDYLWKPDVLDNATHSGEYLTQRV
                     HEFAASTKDAGQLTNFIEKQIFEFGLGIYDYTFKDVQKAIEYKESLELGNYLNEMVSH
                     RAQVGWSTHGHTAVDVNIYAHSNTEEGQQLLHKYLLGNHENVEIGQFWQTLCDVNLDD
                     ITHKLRGTVHNVDVEAAEEHSESLYGHEMGSVEW"
     gene            <309516..>312533
                     /locus_tag="FOA43_002115"
                     /db_xref="GeneID:62195516"
     mRNA            <309516..>312533
                     /locus_tag="FOA43_002115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922418.1"
                     /db_xref="GeneID:62195516"
     CDS             309516..312533
                     /locus_tag="FOA43_002115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778346.1"
                     /db_xref="GeneID:62195516"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR032675"
                     /translation="MKENNAKEIVEHFERLAAEATGPRSATGPKSETVIPKEKSEGEM
                     NNSVPIDTVHTDDCIPAGPPKLVNKYILNKNFNEPSPERDGSFGDNSSDPSFQEWMPE
                     VLKGQRWGKIDSEGNSSDYTTSPGGDGAQVLDENPYLSVNAKTNTIVKNSELEVEGQD
                     EAEWRKYKNDEFVRHLNANNFKGSNIDGGFVADTFAKKSKGGSNSVLSESFTPRSPLK
                     LFGDRHDTYTKGKLKNILGYVNKGSKEGEEEQEAEGDEKINHLLQSADSIYNKVVASA
                     RAATNPDESNSMTYTDEEYTSDADEFNSERSGATFSANAYYKNGDNILKNLKRKFSQP
                     LPKPGSEISDYTSDEDELKTTMASASASASASAVVIKQLDEDPDLTPSLELLQKQFNI
                     SMSDLGHSIKPLTMPRIQEDKDDEDSIKTAESSPKYRGLNFISAEDYKDKVFDKKQNK
                     YVTKEQYAQLYGGDISDRSNDDVFSGVSETIQKTPGILKHDTGVRTPREVSFKLPDEP
                     SNLSFSQTNAALVSAITETYPEEDWDYVEQLDISGKGLDKLRELKRFTPHLWLLDASN
                     NDITHVEGVPEKVQIIKLNRNKFGSLASFELSNLQVLELDENVLENLSGLSSLTNLTK
                     LSISSNQLTDISHLQSLRMLRYLNLGNNKLKGTINFANYQMWLLEDLIIDDNEISGLV
                     GIESLPNLVYLSANGNPNLHTLSCQGVKHENLKRLSINSTRLSELDLSRFPNLMRLSI
                     DRTEIQRLEGLGKYLEKVSFKYQSSSENATLSILKNSLDNENLRWVKFTGGSVKFGFP
                     AHRFSSITKLDISATGLNTLPRRFGEMFPLLTDLNVNFNNLENLKGVEGLHQLRKLKL
                     LGNSFNRMEDIFNYTESLRSSLELLDMRVNPVTKGFYPYVFYDPETGNENEDETLNNG
                     ETTVTTLNLKDYDDIEAFSVEYERLYTKEMLSKWNNKNDLYENKQSTTSSTQKQEYQM
                     EAIVWFYTIRYLDGLKIDSSRRVQEYKRFTGVQ"
     gene            <312650..>312865
                     /locus_tag="FOA43_002116"
                     /db_xref="GeneID:62195517"
     mRNA            <312650..>312865
                     /locus_tag="FOA43_002116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922419.1"
                     /db_xref="GeneID:62195517"
     CDS             312650..312865
                     /locus_tag="FOA43_002116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778347.1"
                     /db_xref="GeneID:62195517"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="PFAM:PF14880"
                     /translation="MTSGYPWYTRATDIAHRVTVLSLVGFTLYMSGAVVYTLWSTGKE
                     NEKRLTIEKTRRAAIAEQRKLDETESK"
     gene            complement(<312890..>313744)
                     /locus_tag="FOA43_002117"
                     /db_xref="GeneID:62195518"
     mRNA            complement(join(<312890..313690,313739..>313744))
                     /locus_tag="FOA43_002117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922420.1"
                     /db_xref="GeneID:62195518"
     CDS             complement(join(312890..313690,313739..313744))
                     /locus_tag="FOA43_002117"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778348.1"
                     /db_xref="GeneID:62195518"
                     /db_xref="InterPro:IPR027799"
                     /db_xref="PFAM:PF04641"
                     /translation="MGNEGGTIPSRSEILNFNEQKLEGAEKARNVSDKQLQLYELIGS
                     YGYCRLSHKRLCKPIVSDYRGQLFNKEAILEFLIGSKANDDQFGYIKSSKDIVELNID
                     YDEDKGEIRCPISGEIYDLSDENDVLSRLRLCYIVPCGCTMNRVILDQLVDVEYDKQG
                     IKKQTNGPIIQFECPVCMISARSRDIVDINSSDRAVRKQLERRMKLLEQEGLTHSLKR
                     RRTRLKGKVAKKRKHTSSRSAHDRNTRDRNTRDVKSPHICFSSTEPQYNN"
     gene            <313951..>316860
                     /locus_tag="FOA43_002118"
                     /db_xref="GeneID:62195519"
     mRNA            <313951..>316860
                     /locus_tag="FOA43_002118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922421.1"
                     /db_xref="GeneID:62195519"
     CDS             313951..316860
                     /locus_tag="FOA43_002118"
                     /note="BUSCO:EOG09340834;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778349.1"
                     /db_xref="GeneID:62195519"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /translation="MPSSRSLSNSLMALSQSIIEEKGQFYSDKVQWSYSFDTSSSIDN
                     NWKKIPLEINSSGELKAHGNVVIVSHIQQCSVNIFPKNLVLKVGITSQKVLYFKLPDT
                     KVYLELLSCFMTWQNLRPEGILAKWNFDKSIVYDSNLRANDVLVCHFRVYGPLPNNKK
                     VKPLTDLPAMRMYPLDSKSISDRPTEGWFVAIGHLLPTGILNLLCESDGSLLYSINVT
                     SLFSSEIRHVHHSVSQASNVLFLGVINELRTLRCVTDDFNSNGSFIVTNPNSTKRLAH
                     VSRILIDFDLRIDLEDWFVALTSVTSLEYVGRTLTKKRLRIMRDAKLEIMEATFEKAS
                     EQNIYCELRMWNGPWFRTSVVKSSPTSGCFWKESTDLILPPGTEYFKILIRASKSHEE
                     YDVGGVDTDNTIGACFITPNFFAENQFLTKVPIFNADNTVLGQLTINLSIDETHVLPY
                     SAYRVFEKMLMNMDIGTLLDFISPLTDSSSLDSWSIMLLDVFQTLHKEHQFFSSLMKR
                     ELAPIDSITRNNRISSRHGTPDPSSAIKTTLTSPTFNTIFRGNSMLSKSLEKYDIRVG
                     QEYLEKLLGSFIQQVVDEDVNCECDPKTFPDTYREHYANLLRYLEILWHRVYITSNDL
                     PEEMKLEWKNLRRNVELSVEPNDTETPLNALSAFIFLRFLCPAILNPQLFNLMRGHHS
                     GNISRTLTLIAKVLMVFANRSYFQQHKDPSLLPLNKDFIDRHQKEIVVYFDRVTGCKM
                     DFNEKILELSNLKDRLSLNASKEVLNELPTMPYLIDKYLNLAKLAQILYDKGPNDKSK
                     GTNGEQLLGFDDSELGTGEFLKNLLDDNDEEFNNILFKRDFSIKELSDQASILIEKTM
                     SLDKDLEEPECPSQFDEESWRIFVESNLAAARLTEQDNIVYDPFVAHNGALGKDDRTL
                     DAFLNFMTKSQGIFSGAGGENNRKKLMTAMKIPAKQDADHSRNPFKKLFRRKTSH"
     gene            complement(<316896..>317816)
                     /gene="SEC14"
                     /locus_tag="FOA43_002119"
                     /db_xref="GeneID:62195520"
     mRNA            complement(<316896..>317816)
                     /gene="SEC14"
                     /locus_tag="FOA43_002119"
                     /product="cytosolic factor,
                     phosphatidylinositol/phosphatidylcholine transfer protein"
                     /transcript_id="XM_038922422.1"
                     /db_xref="GeneID:62195520"
     CDS             complement(316896..317816)
                     /gene="SEC14"
                     /locus_tag="FOA43_002119"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG0934387Y"
                     /codon_start=1
                     /product="cytosolic factor,
                     phosphatidylinositol/phosphatidylcholine transfer protein"
                     /protein_id="XP_038778350.1"
                     /db_xref="GeneID:62195520"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="InterPro:IPR036273"
                     /db_xref="InterPro:IPR036865"
                     /db_xref="PFAM:PF00650"
                     /db_xref="PFAM:PF03765"
                     /translation="MTLTKEEETLWNSIPQKVKQPELNQTGYPGYTTKSEESALEQLR
                     MILEAEGYTERLDDSTLLRFLRARKFDVMLSKKMFVECEKWRREFGTNTILDDFKYVE
                     KPKVARFYPQYYHKTDKDGRPCYYEELGAVNIPEMYKITNQDRMLKNLVFEYESFAKH
                     RLTACSRQAHFLVETSCTVLDLKGISVSSIYQVIGYVRAASNVGQNFYPERMGRFYLI
                     NAPFGFPTAFRIFKPFLDPVTISKISILGSDYQAELLKQIPAENLPSKFGGKSEVSDS
                     DGGLYLSDIGPWRDPKYIGPEGPAPQPIIH"
     gene            complement(<318001..>319401)
                     /gene="MAS1"
                     /locus_tag="FOA43_002120"
                     /db_xref="GeneID:62195521"
     mRNA            complement(<318001..>319401)
                     /gene="MAS1"
                     /locus_tag="FOA43_002120"
                     /product="Mitochondrial-processing peptidase subunit beta"
                     /transcript_id="XM_038922423.1"
                     /db_xref="GeneID:62195521"
     CDS             complement(318001..319401)
                     /gene="MAS1"
                     /locus_tag="FOA43_002120"
                     /note="MEROPS:MER0043985;
                     BUSCO:EOG09341XAK"
                     /codon_start=1
                     /product="Mitochondrial-processing peptidase subunit beta"
                     /protein_id="XP_038778351.1"
                     /db_xref="GeneID:62195521"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="PFAM:PF00675"
                     /db_xref="PFAM:PF05193"
                     /translation="MLRLLGPSLKTTLCLRRNLATAAIPTTKTTKLPNGLTVATEEIP
                     NSLSATIGVWIDAGSRADVSDKTSGTAHFLEHLAFKGTTNRTQLGLELEVEDCGSHLN
                     AYTSRENTVYYAKSLKEDIPRAVDILSDILTRSKLEKLAIERERPVIIRESEEVDKMY
                     DEVIFDRLHEVVYKEQPLGRTILGPIKNIKSISQPDLKNYIKTNYKGDRMVLVGVGCV
                     NHDDLVELAKKDFGLVPISEKALPLGTPRGALPKFCGGEVKINERSLPNTYIALCVEG
                     CAWSSKDYFKALVAQAIVGNWDRATNASPTPLAKSVAQGVRGNQDEPLCNSFMSFSTS
                     YSDSGLWGVYLVIDKNTNCKPVIDQVLKEWKRLREGSISQEEIDTAKAQLKGSLLLSL
                     DGTTAVAEDVGRQLVTTGRRLSPEETFEIVNDITKEDVVGWCKKYLEGRPTGMSALGS
                     VKSIPSYGYISEGLKA"
     gene            complement(<319546..>320154)
                     /locus_tag="FOA43_002121"
                     /db_xref="GeneID:62195522"
     mRNA            complement(<319546..>320154)
                     /locus_tag="FOA43_002121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922424.1"
                     /db_xref="GeneID:62195522"
     CDS             complement(319546..320154)
                     /locus_tag="FOA43_002121"
                     /note="BUSCO:EOG09343QDX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778352.1"
                     /db_xref="GeneID:62195522"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR036598"
                     /db_xref="PFAM:PF01105"
                     /translation="MHFSLITVLSVLVLSQFTEAHIALLPPRGKECFYEDLKAQDELA
                     VTFQVGDRDRSATEQLTTDFWIQAPSGRILRSMNDQSHGSFQIKAEENGKYVYCFSNE
                     DSSMKTKDVSFNVHGVVYVDVNDNSGDNLESSARKLLELVYDVKNEQNYIVVRERTHR
                     NTAESTNDRVKYWSVFQLIVVILNSVFQVLYLQRFFEVKTAV"
     gene            <320372..>320995
                     /locus_tag="FOA43_002122"
                     /db_xref="GeneID:62195523"
     mRNA            <320372..>320995
                     /locus_tag="FOA43_002122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922425.1"
                     /db_xref="GeneID:62195523"
     CDS             320372..320995
                     /locus_tag="FOA43_002122"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778353.1"
                     /db_xref="GeneID:62195523"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR036598"
                     /db_xref="PFAM:PF01105"
                     /translation="MLFAIFSVISLLIATVNATALTFALQPNEKQCFYIFNTKLNSNV
                     GYYFAVQAGGSFDINYYIKAPNGANIVKADKLTHADYIFTADQIGEYEFCLSNEMSTF
                     AEKIVDFEVKVDDDFKASLPEAPKENPAVEGMQESVKSIEQKINQLLSSLNYYKTRNN
                     RNQSTVKSTENRIFWFSIVDLLLMVGISVFQVLVVKYFFQGSRKQMV"
     gene            <321215..>322195
                     /gene="SUI2"
                     /locus_tag="FOA43_002123"
                     /db_xref="GeneID:62195524"
     mRNA            <321215..>322195
                     /gene="SUI2"
                     /locus_tag="FOA43_002123"
                     /product="eukaryotic translation initiation factor 2
                     subunit alpha"
                     /transcript_id="XM_038922426.1"
                     /db_xref="GeneID:62195524"
     CDS             321215..322195
                     /gene="SUI2"
                     /locus_tag="FOA43_002123"
                     /note="BUSCO:EOG093433YR"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     subunit alpha"
                     /protein_id="XP_038778354.1"
                     /db_xref="GeneID:62195524"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="PFAM:PF00575"
                     /db_xref="PFAM:PF07541"
                     /translation="MSTTHCRFYENKYPEVEEVVMVNVQQIAEMGAYVKLLEYDNIEG
                     MVLLSELSRRRIRSIQKLIRVGRNEVAVVLRVDKEKGYIDLSKRRVSAEEIVQCEERY
                     NKSKAVHSILRRCAEKFDIPLEDLYKSIAWPLAKEYGHAFDAFRVSISNPSVFDTITP
                     PSTQVLEELKKNIARRLTPQAIKCRADIDVSCFSYEGIDAIKDALKAGEAISTETDKI
                     KIKLVAAPRYVMTTQSLDKKQGVQELQKSIEKVTEVIAKYGGVCDVAMAPKAVSATED
                     AELQALLERKEMENTMDSDDDSEIEIAGVGVGAGAAGAAAAAAAAAEYDE"
     gene            <322241..>325665
                     /locus_tag="FOA43_002124"
                     /db_xref="GeneID:62195525"
     mRNA            join(<322241..322247,322517..>325665)
                     /locus_tag="FOA43_002124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922427.1"
                     /db_xref="GeneID:62195525"
     CDS             join(322241..322247,322517..325665)
                     /locus_tag="FOA43_002124"
                     /note="BUSCO:EOG09340POX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778355.1"
                     /db_xref="GeneID:62195525"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF09369"
                     /translation="MKEAPEKVIKRKLLPIDLARIKALIPDDVIFDYFDENQLVLEDK
                     HFTWKDGFQQKDIDIFELKDDDGKDRVFKQLLIFEFIDGDLTKSRTSTTFKTQMKVPQ
                     YSVESIKKLIVYRNEKFDSALQKFLDGHPNHPWDTLTEMAQQHIPHKAEFVDPMAEME
                     SRTDADDSGKRPSVGNLIAKLRHTTFYRDQIPVNGQFFIPPIAAKYGDLDFALSPKLM
                     EALSQSKGIEKFYSHQAEAMNMIHSGKNVIVSTSTSSGKSLIYQLPVLDAIERDPCIT
                     AMYIFPTKALAQDQKRSLRDLLNSMPEMSKLVVETYDGDTEKKNREFVRTNASIIFTN
                     PDMLHMSILPSHHFWQRFLRNLRYVVIDELHMYKALFGSHVALIMRRLCRICSLFGNT
                     DLHFISCSATLKDPVSHMHNIFGVPFEDIYHVSQDGSPSGGKHLVAWNPPLIDAGDPM
                     TGRVNFIGESARIVIEMIKNNVRTIVFCVVRRTVELVMKEIRHLLKNKDQMELLGQVM
                     SYRGGYSASDRRKIEQQMFHGNLKAIVSTNALELGIDIGSLDAVVMCGFPISIANFHQ
                     QSGRAGRRNKDSLTLLVSSDDPVSQYYMSHPRELVKTEYPELALDFENILVLEGHLQC
                     AAYEIPLAKDLQLEEPFFCDYKKLKDVVEKRFVFDPSDNRYHCNPRYLPWPSSKVSIR
                     AIEEDSFAVVDVTNGRDVVIEEVEASRSTYTLYDGGIFIHQGLPYLIRDFNPDERYAK
                     VERVNVDWTTSQRDFTNVDPLEIDKIRSLSKSDVPIYFGTVQTTMIVFGYFKMGRRNQ
                     ILDAVEVHNPPVKFKAKGLWIDIPDKALEYIHIKGLSAPGGIHAAQHAIINMLPLFIL
                     SGLDEIRTECKAPEKEFGHRESSRKRPARLIIFDSKGGQFGSGLSTKAFDNIDIIIEQ
                     ALKTLLECDCEWGCPKCCAAANCKENSLVLSKYAAIIIVAVILGKKIDLNSLPNGPEQ
                     NMPEITIETIRPAKEFGMVKFASDLEIIDVRKAEKPLMPLPKEEEVVYMSSSVREARQ
                     EVKQEKDDDEIIVKREDQDHV"
     gene            complement(<325667..>327670)
                     /locus_tag="FOA43_002125"
                     /db_xref="GeneID:62195526"
     mRNA            complement(<325667..>327670)
                     /locus_tag="FOA43_002125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922428.1"
                     /db_xref="GeneID:62195526"
     CDS             complement(325667..327670)
                     /locus_tag="FOA43_002125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778356.1"
                     /db_xref="GeneID:62195526"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="PFAM:PF01602"
                     /db_xref="PFAM:PF12717"
                     /translation="MGDSKLYTRVKASDILTELNNYEKKPKSSVYRKTILKKIIINMS
                     VGDNEVIMLISQVTKILSDLGPTDSEIKQLCYFYLTNYWRHKQEETLHALPFIVNDYE
                     TNKKTSDNDTCLAIRTMASIHIANYLNSLVPILEESLQREISGKIRKTAAYAVAEIFN
                     VNEKRDPESNRRLLMLLNDMLAEEDDASVVSAALSALREITDKSDTLKLSIDSNHAVK
                     LANSLTGCGEWSQVSILSSLLSFISQDLKTAAHLIDTVLPYLQSENSSIVLNALKVVV
                     YLSHYVDNVLDVFPVLPQSISGAVANLLLKPAEIQFLAMRNVILLLLDKPALMDLDIR
                     MFFCQYDDLLYIKDTKLEIIFLLACQENMDMVLAELQEYALEIDVQMVRKSIRAIGNL
                     AVKIDATSDKCVSVLADLISNSIPYVVEEVAIVARDILRKYPGKFDHLTHLLVDRVDL
                     ITEPESKTSIIWILGEYSSSISDSIYLLKKYAANMLEEPTETQLALLTAIIKAHVCQP
                     YNKELQGLVENTLKDVTQNTNHPDLRERAYFYWRLLSAKLPNAIDIIKPRLLKLNTET
                     DALSPDVCEELNLCIGTLASIYLRPVSQVFRHVKPDRLVDSPALVHQDLKSPQVRAKV
                     RRSTIRSRSSTTTSQQLGNPSINRSRSSSFKLDEIVKKLSLKK"
     gene            complement(<327843..>330353)
                     /locus_tag="FOA43_002126"
                     /db_xref="GeneID:62195527"
     mRNA            complement(join(<327843..329791,330350..>330353))
                     /locus_tag="FOA43_002126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922429.1"
                     /db_xref="GeneID:62195527"
     CDS             complement(join(327843..329791,330350..330353))
                     /locus_tag="FOA43_002126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778357.1"
                     /db_xref="GeneID:62195527"
                     /translation="MTPKEALSSSNPASPIPLSDSYGRPRNFSSASHGSTQRTVSGSL
                     KSIIRATSTGGAQSRNSPITTVVPDELMPIVTLIHAQQSRCYFEASVRVPADDADSST
                     AEISVQSTSTIIWRPALIKLIGTDLAIWPHLGAAGSGSPRMTGFTGLGSPRTTGFTGI
                     ASPRTTDSTGSTNSAGYAGSTGSTGSTDSTQPIIINISDSELEFFRSKTFFDLKIKIT
                     NEKSYFIRTETDEDLDYLFAGLLLSQCEFKQLQESFTGALLSSKAVNFSDIRTLLDPN
                     NQHSHEEWCILRFPFINDKWVRCYVVTIPPSHLSNKIKRGGKKNADGSIRTGKVEIYI
                     SSNTSKKNLLASVTNGRSCYSLYPESPEYIDNNALIRIWGDCYINHQLLQKIINENTD
                     NEVVRSTSKSLSKRLSSSSLRHSRNSSWAKPRESSFSLSHRHTDSGVSLASSHSEAGF
                     AKRPQKMKNLNILQTKLCYLIPETHGSVSPCETMIRSLIPIMNAFHLYGRPEKFSASR
                     EESNSLLFGFPQLPHTQYLDMQNAYDLVSLNIKNSMEQHWSSYEWVEVFKEMVHVKMS
                     KGWNGTGSIVETFRDGLLYDRNQLMSPDYLEYDPVDDFGDNSNTNSSSIVTESPPMTD
                     SIDVEEGKRGVSETAAALAYKEFVKT"
     gene            complement(<330927..>331370)
                     /locus_tag="FOA43_002127"
                     /db_xref="GeneID:62195528"
     mRNA            complement(<330927..>331370)
                     /locus_tag="FOA43_002127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922430.1"
                     /db_xref="GeneID:62195528"
     CDS             complement(330927..331370)
                     /locus_tag="FOA43_002127"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778358.1"
                     /db_xref="GeneID:62195528"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="PFAM:PF07960"
                     /translation="MDPITKTLLKKSLIWGGGIIGLGVVLFKFTTPSPEQMLAQMSPE
                     LRADVEKNRELRMKEQEELIKVVKRTSASNDPIWKTGDIQSPWDPDFKKTSESMLVKK
                     QAIEKARAEEKTKLELESMKEEAKRREGMEKEGMKKASGGSKWWW"
     gene            complement(<331486..>333282)
                     /locus_tag="FOA43_002128"
                     /db_xref="GeneID:62195529"
     mRNA            complement(<331486..>333282)
                     /locus_tag="FOA43_002128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922431.1"
                     /db_xref="GeneID:62195529"
     CDS             complement(331486..333282)
                     /locus_tag="FOA43_002128"
                     /note="MEROPS:MER0000413;
                     BUSCO:EOG09340YYF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778359.1"
                     /db_xref="GeneID:62195529"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR033124"
                     /db_xref="PFAM:PF00450"
                     /translation="MSLTLAGLLLFSLIAAVLGIPIDEGSQYLVKGLPGISNIPESLI
                     PTMHAGQLDLSSENNTGLFFWRFSKEETAPTDSLVIWLNGGPGCSSMDGAMMEIGPFR
                     PDSKDSSKLAYNNGTWLDSADLLFIDQPIGTGFAYTEVNFDTELTEASQHIVEFLKEY
                     LRLFPGDATRKVWIAGESYAGQYIPYFADAILKEVKKDGGFKMNIQGLLIGNGWIEPD
                     IQSLSYVPFAMQHNLIDSTNPLMARLLSQHERCQNAINDPQNDEFEKTQCDKVLDVFT
                     RATRVAKNQQDRGTCYNVYDYRKQDSYPACGSNWPEILPSTQNYLNLEQVHKSLNLKH
                     EKEWTECNNRVSSLFSPKKSAKAFDLLPNLLTEVPVMLFNGDKDIICNYMGTEMMIEK
                     LDIGGGQMGFSNESETWDWTYSGNSVGSVRNEMNLTYVRVYNSSHMVPYDLPEVSLGL
                     LDIMYQVVAGNSYHEGVIVTPVHGVDIENTAVESSATSHTLLEVGIVIFAIADIYFIY
                     IYFAGQRPPKSSLIKSTGSKKTKKKRVHWSDGSEESTRSSEDFADKPDENRSMLSSIL
                     TRLGYGERRYEDLDGDIEMGDIEEMVSDEDVK"
     gene            complement(<333443..>334039)
                     /locus_tag="FOA43_002129"
                     /db_xref="GeneID:62195530"
     mRNA            complement(<333443..>334039)
                     /locus_tag="FOA43_002129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922432.1"
                     /db_xref="GeneID:62195530"
     CDS             complement(333443..334039)
                     /locus_tag="FOA43_002129"
                     /note="BUSCO:EOG09343SOE;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778360.1"
                     /db_xref="GeneID:62195530"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="PFAM:PF04603"
                     /translation="MHFQSKSLYGGAITVDLPEGLIDASTFRQIPDTQEVYVCHDSKV
                     LSKNDAIIIDLMERVDCSDDSAIDSHLREVCKLNDADQNDSIILEQDRNAHARNFPED
                     YCGWIVSGEQAKKWGRDETPLVLILALIRLKNVGTDLLVSYNIPFDEKSEIEDLKEVL
                     SGESLAGNLALRRINVAKEVVIRILDTLKVQDWKLFKN"
     gene            334339..334420
                     /locus_tag="FOA43_002130"
                     /db_xref="GeneID:62195531"
     tRNA            334339..334420
                     /locus_tag="FOA43_002130"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:62195531"
     gene            <334524..>334901
                     /locus_tag="FOA43_002131"
                     /db_xref="GeneID:62195532"
     mRNA            <334524..>334901
                     /locus_tag="FOA43_002131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922433.1"
                     /db_xref="GeneID:62195532"
     CDS             334524..334901
                     /locus_tag="FOA43_002131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778361.1"
                     /db_xref="GeneID:62195532"
                     /translation="MFCNISRGIARSLSGVGRKGGVPRSICGGRFYHTQQQQGKFSRY
                     GLMVAGISLVGATGVSIVKYQEAARTTEEAKDMDEETVKMVKEGAAKAKEAAAEAKKA
                     EAESEAENETDTGEGSEGGQTSL"
     gene            335109..335180
                     /locus_tag="FOA43_002132"
                     /db_xref="GeneID:62195533"
     tRNA            335109..335180
                     /locus_tag="FOA43_002132"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:62195533"
     gene            complement(<335222..>336247)
                     /locus_tag="FOA43_002133"
                     /db_xref="GeneID:62195534"
     mRNA            complement(<335222..>336247)
                     /locus_tag="FOA43_002133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922434.1"
                     /db_xref="GeneID:62195534"
     CDS             complement(335222..336247)
                     /locus_tag="FOA43_002133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778362.1"
                     /db_xref="GeneID:62195534"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF13602"
                     /translation="MSSIPSSIPSSQKVVLFNKTGGPEVLEYVDFAIPKIADNELLIK
                     NRYAGINYIEGYFRTGLYPAKTPYVLGREATGVVVRVGSAVKGFQQGDKVTYLSGSTF
                     AQYTKYPAVGNLIKLDAKADDEKMKLYSASLIQGLTALTFINEAYNVQPDDYILVTAA
                     AGGVGLILDQLLSKQKKAHVIAIASTDAKLQKAKEAGAEYLLNSSKLSQDQLVAKIME
                     FTKNKGVSASFDSVGKDTAELSLAVLARKGTFVSFGNSSGAVPPLNISRLAKKNLKVL
                     RPLLFGYIAEPEEFRYYLQKLFDLIDNKQLNISIYKVYPLSEYKTAVKELEGRKTSGK
                     LLLEIPQ"
     gene            <336389..>337567
                     /locus_tag="FOA43_002134"
                     /db_xref="GeneID:62195535"
     mRNA            <336389..>337567
                     /locus_tag="FOA43_002134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922435.1"
                     /db_xref="GeneID:62195535"
     CDS             336389..337567
                     /locus_tag="FOA43_002134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778363.1"
                     /db_xref="GeneID:62195535"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR012913"
                     /db_xref="PFAM:PF07915"
                     /translation="MLFITLLASIVAASTFEEYPPDYKVTLGSDWINKDDVHPYLYTI
                     RDDNFQYACNISTPSYFKDVNLSRSINTTHLDLQKKDAIQAIKNFNKVHENHCIYSEL
                     GYWSYRACFSRGFTQFHYTGDRSKVHEQLQTDPSIPSHRLGYMKDDLFSKLSDFEFVK
                     SSDGSRYLSQLVYNGSVCDLTGKERSVFVQYRCAPEYSVPVITDVDELKTCQYRMVIS
                     SAELCQYPVLKPQNYVTEANISCNPIRESNSNSDAHLLAIHEKLDLSTLDLQPIGDGI
                     FLGSFQNQALPMLPRILVTNRKYSSLENDFLTDVGQAFMNMMKANRVFTPPGVSPARP
                     LKKGDKFEYVTEVYGLNREFIANVAIEQNENDFLVTYFTDFGSANDNFVEFTAGDTTA
                     "
     gene            complement(<337581..>339224)
                     /locus_tag="FOA43_002135"
                     /db_xref="GeneID:62195536"
     mRNA            complement(<337581..>339224)
                     /locus_tag="FOA43_002135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922436.1"
                     /db_xref="GeneID:62195536"
     CDS             complement(337581..339224)
                     /locus_tag="FOA43_002135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778364.1"
                     /db_xref="GeneID:62195536"
                     /translation="MAFTKAKFHNFFVDWFSVLKGLDKRTGILSVSIPLKEDFFEDNV
                     RKINYSILRYMDSLKDEVSDDSEPSGQPKLENSTSIEEKFESKEYKTVYEMFHDLKIA
                     SVIKMVQVEDDLDLYGKVDTFFRVGSELLLRECLRLGLTVEDEMKKDNEDENEKKKQQ
                     KRKMLEEKEKEKEEEEEKEGEEEGEDETEESGFGMETSLEEALARDFELITGTYIDKA
                     GEALSIVAAGNLPLFTSLNKKKSELDDREPVIDAGLGVNLVKIVPNLDSVTPEKLTFV
                     SPVSQQPVSDVREVLQEYIHPNWLRLTSPQWLKNGDYDMNFSFAPSYDESKSTVSNEW
                     KGLTWMQEVGFEKFKEAKREKKEKTDEKAEEAEEAEKAEKAEEAEKAEKAVGDSDEES
                     EEPIDLGNLFKWNIGNKIDEHEKDVIADDGVQEEISKLMLELNHLRKSRITFQKQQLA
                     AQQQLFVRQAQQGADMSHAEYKVLRTSKQEVEKYHRLKRLMTGLLRSKDINPDKLNLK
                     LSTRLPVLQHNYTGMLPASFGGNSHYGRYGGSSRNRRRR"
     gene            complement(<339366..>342941)
                     /locus_tag="FOA43_002136"
                     /db_xref="GeneID:62195537"
     mRNA            complement(<339366..>342941)
                     /locus_tag="FOA43_002136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922437.1"
                     /db_xref="GeneID:62195537"
     CDS             complement(339366..342941)
                     /locus_tag="FOA43_002136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778365.1"
                     /db_xref="GeneID:62195537"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /translation="MVRKFYGKACDEVTETHGEEGDDSGSKKVNKSGSEEVSEEKNKR
                     KRRLKDELREQHKEKLTKQKKKRLNKYIEHQLRREEKEILLKKLEETRMDSSILKSAK
                     LIGTGKETKRERLQNALQLEKEGKGDENTKDMLYEKRDMRSWEDELDESEDNDDQFKS
                     TDDVSKFNVPEGGFGNGLGFSNLPKIVKRHKKKYTWRARIEAEEEHAKKLEEEGDFES
                     SQDEEGEDEDGEDEDDEVVEDEDDEVPNEVPVPNEVPVSNEVPVSNEVPVPNDSASRS
                     RDFKIWAEQQVKKMEGRHEMVVPAVSSNYKPLVRSEDLDDGLKVDGNSIPLNENLDRK
                     IFTVEVERSEDIQAARIQLPVYGEEYKIMDAIHNNDCVIICGETGSGKTTQVPQFLFE
                     SGYGSKNSETAGMIGITEPRRVAAVSMSNRVCKEMGNCGDRVGYQIRFDGNVKKQTAL
                     KFMTDGVLLREMMSDFLLTNYSAIIIDEAHERSVNTDILIGMLSRILRLRRQYHQKDP
                     AQYKVLKLVVMSATLRVSDFSENKVLFPVVPPVLKVDARQYPVSVHFNRRTVFNYMEE
                     AFRKTCKIHRRLPKGAILVFLTGKAEINTMVKRLRKEYPFPKDAGQIYNEVPDVLVNS
                     KNADVEVEEIELDANEEEMVDDYEDNEEEEEEKEEEEGFEETLEEDQTAEDPLYVLPL
                     YSLLPTKEQMRVFEEPPQGSRLCVVATNVAETSLTIPGVRYVVDSGRSKERKFNEDTG
                     AQLFEVGWISKASADQRSGRAGRTGPGHCYRIYSSALFESDFLQFSRPEILRMPVESV
                     VLTMKSMGIDNIVNFPFPTPPSRHILDKAEKLLHYLGALDDEKRITEFGKKMSLFPVS
                     PRFSKMLLIGNQQKCLPYVIVLVSALSVGDPFLSEFDLGIKMHELKEEDEVVEDQIQI
                     ERRRQILSKFNKSREMFGSLDKFSDSLRLLFAVCSSDHVGAQQRDEFYRQNFLSSKLM
                     NEIRKLRKQLTYIVRINTSRDSLAASRVKEGDLKLDKPNGKQVQAIKQMVASGFIDQI
                     AVRADVINSELKVTSNTRIINIPYLTLFPSVDHPKEDDDPFVYIHPSSILVQSGEVPP
                     DYLVYQTLQFSSEASKNGSRKLRIKPLNDIKDRALANVGKHSGLVTFSKPLGNPYAPR
                     SISATERVCYVVPRFGANIGTGGVGWDLPAAKVTQKKVRGTWVVA"
     gene            <343096..>344124
                     /locus_tag="FOA43_002137"
                     /db_xref="GeneID:62195538"
     mRNA            <343096..>344124
                     /locus_tag="FOA43_002137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922438.1"
                     /db_xref="GeneID:62195538"
     CDS             343096..344124
                     /locus_tag="FOA43_002137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778366.1"
                     /db_xref="GeneID:62195538"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PFAM:PF01853"
                     /translation="MTSSDYGSLDYRNVRRIKLGRFEFDTWFSNSALFLPTEPELLAY
                     KAIESGIKLSSSHRKRLDYDELKKTWIDTLHFCPYCFKYTEDSLQMAKHTAGCRLKSH
                     LPGKVMYFDGDSTIRKIKASRHKLFCQCMCLLAKFFLDNKSIFFNIDYFDFYVIYKVL
                     DGVSAPMGFYSRELLSWENNNLSCIMVIPCYQKQHLGTKLIDFSYCLSRYQQMISGPE
                     RPLSQLGRITYLRYWSSRLCIEFLYGSLTRFKVVTLKLISAKTGFREEDILMALDFMK
                     SFLETGVKDPYTIHPTTHYDDDDDDELVLLDEQYRLYIDKSRLKQWVIDHQIKDGQVL
                     KRDRLILY"
     gene            complement(<344153..>347248)
                     /locus_tag="FOA43_002138"
                     /db_xref="GeneID:62195539"
     mRNA            complement(<344153..>347248)
                     /locus_tag="FOA43_002138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922439.1"
                     /db_xref="GeneID:62195539"
     CDS             complement(344153..347248)
                     /locus_tag="FOA43_002138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778367.1"
                     /db_xref="GeneID:62195539"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MFFDHSLQTTTEPIVVLDSDGDDSEPSKNVLSFAEFKAGISAAL
                     GQISEMSIHRLYDDFLYSAHPLEKAANAYLDSPDVYQITATKRKQYVPDIQYKKKPKT
                     SESTWQRYIGTIEIDCWCTRTTLGSASIGETKYVTVTHPGHFEVVYVDQLDEKTGYKR
                     EIGRFNESAAHSVGLLLQGHYIDLILDPVYLPDGILHIGDTFIMQADCFVTSVLFPES
                     VSSQADAFTRAFSGSKGDKSLDDATIGRRSGVLRLFDLVQLQSPQLNKGHKVVSLGQN
                     LELDQLRDLYKSTQSNSLESQLPETEPCDFNLTLRPYQKHGLSWMLQREGELEEVKSD
                     TKDDNEVINPLWREYRWPIAPKRITKLVGERDGDSNSFYLNLYDGSCSVEKPVIRSDC
                     MGGILADEMGLGKTITTLSLVLKCPMDSVDTHILPNYAYGTTLIVVPMALLSQWEKEF
                     NRVNNKIKNRCFIYYGADTIDNLKGLLCQKGVNVPPTVILTTYGTIQSEWSRLETRSQ
                     VQGLFSVKFFRIILDEGHTIRNRSTKTAKASYSLKASRRWLLTGTPIVNRLEDLYSLI
                     RFLEFEPWANHSLWKHFITAPFETGEDLPLAFNLLKSILDPILLRRTKNQRDKNGKLL
                     VELPPKEVVIERLRFNEKEEVIYNWLKERAVSTLNENFRRGLLLKNYSSILTHLLRLR
                     QVCDHIDLIKSQDQGDPDAEDKVVQQSITNESDEEALALIREIEVKEAKGKMSIEEMK
                     KIKVDIYSLYPTLEGVECSICTGPIDIKSCVITECKHCFCVGCLKEHFDFQESHDKEQ
                     VLCPMCRSEIKKSRLFRTIAKQFVRGNDEKADVLLTQVYEVDRNYLVRSFDPYGKSSK
                     INALISHLEQIKEESPGDHVIVFSQFTSFLDIVEEELGKYGNDFHVLKFDGRLGMEQR
                     TNVLKSFEDDDVKGKNISVLLISLKAGGVGLNLTVASKAFLLDPHWNNAVEFQAIDRL
                     HRVGQTKSVKVIRFIMQDSIEERMLEIQQKKNRLGEALTLNDEERRKKRIEEIQSLFK
                     K"
     gene            complement(<347462..>348988)
                     /locus_tag="FOA43_002139"
                     /db_xref="GeneID:62195540"
     mRNA            complement(<347462..>348988)
                     /locus_tag="FOA43_002139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922440.1"
                     /db_xref="GeneID:62195540"
     CDS             complement(347462..348988)
                     /locus_tag="FOA43_002139"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778368.1"
                     /db_xref="GeneID:62195540"
                     /translation="MSVVEPVLEKTADADAAEISSPESRSESLTPSSTSSAISSSANS
                     VSTAATSDADSSESVKKAVKSSSTSSTSSTSSTSSSSSNASTPMASSSSSSSHKSKKK
                     KARTINHATGISTTVPLVGVRIRPTAHSSLNDKVLMAIFEILHDDDSDCKGMTVKHIC
                     DILIKKHPEMANLSSKTSNLVSAKLNAYVKRIEKGDKSMKYALSRVWANTSPRRMVYV
                     YRGVLAEGYPEYVQLAIDKLRSEEAIRAAIEDSESPARSPKSSPFDAGDRNPPLAPGI
                     GVSGYPQVVSPSGLQLKRQSPFKDTSFRLPQFSVPYSSAPVTASLNTTNVPELGRPSV
                     SDYHTINSWLTLANNNSSDSENDDDDDDNNSNDEANDTLDSVVGFNPSYRRSLSGVPP
                     STLDKRSKSMSFIQSKRPKTSHITAAAATPRIPRKQSIAGSPSAAAAVAALRASALNN
                     FGSPVESVNSITSSIMSDTSVEPSISMKWLETVRSGFLNQDIESPEDVSLAELDGMFA
                     "
     gene            <350571..>352361
                     /locus_tag="FOA43_002140"
                     /db_xref="GeneID:62195541"
     mRNA            <350571..>352361
                     /locus_tag="FOA43_002140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922441.1"
                     /db_xref="GeneID:62195541"
     CDS             350571..352361
                     /locus_tag="FOA43_002140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778369.1"
                     /db_xref="GeneID:62195541"
                     /db_xref="InterPro:IPR006042"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="PFAM:PF00860"
                     /translation="MQRQQENKISMHSVREDITSITSIDPAVQADLDAHPEDDMIFTE
                     KIRKNWRSLLGKVTTKEGLLGSYDYGYLFMPEVPFMSKTPKTQPFFGLNDKMPVFLGM
                     LLGLQHSLSMLAGLCTPPILISGFANLTIAQEQYLVSASLIASGILSSIQITRFHIPK
                     TPYFIGTGLVSVVGTSFATISIVTKGIPMMYKTGYCPVSDDGTQLPCPDGYGAVIGTS
                     CICGLLEVLLSFMPPALLQRIFPPLVTGPVVLLIGVSLVETGFEDFAGGSGCMTSNDC
                     AKGLPWGSAQFIGLGFLVYVTIIFCEKWGSPIMKSCAVICGLLVGCIVAAACGYFSDD
                     GIKAAPAATFLWVHTFKLRLYGPMVLPFLACYVVLMMEAIGDITATSDVSRLEISGPL
                     YETRIQGGVLADGFNGILAGLMTLTPMSTFAQNNGVIAITKCAARAVGYWCCFFLIVM
                     GVFSKFAAALVSIPDAVLGGMTSFLFTSVAVSGLKIISSIPFTRRDRFVLTCSMMFGL
                     GATLVDDWFEYVFTYSGDNKALQGFLNAIVLVLETGFAVAGFIGVILNLFIPQELDED
                     DEADQMIEEMVVDNSSGTERSSNEKKKIEA"
     gene            complement(<352383..>353687)
                     /locus_tag="FOA43_002141"
                     /db_xref="GeneID:62195542"
     mRNA            complement(<352383..>353687)
                     /locus_tag="FOA43_002141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922442.1"
                     /db_xref="GeneID:62195542"
     CDS             complement(352383..353687)
                     /locus_tag="FOA43_002141"
                     /note="BUSCO:EOG09341QBH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778370.1"
                     /db_xref="GeneID:62195542"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030666"
                     /db_xref="PFAM:PF01715"
                     /translation="MLEQRPKTVISIIGTTGVGKSDLGVALAEMFNGEIINADSMQMY
                     KGLPQITNKHPISDRHGIPHHIMNHVDWNEEYHIHRFQKECLAKIAEIHSRGKVPILV
                     GGTHYYLQSVLFVNKTIGTEDGSEEKQLTEAQQRMLDSGSGEQLHELLMKYDPKISMK
                     FHPNDVRRLRRALEVYYKMGKPASQFYKEQQKQQTFRSRLRYTTMFLWLYSGSSELNL
                     RLDKRVDKMMDQGALQELTELYDYYDGLPNPKPKMDTGCFQVIGFKEFLPYLSSRRKD
                     PLDGQDPLFMKCCEEMKLRTRQYAKRQVKWIKNTLIPDLQSEADHDWCHFGKVYVVNA
                     SDLSQWHELVEHRAVQIVQEFLKSGGKVNDSVVQVPKELEDQNLIHDKSNKFDETKWV
                     YHTCGVCINKVTGEPLVLVGDQYDIHMKGRRHRRNFKYKSKK"
     gene            complement(<355684..>358242)
                     /locus_tag="FOA43_002142"
                     /db_xref="GeneID:62195543"
     mRNA            complement(join(<355684..358211,358239..>358242))
                     /locus_tag="FOA43_002142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922443.1"
                     /db_xref="GeneID:62195543"
     CDS             complement(join(355684..358211,358239..358242))
                     /locus_tag="FOA43_002142"
                     /note="BUSCO:EOG09340WA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778371.1"
                     /db_xref="GeneID:62195543"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MGDTSRTKEVKEEKEDIEATEATVPASSSATPTPPVIAVDPTLD
                     RKTLFIRSIPSEATKDELSEFFSQFVPVKHSIIVLDKERKSRGFGFVSFPTEDDALTA
                     LDKAKKTKFQKKLLNIDIAKRRERKVQEDEPVEPVKMIFKRKETTIMEKTAKVIVRNM
                     PWSVRDPEVLVKIFEKYGKVKEAHIPRKKDGKMTGFAFVTMNKHTTALKAVKECKDLE
                     IEDRKVVVDLAVDKKRWEEEEEKEKEEEEEEENDEDEEEKNDEDEEENSDEVNSGSEE
                     TNDEANSDSEETNDEVNSDSEEINFNPEIKEPHAPKNRQERYSIFIRNLPYDVTKETL
                     EEHFKQLGPIKYALPVMDKSTGLARGTAFVAFAANQPYEECLLNAPVVPKDSVLLPDD
                     VSPFYVFEGRVMQIAAAVDRESAAKLSERHAEARLELMGREPRERDKRKLFLLNEGRI
                     APGSKLAQLLSPTDMEIRDRSYDLRVKQLTSNPSLHLSMTRLAIRNIPRAMNEKALKA
                     LGRKAFVEYATEVKAGKRHGLNKEELDRSTKHTEYMNEKLGMKPGEKVKSKHGIVTQA
                     KIINEIKGSGEYGRSRGYGFLELKDHRTALMALRWLNAHEVTSDEILSSLTDDQRKIA
                     EKEKLIKKKRLVVEFAIENANVIKRRIEQVLRSRKRSQEDRGERKREGDEEYGGDRKR
                     RFGSDRGRGGDRGDRGRGGYRGRGGYRGRGDDRERGGDRGRGGYRGRGGDRGRGGDRG
                     RGGYRGRGGDRGRGGYRGRGGDRERGGYRGRGGDRERGGYRGGRGGDRGRGGYRGRGG
                     DRERGGFRGRGGRDRYDHHYGDHSHNEFHKSSKRFERKQQRGAES"
     gene            <358454..>359878
                     /locus_tag="FOA43_002143"
                     /db_xref="GeneID:62195544"
     mRNA            <358454..>359878
                     /locus_tag="FOA43_002143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922444.1"
                     /db_xref="GeneID:62195544"
     CDS             358454..359878
                     /locus_tag="FOA43_002143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778372.1"
                     /db_xref="GeneID:62195544"
                     /db_xref="InterPro:IPR007902"
                     /db_xref="PFAM:PF05238"
                     /translation="MHRHHSGILSNTYIPPLSPNTIAKELSRLSTESLFNLVELWFTL
                     PVTQPTPNKQKRRHGVTQQQLVEKFKVVVKSLRAAKSSKKRKLIDRILVDFYPEGLNA
                     LQLAQLDIQLMVDKPNLYTWVSSTAKIISNIGPIDEIKDALDDFIFSLDSQSFLDHLI
                     KNLANLYLTHIYISRHPQLPLIIIRIQMYEYVHLKRAKRGSISGSLSNGQNPDIISRK
                     PYYLVIPTSSPNLIHSVSNVDDLTSKLILQSVETTLSSSLRRVKLIKNKEPPLKTLEA
                     MHILKGISRFGHALGSWAPYADGTVDIGPLGDPTQHIVLRPAKNGAYERPQSQDEERK
                     MIAALKFKGSLFPKLKSDRLYEDNRKKRQRLATGLVSTDGEDDIDEEQPNEYQSIVPV
                     QSGDFIVQNKLKEPYNEDKTIRDVSDAPSIRLRLFGSDIFAGLHQLAVEGIVDPKTIP
                     SWLTGEEGLHRGIIKDGEFIRKDE"
     gene            complement(<359888..>362413)
                     /locus_tag="FOA43_002144"
                     /db_xref="GeneID:62195545"
     mRNA            complement(<359888..>362413)
                     /locus_tag="FOA43_002144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922445.1"
                     /db_xref="GeneID:62195545"
     CDS             complement(359888..362413)
                     /locus_tag="FOA43_002144"
                     /note="BUSCO:EOG09340KMP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778373.1"
                     /db_xref="GeneID:62195545"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="InterPro:IPR038132"
                     /db_xref="PFAM:PF04840"
                     /db_xref="PFAM:PF04841"
                     /translation="MPSSPSLGWERLQNVFYRSRPCFELNCTPNSEVDQNSNNVGSFP
                     SSLEDYMVSIGPYASHIALYERSGAHYAKPTRSIDIYLGSGNLVCSLPWLVSIGEIVA
                     LGWRSDCSLIVVMRSGKWRIYHKLDGDFDEYDLQSDDDLLDVRFWENGFMARLANNTF
                     TGVLDYDKPKSVSLEMLAPEEQAVELHGWDVISPNANHSVDIMVGINDSVNLLKDSNT
                     SLAKGPYDIVSLPPNKELVALYSHESREITIATADLKRTLNIFKSDNESIPLQLQWCG
                     NDAVIVSYKDEMKLVGPSKDSLDFYLDFPAILHSEPDGLYYLCGNKLSFISRVKPVTL
                     ETFKIGSTAPSAILLDAMDLLDQHSPKANENLEIISDFLVEAVDGCIRAAAEEFEPYW
                     QKKLLNAASFGKTTIDLYNSEEFVETCNYLRVLNIVRQPEIGMFITYTQFLTLGAQNL
                     IKILLLHKEHFLCLKLADFLDLPKGDILLNWADCKIKTAGDLNDEQLANIIIKRLAKK
                     RISFASIAEVAYQEGRKVLSIKLLNEEIETAKSIPLLLEMDQDDYALVKAEDDMDVDS
                     ILYVLLTLYNKLNVADFFKILDGKPNSTGVFKANLVNMDQNLLYNYYYQDDFIPGLAE
                     LDLKNFFDKDSNGGSLEAKRVDLLKASRLLLRSKSTNDDGQRLKDEVKLVEAQDKLHQ
                     DEIMPTSRYEPVMKTIERIILVDLRKAIRFQKTHKVPDRQFYHKVVKTLAPIPERRHE
                     LYEFATSKKSPIGYEPFYLELLKVGDKRQAAMYVKLCTDISYKARVHCYLKCDDFKSA
                     VEEAAKKKDSDLLEAIKSLTDNQVYLRLIDDSLETITGAGRFG"
     gene            <362557..>362868
                     /locus_tag="FOA43_002145"
                     /db_xref="GeneID:62195546"
     mRNA            <362557..>362868
                     /locus_tag="FOA43_002145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922446.1"
                     /db_xref="GeneID:62195546"
     CDS             362557..362868
                     /locus_tag="FOA43_002145"
                     /note="BUSCO:EOG09344RAA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778374.1"
                     /db_xref="GeneID:62195546"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="PFAM:PF03931"
                     /translation="MSDSDEEKTSPYVTLISNDGYSFQITREAAMISGTLRGMLNTSF
                     QESSTNTIKMHELDSQLLEKVVEYLYYNLKYNELVDVPEFDIPTEMALELLVAADFLD
                     V"
     gene            complement(<362905..>365385)
                     /locus_tag="FOA43_002146"
                     /db_xref="GeneID:62195547"
     mRNA            complement(<362905..>365385)
                     /locus_tag="FOA43_002146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922447.1"
                     /db_xref="GeneID:62195547"
     CDS             complement(362905..365385)
                     /locus_tag="FOA43_002146"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778375.1"
                     /db_xref="GeneID:62195547"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="InterPro:IPR038499"
                     /db_xref="PFAM:PF03097"
                     /db_xref="PFAM:PF13949"
                     /translation="MKFISLPLKKAEPTDWIHPLKTYLAQIYGSYSDFEDSVHLFDKL
                     RIDIIHSNKDNIAKELYYHYYGQLELLELRVPLPMLGVKFTWYDAFKPSEKTTQHSAA
                     FEKASILFNLGSLLSILGVQAAAEDDLKESYSDFQKAAGVYQFIQENFMHAPSDDLQV
                     DTVKAFYKLMLAQAQEAFLLKYLASGVTLKMSLCAKLAQATSNLYATSHDLTSSIDYI
                     PAEQDYYCKLKQMYYQSMAHYYNSKGYVEKGEYGVGIANLKLAQTDMDGYKRYNPSYD
                     HSIVESMKDHLDTVEMELKQLDKDNDFIYHQNVPKAVGLSPIKPLESSKAIPLNEQQI
                     DSMVGHDLFEKIIPMSVHEKSSLYSEEKAQIVRDEEDRCSTASEVFNSTLEFLKLPQS
                     LTELKQLCEPLEEVDQRASDEIDPRVLAISAEVSSTNVDLSAAQRVRRDIQNTLQRCD
                     QLLLDDTNRYEKNRALHGAQWTQELYPSELIQIKEDLGKARKSLLDAAESDSKIQQLY
                     ESNRADIDVLKFGPSDPRFAKSFLEETKDTGSTLAAQVSLLDIDDTPRSVADIPEIKA
                     KLNTIDSKLQELRRLQKERSNTLMDLRQAIRDDDISNVLVLNKDKENMDDLFNQELQK
                     FKPYQERIAATTDKQSSLINDMKQSMAEVLDDTSVKACMKKREKDKGSRQTKTSHYLD
                     AYESWKAYKSGCEQAPLFYKQLLQFSTNLKYKIEKFAGERANEGNRMLQSIQARGSTE
                     QDLLRQRMNQSQGYPPPPAYTESYPSGYQRPGPSAPSAPSTSLPYMPPKPPLPSKPTN
                     QQSGDFYSTPSAYDPSLYSKFGNRNWNQ"
     gene            <365508..>366665
                     /locus_tag="FOA43_002147"
                     /db_xref="GeneID:62195548"
     mRNA            <365508..>366665
                     /locus_tag="FOA43_002147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922448.1"
                     /db_xref="GeneID:62195548"
     CDS             365508..366665
                     /locus_tag="FOA43_002147"
                     /note="BUSCO:EOG093435ZE;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778376.1"
                     /db_xref="GeneID:62195548"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR037683"
                     /db_xref="PFAM:PF10607"
                     /db_xref="PFAM:PF13445"
                     /translation="MSRAQTLTEEIDKLSGDDSLEMISRGSDDFLGGLKRLKEKISNN
                     EPYDIDSVEKDFKNWHDNSIMQEKKIHRSLRNYTSKTEKLFDFDLDSVCHYNKVSLVK
                     GQTEELLDRAIVMDLLRNGQFSLATEVCTETKLPFVEELVSEFKELRNILTSIEEEFE
                     LGPAIKWAVKNSNSLREDGSDLEFLLHKIQFLKISMQFNSEPFEAYAYAKRTFPKFAK
                     RHLNTISKLLGTLAFGEDIEIPDDFSIPDTKKMLCNKVVHDYCSLINLSARSPLFNTL
                     LASYMALPAFKKYNRIANLSNKLNWTTQNELPFEINLPQSLQFHSIFICPVSKEETTD
                     DNPPMVLPCRHLISQDSLQKLSKNGISSFKCPYCPRTCLCSQAKQAKFMNI"
     gene            <366781..>367293
                     /locus_tag="FOA43_002148"
                     /db_xref="GeneID:62195549"
     mRNA            join(<366781..366784,366833..>367293)
                     /locus_tag="FOA43_002148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922449.1"
                     /db_xref="GeneID:62195549"
     CDS             join(366781..366784,366833..367293)
                     /locus_tag="FOA43_002148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778377.1"
                     /db_xref="GeneID:62195549"
                     /db_xref="InterPro:IPR028217"
                     /db_xref="PFAM:PF14615"
                     /translation="MDSSSSESEEERREGGEGAEEAAEEVAEEVAEEIKNKDITIEGL
                     NLPDRTSINATKDQINRLEDKFQTMEQMKLDLSGTNNSNKLQQLNESINETREALLNE
                     YLGKMLGTYSDDLDELRSKADFHGEMSLKLIAKLLKESGNVFDDSTLSQLKQ"
     gene            <367594..>369468
                     /locus_tag="FOA43_002149"
                     /db_xref="GeneID:62195550"
     mRNA            <367594..>369468
                     /locus_tag="FOA43_002149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922450.1"
                     /db_xref="GeneID:62195550"
     CDS             367594..369468
                     /locus_tag="FOA43_002149"
                     /note="MEROPS:MER0000948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778378.1"
                     /db_xref="GeneID:62195550"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR033121"
                     /db_xref="InterPro:IPR033876"
                     /translation="MLFSFPLLATLASLSLVSTATASGSPGYIKLDAQKFRGNSWEEA
                     KLGAQPRVLQKRDSDGTVTMILENEQTFYQTILEIGSTKQRVAVLVDTGSSDLWVVSS
                     NNTGCLAGTTGSLSSGVVSVHSSAGSTIAGTLVSSLSSATATGSLLGDIYSIESDYSL
                     MSDVYYTTITTMMMKGIALSNIRNLNADIGSPTVEKANDDSDYASSSIATAEPTLDCS
                     EYGTFNSNDSDTFSSNNTAFSIEYADDTFAIGIWGNDNVMINSVKVSDLSFAVCDDTD
                     NQLGVLGIGLPGLETTYGGSTSSSTSDMYMYANLPIKMRDLGLIESVSYSVYLNDSDS
                     SEASILFGAIDHDKYVGDLSLFPIINSVASYGYKNPIRLEITLNSLNLGSSKEDKQVT
                     FGSGYAPALLDTGTTLTYMPTDILDELFSWLSVEYSSSLGYYMKCDDADGLSITFNFQ
                     GVDIRVPLSDFLVTLTTTSGSTSSYCMVGLKENSDESFTLGDSFLRNVYFAVDMENYV
                     IAMAPANLNSTSEDIEVISSSIPSAVSAPDWSMSYGGSSTLMTEVSTSPVALSSVTIA
                     SRVQTTGTSKSSGTEGTKSTKSSSSSGSSSKNSASSSSSFRWSLLLPIAVGMGMAVMM
                     "
     gene            <369866..>370990
                     /gene="ERG6"
                     /locus_tag="FOA43_002150"
                     /db_xref="GeneID:62195551"
     mRNA            <369866..>370990
                     /gene="ERG6"
                     /locus_tag="FOA43_002150"
                     /product="Delta(24)-sterol C-methyltransferase"
                     /transcript_id="XM_038922451.1"
                     /db_xref="GeneID:62195551"
     CDS             369866..370990
                     /gene="ERG6"
                     /locus_tag="FOA43_002150"
                     /codon_start=1
                     /product="Delta(24)-sterol C-methyltransferase"
                     /protein_id="XP_038778379.1"
                     /db_xref="GeneID:62195551"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR030384"
                     /db_xref="PFAM:PF02353"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF08498"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MSSVKLAPKEFKKDKDFAHALHGKTATESTGLGALAHKNKEAEQ
                     AALDGYFKHWDGKTDKDSEQSRLDDYSSLTKQYYNLVTDFYEYGWGSSFHFSTFYKGE
                     PFHQAIARHEHYLALKMGLKEGMKVLDVGCGVGGPAREICRFTGASIVGLNNNDYQVE
                     RGQHYAHVAGLDDKLKFVKGDFMQMDFEPESFDAVYSIEATVHAPAFEGVYGEIYKVL
                     KPGGVFAVYEWVMTDKYDEKNPEHRKIAYGIEIGDGIPKMYKREVAEKALKTVGFEIT
                     YQHDLADDYHEVPWYYPLSGDWKYIKSLRDAITFFRTSYLGRKLTTTFVNTLEAVGIA
                     PKGSSKVTDALEEAAVYLVEGGKQKLFTPMMLFVCKKPEN"
     gene            complement(<371065..>371727)
                     /gene="CCC1"
                     /locus_tag="FOA43_002151"
                     /db_xref="GeneID:62195552"
     mRNA            complement(<371065..>371727)
                     /gene="CCC1"
                     /locus_tag="FOA43_002151"
                     /product="Protein ccc1"
                     /transcript_id="XM_038922452.1"
                     /db_xref="GeneID:62195552"
     CDS             complement(371065..371727)
                     /gene="CCC1"
                     /locus_tag="FOA43_002151"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="Protein ccc1"
                     /protein_id="XP_038778380.1"
                     /db_xref="GeneID:62195552"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="PFAM:PF01988"
                     /translation="MSDLIIGLSDGLTVPFALTAGLSSLGDSKLVITGGMAELVSGAI
                     SMGLGGYLAARSESQYYKAQVHRERQLFFENLDLIDQELEEIILDMGGSVDTAAMFIK
                     DLSKDPKNMIEFIIRYGRGLDEPAENRQLTSALTIGSGYFFGGFIPLVPYFFTTTVRT
                     GLLISVLVMLFTLFWFGYFKSRISMGSECGKWECITEGFQMIMIGSLAAGSAWMLVYL
                     IE"
     gene            <372384..>372920
                     /locus_tag="FOA43_002152"
                     /db_xref="GeneID:62195553"
     mRNA            <372384..>372920
                     /locus_tag="FOA43_002152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922453.1"
                     /db_xref="GeneID:62195553"
     CDS             372384..372920
                     /locus_tag="FOA43_002152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778381.1"
                     /db_xref="GeneID:62195553"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR035896"
                     /db_xref="PFAM:PF01428"
                     /translation="MKVVIRINNQHNFHVTVPDNATVEDLKIASLVALPPKSGLNSHT
                     AKLWYSGKKLEFSTLLSSYGITAVSDSTVYLTDDSQVESNCAITDNDVADLTIVQQHI
                     KKTRSKSKSKNRCSFGTCHASALRLTGECQFCKGKFCSKHRLLEKHNCKGLKICKNKC
                     FERNALKLRNEQTVTSKV"
     gene            complement(<372955..>374154)
                     /locus_tag="FOA43_002153"
                     /db_xref="GeneID:62195554"
     mRNA            complement(<372955..>374154)
                     /locus_tag="FOA43_002153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922454.1"
                     /db_xref="GeneID:62195554"
     CDS             complement(372955..374154)
                     /locus_tag="FOA43_002153"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778382.1"
                     /db_xref="GeneID:62195554"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF13242"
                     /db_xref="PFAM:PF13344"
                     /translation="MFSLGSSVFRTIYGPIAIARCYAGHSQAVLSRFSSTVSKSDIGF
                     AFDIDGVLIKGSKPIPEATEALSYLSVNKIPFVLLTNGGGILESERVTYLNKLLQLQD
                     HPINTNQIIQSHTPLRTLIAKHHRVLVVGGPGDRSREVAKHYGFKQVLRPIDIIRSNP
                     SICPHHRYTEREIKEWGLPPEESKVSVGNANCNEPIDSIMIFNDPREMFSDLQIMLDL
                     LNSEYGLLGTKRLANRSKPSIPIIFSNNDFYWANDFPLPRLGQGAVKLAVESLYSKMN
                     DGMPLQSLTLGKPYKVSYDYAYHILIDWREKLLSGNTDSDVCLPELNDPPIKSPFKHV
                     YMVGDNPESDILGGNDYGWNTILVRTGVYKDGDFVTNPALPQPNFGIVDNVKEAVKIA
                     LEKNGLY"
     gene            <374435..>376900
                     /gene="HSP78"
                     /locus_tag="FOA43_002154"
                     /db_xref="GeneID:62195555"
     mRNA            <374435..>376900
                     /gene="HSP78"
                     /locus_tag="FOA43_002154"
                     /product="chaperone ATPase hsp78"
                     /transcript_id="XM_038922455.1"
                     /db_xref="GeneID:62195555"
     CDS             374435..376900
                     /gene="HSP78"
                     /locus_tag="FOA43_002154"
                     /codon_start=1
                     /product="chaperone ATPase hsp78"
                     /protein_id="XP_038778383.1"
                     /db_xref="GeneID:62195555"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF07724"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF10431"
                     /db_xref="PFAM:PF17871"
                     /translation="MLSSLKARTSSVAQRAVQAERDALTRCAMRNEALTTCVFKYNRP
                     FSSLARQPISSPRSKTSQSSILKTIPQLSVLQSRMFSTSQPRAIQMRMDPKQQEQEPA
                     LKRFGTDLTEMAKAGKLDPVIGRDDEIRRTIQILSRRTKNNPVLIGNAGTGKTAIIEG
                     LAQRIVKGEVPESMKGKQVIALDLGSLISGAKYRGEFEERLKQVLKEVNDTIILFIDE
                     LHILLGLGKSEGSIDASNLLKPALSRGQLQCCGATTIDEYKKYIEKDTALARRFQPIL
                     VKEPTVQDTISILRGLKEKYEVHHGVRIQDNALVTAAVYSNRYITDRFLPDKAIDLVD
                     EACSALRLQHESKPDSIQELDRAIMTIQIELESLRKETDPVSRERRQKLEDMLKSKNE
                     QLARLTDIWESQKKELDEIKELKKELEKNRHELEMKQSEGNFAEASKLQYATIPEMEQ
                     KLNKLVKKQDAAANTDEGGVEPLLHESVTSDDICKVVSRATGIPVQNMMRGEKDKLLY
                     MEDALKARVIGQNEAISAISDAIRMQRAGLTSERRPIASFMFLGPTGTGKTELTKALS
                     EFLFGDDNAVIRFDMSEFQEKHSIMRMIGAPPSYIGYEEGGELTEKVRRRPYSVVLFD
                     EFEKAHPDISKLLLQVLDEGKLTDSQGNQVDFRNTLIIMTSNIGQTIMLSDHPDKQQI
                     NSLLKQTYAPEFINRIDDIVIFNKLSEKALRKIVDLRINEIQERLNDRRIELNLSNSA
                     KEWLARNGYEPQYGARPLNRLIKRTVLNPMSKMLLKGEIKNNMIVNVDVKKDQLAFDT
                     VVKKHRDGEKEKDQEDPDKKQHI"
     gene            <377585..>378823
                     /locus_tag="FOA43_002155"
                     /db_xref="GeneID:62195556"
     mRNA            <377585..>378823
                     /locus_tag="FOA43_002155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922456.1"
                     /db_xref="GeneID:62195556"
     CDS             377585..378823
                     /locus_tag="FOA43_002155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778384.1"
                     /db_xref="GeneID:62195556"
                     /translation="MTKIGNRKRKASAYIKKVRSVKDTKAKMIKAKVIKGKIAKGKVA
                     KGKVAKSKLTKAKMFKDKMTKRIKGRISVQGLKKISSPSSPVSAPDDDLFDDTGSMSD
                     ITSSSEYDDSVKKTNLGKKRKRYSKRDFRSCFNSFFQQLNCIPHPSSVKIDIDSEMKL
                     QRQRRLIELDRLRADSDDENDLSDVDNCLDLYERTNTASSQMTCKASTSKTFEKIEEP
                     LSQLTTGLEPVDRIILQAEGCSDEDRDLFKMASETNTLAGHLEISDPIGNDPEVENMS
                     AVKDVSGSCDLISATSFFKSLTDEEEVELPLEEAGESITCDYASLTPTSASSLNITDF
                     LNIDVPPEDDCTTVFHHNTIFPYRYNSDNLNLSLVDDAEALTSQPKGLPALNKRALFY
                     GNSQAMMSNEKSVSIDDFLC"
     gene            complement(<378933..>379774)
                     /locus_tag="FOA43_002156"
                     /db_xref="GeneID:62195557"
     mRNA            complement(join(<378933..379709,379757..>379774))
                     /locus_tag="FOA43_002156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922457.1"
                     /db_xref="GeneID:62195557"
     CDS             complement(join(378933..379709,379757..379774))
                     /locus_tag="FOA43_002156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778385.1"
                     /db_xref="GeneID:62195557"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="PFAM:PF03398"
                     /translation="MAISEETVFKTALKMTVSKLKFKADKMRTLNRLSLSSISKELND
                     LASEQGSKFDRELTMNKIRISKLVTDDNTADVYEILMVDCELLLSRLNRLLSIKHDRK
                     TGEIEAGADETVIKLAKKMIFASSYISIKEFRKLATLLANKFGRPFYEQALIDDSEDD
                     FVKKCKGENVDELTEMYLKEFCETYRIDLYGEGKYEVEKGEGEASTDASTDASADAGA
                     KTETGTEAGTEAAPASSDNAKEDHKSQTPLNDMDDLKKRFSALKRL"
     gene            complement(<379867..>381393)
                     /locus_tag="FOA43_002157"
                     /db_xref="GeneID:62195558"
     mRNA            complement(<379867..>381393)
                     /locus_tag="FOA43_002157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922458.1"
                     /db_xref="GeneID:62195558"
     CDS             complement(379867..381393)
                     /locus_tag="FOA43_002157"
                     /note="BUSCO:EOG09341JWO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778386.1"
                     /db_xref="GeneID:62195558"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="PFAM:PF06423"
                     /translation="MSLKDRKEAFVTDLTGGSTLDIYTVTSISACSYLIWCILKKRTK
                     LFDDPKDLLGQLVDFCLNWNNLLLAVTAYSNNISLMMFLIGLPVLFIILGTKDKKRSQ
                     RRTIKVNFETLTPKQFLPFKSYITIYRSQMMILTCICILAVDFPLFPRRFAKVETWGT
                     SLMDLGVGSFAYSMGVITARSFLRQHFLGKYSYIRNMFKAIKGSLPILAMGLIRLACV
                     KYLNYQEHVTEYGKNWNFFFTLGFLPFLTNLTAPIVFKVSPLILSLIIGLSYEFALNQ
                     GGLMEFIVTAPRVNFFSDNREGIFSLIGYFCLCLNGLALGSIILPVVPAPNNLIKMTN
                     SREDFINQQKQQKSCWTLTPLQGLSLMTVLFHVLFYIGDRCYTYEVSRRMTNFLYVIW
                     VSAYNSTFLLCYKLIENFIWGEVKVQYSTSKEDSKTEHSTDLHVLEASETVPISLTAV
                     NNNSLTLFLLANVATGLVNMNFDTLDSNEWSGIAVLMGYEFVLALFTMLMYHRGVIFK
                     "
     gene            <381861..>387071
                     /locus_tag="FOA43_002158"
                     /db_xref="GeneID:62195559"
     mRNA            <381861..>387071
                     /locus_tag="FOA43_002158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922459.1"
                     /db_xref="GeneID:62195559"
     CDS             381861..387071
                     /locus_tag="FOA43_002158"
                     /note="BUSCO:EOG093401XZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778387.1"
                     /db_xref="GeneID:62195559"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="InterPro:IPR036621"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF05773"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF12745"
                     /db_xref="PFAM:PF13393"
                     /translation="MGTVEEYYQEQLDEFEALKAIYPDLLVDKTPTSSAWNQKLHPKF
                     EITLSSDKCKDPVLSVTVAVEFTATYPQSVPIVKFEKPKNIMASQMDCIRRQCERILK
                     DEKGQPVIYSITSTIQEYLDEIQQSARTESLEEERLKRLESEKMKLELKQKREEQEIE
                     QEREKEQEMLDEMVQREMRRRDDNDRNEMSYEPMKEANSMYGTININDETLIPTMDEL
                     QNGGSYFVFDKSITVEIQHLQFSFRTVTGFVPVQPSGLLKQISKQFLVKPYVKKGSQA
                     ENVLKNLASNTGILKRRYGRNISGIEDDLQCVITVIELTNPYWNTTQGKKTMLTLEKE
                     LQAVLELKHDNVDRVLAFNIEKLEVTSKGDISLENSAARKTSKKVTAENEKLTIWKIR
                     ILSGYCESLGELLSTISFLNLNSAREWTIQMLESLEYLHKNGLIHRCVTLDSILITQP
                     KALGSTSVKLSSTCYGYTLLSMLYLHPNLDSDGDEDLLPFENGGWTAPERINSNGNGI
                     FLKPQRKTDVWDIGVVFVQTILGTDIIYQFENPSDFLNNCTNLDESLRSFLESIFEVK
                     TRKRPDPLELLPSKFLRLNLNVSPLAELTARDAQSSSNLDSSVIKNRPISGFTDISTE
                     PVLMIPQRSSIAGHRAKRDSFGMSMLAPEQRTYSRYAQDFEEVGILGKGGFGEVVKVR
                     NKLDGRFYAIKKIRHTEDKLAKIMNEVMLLARLNHQYVVRYYAAWLEDDYAYKLAGGS
                     AIESDSESNSKEESSDDSEEVENERTLSEPRTNSQSFTDFISGSTNPELEFDFSDTSG
                     EEEEDIDGNDGEAGGNDAQKPAEAKNADSPAANDDAEDSAFTFGTPSEKGLNETLVRT
                     ASKQSRSKKKSVLFIQMEYCENRTLFDLIRQGLPNDSDNYWRILRQILEALSHIHAQG
                     IIHRDLKPMNIFIDRNNDVKVGDFGLAKNVHSSSSATKLVDVERSNEDLTSDIGTTLY
                     IATEVLDGNGDYNEKVDLYSLGIIFFEMIYSLGTSMERYTAIRNLRTLEIVLPSDFEA
                     NKLATEKTIIKMLLNHDPAKRPSANELLQSGLVRVQQQDTLMKEALDALVDPSSSWHH
                     QARNILFSQPYSFARDLLFGDYSDKKQFEVSDFLLHTTIENEVAKVFQEHGALKFYDN
                     NSLMFPRTPLYDENYQVYEVLDRAGSVLQLPYDLTLPLARLLGRRKLSVHKIYRIEYV
                     YRSMENDEGSGPIKFREADFDIITEPADVPEYLPFSDAECIKVISEIVEIFPFIRASN
                     VKIILNHCNLLETTLEHCGIERAQRLMVSRILAEVGYSKTMKEAKAILKQELNLPSTI
                     LNELVQFEFSAPIEVCKAKMHKIMLDSPLLAKVDASLSYLSRVVRYLRLFKVNLTVEV
                     CPFSGYNASFYRGGIMFTAIYEDKRRSIICAGGRYSFLIGSLARNKAPGSLPNAVGLR
                     LAWDFLYNSMKRYIDMLKRRKSSRKKKEQTEQLKLTWNPSKCDVLIGFFSVGILKEAV
                     PFLLNYLWSSGISADITKSCLTTEEMANQVIKDNVKFLLIIKAQTSLQALLRQNKSSS
                     NYKLLRLKNLETKTDYEVDLNDLVSTIKEELTQEKPKEADELEDSLVEESDHKTESDE
                     VRNPNQKVVVVANHATNANKKNNRKEKWAMVDDALKATDSLISTLGGAPVFTIEAREE
                     VLDMISITSLDQPEEWKRRVGGVSSATPRSFVGNIYSSLAKEAAKGTKWAVVYGGPKS
                     EKMCVVDLQR"
     gene            <387171..>387923
                     /locus_tag="FOA43_002159"
                     /db_xref="GeneID:62195560"
     mRNA            <387171..>387923
                     /locus_tag="FOA43_002159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922460.1"
                     /db_xref="GeneID:62195560"
     CDS             387171..387923
                     /locus_tag="FOA43_002159"
                     /note="MEROPS:MER0000841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778388.1"
                     /db_xref="GeneID:62195560"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="InterPro:IPR036959"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF01088"
                     /translation="MSFQDFGSVVPLESNPEIFTEFGRKLGLSPLLNFFDIYSITDPD
                     LLAFIPRPLNSIILLFPITEQYEKFKKEEEEEEEKAAQPHQDNFESVIWFKQLLKNAC
                     GLYGLLHAICNLPTGLIVDQSQMCKFVENIKALPEVSNSNHFYEKTKLISDLFLSTYN
                     DFSQQGQTEAPSAEDDVDLHFICFAKGKNGHFFELDGRRDGPLDLGEPIDSHQDVLAS
                     QAILSRIKKYMSLADDKNGMNFAMMGLGPVME"
     gene            complement(<388061..>389459)
                     /locus_tag="FOA43_002160"
                     /db_xref="GeneID:62195561"
     mRNA            complement(join(<388061..388078,388155..>389459))
                     /locus_tag="FOA43_002160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922461.1"
                     /db_xref="GeneID:62195561"
     CDS             complement(join(388061..388078,388155..389459))
                     /locus_tag="FOA43_002160"
                     /note="BUSCO:EOG09341U3S;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778389.1"
                     /db_xref="GeneID:62195561"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="PFAM:PF03399"
                     /translation="MKHYNSVAPRMSLKENKEQKNMRDPSNWPKPLHEFISNCFSKAS
                     EMKLPPTEKTKFQGELKNLINLAITKGKIEENDWTQQVLPSLERRPLKLDLYCNSIRH
                     KTVRSFTPPNQNFIRIAIPKKRNMFDQDSDGDTNSGDDSYEPTINSTKIHPIKKLKKK
                     TNNTSSMVNTGNGDRMTSEERKKLRGKRFQRELNYTPTYEPDIPNYDTNKQFVGKSTT
                     LEKRYLRLTSQPNPSLVRPVHVLRKTFQLLMDKYLEGTKYNYLCDQLKSMRQDLTVQN
                     IRTDFTAMVYEFHSKLAIEFADLGEFNQCQSQLKLLYNDPRIKGTDKDEYNAYRILYC
                     IITTDYNEANNLKLQILGEKAIIDSHFLEDAFRLLNYVITGDYYRIFDIARQIRTKNE
                     KDQKQVHTKTHIDILQDPNALKLNHAEMYFFFKFLEKILDRERMKTRN"
     gene            <389615..>391009
                     /locus_tag="FOA43_002161"
                     /db_xref="GeneID:62195562"
     mRNA            <389615..>391009
                     /locus_tag="FOA43_002161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922462.1"
                     /db_xref="GeneID:62195562"
     CDS             389615..391009
                     /locus_tag="FOA43_002161"
                     /note="BUSCO:EOG09341FZV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778390.1"
                     /db_xref="GeneID:62195562"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MGDVFDFDEDDLVSNFKKKVAMDSSSVNDHPEPQEPDDGEGVKF
                     FKKYESNSVVSVGPIGKRLGTSYKVEIDEFYEAESRSNSAAGVDNVHKLPRMIYSSLH
                     KTKPKIQDFEQLKVLGKGSYGKVLLVKHKQSGKLYAQKQLQKASMIVNAKNYEQTLTE
                     RTILQKVTHPNIVKLYYALQDFDKVYLFLEYLDGGELFHYLREERILSEKVACYYVAE
                     LILALRHLHTNAGVIYRDLKPENCMLNDCGHLVLTDFGLSKASRECNSMFGTAEYMAP
                     EVIRAEGYDSQCDWWSLGAVTFDMLTGTPPFTGNNHKKIMDKILRQKVKYPFYLSLDA
                     KDLLRRLLNKNPIKRLNCDTDFEKVKAHRFFRYIDWNDIITQNDEKLPPPIIPIITDP
                     EEAENFDEEFTSMAITPPSSPIGDSLFETIEESRSTSTSSFIPIQRPDPDNRNDLKKS
                     VYFTGFSYTNESLL"
     gene            complement(<391087..>392964)
                     /locus_tag="FOA43_002162"
                     /db_xref="GeneID:62195563"
     mRNA            complement(<391087..>392964)
                     /locus_tag="FOA43_002162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922463.1"
                     /db_xref="GeneID:62195563"
     CDS             complement(391087..392964)
                     /locus_tag="FOA43_002162"
                     /note="BUSCO:EOG09342HBD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778391.1"
                     /db_xref="GeneID:62195563"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF02148"
                     /db_xref="PFAM:PF07576"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF13923"
                     /db_xref="PFAM:PF17123"
                     /translation="MQEYCESTYTVLFDIFKPAKLIGQAEIANNPKALDYIYTLQKND
                     LLQYPEDLVLDPWCNQVYIKQDIFVRTVKSSLSSKSSASSLSSSLKSDSEQSILAEKK
                     LGQLRLEDWHTEPSHNQFNNYLDYRFSRLEITAVDMKKGEILSANEPLKAKLLGYGVV
                     RLYKDRENEKEELRRNSGDQTTVAILGVPFYFTASDLLLGFFDKDIPNNVSHMRLLKT
                     QTPNRFMVLLKFCAVDKAAEFVQKYNGKHFNSMEPEACQVIFIKEVLFRPVNHTADKM
                     NTIPYLLDDPFTKVESPKAVTASSSSNIKPKVNTSAYTELATCPVCLERLDSNVTGLL
                     TIPCQHTFHYTCLSKWNDDTCPVCRYSGKSDMRKRKQEEQDEKCFECGSTENMWICLI
                     CGHIGCGRYDQGHAISHYNETSHCFAMEITTQRVWDYSGDNYVHRLVQNEADGKLVEL
                     PLRDDRKGAEDSSDDEDNDAKIEKIGLEYSKMLISQLESQREFYDMKYEEAQNQLKLA
                     NDGLNEVRKNVAVLTTELSKAKEKLNSSAQQNRTKNELKEMKSKYEDENTINGGLSEK
                     VKYLTERNDQLAKTNEDLQEQVKDLMFYLESRDKFKDAADDVKEGKVMIIPKKTTKKR
                     H"
     gene            complement(<394437..>399419)
                     /locus_tag="FOA43_002163"
                     /db_xref="GeneID:62195564"
     mRNA            complement(<394437..>399419)
                     /locus_tag="FOA43_002163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922464.1"
                     /db_xref="GeneID:62195564"
     CDS             complement(394437..399419)
                     /locus_tag="FOA43_002163"
                     /note="BUSCO:EOG093403G0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778392.1"
                     /db_xref="GeneID:62195564"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="PFAM:PF00575"
                     /translation="MVEKRHREEEEVAESGTSKSILTQSAEMSFPRGGDSVLTPLEIK
                     EVSNKAKSDVLFEQKSVISGHKKKRARKSKVRTADEKDTEDNETVDSVSFKILQPGSF
                     VLGRISHINKMEIVLSLSDNLEGYIPITNLSDEVSKTLSVVDDEDDDDDESSSDDDEE
                     SSIPSLSSLFTIGQYLRAIVTENTSDTGKKRLELSIEPSKVNEGMEKDDFCVNTIVQA
                     SVKSVEDHGAILNVGHSHLSGFISKKELPSSVDVGSVLLVVVSKKSGRTITVKLPTET
                     IVKKLNTVQSATNVNAILPGMLVDAAVLNVFADGIIVKALNLCNGSISCMHLGFYELE
                     QLKHRFSTGSQIKARIIASYMKNGQKKVMLSILPHILTLSQFAYDPEKDSDPLEAFPI
                     GHIFDEVIVKGKDSHYIFIDVGSRNAIGQVFKTRVSENADLDMDFKIGSVHKARVLDY
                     SSFDNIYILTMDKAQINQKYLRIEDLPTGQLIHCKVEKLVPGKGVQVRIENEFNGFVP
                     SIHMSDIHLAYPERKFKIGSKFNGRVLRVSTEGRRPSAFVSLKKSLVRIENEDEVVKS
                     MDDAVVGKKAPATIERFYPGGCLVSFFGDVRGFLPISEMSETYVKKAEDHVKLGQTVR
                     VTMIDVDKEKDRIRVSLRASSTISESQTDALEDIVLGKTIVEAHVVERNKDCLILELP
                     PSGVRAILPYGQVSDENYENSRARMKKISVGSTVKVVALSKDHKGRFVNVSCKPSILK
                     DAEAGKFPSSYSEVAHSHELLHGWVKNVNTHGVFVSFADELTGLILPRFISEDMAEDL
                     EKNFFVGQSIACKVVDTDDAHERFLLSMREDGIVVSETAVNPVDKSVKLLNEFVPGKT
                     TKGIIKTVQPTQLTVKLADNQLGRLDKVDIADTEKSFSDYKTGDVLNVRVVGYFDSLN
                     RTHNFVPNRDMSDTTIKLSMKKNDVVSIEDLEEGQEVTAFVSRVSEDAIYVDICPQVK
                     GKVSMADLNGEALELDDLDQSYPVGSALQLVVKSVDKESSLVKLSAKEGSTNSFESIK
                     VGTILPGKVFKVEETYVLVDLGHNIEAMSYITDALDDYSKTMEDTFSINQKVMAKVTE
                     IDTSNGRIFVSLKTKDVKDRLIEKSEDIKVGDVLRGIISNISDKGVFVAFSRKLFAFV
                     RVSDLSDSFLRDWKSFFKLYQPVIGKIVHSGGAGKIMMSLRESDVSSKGGLKRFEDLK
                     VGDIFNGSIKRVVDFGVFVKLDGTVNITGLCHHSQISDNRIDDVASIFAEGDRVKVKI
                     MEINLARKQLSLGMKASFFKEVDDDKYSDEETASVGGEDGEDVEMSDDNSDEDNSDED
                     IVDGNETLDLPSNPSQGLSAGFDWTASILEQAKDDVESDDDEYDENLKKKKKRSKLST
                     AVEDKTAEINTRAPESVSDFERLLVGNPDSSILWIQYMSFQLQLGEVDKARELGKRAL
                     KTINYREEQEKLNIWIAMLNMESMFGTDESLEKIFKKSCKYMEPYAIHQKLVAICVAS
                     EKFDKASELYRVMCKKFGYDHVPVWVSYGSFLIDRDEADEAHKVLSNALQILPKRSHV
                     EVVRRFAQMEFDKGDSEQGRSLFEGLLSDVPKRLDLWNVYIDQEIKNGDKKKAESLFE
                     RVSARKLTKKQAKFFFGKWLAFEEKEGDSKAGDYVKAKAVEYAQKLVDKQ"
     gene            <399746..>402478
                     /locus_tag="FOA43_002164"
                     /db_xref="GeneID:62195565"
     mRNA            <399746..>402478
                     /locus_tag="FOA43_002164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922465.1"
                     /db_xref="GeneID:62195565"
     CDS             399746..402478
                     /locus_tag="FOA43_002164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778393.1"
                     /db_xref="GeneID:62195565"
                     /db_xref="InterPro:IPR027794"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="PFAM:PF13691"
                     /translation="MYLTEEIFASRALFRTLRLDYKIQYRKLTNFAPAGMSFELIPVA
                     HPTSDLERPAVFIRDTLSGSRQLVGNVPEGLQRKCNEFGFKTSKLEHIFLTGILDWKS
                     VNGLPGLILTVSDQGLKKFGVYHSGNQILQYLISSWRFFVFRFGLQLDARDLDSPFES
                     DKFIMKPVNIDSINPLNVVNKPSDISKLQIMVDQIFPTAVDTDFSAKVVTNVGLPKSV
                     RNPKRSVSWIMMGNPIRGKFMVQQARELGCKVEHFRHLCNFEPVTLDDGTVINPEQVL
                     EPTRCFQPILFVEIPSEDYLQGTFNHDWSSELKSLNSSSFGVVYHFIDDSINNPLNNP
                     DYVKFIQSFGDKTLHFISHKQYVPNLINYETSYNTSLKWKTLLKSWFPLYRWNSEPKL
                     QIPSCLKSTGRVFPMVSGQVVNLKAGEAVLFQKNTVNGTLKDSQYFENIYDKEITPIH
                     LNQVASKDEFVHTAIDKQRDSLLHSPPRSGSSLNSQMETVVLGTGSALPSKFRNVLSN
                     LVRVPYKGVYRCILLDAGENTLGTIKRLFSDEDVDQIFAELGMIYLSHLHADHHMGIT
                     SIIQEWIKRQKLHPTSNKHLYVVTPWQYEKFLMELDQVESISDPSLIRYLSCDQFNHC
                     SNTMLPEFEQVPIEDMPANEILNVENHPREFVPRNATASELFEELHFLDFQTCYAYHC
                     DYAYSCSITLALDDKSQFKVSYSGDTRPRYQFAKIGYKSDLLIHESTLEDDKFEDALA
                     KKHSTTSEATQVAILMEARKVLLTHFSQRYRSFTNSEDVYKQLNDPKEQEAADVDIDD
                     QIQPSTPLTSFLENRDLLKKENDDSISIEQKANIFKVPLNKSMKENAKTMQIVFAFDN
                     MIIRYDDFALQREVIEREGSKLELLFKSEDKDEQEEGVPSPCKTNKKKNKKRRI"
     gene            <402725..>403750
                     /locus_tag="FOA43_002165"
                     /db_xref="GeneID:62195566"
     mRNA            <402725..>403750
                     /locus_tag="FOA43_002165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922466.1"
                     /db_xref="GeneID:62195566"
     CDS             402725..403750
                     /locus_tag="FOA43_002165"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778394.1"
                     /db_xref="GeneID:62195566"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR037256"
                     /db_xref="PFAM:PF04739"
                     /translation="MNNAEISENSQFNGKSRTSGKVPRPSLAKRRQSDEFSQTFVEYV
                     DTVDESDNEDDVSDNSFTNDDYVYDGASEDPCKHYAPATFFSDADDGSVESVYNKVPI
                     GSDEDDVDDEGSTDTTDHADGAHVNREGILTHHHISSSYTTEIPEFYDPEKIVYPGLS
                     PYEFSDEEFSKMNHFEFLRSLNLEEPPLLPPYLNSNLLDDSSSKDYKQYPYQYQSSNH
                     VYINDQYSYQINNLNIMDKYAVINSSAPPKRPDINRSSSSQSSIKSIRNELLKNKEGH
                     PKLKHVDYIEQVEKRHNLVPSHVMLNHLITSNLKLNKVMTGSCIHRYGGKFITQIVYF
                     PVASQKE"
     gene            <405321..>406454
                     /locus_tag="FOA43_002166"
                     /db_xref="GeneID:62195567"
     mRNA            <405321..>406454
                     /locus_tag="FOA43_002166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922467.1"
                     /db_xref="GeneID:62195567"
     CDS             405321..406454
                     /locus_tag="FOA43_002166"
                     /note="BUSCO:EOG093417VH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778395.1"
                     /db_xref="GeneID:62195567"
                     /db_xref="InterPro:IPR036047"
                     /translation="MAEIDLIEKRLRCLSLADMRSHSSKTASQFALELFEVAASKERV
                     GLLTDAVEFYRMAYKLDDKVDLKYRKKIFEDLPPLEKRKDGIPKVDHRFKKLDLSKIR
                     VRKTLASYKNCQFEPLDESLSPVLAISVLPDEILMKIMKILLLGDSPSWFNFSMSCKK
                     CAYLGLYDGTIWRLLARIVYPHQVYQKGNNRDYRVYIRKQWGRNYLKMLNERPFIKYR
                     GVYISTVILQKEGGRGELSSAWTAPFRIITYYRYLRFYEDGRCLKLLTILEPKKVIPR
                     FKQNWRGLIKADQVDENTIGKEWQRVYEGAFTINLQGDLVIESDGAYPDWTFTDKLKI
                     VNGGRYSRHHKLMWLDMGYKNKHGEPGSFSLEGEKPYVFNRDK"
     gene            <406947..>408653
                     /locus_tag="FOA43_002167"
                     /db_xref="GeneID:62195568"
     mRNA            <406947..>408653
                     /locus_tag="FOA43_002167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922468.1"
                     /db_xref="GeneID:62195568"
     CDS             406947..408653
                     /locus_tag="FOA43_002167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778396.1"
                     /db_xref="GeneID:62195568"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006252"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="InterPro:IPR019830"
                     /db_xref="PFAM:PF01274"
                     /translation="MPSALLYNSTLDGVQVVGEISGKTENSPSSPKDILTKSALKFVV
                     FLHRAFNERRKVLLAHRQEVQKELDNGGQLHFLKETEYIRNDPNWKCLPVHPKLQCRK
                     VEITGPPDAKMIVNAFNTDVQTYMTDFEDSCSPTWHNMIYGQVNLYDAIRDKIDFTNP
                     QTGKRYKIKRDGRRVPVMIVRPRGWHMVDRHILVDGEPISASMLDFGLYFFHNAKYLI
                     EQGLGPFYYLPKMEHWQEAKLWDDIFSVSEDSLEILRGTIKATVLIETLPISFQLDEV
                     LYALREHSSGLNCGRWDYMFSTIKRLRNQKEHILPDRNQVTMTVPFMTNYVKQLIKVC
                     HKRGVHAMGGMAAFIPRKDDPAKNIEALEAVRNDKLREVLAGHDGTWIAHPGLLATAR
                     SVFEEHMPTPNQVFKQKPDTAVTESDLVDTNIQGGHITRKGVEANIYIGLNYMESWLR
                     GFGCVPINHMMEDAATAEVSRLQLFSWSHQKVTLQDTKETCTPEFVIKMINEEASKLA
                     TKDGNKFAEASKALTDEISDKKPVAEFLTDILYPQIVTVGQPVDLSFLKASEQQICQL
                     KL"
     gene            complement(<408743..>409735)
                     /locus_tag="FOA43_002168"
                     /db_xref="GeneID:62195569"
     mRNA            complement(<408743..>409735)
                     /locus_tag="FOA43_002168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922469.1"
                     /db_xref="GeneID:62195569"
     CDS             complement(408743..409735)
                     /locus_tag="FOA43_002168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778397.1"
                     /db_xref="GeneID:62195569"
                     /translation="MTSIAPPRPVSSSRENYHYAKYTPKKPSIPAADDSEEFSSSSSN
                     ASEEEEEDVEPLPVISSEAVKKAHEQLTSRRNSLQPVHPVQPSQPRRTTEAAATRPKA
                     RPPVEQSRFIQASSTPVNFKQVQKNAALNNVNRNLAQTLRKFSEEEDDEKREDRDNEH
                     HEDEDALTNNNLFKELTEKRKEVGNLQLELDKYKRLVREMKSSTESQENEISTLKKDL
                     QNVVTKFRKLYGNEEDKLNIEFGKNWDSLELNKVENLTWVEATNDIKNVLNRFGVKYE
                     DLRNRVKFISEKEFWFISELHKVLHGNELKGEEEMRECMDVMMDEIRQLVKLAR"
     gene            complement(<411235..>412122)
                     /locus_tag="FOA43_002169"
                     /db_xref="GeneID:62195570"
     mRNA            complement(<411235..>412122)
                     /locus_tag="FOA43_002169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922470.1"
                     /db_xref="GeneID:62195570"
     CDS             complement(411235..412122)
                     /locus_tag="FOA43_002169"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778398.1"
                     /db_xref="GeneID:62195570"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="PFAM:PF09084"
                     /translation="MTLKVGYIPEHFSTPIAFAAKYDYFGENGLTNVQLIPYPSGSGH
                     LISSLKTREIDIAIGLTEAFVRGLCQGDGGDYQISGEYVESPLCWSISSGNGREDVNK
                     IEDLEGKRIGVSRIGSGSYIMSYVLALEQDFGKSTFEFKILENFENLRNSVNNRSTDA
                     FMWEYFTTKKYYDSGELKKIGEIYTPWSSWVISSSTSKDVQELVPMFLKSIQQGINYY
                     NEHEDEALDDILENLDYNSRDDLKEWAKRVQFTKDVTKIYFNKNIIKTKDVLKTAGLI
                     TDDDSVVLRRLKQGVRSEM"
     gene            complement(<412240..>413656)
                     /locus_tag="FOA43_002170"
                     /db_xref="GeneID:62195571"
     mRNA            complement(join(<412240..413474,413650..>413656))
                     /locus_tag="FOA43_002170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922471.1"
                     /db_xref="GeneID:62195571"
     CDS             complement(join(412240..413474,413650..413656))
                     /locus_tag="FOA43_002170"
                     /note="BUSCO:EOG09343C9K"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778399.1"
                     /db_xref="GeneID:62195571"
                     /db_xref="InterPro:IPR007823"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF05148"
                     /db_xref="PFAM:PF08241"
                     /translation="MSNGIISNDKRLPLHLVQSGNDNYFKKMPLFEIDGWNLGDNSVV
                     PGVTAEDLKRKHKKEKKKQRKEKWEEREQEKKKRELETDSTEPEDHKRPKKSEVRADN
                     NHDTPSSVAPPPAPAKLDTTNLTPLQCKMLNKLSGSRFRWINEQLYTADSEDAVELME
                     KQPELFEEYHKGFRSQVEAWPENPVDLYIKHLVFRGSNRAINSPGGLPGLEINGKKTV
                     VVADMGCGEAKLAVEVERYMEFYDKDSKKALKIFKKKYGGDSDIFAKNKKLNFEIHSF
                     DLKKMNDKITVADIKHVPLKNRSCSVVIFCLSLMGTNFLDFIKEANRILIPRGELWIA
                     EIQSRLTDDKGEEFSEVLSRLGFKHKETDTSNKMFARFEFFKPLNEVDPDLEDLEDLE
                     EKRKENKEGKWLLKPCIYKRR"
     gene            complement(<415825..>417291)
                     /locus_tag="FOA43_002171"
                     /db_xref="GeneID:62195572"
     mRNA            complement(<415825..>417291)
                     /locus_tag="FOA43_002171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922472.1"
                     /db_xref="GeneID:62195572"
     CDS             complement(415825..417291)
                     /locus_tag="FOA43_002171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778400.1"
                     /db_xref="GeneID:62195572"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR036887"
                     /db_xref="PFAM:PF04383"
                     /translation="MYQYMSSGPSRKSEQQHFDSSQLVQTQQLQAQPIKSQTVTQTQA
                     QQQQQQQQQQQLQSQQRRSQPLQSQSQSQSQYTYPVSYEPQGMANMHSSQAASAANDA
                     ARTSPNNVAQSVPTYQSYQGQASYPYQGMYTQYGATGTAASNPSLNSADNVVRSTNSS
                     SPAYGSVYYPGSYGTTTSGAHVANQTTGYYQPGYPVQYMYGAAGPPAITANTSVTSDM
                     QHSVLKPKIATTMWEDEKTLCYQVEANGVIVVRRADNDMINGTKLLNVTKMTRGRRDG
                     ILKSEKVRHVVKIGSLHLKGIWIPFDRALAMAKREGIYDLLYPIFVKDIARLIQQGTP
                     VSDDPKLNGNLDVSDSSRSLSYSTYNSQPQNQSATQQIPQNQYQSSSQSVSRAPPSHS
                     SSSQSRSTQSSQVPPQQQSLYYYPGYVDQSFYSRQGAQQPQSQVQQSYYPYYSQVPYF
                     QKQTSTNNGSSFQDPKSSEAKQQQKQQQKPIPPSSSTQ"
     gene            <419067..>420570
                     /locus_tag="FOA43_002172"
                     /db_xref="GeneID:62195573"
     mRNA            join(<419067..419075,419314..>420570)
                     /locus_tag="FOA43_002172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922473.1"
                     /db_xref="GeneID:62195573"
     CDS             join(419067..419075,419314..420570)
                     /locus_tag="FOA43_002172"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09342LR0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778401.1"
                     /db_xref="GeneID:62195573"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="PFAM:PF00149"
                     /translation="MFFKAFSAPYISDLYRYYLNSDLLPNPADIRILAIGDPQIDGAW
                     PNTTPRKRLDIFGNDYYLGHIYSVMKRRLQPSVVTVLGDLISCNWVSDSEYFNRTERY
                     ANRLFPRPDSVRPDSPSAIDLLERRGIRNQSSYEKWFHNALKSNIFDDSYFGYEDLNS
                     WSNDSSEPLFINTTGNHDIGYSGEMTYDNIYRWNKFYGKDNFWIEYAKNTSHPWRIVV
                     LNSLMLDGPAKHNDFVEANWNFVRTVSNRQFNGSTILVTHVPLFKPAGVCSDPPQTQF
                     FTKENSAAYDWNKIGNLKSQNLLSYETSQKVLDALFRNNQPGIILNGHNHEGCLSYYS
                     RDQSGEWIVSKDRPINDTGSYIREVTVRSIMGDYDGSTGIVTGHFDNNKKIWRFEYSV
                     CPFVVQHVWWASKVTLLISILLQSIAFFV"
     gene            <420810..>423053
                     /locus_tag="FOA43_002173"
                     /db_xref="GeneID:62195574"
     mRNA            join(<420810..420815,420957..>423053)
                     /locus_tag="FOA43_002173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922474.1"
                     /db_xref="GeneID:62195574"
     CDS             join(420810..420815,420957..423053)
                     /locus_tag="FOA43_002173"
                     /note="BUSCO:EOG09341F8N;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778402.1"
                     /db_xref="GeneID:62195574"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="InterPro:IPR036443"
                     /db_xref="PFAM:PF00641"
                     /translation="MRNEPRTERTTSVASDGSFPSIASSTSTASTAGKASLEKSPEKS
                     CDTDLKVSDRFDDSSAYVFINISSTGSEQMPHTNKDSSEIIEIAWSIVDCEHLETISS
                     DSRLVKPINTPITPLCSSLTGLTWNSVKDAGSLNEAIIALDKSIQKHLISNKRSFNFI
                     TFDSWDLRMRVPKESREKSIELPQYLKYPKYFDLRREFVRYEEASKGELYASGSISEI
                     SLGQVMDVLKLSPVDAPSPISNIGDLDTFTSASSATIQSLLLIFSALVDASTLSKPHD
                     MGLDLSQFFSERSKVLYITNLPLDVTQGELESWFTQFGCRPIAFWTIKSPLPEFGTNS
                     NFNNSNAIIMRSTCSGFVIFASHESASDSLAMNGRILNDRIVEVQPSSLKVLDKAQDI
                     LTPFPSSKNRPRPGDWTCPSCGFSNFQRRTACFRCSFPVASAQTVQDSIYANANANPS
                     NGNVNGGGSPGDLVNSGIGDSFFNHHRPHPNGHHTQHQNGNHSYNTTNSGNNSNNYNN
                     YNNNYNNSNNNVGNRQNLGSSNVPFRAGDWKCMNENCAYHNFAKNVCCLKCGAPRVQS
                     AILTGHQHNSRHNNGNNNVKLNSFQGTNGYSKRPFAQSNFTQFVSQLQPFSQQNTSSL
                     ADTNFDTLSAQINGLNLGQPQSQSQSQVQSQSEPHPQPEPLPQNSTGSINPAGTSIYN
                     NRADLAGPTMGLNMDNEY"
     gene            <423545..>426304
                     /locus_tag="FOA43_002174"
                     /db_xref="GeneID:62195575"
     mRNA            <423545..>426304
                     /locus_tag="FOA43_002174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922475.1"
                     /db_xref="GeneID:62195575"
     CDS             423545..426304
                     /locus_tag="FOA43_002174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778403.1"
                     /db_xref="GeneID:62195575"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="InterPro:IPR032880"
                     /db_xref="PFAM:PF02714"
                     /db_xref="PFAM:PF13967"
                     /db_xref="PFAM:PF14703"
                     /translation="MPSRFGDTDPPPYDPRAQTQTVFWVQLGICTGLGSIIFFIFCLL
                     RRRFPILYAIRPYRNKKIRMLPDSLFGWFTILFNISSEDVLQVAGLDSYVFLRFFRMC
                     LKILLVMSFLGACIMSPLRYWLTGQFDNDFYLQKGTDDHVDPPVYLLVCTIFTYIFTG
                     VVYYFLFAETKHIIRTRQRFLGSQKSLTDRTIMITNVPKAMRDELVLKKHIENLGVGS
                     VDSVILVRDYSKLAELFKEREEYVERLEMLYSEYYGLDVRIWLKHRTPSTTLRVKREE
                     RPPKKDDIVYSPNVDSVNMSSDGFITVLNSDKSRPTHRLGLLGLFGKKVDSFNYYSHR
                     LVNLDKTIRQIRVSANFKPIPYAFVSMKSVTNAQMAAQALFSPNPLQLETCLAPAPLD
                     IAWNDLLLSAKSVFMRKNGIELVCIAFSALLIIPIRYITSLLNVESIRKIWPTLGKYL
                     LTHDKARTLVTGVLPPYLFTIINSILPYLISFLCQLQGLPSKGQIELSIVRKNFMYIF
                     FNMFLVFTLFGTISSYKALLTDTTKIAPLLAKSMKSLSLFYIDLIVLHGLTMIPLQLL
                     QPGDIFLNLYSLVFLHFQQTPKKYRDRFYKPTIFQVGLILPQHLMIFIITLIYSVMST
                     KIMICGLIYFFVGYGVYKYQLVYAMVHPYHSTGKVWPIVFQRVCLGLFFLHLQTFGSL
                     ALEQSYAPAALMIPLFPTTLIALMYFKRNYRPLLQYIALDAIKTEGESVEPDGDDDLE
                     SLIAASGIHKRGDSLMLTDAYYDSIDSVDQQQGEEGQEEDPEQQEQPERPEQPEQQSA
                     NISDDETDRLYEDEIANVSQSTEQPYSSSHRLRRRPSTIEEEREAYQSYTYPCLLDPM
                     NGPWAGFVGDYIDIMRYRTVARIPHGSYGSMEQAEEDLEAYPGESQELKTEIVRKESS
                     KNELD"
     gene            complement(<426328..>427722)
                     /locus_tag="FOA43_002175"
                     /db_xref="GeneID:62195576"
     mRNA            complement(<426328..>427722)
                     /locus_tag="FOA43_002175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922476.1"
                     /db_xref="GeneID:62195576"
     CDS             complement(426328..427722)
                     /locus_tag="FOA43_002175"
                     /note="BUSCO:EOG09342OSR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778404.1"
                     /db_xref="GeneID:62195576"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="PFAM:PF01233"
                     /db_xref="PFAM:PF02799"
                     /translation="MANKEENGDNSRKGAPTKSIADLFKKLSIQEQPESPKKDMKDYK
                     FWKTQPVTKFDESVLQEGPIDSSKKTSDIPKEPFPMLPQFEWVTLDIDKDEEMTQLYE
                     LLYDHYVEDHDSTFRFAYNKDFFNWALKPPGWNKEWHLGVRVKATKRLVAFISGVPAN
                     LKVRDHQFRAVEINFLCVHKKLRNKRLAPLLIKEITRRINLCDIWQALYTSGTVLPSP
                     ITVCRYAHRPLNWEKLYDVGFSALPEDKTKAQMMAKFAISSSTKTRGLRKMRQTDIDA
                     VFDLYNRFQKRYEVSQEFTKEELSHWLLGDAHERTLSDSDKVIMCYVVENEDGRITDF
                     FSFYILPFSVLNRPSFTNLGVAYLYYYASDTASEAESRFDSEATKKLTKRLESLVSDA
                     LVLAKNVGVDVFNALTSQDNVLFLEDLKFGPGDGFLNYYLFNYKAFPVPGGFDKTTNT
                     YDTEKRSGMGVVML"
     gene            <428424..>430151
                     /locus_tag="FOA43_002176"
                     /db_xref="GeneID:62195577"
     mRNA            <428424..>430151
                     /locus_tag="FOA43_002176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922477.1"
                     /db_xref="GeneID:62195577"
     CDS             428424..430151
                     /locus_tag="FOA43_002176"
                     /note="BUSCO:EOG093416PA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778405.1"
                     /db_xref="GeneID:62195577"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MNSATTWVPRGVASEFPEKYILDDEEMARINAMAHLHLGEAHED
                     LSEAQSEEESPKNDAGAGSNLSSKADKDDDLKEYDLDHYDDEPEDVTGEPITMFPGLT
                     NTEATYFRSAKKPEEGEDGEKAQEPGDDDHYLQLPTEEDRLEEKKDQQVYPTDNMILS
                     TRTEDDISYLDVYIYDDGAGAPDGSKEEDEDKLDPDVANGMIRGKSLYIHHDLMLPNF
                     PLCVEWLSFRPMGSNDESNVGNFAAIGTLDPTVEIWNLDCLDKAFPDTILGEATEEEA
                     AHQGGKKRKGKKYQQKHVKDRHVDAILSISHNKVFRNVLATTSADTTVKLWDLTSCGV
                     ARSIDGLHHDKEVSSSQWFGNDSETDGSILLTGGYDSYCAVSDVRINELEKMARYYQV
                     GSSGEEVEAVSWAGKNSSCFYAGTDQGNVYYFDARNEKKPVWTLHAHDSGITALNSNG
                     YIDTMLVTGAMGDKQLKLWKTTPTPSMVTSRDFGCGNVLTSSFAPDIEVAGDLVVGGS
                     SPGLKMWDCFSNRYVRVSFKDELRKLQKSAREEAKKAGIASRLARKYGDVFREEVLEP
                     EDEVEEEEE"
     gene            <430754..>437065
                     /gene="GLT1"
                     /locus_tag="FOA43_002177"
                     /db_xref="GeneID:62195578"
     mRNA            <430754..>437065
                     /gene="GLT1"
                     /locus_tag="FOA43_002177"
                     /product="glutamate synthase [NADH]"
                     /transcript_id="XM_038922478.1"
                     /db_xref="GeneID:62195578"
     CDS             430754..437065
                     /gene="GLT1"
                     /locus_tag="FOA43_002177"
                     /note="BUSCO:EOG093400PY;
                     MEROPS:MER1054487"
                     /codon_start=1
                     /product="glutamate synthase [NADH]"
                     /protein_id="XP_038778406.1"
                     /db_xref="GeneID:62195578"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="InterPro:IPR036485"
                     /db_xref="PFAM:PF00070"
                     /db_xref="PFAM:PF00310"
                     /db_xref="PFAM:PF01493"
                     /db_xref="PFAM:PF01645"
                     /db_xref="PFAM:PF04898"
                     /db_xref="PFAM:PF07992"
                     /db_xref="PFAM:PF13450"
                     /db_xref="PFAM:PF14691"
                     /translation="MDPPPETYSVYHYDEVPENKSWASTLPVKQGLYDPSLEKDNCGV
                     GFACHIKGKSSHQIISEAKYLLCNMTHRGAVGADARDGDGAGVMTSMPDKFMQREFKY
                     RYNIELPPAGQYAVGNLFFKKDDAIFIKSKATFESIAESQDLKVLGWREVPVDSSLLG
                     PASLSREPKILQPAVVMQNVSDPFDAAEFEKRLYILRKQATHTIGLHNWFYICSLSSK
                     NIVYKGQLVPPQVYSYYHDLVNVDYECHFALVHSRFSTNTFPSWDRAQPLRWVAHNGE
                     INTLRGNKNWMRAREGVMKSKLFGDELDKLYPIIEEGGSDSAALDNVLELLVINGVLS
                     LPEAIMLLVPEAWQHNDHLDPRKKAFYEWAACLMEPWDGPALFVFADGRFCGANLDRN
                     GLRPCRYYITSDDVMVCASEVGVVPVESSKVVQKGRLQPGRMLLVDTEEGRIVDDREL
                     KKQVASRFDFKAWILSNMMTMPELCEKLHNKGVSIEIPVDYSLKPDSDPRMKAFGYTL
                     EQVLILLGPMAIKGKENLGSMGNDAALACLSEQPQLIYEYFRELFAQVTNPPIDPIRE
                     RIVMSLECYVGPQGNLLEMTPSQCNRLKLKSPILTNSQLQAIKEISKVYPKWSVREVD
                     ITFPVSEGLTGYTDAIDRVCQEATQAIIDNNQVIILSDRAISADKVPLSALVAAGAVH
                     HHLVRQKQRSRVAIIVETAEAREVHHFCCLVGYGADAVNPYLAMDTICKLNKDGLLAG
                     KMSQETVLANYKHAIDDGIMKVMSKMGISTLASYKGAQIFEILGIDNSVVDRCFAGTA
                     SRIKGVTFEYIAQDAFTMHTRGYSERDTVKPAGLPESGEYSWRDGGDAHVNEPAAIAN
                     LQDAVRNKNQKAYSAYAKKEHEAIRNCTLRGLLDFDYKDSTPVPIDQVEPWTEIVRRF
                     VTGAMSYGSISMEAHSTLAVAMNRLGGKSNTGEGGEDVERSRPNAAGDSMRSAIKQIA
                     SGRFGVTSYYLSDAEELQIKMAQGAKPGEGGELPGYKVSKSIAKTRHSTPGVGLISPP
                     PHHDIYSIEDLKQLIYDLKCANPRARVSVKLVSEVGVGIIASGVAKAKADHILISGHD
                     GGTGAARWTGIKHAGLPWELGLAETHQTLVLNDLRGRVVIQADGQMKTGRDIAVACLL
                     GAEEWGFATAPLIALGCVYNRKCHANTCPVGIATQDPKLRAHFKGTPEHVINFFYYLA
                     NEMRTTMAKLGFRTVDEMVGRADKLVVRDDLRTTKNANIDLSPILTPAHQIRPGVATR
                     CVKKQDHRLHVRLDNKLIDEAEITLDKGLPVTVEAQAMNTDRAIGTTLSYRCSKKFGP
                     KSLPHDTIHVNITGSAGQSFGAFLAAGITLELEGDSNDYVGKGLSGGRLIIYPPKDSP
                     FKAEENIIIGNTCLYGATSGTAFIRGIAAERFAVRNSGATAVVEGTGDHGCEYMTGGR
                     VVVLGSVGRNFAAGMSGGIAYVLDMAQDFEEKVNRELVGLESLTDPAEIAFLRALLED
                     HRHYTGSEIADRILNDFNRFLKKFVKVIPYEYQHVLDAEAKKQAELGEKEASSLFNTV
                     KDDPEADVTGGEFSKPTVLERVKKSEPKVADLEDVAGSSTKASEKLVKLGGFMRYKRR
                     NEKHRPPKSRINDWKEMTTRLSEKELQFQTARCIDCGIPFCQSDTGCPVSNIIPKWNE
                     MVFKGLWKDALKRLLMTNNFPEFTGRVCPAPCEGACVVNVSGNPAVGIKSIEAGIIDH
                     AFKEGWIVPDPPKFRTGKHIAVVGSGPAGLACADQLNKAGHLVTVYERANRPGGLLMY
                     GIPNMKLDKGVVKRRTDLMEAEGVEFVCSCSVGEDITVEELEVENDAVVFAVGSTIPR
                     DLKIPGRDLKNIHFALELLKPNTEALLDGDLEEIRKRVAGKDVVVIGGGDTGNDCLGT
                     STRHGANSVTNFELLPKPPKERARDNPWPQWPRIFRVDYGHTEVKEHYGKDPREYCVL
                     SKEFVGDEDGNVKGINTVRVEWKRSDSGAWQMAEIPGSEQFFPAQLVLLSMGFVGPEA
                     DKFKVATTKRGTIVTAQSGSYKVDASSKLFAAGDCRRGQSLVVWGIQEGRQCAREIDV
                     MLMSKTALPGNGSIEKRDYKMLEELAAKV"
     gene            <437266..>440523
                     /locus_tag="FOA43_002178"
                     /db_xref="GeneID:62195579"
     mRNA            join(<437266..438605,439113..>440523)
                     /locus_tag="FOA43_002178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922479.1"
                     /db_xref="GeneID:62195579"
     CDS             join(437266..438605,439113..440523)
                     /locus_tag="FOA43_002178"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778407.1"
                     /db_xref="GeneID:62195579"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR018829"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF03031"
                     /db_xref="PFAM:PF10360"
                     /translation="MKSTLIQRDDVRILAVADIRGEISIFNRLAKEYNADMIIHTGNF
                     GFLDSASIDRIHESYLRHIVEFSPLLPENLILEISKLSKVTGRSVEHLSNEHENLKKL
                     LRNHSISELEDFIQGKKKLDIPVYTIYGMCEDSLVINKFRYGVYKVPNLYIVDDSSIF
                     TVEMKNQVLLFAGIGGSLSYHKLFHQGSTIDLKDIIGDGDEFSDLRGHESLIPVSGDP
                     GNIWVTILQLGKLIYTLIDYSQQNPEIYNKAIKIFITHQSPTREPLLEHLAIFFKMDY
                     TISNSLHFKYTSSYNELSINPTFEAFKAKFNDCRTKFATIWKNVQPKFEKLLYGLNDP
                     MMITCVELALEVFDKIPISTKSSDVIIPLQLSKTGDSDTSSMNLQSKQRELNAIIRQL
                     NDLYYISFQNTWHYNLCDLGYGSLLLYFDDGHLSMQCKAKGFDFTYRGQSEQQVHETK
                     VSDDFDIVARPVDLTEGASDNDDGGGPYIIRKQRSASSLIFHIIFFLPNNVLFKPIGY
                     ILFIVTYPIKLVMYLLFYRVSLRDQQSPVAVESASTTSSSSPSIKSLTSSSTSSSSSP
                     TPDDVIEFEVDKGDDGIKSPTEAAPITRHLPSGSSSTTPRGGHGTPSSSLSSKRPKKK
                     LVFPRLLFNFDISNPPNMPKKTLVLDLDETLIHSLSRYNSSILTKNKGVTVEVRLNNS
                     GLATLYHIYKRPHVEEFLGIVRHWFNLVCFTASIKEYADPVINYLEGEVILKDKADNK
                     ATIASSVVSDTVFSQRFYRDSCIFIEGRGYVKDLSFLTGRDHIKSPSFGPSLSQTPSP
                     SPSSSPKVVPSIPSTLSPPSLILSPMDSGRSRSRSRSRCRTGSRARNSKTTDLSKIII
                     VDNSPISYSYHRDNGIMIEGWINDPDDFELMTLLPLLNGLRFTSDVRAILGLKNGQSA
                     FK"
     gene            complement(<440612..>442165)
                     /locus_tag="FOA43_002179"
                     /db_xref="GeneID:62195580"
     mRNA            complement(<440612..>442165)
                     /locus_tag="FOA43_002179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922480.1"
                     /db_xref="GeneID:62195580"
     CDS             complement(440612..442165)
                     /locus_tag="FOA43_002179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778408.1"
                     /db_xref="GeneID:62195580"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036961"
                     /db_xref="PFAM:PF00225"
                     /db_xref="PFAM:PF16796"
                     /translation="MKYHEDKQSVTVESPSTSMAQDFRYDCVFDNTTRQEEIFNYSVR
                     QTTDDLSEGYNGTVLCYGQTGAGKSYTIMGNLDDDEESGLIPRIFQRIFEIIENSSKT
                     LEYTVGVSYMEIYNESLRDLLDPRNNKKLAIRENRVDGVYVSHLETFYVANLGDVYTI
                     LKQGSLNRTTGATMMNKQSSRSHAIFQIRLTSKDLDSGIVKTGNLFLVDLAGSEKIDK
                     SGASGQLLEEAKKINSSLSALGNVINCLTDGKSRHIPYRDSKLTRILQESLGGNSRTT
                     LIINCSPSAYNELETISTLRFGSRAKRITNSVHVNSELSPNELKKRYFEQVKINSEKN
                     KRMETIEVRIKLLEEENEVLKVELGKVSGPKSVSATGLSKQLQALSSDVDSDKLKSLE
                     VALKQFGTQIDQADSQNVILQKDIEALKRIKEMKDVRIKELQDQLDSREVLVAMNSAN
                     FENKLGNLKSRMDARKTRKRSVGTEDVREAGNKENNRSMKVGRPKRIGLNLRIVKPMR
                     GQQDNVERK"
     gene            <442579..>443933
                     /locus_tag="FOA43_002180"
                     /db_xref="GeneID:62195581"
     mRNA            join(<442579..442582,442690..>443933)
                     /locus_tag="FOA43_002180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922481.1"
                     /db_xref="GeneID:62195581"
     CDS             join(442579..442582,442690..443933)
                     /locus_tag="FOA43_002180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778409.1"
                     /db_xref="GeneID:62195581"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PFAM:PF00789"
                     /translation="MKRDLDLSLPIRLISLPQGCKLKMIRTKNERCGELLVTVRLQII
                     SPEGETLNNYPVESLVQKFDSSTSLIDVIKKYEQVLNDSLLNRKSHYDDVKLGKRVYC
                     EYHSMIQTISKVIDTIEEMKSTDLRRLGMTKGNHSLRLKFIREDIRAEDIKEEDKVIE
                     VPEIKPEIHEPIEAKSSIPVMEKEIESSGEKPAVNVAVFSKQTKQISHEDTDDSVYDM
                     TVEQARKYQALLSRRATGGPMMTRALREKLKSERNVEVLECLIRIRFPDHTTVQIELK
                     ATQSLRDLYDVLISTILDLSSEEISLLASDDPIFFDLMTLYPQTKLLSTEEDLDKQLV
                     ANCHLGKRSLLVYREKQPSGKIHFVKEEYLQNAKPLNDMDELKLEEQMEAKPKESANE
                     IARNLRPHTTTKKVPKWFKMGRI"
     gene            complement(<443968..>446280)
                     /locus_tag="FOA43_002181"
                     /db_xref="GeneID:62195582"
     mRNA            complement(<443968..>446280)
                     /locus_tag="FOA43_002181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922482.1"
                     /db_xref="GeneID:62195582"
     CDS             complement(443968..446280)
                     /locus_tag="FOA43_002181"
                     /note="MEROPS:MER0015691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778410.1"
                     /db_xref="GeneID:62195582"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR036757"
                     /db_xref="PFAM:PF02225"
                     /db_xref="PFAM:PF04253"
                     /db_xref="PFAM:PF04389"
                     /translation="MSGKCPEKVNEDDDETTFCQRCENVEGHRWFRSFCSFRHSSLIT
                     LLVCAIVSVQLFASWYAINISAIQLSNDHISVANSSPPREVLGRAYLGTLETNMASNW
                     SRKYSSENQLAGTNLQMVNWTRSKFEEFGFDTCVDEYEAYVSYPEDQALNLLSNNSDL
                     VFRASLKEDYVKEDPASAKYVPSFLGYAASGNVTASYVFCNYGTYEDFALLDKLDIDL
                     KGKVAVIRYGQIFRGLKVKFAQQRNMSAVLLFSDPIDDGNITEANGLKPYPKGPSRNP
                     SSVERGSTQFLSDLPGDPLTPGYGIKPGENKTHADPLLSTPRIPALPVSIRDITPILN
                     KLNGHGPKIEGRWSEGLIKGFDYSIGPNPAYLVNVYNKQNFTTAVMHNVLAKLEGHNP
                     HEVIIIGNHHDSWTPSAGDPHSGSAVILELARGLGQLAKLGWKPQRTILLASWDGEEY
                     GLLGSTEFGEYNAHKLMKSTVAYINLDLAVSGDKLDIGASPLLYDILKDTTKGLSYSQ
                     NQSLYQHFETTSKGRISNLGSGSDFTVFLDHLGIPSADIGFHGNLNSPVYHYHSIYDS
                     YNWMAKLGDPDFKYHNLLSKYIGLVILKMSETKVLPLRTNPYGLKLHEFFNVAVSQVP
                     EEWLTHNVFNSTCPHHKNITVSQIIGSVKHKLGKLSEKTLEFDTGASDLQYNYDHWDE
                     LSYWARFKLLFHINRANFWLKYYERRFLKRDGLKNRPWFKHIIFTSGRHTGYSGQQLP
                     GIVEPIEDGDRDEFVRNLVYFDRVITRLSI"
     gene            <446996..>448342
                     /locus_tag="FOA43_002182"
                     /db_xref="GeneID:62195583"
     mRNA            <446996..>448342
                     /locus_tag="FOA43_002182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922483.1"
                     /db_xref="GeneID:62195583"
     CDS             446996..448342
                     /locus_tag="FOA43_002182"
                     /note="BUSCO:EOG093421L1;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778411.1"
                     /db_xref="GeneID:62195583"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR026841"
                     /db_xref="InterPro:IPR036938"
                     /db_xref="PFAM:PF01569"
                     /db_xref="PFAM:PF14378"
                     /translation="MITTTRLGSTPAVADQYIRMTSFDDDRTLADSSVDQQPKGSTEA
                     SQAAPSSTVISEDDLTLSEIPPSQVKEYHTGFFLANLILRLWDEFKNSSQVNNQLPLL
                     RPGFRPTMRRFRHMSTIIKLNAAICASTFMFVLYILPVSVFVKLALFGALSLLNTVPV
                     LSQFFFYGMPVLAWVFLFFSAAKVPEAWRPPISVKFLPAMENILYGDNLSDILAAYHN
                     TFLDLLAWFPYGIVHFGGPFVVAALIWLFGPPTALRSYGWSFGYMNLLGVFIQQVGAS
                     APPWYKNLYGLAAAHYGMSGSPGGLARIDELFGFDMYTTTFSTAPLIFGAFPSLHSAC
                     STMSALWLSYLFPKYTACFVCYVCWLWWATMYLTHHYFFDLTAGSVLAVSFFYAAKFT
                     SLPLKDPKCWCRFNYTQLKYFDTHAEDPLFESEELNNASGLDAGFSMVEEPVIETI"
     gene            complement(<448536..>449483)
                     /locus_tag="FOA43_002183"
                     /db_xref="GeneID:62195584"
     mRNA            complement(<448536..>449483)
                     /locus_tag="FOA43_002183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922484.1"
                     /db_xref="GeneID:62195584"
     CDS             complement(448536..449483)
                     /locus_tag="FOA43_002183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778412.1"
                     /db_xref="GeneID:62195584"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="PFAM:PF01417"
                     /translation="MSFYGLRKYTRKIQNALTGYSDLENLIRESTNTDTWGPTSQQKR
                     QLSNWILSYTSFDQGIDFNDIDLAQNVDPQYTHQISQYTINFITDRILEYSQHKRGDS
                     IYQKLKKNLVTKGYEFQIIVKCLNLLEYLLLNCFRLQGSTTTFDIADDMRMHLSVIDK
                     LKSYHAKIAYDGLVLVHEKQVRQLADHLSRLLQDDGLLQKEREKFHPDIKTTGDNYVD
                     QAEELEDENGWADQFGDLQSADEGVDEQKPPIVDLLSDFNGLEISQLQTTEPLPNVSN
                     SIPVHQISSEDHPTPVKTSPKQRDLFDDLLSDFKSTNPR"
     gene            complement(<449678..>450213)
                     /gene="CYP1_2"
                     /locus_tag="FOA43_002184"
                     /db_xref="GeneID:62195585"
     mRNA            complement(join(<449678..450129,450180..>450213))
                     /gene="CYP1_2"
                     /locus_tag="FOA43_002184"
                     /product="heme binding"
                     /transcript_id="XM_038922485.1"
                     /db_xref="GeneID:62195585"
     CDS             complement(join(449678..450129,450180..450213))
                     /gene="CYP1_2"
                     /locus_tag="FOA43_002184"
                     /codon_start=1
                     /product="heme binding"
                     /protein_id="XP_038778413.1"
                     /db_xref="GeneID:62195585"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PFAM:PF00160"
                     /translation="MTQTYFDVAANGKPLGRITFNLYDDVPKTTENFRALCTGEKGFG
                     YKGSIFHRVIPQFMLQGGDFTNFNGTGGKSIYGAKFPDENFVHTHSKPGMLSMANAGP
                     NTNGSQFFITTVVTPWLNGKHVVFGEIADGLDIVKKIETLGSPSGATKAKIEITDSGE
                     L"
     gene            complement(<450614..>453043)
                     /locus_tag="FOA43_002185"
                     /db_xref="GeneID:62195586"
     mRNA            complement(<450614..>453043)
                     /locus_tag="FOA43_002185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922486.1"
                     /db_xref="GeneID:62195586"
     CDS             complement(450614..453043)
                     /locus_tag="FOA43_002185"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778414.1"
                     /db_xref="GeneID:62195586"
                     /db_xref="InterPro:IPR032741"
                     /db_xref="PFAM:PF14611"
                     /translation="MLRFAIQKVCIARGPKIWRIESVRYNSSGEKPAEESVHKPAEES
                     IEKPAEESIEKPAEESIHKPVEFSTEFPTADMFKDIPTESPIADMLRDIPTESASNIL
                     LPWEENTEGNDEDNAQNSSTDHLILAPFRRKYSPLEKFHIGRTQEKNKSNRLNENYFN
                     VVDFERDVKSLMVFKQDISSTQLYNKIDEFKPKEAVISAKRYNQLVGDLKSAFKLSQL
                     RHYAEEKEIVGVTKSITKARLITKIIKDYWKVSLSDRVIDQSSLNTEAHIALQNRREL
                     FLLLSHRGYITNSWSRLGAKLSLSPENDELIVSGSPNIVSFVQVSWNELLNNVQSITL
                     KLKKLRNFYDTELHREMPIDALQELSNVYFDKISDNDQLYVLSSFTQANLSLAKSALL
                     AATEYSGTATKELDKTTLTRTDLIYKEYNDPSLPWYAANGGPIYRLKVPKIRTGQSSS
                     LSDVTKTSSLFEELKELKEAVDKSEERFEMNFIDVQKSGKTKEEPKETEDAERRIETT
                     NTPAFDFDSLSKSLLQPVEKKSDWMPNIINATLGRVLFQGKSTSSNMFFHSNFPEVNR
                     KLSQLSLLDKESHLFGSAGGIKNQFTHVLQIKLVPDGFKKFTNFKDLPNIEIWFDVHR
                     NQVDLQSCNMFVNECECNYHIPLPQYGTDVKFQSSFNSMLINSEFDDNLIFNKKQKPL
                     FKFLNRIPDDLLDLGEANSVSRLVNSIQNHTIAIKLDDRYRKDSAGNTKKINKNVPYL
                     ITSVSRKRSIELEFEGVPVIYEVVDDTNGERYEVSILSKVNETADDAARKTGLKKFSD
                     KVFRFVEFLQN"
     gene            <453261..>455459
                     /locus_tag="FOA43_002186"
                     /db_xref="GeneID:62195587"
     mRNA            <453261..>455459
                     /locus_tag="FOA43_002186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922487.1"
                     /db_xref="GeneID:62195587"
     CDS             453261..455459
                     /locus_tag="FOA43_002186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778415.1"
                     /db_xref="GeneID:62195587"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /translation="MSSPNGKSQGLNPTKVLEKYGGSENDTTDEEMLLGCYGDTSNQY
                     NSLAHFTSLDKVIYSGIQGFRASPIDDNMKDGVNLRRKMSPLVKRAYQGYLPEYRLKQ
                     GPLLERLAKDIEVFDRTQHGKQDTLAHFLSSYRHLRSKRRYFQGNINYYNMFNKEVKD
                     FYEFRRSYNEIEMKQGSIGIDGSLRYSTHKRDDDPLQRTRWDQEEKEIFFGALARYSI
                     HRLDEIKKHLPKKSCVQILDYYHLLKKTLRRYKRDPKKIQSLVAMSEIPIAYEMSDEF
                     IEFEESQASLMISPCNKRVQSKVSSSKKIAAMHIFRPHQDLIDWDKLAKIAEAFEDKK
                     RSADNPDVNIPDSVQILIKDLIVDLIYRTLLKITERKICELSVSKLKETRRMSIDITR
                     EEINTAFGKLTTRNFNIEEFWSEYFHEPPNKKRRVESVDPEDVYNSQEIERHADLQNS
                     VEIEQKQPPPSFDFNTAVRNTRPIEVLNYVVPEMHTYPEDLQAQNIDPLLWKEIDEAN
                     EVPALAEDEETTEDVEISEKLMLMESALLERLDHEASVKYESIVLGYMQAHPDLIDMN
                     HRDLCSYYILSKYYPKDLPFYYHDDLSFVKEEQRLIQEREEENAKEAVATAVLERAEA
                     LNACQKNKKRLKKRLNQSSTNANVHQLDKLRNQLKEQESVMETLKKSRDLMPIYDNTG
                     KSELIKIALLYGDGKVTYAYYNENDPYEMPMFDEITDEMLLLHNYQFSEY"
     gene            complement(<455471..>456229)
                     /locus_tag="FOA43_002187"
                     /db_xref="GeneID:62195588"
     mRNA            complement(<455471..>456229)
                     /locus_tag="FOA43_002187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922488.1"
                     /db_xref="GeneID:62195588"
     CDS             complement(455471..456229)
                     /locus_tag="FOA43_002187"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09344MQ7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778416.1"
                     /db_xref="GeneID:62195588"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="PFAM:PF05773"
                     /translation="MDPLKEQKQEVEILKSIYPDELELISGKEFTINLLLDVSSERKH
                     AVKLHIRYPAAYPEVAPELWVTEGEIGIDGDDDDGENYNSEDGDDDSDDQETVELKDS
                     QRAVNLIETIDLGKNDYSQLAEKLDKEAKLNIGMPSAFTLASVLKDEAEQLFNDKVEQ
                     EAQKLENLRVVREKKEQRKFVGTKVTDESFSKWRAKIREEMGYDGRMKKRFQEIHQGK
                     LTGKEIFERGLAGEEDASTATVNEVAEGVDKVII"
     gene            <456404..>457597
                     /locus_tag="FOA43_002188"
                     /db_xref="GeneID:62195589"
     mRNA            <456404..>457597
                     /locus_tag="FOA43_002188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922489.1"
                     /db_xref="GeneID:62195589"
     CDS             456404..457597
                     /locus_tag="FOA43_002188"
                     /note="BUSCO:EOG09343V98;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778417.1"
                     /db_xref="GeneID:62195589"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF13181"
                     /translation="MSDISELLGSLVTESSQLVSQSQSDQAVQLLKAQFETLQSHPVY
                     LQSLGEALLENGNLEEAQDVLTRACELDPQASQGVEKFLYLGEIMGAKEGIELLQTGL
                     NKLLSQMDILKKQGISDRSQEFDDSFNLLISAYGNEKGIKEYLLKKMDQGIFAMIEIW
                     MTDLCDELEAEQQCEQLIDQALVLDPENPEAWSLLASIRISQMRNDDAIKAITKAWEL
                     FSKRKTLLEDISNIKNESIDVSDAQMEYLELVEPIVTLAKYSMEMGLFEESIGIASSV
                     QDINERSVESYYLEAFANYLNAKRIQNRLSPQDGYKVSQDFAKYPLKTNIDESDDSFV
                     YLKEARRALTSGFKLLQIDEVAEETDDELKKTIHSLLKQLGGPLLKEKDDSGVDETNW
                     EAQII"
     gene            complement(<457648..>458382)
                     /locus_tag="FOA43_002189"
                     /db_xref="GeneID:62195590"
     mRNA            complement(<457648..>458382)
                     /locus_tag="FOA43_002189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922490.1"
                     /db_xref="GeneID:62195590"
     CDS             complement(457648..458382)
                     /locus_tag="FOA43_002189"
                     /note="BUSCO:EOG093446RZ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778418.1"
                     /db_xref="GeneID:62195590"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF07653"
                     /db_xref="PFAM:PF14604"
                     /translation="MTTIETVCTNPGNIQPISTSNESEPNRFSSLTDRSISIKDFAYS
                     SDNPMHYGVYEEFDEDDSKDNPIDELEDKNIVFTFKKDNESGKLKPTNEYIRPKDTKE
                     SSITASATGSEEENLTHAVALYPFEPENENELRLTTDQIIIISYEYGDGWLVAYDPFT
                     GETGLVPSGYVQIVGRDVEFAEEVLDEEEIAQATRYLPGVLNVEQQDQEDEDQSKSVL
                     KKEPKAPDTHQKDDSDISVSLSHLKL"
     gene            <458557..>459264
                     /locus_tag="FOA43_002190"
                     /db_xref="GeneID:62195591"
     mRNA            <458557..>459264
                     /locus_tag="FOA43_002190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922491.1"
                     /db_xref="GeneID:62195591"
     CDS             458557..459264
                     /locus_tag="FOA43_002190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778419.1"
                     /db_xref="GeneID:62195591"
                     /db_xref="InterPro:IPR006973"
                     /db_xref="PFAM:PF04889"
                     /translation="MTTAHRPTFDQSRARSSKPKSSIQHKRALPAHRELKFRKRVKKV
                     DEDFDSDIEDEEDEEEEEDEEEGGDGKKRLYIKKSDVKEMRRRLEDGSGDHESGQSLE
                     QRRLELLKETKEVDESESEGDADEEEEESDSTSTSSSASDSSSDSDEELLKELEKIRQ
                     ERKQKEEQQKEDAIMKKVQQEQEKEKEEEDTEEITKSWRSQALFHKQSHTEKDPEFVN
                     DMLRSDFHKRFMDKYFK"
     gene            complement(<459291..>460682)
                     /locus_tag="FOA43_002191"
                     /db_xref="GeneID:62195592"
     mRNA            complement(<459291..>460682)
                     /locus_tag="FOA43_002191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922492.1"
                     /db_xref="GeneID:62195592"
     CDS             complement(459291..460682)
                     /locus_tag="FOA43_002191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778420.1"
                     /db_xref="GeneID:62195592"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="PFAM:PF01619"
                     /translation="MFRSPSLASRIAKASSAPLLKQPANGFFARRYISNTQKTSTGAA
                     VHAHHTSPKQNTDSYLDTLNTSELLGYGIIGMCTLSKPILNLAIRVFPYTPLWVIKAL
                     VYKNYCGGDTLPEMMKTGERLSQRGIRNMMVSYTLEACDGKKMSVSIEKIIEETRRSI
                     RELLVPHTVKMIQQTGAENINSIPPGYVALKPTALIENAADILLHYQEPAYKARYEQL
                     LNTCSDIVKVAEDANASLHKQYPGRKSPFIVVIVDAERNDLQQAVYKLQRDLFARFNN
                     LEPTVVGTMQMYLKESTPNLIKESELAKKGGYLLGWKLVRGAYIHTEPNRAVIHDTKA
                     DTDANYDAGITRTLAEMCSTKPTVGHLVVASHNSDTQRMATDLLDKVSNEKVRANVVL
                     GQLLGMGDNVTYYLTTHRNVKNIIKYVPWGPPLETKDYLLRRLEENGDAVRADSGWPL
                     LKGVAKTLFKRVF"
     gene            complement(<461118..>463244)
                     /locus_tag="FOA43_002192"
                     /db_xref="GeneID:62195593"
     mRNA            complement(<461118..>463244)
                     /locus_tag="FOA43_002192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922493.1"
                     /db_xref="GeneID:62195593"
     CDS             complement(461118..463244)
                     /locus_tag="FOA43_002192"
                     /note="CAZy:GH81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778421.1"
                     /db_xref="GeneID:62195593"
                     /db_xref="InterPro:IPR040451"
                     /db_xref="PFAM:PF03639"
                     /db_xref="PFAM:PF17652"
                     /translation="MVAQTSGNLFGAIATSSPVSTFFRKASTVAVPSGVATTSPIQTN
                     NFWGNLTLGDQTSYVYTHPYAVWMSTLSKFKGLAVSDQDASQRVFGSDNSEKAASYFY
                     MPAGNKCVVLGSSDFEKGMSIKMANLAKLSAEVKLQSAKAGYLSCHLVQGMGFISGVY
                     YDLIPEVHSGIGIKSVSGATSPRTGTNKYTIVLNDGRVWSMYVNFTDNQTCSFALKDN
                     YHIIGSNSINNCSIQLARDKFSSYDSAAGCFPTAVTLKASVSGSTGTYSFNYTTQGSS
                     NKGTSLIYALPHQIESFTSSTSSKKTAATLLDTVHGEMTGYLTNVFEMSESLPTSIGI
                     DPWSSISGWSKPSYTTDEMSKIKAAALIDAAADVYTASNSDSMYFSGKVLDKYAYVLY
                     VLYYVVKDESASKAFLKKMKTAIERFSNNKQTYPLCYETNWKGICSTGGMADGDTSLD
                     YGNAFYNDHHFHYGYHIHAAALTAVVDKALGGSWYKDIKDWVNTMVRDVANPNESDTY
                     FPVFRSFDWFIGHSFAHGITVYADGKDEESSSEDYNFSYAMKIWAQVIGDTNMEDRAN
                     LMLAISKRSIGTYMLYNQSNTVMPSKFIGNFVSGIKFENKIDHTTYFGTNVEYIHGIH
                     MLPITPVSSFIRTPEFVKEEWETGPLANLVGSVDSGWKGILYLNSALYKPTLAYQFFI
                     SGFQDKWLDDGLTKTWALAYSAGVRQ"
     gene            <464685..>466529
                     /locus_tag="FOA43_002193"
                     /db_xref="GeneID:62195594"
     mRNA            <464685..>466529
                     /locus_tag="FOA43_002193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922494.1"
                     /db_xref="GeneID:62195594"
     CDS             464685..466529
                     /locus_tag="FOA43_002193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778422.1"
                     /db_xref="GeneID:62195594"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR035959"
                     /db_xref="PFAM:PF01042"
                     /db_xref="PFAM:PF01902"
                     /translation="MKFVALVSGGKDSCFNILHCLANGHELICLANLYPPPSGSDEID
                     SFMYQTVGYDALKYYAECIGKPLYSQMIRGTAENKELEYARTSNDEIEDLYSLLTNVL
                     KEHPDVEAVSVGAILSNYQRTRVEDVCNRLGLTSLSYLWQRDQAELMSEMCQSGLDAI
                     LIKVAAIGLSDNNLGMTLQQAFPVLSSLNSRFGVHICGEGGEFETLVLDAPFFRCGKL
                     VITEQKVLRHTNDDVWYMKLKVEVEKKVPPLPEKQDWSKYLHEPSLLTEEFQEIEDSV
                     NSVDSVDSVSPVDSLGVLGSWKTNTSHIGNKIYICNLSSYKPSVSDQITDIFTQLKGH
                     LDQYNVSFSNIQSVDIFLSDMKDFAQINGIYKSYFTKPLPPARCCVETNLPTKVKALV
                     SLKVLPELTFKEGLHVQSRSYWAPSNIGPYSQTIIDRNEGIAHLSGQIPLIPKTMQLC
                     TTPVKLSATLALQHLDRVKNVVNYPKSLLLVAYITDECWLQTIVQVHNAYTTNDKFII
                     VQVTDLPKGAPVEWSGLSYKDPEPDLDEESDTEIKDPQKSVTVFFTDSLEELSTTDKN
                     SHYTIYCKPADLMTDLGNLSYEFCPVCKVYRGDQSEFKYGIVKEEGVM"
     gene            <466801..>467331
                     /gene="RPL6A_1"
                     /locus_tag="FOA43_002194"
                     /db_xref="GeneID:62195595"
     mRNA            <466801..>467331
                     /gene="RPL6A_1"
                     /locus_tag="FOA43_002194"
                     /product="60S ribosomal protein L6A"
                     /transcript_id="XM_038922495.1"
                     /db_xref="GeneID:62195595"
     CDS             466801..467331
                     /gene="RPL6A_1"
                     /locus_tag="FOA43_002194"
                     /codon_start=1
                     /product="60S ribosomal protein L6A"
                     /protein_id="XP_038778423.1"
                     /db_xref="GeneID:62195595"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="PFAM:PF01159"
                     /translation="MSAPADKWYKAHDDPVAKKTRKTVRPQKLRKSLVPGTVLILLAG
                     RFRGRRVVYLKPLEDSTLLISGPFKINGVPLRRVNARYVIATSTNVSLEGLGLDKFNV
                     TYFAREKKSSAKKSEKDFFNEAGAKKVIKAERIEDQKVVDKFLITEIKKTPLLKQYLA
                     SSFSLKNGDKPHSMKF"
     gene            <467650..>468963
                     /locus_tag="FOA43_002195"
                     /db_xref="GeneID:62195596"
     mRNA            <467650..>468963
                     /locus_tag="FOA43_002195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922496.1"
                     /db_xref="GeneID:62195596"
     CDS             467650..468963
                     /locus_tag="FOA43_002195"
                     /note="BUSCO:EOG09341UDE;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778424.1"
                     /db_xref="GeneID:62195596"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="PFAM:PF02214"
                     /translation="MLRPNLPAPRETVSKSDPQILEVLPHERMYSIQIGARLFKLSGA
                     SLSFDSPSYFTNYFLQHGNESEVLFIDRSPRVFEKICLHLQGYSIHVEDEYEYLYLYA
                     DSTYFHLDKLHSKLLDEGFFVNVGGKAFQIPKCIFLQQGNYPNYFSVIYDTLVSDPFL
                     TNSELLRPPPLSPVTVQRCPALFDQLLQVLQGNHIEITSEIHRRDLINEAKYYSFFAL
                     EQQFIKVDISINPCSGREEVLVNFNDLKKEGLLNSSSNQSSSSVQYARPYIDMYSHRD
                     LVLQIDSAEASLLINIDDSFVSLTIVGKTAKKLHDLLVVVSDDLMYELVNNKLPKLTL
                     LVHMNQCCTYINGLEVQDDWISKLIDAKCDIAVTSPDAKYSSEFSTDLPPPLKRRTPP
                     KVIAVRLLKSQWKVSVAGRNKIWMNGVLCDGVLDEPNFNKKRGFL"
     gene            complement(<468993..>470300)
                     /locus_tag="FOA43_002196"
                     /db_xref="GeneID:62195597"
     mRNA            complement(<468993..>470300)
                     /locus_tag="FOA43_002196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922497.1"
                     /db_xref="GeneID:62195597"
     CDS             complement(468993..470300)
                     /locus_tag="FOA43_002196"
                     /note="BUSCO:EOG09343OVZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778425.1"
                     /db_xref="GeneID:62195597"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR028884"
                     /db_xref="InterPro:IPR036322"
                     /translation="MPHYPYQHILLNKRGDTLFASAANSVFVFSISGTEATLISKWTD
                     QIDPYYGIRKHHKDLMEKYEREQRELDEAGNNEKKQKAPKMPIPGPGAPPTFTYIRGM
                     HLTRDDTHLIILTDNDKAAVVFKVNPLETGSPSSVLRLVKRQPFPKRPSAVTTSLDDK
                     NILVADKFGDVYSVGLLDTEIQDEEKMQPLLGHVSMLTCIDSSVDENGKECVLTSDRD
                     EHIRVSYYPKSYVIKKWLFGHKEFVSKFVLPSWSKGKVLVSGGGDNFICSWLWQAKEG
                     GELVSQVSVDELVKNYLGDKHLVPEKFQNENHDFKEYCVSDIIPVDSCHKLAFIFERV
                     NALFLFDLKDDGTLSYDKTVDTDADIISGTVSGDILILSVESEERPIVAYKIEKKGDT
                     YDIRQIAGAFQAVSENRVEVQSDDSKQNVPLFTVGGLRKRREH"
     gene            <470475..>471380
                     /locus_tag="FOA43_002197"
                     /db_xref="GeneID:62195598"
     mRNA            <470475..>471380
                     /locus_tag="FOA43_002197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922498.1"
                     /db_xref="GeneID:62195598"
     CDS             470475..471380
                     /locus_tag="FOA43_002197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778426.1"
                     /db_xref="GeneID:62195598"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR030373"
                     /db_xref="InterPro:IPR030374"
                     /db_xref="InterPro:IPR035246"
                     /db_xref="InterPro:IPR037163"
                     /db_xref="PFAM:PF01564"
                     /db_xref="PFAM:PF17284"
                     /translation="MSLLTHPLIKNGWFKEVNNESFPGQAFSLRVSKILYAEKSKYQD
                     VLVFKSTDFGNVLVLDGIIQCTERDEFAYQEMITHVAMFAHGNAKKVLIIGGGDGGVL
                     REVVKHPSVETATLVEIDDMVIRIAKKYLPNMSCSFENDKVNVVLTDGFKFLKQVAMD
                     SGRYDVIITDSSDPEGPAEAFFQKDYFQLLYNALAPNGVVISMASENIWLNINKLGHL
                     RKVANEVFPVAKISNCTIPTYTSGQIALLCCSKDPQLDVSKPSRALPRDQEIKLFKYY
                     NSQIHQASFILPTWADQIIYERAGC"
     gene            <473025..>474779
                     /locus_tag="FOA43_002198"
                     /db_xref="GeneID:62195599"
     mRNA            join(<473025..473350,473471..473496,474004..>474779)
                     /locus_tag="FOA43_002198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922499.1"
                     /db_xref="GeneID:62195599"
     CDS             join(473025..473350,473471..473496,474004..474779)
                     /locus_tag="FOA43_002198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778427.1"
                     /db_xref="GeneID:62195599"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="PFAM:PF00399"
                     /translation="MQSVLISSVFAAVVSAVTVVSQIGDGQVQAATAVAVSSAAAVSS
                     VAAVDTTVYAQETLTTTYCPESSSLAAANSTVASNSTVATFEGAANVNGVAAAGLAGA
                     AAVVMLLIRFTGLRSEAMPVEVEVSKNEVEDSKNEVLYYQRQDGADEKASQSLLSSLY
                     DSISSLVKSSDEDLEAENPWKKTGKDKKEHWKHHGKHHGKKWGKTREDPSDEDGSSDE
                     CGHNELEDPKKHWKHRGEHERKHWKKVGEHERRKWARRPPESDDEFEPSDTEGPEGHW
                     KHRGEHERKHWKNVGEHERRKWAHRPPEGDDSEELSVLSGPPEAPDCSSTIDPDACWK
                     DYGEQQKKYWKQYGKEQKKHWKKKYSEKPDDSDDSDNSGEE"
     gene            <475256..>480514
                     /locus_tag="FOA43_002199"
                     /db_xref="GeneID:62195600"
     mRNA            <475256..>480514
                     /locus_tag="FOA43_002199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922500.1"
                     /db_xref="GeneID:62195600"
     CDS             475256..480514
                     /locus_tag="FOA43_002199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778428.1"
                     /db_xref="GeneID:62195600"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="InterPro:IPR032436"
                     /db_xref="PFAM:PF11707"
                     /db_xref="PFAM:PF16201"
                     /translation="MSDRKSKYKSNPVNSQVDSHFSELVQSLDEKTKDSDISDLLLFL
                     EKDFNITSLGQSFSYASTANDSSSLASIIVNLGRLVKFASNVKSLELSIDQLIDELIK
                     NANVFSKCLSSGKPSLVNPILRLMTAIITYNSGVKTDKLLESLDFSSKVLPKLAIPSK
                     LEALDPAKCQTEFSVRSNFVTFWITLCNAAAPLSRKDILTTAGKVMSNIFKYIAVYDS
                     PELQRDVLNFLDQSILMEPSYKRMTKCKMIGDWVMSKVVDLYLVETLRDQLHQLLIKM
                     CTDETNGLVFPDDNVWFETSEVSGAAVSIGDRTFHVHNKLIYTMLTKLKPWADDLQLE
                     LVITVIRYIPELMPAYCYYCFFINGSHDPKLSSFYMGQSLMLLKLVRLPIPQQFIKRV
                     RNSVDTSSATSNGTPLPASNVMEFICPSQLNRSAFTQGLASPHKLITHINTVLLIAIF
                     QKFEKMIKTLSYDNNDLYTDLKNELLEIMEVQKLPTFGAIVGDLNEFSKKTPDNKILL
                     LNYLKMAEYYHKVLGQTGSILLTSINLGQSDEDFQGVDLAILDCYLNLTSDSSDQNKW
                     WNVAKGSENTLFTSLLRLPYRLEAKGASGSVTDEQITEVLSGLVGDSLIFSDFRAKTQ
                     IALTSQIYAILLSLHQFSSIVHNAQEIDKVCKVLDESVSRCVKTPYKYIDHASKYSSY
                     LSPFYITVLEQSKFVKGDLDGLFLWIQLVTRSLFLLGEPLNAMKQSVEEFLGPDKVSI
                     DFDLTSYETTVDSFFEENYKTLKLADTGFAELVLNAPLAMLQTNIDTMIPMSDIDMVS
                     LITRCNTLVYCEALPLDKVQLLLTKLLEKMGNYLIQRFDVIFDSEEVSTRCLNLFDNK
                     YWKSLYLDTEEQNPKKYHTAAFLNSLFYTLFKGKSEVFSDYADTVLQLAAKLNSSTNP
                     EAIRVLDSSLWTLANDQVSKLLSITDNKKLRESLLRMSVNRNISLLFSEFFQLLQKHL
                     NKENRDLFGELAKRVDVSKSDLSSMLAAHSNENMYPVLCSVLSSHSEFAEYIATTLKP
                     FSVDISATGEGLSFLHFLSEQYSPLQEYVFTKAREGLQRVIDIGDVGNHPINLYLKIV
                     SFNSGLIEQEDASEMVIKLMALDSFANEASLIFSKEFVSVILNCQFKEVSIINGWLCR
                     ETLYASKMFAETGSCQLPEQFIGFLKSMKPLINKMPVWKVVPRSLMNSQLEIILSNRW
                     IENVDILKYVLWLLGSKSKGFVEEDKMLQIFINNEYNALRKSPTDKSGLELRYYCAVM
                     IYFLFESNPKRVSTTDVQLTLSKFHLGTTRPDDRVLRKVLNKLEASLGVSWINYISSW
                     EFQEESSKIISGDSEDANDESYALQNYWLVKESPEISQGLNVVLRKDIVTATIENFNE
                     TTLKLPISSLKDGKWEEFFVNTTIDVGERLRRKDFLYDSEFLMLLMLNNEELFNFGEE
                     DVKVSAKALIESDLLQIVVMNLVNSREEIRSMAHRILSSVFMILDSQVKMADKNREAR
                     ESDESKKVGESLDSFHLYKERSIFKMFLGNLLYTIEEPTDEESEDICPLIVVFLSYLV
                     PVLNNPGHFMYEKVYRFMLGAPKFRTYEIPLFKAVMRLFTKDTHASSDTDNTEDYYRR
                     LLWFLETLSKSITSSRDLRVLRRSGFLDTLMTLTSSPFVHLRVQCLIIKVLLKIVQIP
                     SGADLLVRSSGLLAFLEEKAYSLGTKSGFRIDQVRNSLLLLNYQKMAVEARISSDLNG
                     ANKRTREWCRGDMDRSVKRVITSKPV"
     gene            complement(<480587..>482054)
                     /locus_tag="FOA43_002200"
                     /db_xref="GeneID:62195601"
     mRNA            complement(join(<480587..481196,481258..>482054))
                     /locus_tag="FOA43_002200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922501.1"
                     /db_xref="GeneID:62195601"
     CDS             complement(join(480587..481196,481258..482054))
                     /locus_tag="FOA43_002200"
                     /note="BUSCO:EOG09343EYP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778429.1"
                     /db_xref="GeneID:62195601"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PFAM:PF00300"
                     /db_xref="PFAM:PF10419"
                     /translation="MPLKHLYIVRHGFRSNWLPVDQQLPNPTGVDSDPALAPHGVDQA
                     NQLADFVSKELDPKPELIFSSPFYRCVETINPIADKLNLDIYLERGIGEWYKRNRGVI
                     PFPVDHKVMSSFFPRVSDDWEWNTVIPSSVGETEEEVFERCRIFWNKFFPKLEEHFPR
                     VETVIIVTHAATKIALGMSLMGYKNNREFLVAEDGGDGKTTCIQAGTCSLDMYSFDPA
                     SQKWHLQINGMTSFLKNGTEMNWMYTDSGFEAGSDEDVAARKKLKDKFGPEPLDSDEA
                     TVNTEDERRHGLSESGEDSKETTEAGDNDDGKTGSDMEPTVEPDSEYEDVYVSMVFPP
                     SSNQLEQKSDTAGVPKKSTTGDKASEFDDIKANLYSKGTDSLKKIRISGLSKQRPLVQ
                     MHNNLYMGDWSKLVGTELVFNENGGFVTKVDSHVVLHSGKLESHKEEKDPLLKRAIDL
                     AREVQQPRKDDDGDIQMS"
     gene            <483162..>483594
                     /locus_tag="FOA43_002201"
                     /db_xref="GeneID:62195602"
     mRNA            join(<483162..483255,483317..>483594)
                     /locus_tag="FOA43_002201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922502.1"
                     /db_xref="GeneID:62195602"
     CDS             join(483162..483255,483317..483594)
                     /locus_tag="FOA43_002201"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778430.1"
                     /db_xref="GeneID:62195602"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR036400"
                     /db_xref="PFAM:PF00173"
                     /translation="MTEHKFTPETPVKLDPPKDDPITMEQLIKCDGVQSDKLYIAIKG
                     QVFDVTANQKSYGVGSAYHSLVGRDASRALGKMSLGPEETNPSISWDYSSLTEQELRV
                     MNDWYMFFKNRYNIVGRISKH"
     gene            <483954..>488060
                     /locus_tag="FOA43_002202"
                     /db_xref="GeneID:62195603"
     mRNA            <483954..>488060
                     /locus_tag="FOA43_002202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922503.1"
                     /db_xref="GeneID:62195603"
     CDS             483954..488060
                     /locus_tag="FOA43_002202"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778431.1"
                     /db_xref="GeneID:62195603"
                     /translation="MEAAMSAISAGPPGSAGPSGTRGISGRVIHPRHSVVDGITQSNA
                     SMALDKSAYIDISQEVHVNGNMNNNMNNNYDHQQAQYGQPYSNLNSMGGLPPPMANLA
                     PPGSSRNGSLTSGVSFNRFMKSKFSRTANRNGHRKNKESKFDDDDFNGDGNINTNITE
                     PDMSFDDLKHIRGGGRYGMGASAFSLDASSYVPMFNIGPSTSSKPGANSYSPISNESY
                     RKQQVTHKKMMAMRYSRLSQTQLQGGQGGASLGPGGEMYPPRTMSLQTFGQGNRQVMP
                     MNGPGMQQMNGLGMPMNGPGAPMNGPGAPMNGPINGPMHLNSLGGGGVPPNMPPMGGY
                     PHTMSMQSAGYYGRNGGPRQRFMPPQSQFMRPPFGSPKPDMRRVPQSTSQSSLQQSMP
                     GYPNPSYRNNSLTQRQQPMYSGPPQGYQNQQQRQPMNYPAQRFHQSQSLEDLPESDSQ
                     TQETQVPPPQSRSQFSQIPEAPPIPEVLPILLPQRQSQKPMAAPPDHSSKPAYDYNVP
                     SSRETQEVPIHSRDPSSSLVAESYSSNVNQAGTLTSYRSDISLQHDQAPKSMVSTSPP
                     HVFQPQAGKVKVNRYVFTDSEDEENDEDESQEGDGEQSRKSEGQYSTDASNSNSMESP
                     IPQRTSKTASSTTDAEYFSVEKVTSEGIVSPSGSYLKELGAPALMNDNSSYASSSTSY
                     DSDSIRKTPDITLKHDRFTDSGDKAMKVSGESFDFTSSPGKKDREILLPDGDNDGETS
                     SARGNIEITKHELLDELNNSVRNADMKQGVLTPPAEHHKIKSMIPDYLNEEFRNGNSR
                     AQESKNTEIPSWTPSSSDAVGAIGTNVAGLIASQSQGTSQTDSSNSFLPHKKSSDVTS
                     ASNPVYSNNKVPSYTQSVASTSQSRATSGVSSASFRKAPPPLPKDGVEGYQKKNIILV
                     SPETSSNLQENHHKSNSTLSSIENAFARSPKMAGAKNFFLKITQRHRHHSSKGSKSSD
                     KDAQEAESFKVYPPLPNASIGQPLGKSANLVEEKKKSLPPEPLAKDNDPLLNYRLTLN
                     IPRDDNSDHRLTKFLEMDNYSNKTPTESILPKRIVGPVGDKFIPKINVRYKTDLKEYL
                     QPSQLGVLNDNTKLLKELQIVSTELAGSISRELTLEGKLRAKSLVSASILKETENGSK
                     VSELTEQLNEERRKRYATEEMILKRSDGVSDNSQMTEMGYKNSSLSKKIVELEDQLQS
                     EKMRTNLLEEERDKLKSSLEDMSKKYRDLTNNVVPELQNQVEILSNSNNPQNSLEERL
                     ESLQLENESLKQQQISESDEVTVLKSQRDSFREALKNLKIQRDIDFRMNAEKVKSQEH
                     TVNKLSSINGQLSRKLLATGLMGRGEISIVGSPSIRTNTSFEDSPLME"
     gene            <488208..>490970
                     /locus_tag="FOA43_002203"
                     /db_xref="GeneID:62195604"
     mRNA            <488208..>490970
                     /locus_tag="FOA43_002203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922504.1"
                     /db_xref="GeneID:62195604"
     CDS             488208..490970
                     /locus_tag="FOA43_002203"
                     /note="BUSCO:EOG09340LUI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778432.1"
                     /db_xref="GeneID:62195604"
                     /db_xref="InterPro:IPR015172"
                     /db_xref="InterPro:IPR015174"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF09088"
                     /db_xref="PFAM:PF09090"
                     /translation="MSELINRKRAFEDSDTEYEPSLPGTGRRPTESEFDEESNPRENR
                     YKRPRRTQLPRELEALKEICHVISQLGDPEDRLESDWRSLSNTISQEFDSGEFKQNLL
                     DYIYAVIIEQPHKVFVMSGLVQCCHALNPEVGKAVIEHMKQNVESLLDQNVAINESDE
                     PGRFTRLKLIGRFLATLIPIMESADFVIDFIKQMIAAAVKVQAESAKRSAIAEVVYYG
                     FTLSIPFVLASDRGGEELKQKCSELIDLAGSFEIKESKYPVELFQHFKTSDDDKPLPY
                     EPKPLVSLVLDAVKNLEDCINIFPDLQKRIDAVIGDQKEDIEKVSLTTFTVGSLNSAE
                     DEIGLYGTVDSLWKYPRFALEIFSRPKGAAFSAIPPVDSYVSLLMRDLIQDLVQNSEF
                     NRITVSRQLLSLIKYINSKMFAKPNSSEDKLTIVNDMRNGVDLINDLETNPDIPESMK
                     ETMLNSAKKIELEFNDGYKSTWKMEQVITESVLDLMLHLPESTLPAIYYETLLADTCG
                     RDWTLMKRSEDSHEKVAFAKTIAVTIKYLYRNVQTIDFDIRARVVCWIMIQLSSFNFD
                     WQWADWVDDVAKFEQEVYHPTFFLLHNIIAKEVRVSTPRSIRSTIPKDFWKFTDLSLM
                     SRDRVIEYDSQFFGQSLAESCYDSCAKAIKDEMNSDSSSNDDFGNAETFHLLDQYLFN
                     NSEHPQHDLCHSIYTNLQEGETMESFEGLLNDVRKQISESVDNVEKYIVALVVESVCI
                     IGSRSLSVIEGGALELCGDKLRSVLGEGEERQKWLIEAVLRLWNHEPRIGYLVLEKMR
                     NKKFIKSSQVIESLFDLSNGRVLAVTEIYADELLNRLLFEEAENETETQQEKQKVFGR
                     VSISALNRLAQGKWAIKETLGIIESKLRRIKSKELVQQMKQAASDISEESVKVEALRK
                     LELFEH"
     gene            <492046..>497790
                     /gene="GSC2"
                     /locus_tag="FOA43_002204"
                     /db_xref="GeneID:62195605"
     mRNA            <492046..>497790
                     /gene="GSC2"
                     /locus_tag="FOA43_002204"
                     /product="1,3-beta-glucan synthase gsc2"
                     /transcript_id="XM_038922505.1"
                     /db_xref="GeneID:62195605"
     CDS             492046..497790
                     /gene="GSC2"
                     /locus_tag="FOA43_002204"
                     /note="CAZy:GT48"
                     /codon_start=1
                     /product="1,3-beta-glucan synthase gsc2"
                     /protein_id="XP_038778433.1"
                     /db_xref="GeneID:62195605"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="PFAM:PF02364"
                     /db_xref="PFAM:PF14288"
                     /translation="MSYNDNYDQTGGAGQGYYTDNGQQDPSGQQNPGEYYDQAPPQDA
                     AVAAGAPGVAGAPGVAGAPGVPGVPGAPGAPPQDGYYDQNNYQGYAAGYDQNGAPQGA
                     YYDQQQQQQYPPQQGYYEQGGHDAEAYSDFSYGPGAAPGTPYDGYGTQYTPSQVSYGG
                     ARSSGASTPIYGAGPYDQGMVVLPTDPYPAWTADNQAPVTIEQIEDIFIDLANRFGFQ
                     RDSMRNMFDYFMTMLDSRSSRMSPAQALLSLHSDYIGGDAANYKRWYFAAEMDIDDDI
                     GFRNLDVGKLSRKARKAKRKSKKARKAVEENAGDTVKTLNELEGDDSLEAADYRWKAK
                     MNALSSFDKVRQVALWLLVWGEANQVRFTPELLDFIYKCASDYLESDACKQRTDPVPE
                     GDYLNRVITPLYQFLRDQVYEVIDGRFVKRERDHNRVIGYDDVNQLFWYPEGISRIVV
                     EDGTRLIDFPPEERFMKLGEATWDTIFFKTYKEVRTWLHVITNFNRIWIIHISVFWMY
                     CAYNAPTLYTKNYVQVLNNQPLASSRWASAALGGTVACVINIFASVFEWFFVPRKFAG
                     GQRLTRRMMFLFILLAINLAPVVFVFAWAGIDTYSKAAYAVSIVAFFIAVATVCYLAV
                     MPLGGLFTSYMKNSSRRYVAQQTFTASFYKLKGLDLYLSWFLWFIVFVGKFAESYFFL
                     ILSLRDPIRNLTQGVMRCHGDTWFGNVLCQQQARITLGLMWATDFILFFLDTYMWYIL
                     ANCVFSVGRSFYLGISILTPWRNIFTRMPKRIYSKVLATSDMEIKYKPKVLISQVWNA
                     IIISMYREHLLAIDHVQKLLYHQVPSEVEGKRTLRAPTFFVSQDDNNFTTEFFPTNSE
                     AERRISFFAQSLATPIPEPLPVDNMPTFTVFTPHYSEKILLSLKEIIREDDQYSRVTL
                     LEYLKQLRPIEWDCFVKDTKILAEETAAYDNSGDEKQDEVKQEIDDLPFYCIGFKSAA
                     PEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENPEIVQMFGGNAEGLEREL
                     ERMARRKFKFVVSMQRLTKFKPEELENAEFLLRAYPDLQIAYLDEEPPLHEGEEPRIY
                     STMIDGHCEILENGRRRPKFRVQLSGNPILGDGKSDNQNHALIFTRGEYLELIDANQD
                     NYLEECLKVRSVLAEFEELNIEHVNPYAPSLDKEPAKVPHPVAIVGAREYIFSENSGV
                     LGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNAIFMTTRGGVSKAQKGLHLNED
                     IYAGMNAMCRGGIIKHCEYYQCGKGRDLGFGSILNFTTKIGAGMGEQMLSREYYYMGT
                     QLPLDRFLTFYYAHLGFHINNLFIQLSLQMFTLALVNLNALAHESIICLYDRYKPITD
                     IQYPLGCYNFFPAIDWVRRYTLSIFIVFFISFVPLLVQELIERGVWRMICRVGRDFFS
                     MSPFFEVFTAQIYSSSLLNDICIGGARYIATGRGFATSRIPFSVLYSRFADSTIYMGA
                     RLFIMLFFATVARWQPALLWFWAIVVSFMFSPFIFNPHQFAWDDFFIDYRDFIRWLSR
                     GNTKWHRNSWIGYVRLTRSRITGLKQRTIGDSSEKSAGDFVRPHRTNMLFSDTIPCAL
                     YTAGIFVAYTFINSQTGVLDPSAVNSTLRILICSLGPIVINIAVLGVCLSMSCCAGPL
                     LGVCCKKTGAVMAGVAHGIAVVVHLVFYIVIWCVEGFSFVRVLISIIAMVYIERLIFK
                     IMTLLLLTREFKNDHSNIAFWTGKWYGSGLGFAAWTQPAREFAAKIIEMSQFAGDFIL
                     GHFLLFVQLPMLCVPFVDKWHSFMLFWLKPNKQIRPPIYSLKQARLRKRMIRKYSALY
                     FLVLVIFVVLIVAPAVVGSLDLINFDNLNLPTFADGLFQPRHQSINDTGFGSGTYKPE
                     WTTTTSLQTWSTKA"
     gene            complement(<498032..>499816)
                     /gene="ADE17"
                     /locus_tag="FOA43_002205"
                     /db_xref="GeneID:62195606"
     mRNA            complement(<498032..>499816)
                     /gene="ADE17"
                     /locus_tag="FOA43_002205"
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /transcript_id="XM_038922506.1"
                     /db_xref="GeneID:62195606"
     CDS             complement(498032..499816)
                     /gene="ADE17"
                     /locus_tag="FOA43_002205"
                     /note="BUSCO:EOG09341764"
                     /codon_start=1
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="XP_038778434.1"
                     /db_xref="GeneID:62195606"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="InterPro:IPR036914"
                     /db_xref="PFAM:PF01808"
                     /db_xref="PFAM:PF02142"
                     /translation="MAATKDYKKTAILSVYDKTGLLDLAMGLVEHKVRLLASGGTARL
                     LRESGFPVDDVSTITHAPEMLGGRVKTLHPAVHGGILARNIASDEKELEEHHIEKVDY
                     VVCNLYPFRETVAKINVTIDEAVEQIDIGGVTLLRAAAKNHARVTIVSDPNDYPIFLE
                     DLKKYGEISQQVRNKFALKAFEHTASYDATISDFFRKRYAEGVCQLPLRYGANPYQKP
                     AQAFMTEGKLPFTVLNGTPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAA
                     VGLPLTDIEKKVYFVDHIENLSPLANAYARARGADRMSSFGDFIALSNIVDLPTATII
                     SKEVSDGVIAPGYEPKALEMLKKKKKGKYCILQIDPNYTPSAMEKRQVFGVSLEQKRN
                     DAIINSSSFKEIVSRNTHLTEQAVVDLTVATIALKFTQSNSVCYAKNGMVVGLGAGQQ
                     SRIHCTRLAGDKCNNLWFRQHPKVLAFKWAHGVKRPEKANAIDLYVTGQIPTEEPEKS
                     DYESKFQVLPEPLSAEERKEWLSKLTDVALSSDAFFPFPDNVHRAARSGVKFIAAPSG
                     SMNDKIVFEAADAHDIVYVESPIRLFHH"
     gene            complement(<500213..>500827)
                     /gene="RPL15B"
                     /locus_tag="FOA43_002206"
                     /db_xref="GeneID:62195607"
     mRNA            complement(<500213..>500827)
                     /gene="RPL15B"
                     /locus_tag="FOA43_002206"
                     /product="60S ribosomal protein L15B"
                     /transcript_id="XM_038922507.1"
                     /db_xref="GeneID:62195607"
     CDS             complement(500213..500827)
                     /gene="RPL15B"
                     /locus_tag="FOA43_002206"
                     /note="BUSCO:EOG09343TCP"
                     /codon_start=1
                     /product="60S ribosomal protein L15B"
                     /protein_id="XP_038778435.1"
                     /db_xref="GeneID:62195607"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="PFAM:PF00827"
                     /translation="MGAYKYVEELHRKKQSDVMRFLSRVRCWEFRQKNVIHRAARPTR
                     PETARKLGYKAKQGFVIYRVRVRRGNRKRPVRKGVTNGKPTNQGVSQLKYQKPMRVTA
                     EERVGRRVSNLRVLNSYWVNQDSSYKYFEVICVDPFHNAIRRDPRYNWICNPVHKHRE
                     NRGLTSAGKKYRGINKGHLFNHTKKGQHHNWKVHNTLSLWRYRH"
     gene            <502556..>502999
                     /locus_tag="FOA43_002207"
                     /db_xref="GeneID:62195608"
     mRNA            <502556..>502999
                     /locus_tag="FOA43_002207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922508.1"
                     /db_xref="GeneID:62195608"
     CDS             502556..502999
                     /locus_tag="FOA43_002207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778436.1"
                     /db_xref="GeneID:62195608"
                     /translation="MSANIEKKATKAKSSFEDKVSKVADDANVSESSFKEKAAEASKN
                     LKKTASNATKKTEGYLKKTYSTVSDYVVGAAIATKDTVVAYPVVTFNLTAVLATGITL
                     YATSEKQCHKCTAETCKTVSSVLAGTLALVDSAAVYYYHQKGLKE"
     gene            complement(<503110..>508275)
                     /locus_tag="FOA43_002208"
                     /db_xref="GeneID:62195609"
     mRNA            complement(<503110..>508275)
                     /locus_tag="FOA43_002208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922509.1"
                     /db_xref="GeneID:62195609"
     CDS             complement(503110..508275)
                     /locus_tag="FOA43_002208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778437.1"
                     /db_xref="GeneID:62195609"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR032630"
                     /db_xref="InterPro:IPR032631"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00122"
                     /db_xref="PFAM:PF13246"
                     /db_xref="PFAM:PF16209"
                     /db_xref="PFAM:PF16212"
                     /translation="MRLGHISESETGAAGADSGAASSSPKQPSKPIRTRKRGFRFRNQ
                     LLHQQKASHPPSKSSQSLLQPPSLNSSSTNNGADESSLNEFNRNTSISETASAAAHAL
                     QSMPEDQSTQDIELRQVDQTYNPGEWQIFRDNETSENNKSSVVSPRGQKNGSFKSFGS
                     HVTNESVIELSSDSFLSRSKTKIANYSRFRVLKRFKNLLMGISEPIPSQGGRVVPISV
                     SMDPASTDFPTITNRHGRILLIDDRVNVPYVSNTITSSKYTIFSFLPRQIFAQFSKIA
                     NCYFMIVAIMQLVPTWSTTGTTTTIIPLSIFISISIAREGWDDLRRHRLDKLENEHMT
                     YVLRETNERNSHIKPYRDHWISGESSIVSSSQSSRSSHSSSVFSQNIRHKNSSMKEDA
                     LAEEGLNLNKTQWSNIKVGEIVKLECDEWVPADIILLTSTNDLGETFIETMALDGETN
                     LKSRVPNSGLHHLANEAKTLRSLNAIVRSEDPNLDLYHYEGALNLTDAKTHECHKYPL
                     GPENIIYRGSIIRNTKACLGLVIFTGEETKIRMNSIRRPRIKAPKLQRSINIIVIFMV
                     CVVILLSSFSTMGERLLYKKNKNLNWYIYEEDVGVAATLMGFIIMLNTVIPLSLYVTM
                     EIIKIMQMFLLQWDIDMYDPDSNTPAEARTATILEELGQVRYIFSDKTGTLTDNKMIF
                     RKLSVGGSAWIHDIDERLQENNDNDNVEDNSSNQPALFKSPTIRVSGNPPRPSEEVMG
                     QGSITFTGRPSMASLTVRQSRKTSSSPVMSPTTTKTGNSPEDLKSTVELIRYVQTHPK
                     SLFARKVSLFLVSVALCHTCLPKREELDDTSSENDDNTDGAIEYQASSPDELALVQAA
                     SDMGFVFYSRKQKIVTLQLYPSGFDKEPVFEKYEVLDTVDFSSARKCMSIVIRFPDEK
                     IYLLCKGADNIIMEKLKSHGLAGQKRSELARSITERKQIEADLVLANRSMDLRPSDLS
                     GRKSSGIGARVSGISLSRPSNLISPRLPKLSISSLTESQNEARQVDEVISQSKRSIQM
                     MQKQKFNEQSYIPTEKLIENEEFVIEKTLQHVEEFSSDGLRTLLYAYRTLTEDEYHHW
                     SQEYAVAKTSVKNRGQKVEEVGGKLEEGLSLLGCTAIEDKLQDGVPDTIEKLRRAGLK
                     MWMLTGDKRETAINIGYSCRLIKDYSKVVILSSERNSLSELSSMMTAAEIEIDEGNVA
                     HCVVVIDGTTVNAIEEDMTLMSLFISFGVKADSVICCRASPSQKAELVDRVRKLRKGE
                     VTLAIGDGANDIAMIQNADVGVGITGREGLQAARASDYSIARFRFLQKLLLVNGRYNY
                     VRTSKFVLCTFYKELMFYLTQLLYQRYTLFTGSSLYEPWSLSMFNTLFTSLPVMFVGM
                     FDKDLRPSTLIAVPELYAMGCKSERFNLSVFVQWIVLSAAQSVTLFFTMIYIYGFNAT
                     LDNTTYPLGMVLYTALVFVICTKCCIIETHNITKLPVIAWAISVFGWLMWLMLLVGLN
                     THRMQTIFYVNHGLFEHFGKDITFWGSILALIFVGVLIDLIYEFVHDWLRFSDTQVFQ
                     QLEQQPGICEKFELVSYNVLKQGWMWLHDSVINEEIVKDWPKARRRFYYFRSFLRKGS
                     IYPSKATKKRRSTMVNPKELPPGSPSVVKLASSDRYEKEMLPSGKVVRKKKTKKEGDE
                     EQDTVGSRRPRSKSVKFVRLFGSKNDTDNAEGTMQDADIDEVLQRRMKDLEQQ"
     gene            <508904..>511116
                     /locus_tag="FOA43_002209"
                     /db_xref="GeneID:62195610"
     mRNA            join(<508904..510482,510893..>511116)
                     /locus_tag="FOA43_002209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922510.1"
                     /db_xref="GeneID:62195610"
     CDS             join(508904..510482,510893..511116)
                     /locus_tag="FOA43_002209"
                     /note="BUSCO:EOG09341HKQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778438.1"
                     /db_xref="GeneID:62195610"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="PFAM:PF01423"
                     /db_xref="PFAM:PF02628"
                     /translation="MSFCRGQFFFINNSSILGVGLKRSIQHPLGTMGPLSKLAGGATG
                     YTGYSRSATISHFIKRLLTPDSGADTKVMKALNDFPRVKKVSRSSFVTRNSVSSPLLN
                     QRRLFSTSVLAYVEAKSAPLTSSPPTPNPSSWPINTAKPVGYLCIACSILVFAIVVLG
                     GLTRLTESGLSITEWKPVTGSIPPLSQEDWLAEFEKYKQSPEFKELNTDMNVEEYKFI
                     YGMEWSHRLLGRVIGVLFVVPTLYYIARKRVSPPTALKLLGICGLLGLQGFVGWWMVY
                     SGIDKKQLVARNSKPTVSPYRLTTHLATAFTVYCCMISTGFSILRDYKIMADPKKYQK
                     IFQQINSPSLKRFISLSKGLFVMVFFTAMTGALVAGLDAGMIYNTFPKMGEGYIPPTD
                     ELMDPLFARKSDKSDLWWRNMLENPTTVQFNHRIMAVATFCCIFALHMRSHKMKPLLP
                     SKAYMWLSASMGLACLQVTLGICTLLWLVPTDLGAAHQAGALGLLTGVLMVVNNLKRP
                     SRSNLILLDKFLQKAANQRTLRSIDQYLNIKLDNIETNVEKYPHFVAVRSIFIRGSSI
                     RYIHLNPSNVDTNLLQDASRRETMASTSDKIAGR"
     gene            <511722..>512393
                     /locus_tag="FOA43_002210"
                     /db_xref="GeneID:62195611"
     mRNA            <511722..>512393
                     /locus_tag="FOA43_002210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922511.1"
                     /db_xref="GeneID:62195611"
     CDS             511722..512393
                     /locus_tag="FOA43_002210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778439.1"
                     /db_xref="GeneID:62195611"
                     /translation="MNVNIQLQGSKEKIRRLSLYKSCEGEYTVNRRYGYSLLSRDKEI
                     VEDAIIDHTEVPKLKRQYELKGEYLQPVLRIAQQGHKVSPDELLCIGWKYNPAELPYM
                     SREQIKKRTGQGLPDSELLKSLHYYMLDRVRKSSLTKGNGVNEPDFKRFLDESSMIAL
                     GKVIESWIEKMVDEGDTWKDYMEVTLDDVQKEESTDESASNQSSSSSSPSSPSSPSSA
                     SSALS"
     gene            <512541..>514655
                     /locus_tag="FOA43_002211"
                     /db_xref="GeneID:62195612"
     mRNA            <512541..>514655
                     /locus_tag="FOA43_002211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922512.1"
                     /db_xref="GeneID:62195612"
     CDS             512541..514655
                     /locus_tag="FOA43_002211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778440.1"
                     /db_xref="GeneID:62195612"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF01189"
                     /translation="MGKHWRNKGNKSNKGRLGVRRDQRQGWDEIVKENEEWERYYKEQ
                     QVVSSDAEFARMKKAFQDPLPVTFRITGSRDHVQDIANFFTKKIVPQLEKAEQDALAN
                     PDADTENSEVPHKPPSALSWYPSNLAFQIDLPKRVIKKDPVYGPVQGFLVAENEVGNL
                     SRQEAVSMIPPLFLGVKPTHYVLDMCAAPGSKTAQLIEAIHATEHGELPTGFVMANDS
                     DYRRSYMLVHQIKRLNSPSYVIVNHDAQMFPKVRLEKDGSYIKFDRILCDVPCSGDGT
                     FRKNLPIWKEWTVGNGLGLHRLQLNILLRGIQLLKTGGRLVYSTCSLNPIEDESVVAS
                     ALKKFAGKIRIVDCSSEFTGLIRHSGLKTWKVFNKKFELQEPGSKEVPETVFPPKGEE
                     VEDLHLERCMRVYPQDQNTGGFFITVLERIPENDNKREREDEGSDEVSNKKPKTDGEV
                     ADDIPVASPVVSSAPVKRQRLPLDAIEEPFSYVDIGNEQLKKCFQFYEIDDKFPKDCT
                     MVRNATGEPMRSIYFTAPVIKKIIQCNEDKLKLIYSGVKLFVSQKNYECPWRIQNDSV
                     AVVKNHMPTTRQLTSNMGIFKILLEENYPSFQLLKESKVDPSFVEAIENSPEGSCFLN
                     IKREGGDEQLLLPMWKGRVHLNLMVDKHEKAELLYRFFGVDKNALEKAKKAEVKAEAE
                     REVNAKAEAETEAEAEADETTV"
     gene            complement(515514..515595)
                     /locus_tag="FOA43_002212"
                     /db_xref="GeneID:62195613"
     tRNA            complement(515514..515595)
                     /locus_tag="FOA43_002212"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:62195613"
     gene            <516041..>516733
                     /gene="MDE1"
                     /locus_tag="FOA43_002213"
                     /db_xref="GeneID:62195614"
     mRNA            <516041..>516733
                     /gene="MDE1"
                     /locus_tag="FOA43_002213"
                     /product="Methylthioribulose-1-phosphate dehydratase"
                     /transcript_id="XM_038922513.1"
                     /db_xref="GeneID:62195614"
     CDS             516041..516733
                     /gene="MDE1"
                     /locus_tag="FOA43_002213"
                     /note="BUSCO:EOG09343F4A"
                     /codon_start=1
                     /product="Methylthioribulose-1-phosphate dehydratase"
                     /protein_id="XP_038778441.1"
                     /db_xref="GeneID:62195614"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /db_xref="InterPro:IPR036409"
                     /db_xref="PFAM:PF00596"
                     /translation="MGLEKPDSDQLVVPADEEHPANLICELCRNFYGNGWVTGTGGGI
                     SIRDRSRNLIFLAPSGVQKERMMPLNIFVMDFKTKEYIRRPLKLKPSSCTPLFMATYI
                     MRDTGACIHTHSQNAIMCTLLFEDVFEISCIEQIKAIPKVTGSGNLLYSDRLVIPIIE
                     NTEKEEQLEPSLRKAILDYPGTTAILVRRHGIYVWGETIWKAKIYNEAIDYLLELAVK
                     MKQLGIPTVKSS"
     gene            <517338..>517765
                     /locus_tag="FOA43_002214"
                     /db_xref="GeneID:62195615"
     mRNA            join(<517338..517679,517733..>517765)
                     /locus_tag="FOA43_002214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922514.1"
                     /db_xref="GeneID:62195615"
     CDS             join(517338..517679,517733..517765)
                     /locus_tag="FOA43_002214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778442.1"
                     /db_xref="GeneID:62195615"
                     /db_xref="InterPro:IPR015159"
                     /translation="MLLNRKENNTEESESDTEVSGNEDELLERDINDERRDQLANKDK
                     DQLILWASELELDSLEIKEASAKMTAKFNEICKTISQTLSKVQLQIDKVDQKMDKIDK
                     LVRVYEKSNGKPIFNHVTTHKT"
     gene            complement(<517811..>518689)
                     /locus_tag="FOA43_002215"
                     /db_xref="GeneID:62195616"
     mRNA            complement(<517811..>518689)
                     /locus_tag="FOA43_002215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922515.1"
                     /db_xref="GeneID:62195616"
     CDS             complement(517811..518689)
                     /locus_tag="FOA43_002215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778443.1"
                     /db_xref="GeneID:62195616"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTTLNKSIEFLRPFLDVKKSSKQKTRPLFIGLEGPQGSGKTTLS
                     KQLDAKLSQLYPCLSFLTFSMDDFYLTFEEQNLLIASNQDNPLLNGRGLPGTHDVDLL
                     IECLERLSTQKTGVDIPVYDKSKYSGHGDRLPFEQWIHIKGPQLVDVVIFEGWFNGYL
                     VYPNTRNLLKKWSQVKTEYSPAFDRVKKEHVLKLNGDLAKYQSVWNYFDAFICITTDS
                     IENVYRWRLQQEHDMIKQKGSGMTDKQVACFVDRYMPGYRLYFDNLTEIMAKIPSLEV
                     KIALDRTPIAVRFCYI"
     gene            complement(<518806..>519576)
                     /locus_tag="FOA43_002216"
                     /db_xref="GeneID:62195617"
     mRNA            complement(<518806..>519576)
                     /locus_tag="FOA43_002216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922516.1"
                     /db_xref="GeneID:62195617"
     CDS             complement(518806..519576)
                     /locus_tag="FOA43_002216"
                     /note="BUSCO:EOG09343BZ8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778444.1"
                     /db_xref="GeneID:62195617"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR033948"
                     /db_xref="PFAM:PF01012"
                     /translation="MSSKIRILVPVKRVIDFALKPRINKTHDGVETQGVKFSINPFDN
                     IAVEEAVKIRKHNKGVVESIHAVSIGPSKAKDVLRTALAKGADTSSLVDIGSKELDPL
                     AVSKILKKIQEEQGSNLIIMGRQAIDDDAGQTGQMLAGLLGWSQATNASKVTINEDMT
                     VEVEKAIDGGVEIVKAPLPLIITTDLTLNEPKFVTLPKMMKAKKKPLKVVRPEDLGIN
                     LESRLETVSLEEPVPRKAGIKVKSVDELISKMKELKAI"
     gene            complement(<519738..>522164)
                     /locus_tag="FOA43_002217"
                     /db_xref="GeneID:62195618"
     mRNA            complement(<519738..>522164)
                     /locus_tag="FOA43_002217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922517.1"
                     /db_xref="GeneID:62195618"
     CDS             complement(519738..522164)
                     /locus_tag="FOA43_002217"
                     /note="BUSCO:EOG09340EDS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778445.1"
                     /db_xref="GeneID:62195618"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="InterPro:IPR034085"
                     /db_xref="PFAM:PF12348"
                     /translation="MEEEEPDYSKLPLEERLVHKIWKVRREAYQELDSNFQNSASEDT
                     ACFKLWLRSPELIRKAITDSNVVSEEAALSALVSFLQYGGDHTIRTLNTVVPAICEKG
                     LSSSRPVTKKMSVDALLWYIELGSAAPVIEFIIPSLSAQSPRVVASATATINEIYQAF
                     GCSVCPPKLALDQLPALFGHADRKVREEALHLSVTLRSYLGEGFDALIFPSLKPIQQK
                     DLTKAFIRIDGVPRPTRILKSQQSRQLDRQEDIPVEVEDVDMVDPDIESEQLEPEDPF
                     NLAEPVDVLPKLPSNFSQRVQDPKWKERVAVLEEVQKHFDVMRIKNQDFAEFIRVIAK
                     CLGDANLQVVTLSAQTIVELANGIRDEFERYVSVVIGPLLEKSKEKKKSVADAVNSAL
                     DSCFRYSSFGEIYEPCVQFMSHKIPQIRIEACRFLVRCLKELPRVPSKVYGDAIMMVA
                     IKHLDDSQVEVRTAMSEVIATMMKILGERASKQYVTKIDHRHMNKINDLYSRAEVKAS
                     RSSAVSQPKRSSSNNARRSLGPRPSLRKPVEAPSRHSFGSPNSMIPSKRGASPLKVHS
                     KMNLASRSMRSGDELFSGNVKAPAPNMAPNMAPNMAPNMKSTERKELESLRAEKLNWQ
                     KEREQLEVSLKQQIAMNEKNVEKLEELTSTVDDYKSRYASVSVASKSKDTQLRRLQGD
                     LEAAKGKIISLEKARQMQEQMQQQQQLQESLKTQDFQGSQKSSDPVEPAELNRRISGL
                     SLQPSTEKEKENLYRSANKTQTTTSSLASGLYELDSNDDSWKRAAEVTNQLKARIEQM
                     KARTRTLSQM"
     gene            <522431..>522793
                     /locus_tag="FOA43_002218"
                     /db_xref="GeneID:62195619"
     mRNA            <522431..>522793
                     /locus_tag="FOA43_002218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922518.1"
                     /db_xref="GeneID:62195619"
     CDS             522431..522793
                     /locus_tag="FOA43_002218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778446.1"
                     /db_xref="GeneID:62195619"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="InterPro:IPR036086"
                     /db_xref="PFAM:PF02195"
                     /translation="MSIQTSGNKQIDYLPIEQILRPIPPVLDYCKIDAMVSTLNGVPK
                     ESSTCKLENITAGELPPVDVLCVSDKGKKYYFAFGGCHRFQAYEKTKTAKVRCKIVPC
                     TKSMLKIYLGSSVDNFFE"
     gene            complement(<522800..>523873)
                     /locus_tag="FOA43_002219"
                     /db_xref="GeneID:62195620"
     mRNA            complement(<522800..>523873)
                     /locus_tag="FOA43_002219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922519.1"
                     /db_xref="GeneID:62195620"
     CDS             complement(522800..523873)
                     /locus_tag="FOA43_002219"
                     /note="BUSCO:EOG09344M45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778447.1"
                     /db_xref="GeneID:62195620"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030393"
                     /db_xref="PFAM:PF01926"
                     /translation="MYIRTFSARRFLTSFRRLICTTNDGAIPSLLKSIPNIKKILSDD
                     PISLPRSSEKHQQNGTLERRKPSLVDGCTLMKHFQSASVIQIVPKVNRSQESTINGLF
                     NRSQIVQDWSIFEFDQIPGEGEENESNFVDSNNLPEVILLGRCNVGKSSLINALLTNV
                     KERVKTYAKVKQRAGYTLCLNFYNIGGLFRLVDSPGYGNRGKQWQGMLVTDYLEKRRV
                     LRNCYLLLDSKVGLNQYDEMIVQHLVQSGTSFDVVFNKIDKIPNDSRIGHLERLIGNS
                     ILADLKIQPRYYFVNSVETSKGIKYRSGINELRLSMLQSCGLNVRTLAPKKLQRDSDR
                     LRQKRKLKNVKMIVNTKKLQRDS"
     gene            complement(<524023..>525888)
                     /locus_tag="FOA43_002220"
                     /db_xref="GeneID:62195621"
     mRNA            complement(join(<524023..525734,525885..>525888))
                     /locus_tag="FOA43_002220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922520.1"
                     /db_xref="GeneID:62195621"
     CDS             complement(join(524023..525734,525885..525888))
                     /locus_tag="FOA43_002220"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778448.1"
                     /db_xref="GeneID:62195621"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MKAGCTGTSNFIDAEADKRCLDLCNFDSDFPIRKDRYRAAAIVE
                     SACSSPNSSDCEDEEYCNVEIPDWDALETCDNMIRCTPPSLTESTNTPSTLSSIPETH
                     LSSDKLPLSHPLTRNDADSNGSLPTGSQFLKLLEPELSNVSLLSSTKLSNLRDHIQTS
                     ERPIIHPERPHIHEHFPPSDPNHHYHLHYQNHLNGSLVQHDLILPSNFPFQYQQSHHC
                     AVHDHTKVAGKYQNPQSYPEHQPTPKKQKQRPLVCKWDDCNSTLSNSDLNKHMFEQHF
                     TPDWLHQENPGQDFYQCEWLNCMFTTNELDRLFEHIGDHGSGNHQDAPKLPVDSFDDS
                     DLSILPISEISEESTESQVSHICKWIDPSTHILCNMEFSDTGSLTNHIISEHIKSGKS
                     QYICQWAGCPRSGRPFAQRQKIVRHLNTHTKHKPFQCSICGKRFSLELMLQQHIRIHT
                     GEKPYKCRICGKHFKTSSSLTIHSRIHSGDKPMVCGVCDKRFNESSNLNKHMKIHSRQ
                     FRCEICSKSFDNEGRYMKHLAACENKHSAMRNKLQCDCCNDSDRKINEEEEDGVLIKQ
                     EDGSI"
     gene            complement(<526037..>526510)
                     /locus_tag="FOA43_002221"
                     /db_xref="GeneID:62195622"
     mRNA            complement(<526037..>526510)
                     /locus_tag="FOA43_002221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922521.1"
                     /db_xref="GeneID:62195622"
     CDS             complement(526037..526510)
                     /locus_tag="FOA43_002221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778449.1"
                     /db_xref="GeneID:62195622"
                     /db_xref="PFAM:PF05205"
                     /translation="MDNSNIVEQYKLQGHFDSKRKQLLDEFQNGTSGVKGKLDDLLEE
                     LVDLKVQANPELVVENRGKLVAQIQASLTKQQMYSRPTPKGPRGLNHSAPRLTKVEAG
                     PSETPSSTITQKEADIIKQINELLNGYVKEVVSGNEQLNKDLEQSLARIERQTKQ"
     gene            <526973..>529879
                     /locus_tag="FOA43_002222"
                     /db_xref="GeneID:62195623"
     mRNA            <526973..>529879
                     /locus_tag="FOA43_002222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922522.1"
                     /db_xref="GeneID:62195623"
     CDS             526973..529879
                     /locus_tag="FOA43_002222"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778450.1"
                     /db_xref="GeneID:62195623"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF04082"
                     /translation="MTDPIKLSMLINADENRSMSVRSNDSPLYSSNQLKSQDGDSPVS
                     TDGTSNDIIAHKRARGRKRKLKGPPYICDYPDCHKEFHRSEHLSRHQLNHNPKKIYRC
                     TQSGCEKTFVRHDLLARHLKRHANKLEKKRKNGESSSHPPEDHENGAKRRELTSSPSQ
                     NSIGKTLAVQASNQVNAALSPSHTNNRTVSPAAADSTVSHPPVNAFRAPSTQNQHDPK
                     GFSSVSQILQQHNQALAESPIVSQDFSRQETGAAPNLLSWLFGDNPSNVNPQTQNIGS
                     PTSRKDPTDFLTGLNEFQMNNGGQSFFILDGFEQLSPSSSSTLGLYPSPDQQQPQRTP
                     ASVASQSPQPQEQQQQASDETSPISLNHNTVDAANNNGGTYESSRQYEPLHQDNESLH
                     KLSDGKLAEFAQLIPEVKEHSDFTRVKLEKALKMYWKFFHPRFPMLHRPSFDSLETPP
                     LLLLSMIVLGIKLSQCVDDITCPFDEKFRDPKTLADKIGLPLRWLIFASPKFQPPAKL
                     WIIQSLLMLEFYEKNCTTRQLHERAHLHHGTTIQLLRRSPTLGGSPHKTTGADDASNW
                     FKWIEIESMKRATFMCFYMDAIDAISFGHQMLIYAHQIQMTMPVEDDVWESNLRNFRS
                     SFKKCKRPKPFLLVLKNIMNGFPMRTNSFGKKVLLAGLSAIMFQIQQRDMQLMFGLDK
                     FGMTGTVNNWRELLTAAFSIWRNDVGGSCCSSRTAIDNMSSMSNSLQFSTSDTRCKCI
                     TYHMAHVYMSISHYDLFIVAGAPWRMNVKPSSLLEREQIEKRVSEWSQTRHSEVCVVQ
                     CYLLLFEIFLSPQDSAYEYQYDYVPDQDLFFRSYVIGLCTMVLWCYIHARNGPDSFRM
                     TAETYKNHDYEEDGYRYLKRMRNEFTTRSGGIMLHTWFSNCSGAQFYGNLVKWVDVLE
                     EIPDMQNMVGLLGLVGNKLIDADYTVVKEMGKLLLFCRDRCRGSKETILKNMYE"
     gene            complement(<529925..>530617)
                     /locus_tag="FOA43_002223"
                     /db_xref="GeneID:62195624"
     mRNA            complement(<529925..>530617)
                     /locus_tag="FOA43_002223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922523.1"
                     /db_xref="GeneID:62195624"
     CDS             complement(529925..530617)
                     /locus_tag="FOA43_002223"
                     /note="BUSCO:EOG093444G5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778451.1"
                     /db_xref="GeneID:62195624"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PFAM:PF03357"
                     /translation="MWSYLFGGGQQKKELPKKAIVQLREHIATLNKKEEYLEKQIDQQ
                     DKIARQNVTKNKAVARQALKRKKKLEGDLIKVGNQIQSLETQLNAIESANLNLETMKA
                     MKQGAKAIKQIHSDFNIDKVDETMDDIRDQVEASEEISDAISRPLGTDMVDDDELEEE
                     LAEMQQEELDNKMTNTGAKVSENTPSKNEIAKARLPSVPTSKVQDKKQEEVDDEDEDE
                     KALKQLQAEMGM"
     gene            complement(<530795..>532384)
                     /locus_tag="FOA43_002224"
                     /db_xref="GeneID:62195625"
     mRNA            complement(<530795..>532384)
                     /locus_tag="FOA43_002224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922524.1"
                     /db_xref="GeneID:62195625"
     CDS             complement(530795..532384)
                     /locus_tag="FOA43_002224"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778452.1"
                     /db_xref="GeneID:62195625"
                     /db_xref="InterPro:IPR010770"
                     /translation="MDPSILFENTSQEPFYAERDTLVFALFYENVYKTKKEQVTKLKE
                     LEHYLACEIEPFIKYYPWYSKPVEFELYEDYQGRCFIYGELVYGDYVNDLWLITSILY
                     NFSARDSDLYIKVLDQDGEYLLIEGADHISPWMDGEVSCNRIWINDMSIKTVPKEYKE
                     GSSLSMDESLDFIKTHYYKMEPCVDLTDFLVNHVLNKYPKEVLENLYVETVRVNESVF
                     EFIAANKPYLVNAALNFQMESLFPDVPGKKGRFPESFYSDDEETLVDVKVRVSALGYL
                     LLKEYGKRSKLEKGRFLTRSLDKYVSENPMIDIKWESPTSIVEEFNETTDKDLLQKEL
                     LRFSIIDREIMSKEPEFESESESEPGEKNTMSPEAEKGQEILQMLEKFMNGGNKEEEE
                     EEEEEVHYDGTPWGNRGQSWEQDNLGSIMTDYDDMNDDYYEKEEEEDIGLGIDVGIDE
                     DDFFEFFCKEALKLKDIDMEKMSGQLEGSQLQKLSNSPKSHRMQHNDSGIDVLSSLFA
                     SLNTENGDSGAVSSIVRPNEV"
     gene            complement(<532591..>533646)
                     /locus_tag="FOA43_002225"
                     /db_xref="GeneID:62195626"
     mRNA            complement(<532591..>533646)
                     /locus_tag="FOA43_002225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922525.1"
                     /db_xref="GeneID:62195626"
     CDS             complement(532591..533646)
                     /locus_tag="FOA43_002225"
                     /note="BUSCO:EOG09342LDO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778453.1"
                     /db_xref="GeneID:62195626"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="InterPro:IPR036895"
                     /db_xref="PFAM:PF03167"
                     /translation="MSAGVKHSITDFFAVSKRQKSTISKKAAAVVKPSPKSSTPLNVT
                     SVATPGLSMFKVKPPSVANKFDRQAWINSLSVEQKELLDLEINTMDESWLAVLHEEMT
                     KPYFIDLKKFLRDEWKSGKVIFPPQKDIYSWSRLAPLSKVKVLILGQDPYHNYNQAHG
                     LAFSVHDPRTKPPPSLNNIYKCLKKDYPDFVVPTTGDLTQWAQQGILLLNTCLTVRAH
                     NANSHSNHGWEKFTSTVIRKLVDYKNHVVHQGLVIIAWGSPAQRTIRNVGHIDWDQNL
                     FLKSVHPSPLSAPRGFFDCQHFIKCNNWLYERYGSEGLIDWAIVDGNKLQDLEKKKDK
                     SKRLQEALEARKKPKDE"
     gene            <533857..>535749
                     /locus_tag="FOA43_002226"
                     /db_xref="GeneID:62195627"
     mRNA            <533857..>535749
                     /locus_tag="FOA43_002226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922526.1"
                     /db_xref="GeneID:62195627"
     CDS             533857..535749
                     /locus_tag="FOA43_002226"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778454.1"
                     /db_xref="GeneID:62195627"
                     /translation="MKLSKPFVLKAVQSVNKDFHKRIELMKQTKQNVKPEDSAVPENE
                     ADGPEIVPEIPGNNDTEELENSKKRKLEDPPVTKATNLDLLETNSTERRMSWAFWNSS
                     AESKQQSTDSSDKVKSNVKEEVAKEPLKDRSHSWSFWVSKHEQAVYPFQPNVIVRSTA
                     TKFDAAKSEPSGPVSGPIPGSVMGPVSGPASGPVSGSVLESGSQSVREMSKKRENKRP
                     NLIVPSFRETLPPSTAFTTLVSGIKRAKVMLGYTGERQKHLYRRNTAKIFKRVLIIGV
                     HGFFPTRVLRRFIGEPTGTSMKLAQVAEGAVLSWASDNNMEVEIQKIALEKEGKIFDR
                     VDFFYEVLKQSAEDIKQADFIFVCAHSQGTPVSIMLMSKLLEYGIIDEDKRIGILGMA
                     GINNGPFYGMEQSLLVRAYSTFENESMLELFQFQNFESLQSRKYLESVRNLVCHNTKI
                     TYVGSIDDQLVPLYSSIASHVKHPNIYKAVYIDGGSDTPDFVARILKISCMLQNLGYS
                     DHDVIKEISYALAGPLTGGGHSNIYNDINVYKLALNFTMKTEDAEIAIEEPVLFKSFD
                     LKKLGSNPFNLPWCVRGLFFEAMRKLYRGNHEIEMVFKEFDEWNPESKALKDLKYRLN
                     GIKAKL"
     gene            <535845..>536792
                     /locus_tag="FOA43_002227"
                     /db_xref="GeneID:62195628"
     mRNA            <535845..>536792
                     /locus_tag="FOA43_002227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922527.1"
                     /db_xref="GeneID:62195628"
     CDS             535845..536792
                     /locus_tag="FOA43_002227"
                     /note="BUSCO:EOG093430GZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778455.1"
                     /db_xref="GeneID:62195628"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MPKESTVSAAQKVSTLGGCIAGAIAGCAAVTFTNPIDLVKTRMQ
                     LEGELSMKNVPKVYRNPFQAFGLILRNEGIHGIQKGLMASYLFQIGLNSCRLGLYEPI
                     RKVLNSVVYPTKNPENVQNVGINVLTGSLTGVIGCITSSPFYLLKTRMQSFSESVQVG
                     QQSHYDSTWHGFKTIYADEGVKGLFRGLDAAILRTAAGSAAQLPAYNFAKQELIKSGY
                     FEEGMGLQLASSVFAGLGVTVVMNPFDVVMTRMYNQRGNLYSGPVDCLIKTVKMEGPT
                     ALYKGFIAQLLRNAPHTMLLLLFMEQTMSIVYNVEQRFK"
     gene            complement(<536891..>539158)
                     /locus_tag="FOA43_002228"
                     /db_xref="GeneID:62195629"
     mRNA            complement(<536891..>539158)
                     /locus_tag="FOA43_002228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922528.1"
                     /db_xref="GeneID:62195629"
     CDS             complement(536891..539158)
                     /locus_tag="FOA43_002228"
                     /note="BUSCO:EOG09340Y0R;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778456.1"
                     /db_xref="GeneID:62195629"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="PFAM:PF01753"
                     /translation="MRDSNNKSVSANKAAVSITSTLYDRRALDCTEDKPLVNSLNHLT
                     FLASSSLKVREALSQDGGLERLIDILYECRNPQTDAEKCVFAWKWVLAFQSLVLVGTR
                     GNEKLRRKVVEAGILPIIATILDNYLITRRMAWVSQFENGYRPDVYDGVPSVTVAGSE
                     NVGGVSTASDDSSSFGSHAFDYSNVTAATTTTATGTINTAAAAAMAANSVVPIVSQQS
                     SSVPSDDVVINDEITDSQVNTVFRQVRSLLDQANQTILETEAEIGKHRCPKDECIEKC
                     SKSQCKDLSEVDEKYRKVYKCLEFLKFLHRLNNADGLGLIGQELACEYQNLTADVVFG
                     SQLATNKDISNLLKMDSTWTTELPFMKKFEEKLNQSVPREFENGILIPKEDDVIWSLQ
                     LLAFISKYTTLRYEMANTYIVNGLSLRNYSIPPPLESDTGTRSQDVIFDDCDYFEFVE
                     PRPLDNPFLLFPDFSNEYESSKPSPQTVPESVSHALSPEYDKDHADLFKSYYQTLNES
                     EKFMEASKLEKLALDISRFAHREYSKLRMRNRQVYRSQRQSYDKQWDYENSWDELATP
                     AYASACIDNDIRPIKRLNIFPLVEKFTVRHLYSKDINYWSSVIVRNFNRKDENRGGRR
                     QCAYFGCGKWESEPRQFAKCRRCKRAKYCSKECQSKAWAYHKYWCNAVCTGSSADSSS
                     SQPQHATMIGNSNEHHRMHHRHNPMEQGIPPNDTATTLAPGVQVQQQGISDDVSSSSP
                     PNVPNAPTFQHGFFQ"
     gene            complement(<539500..>540723)
                     /locus_tag="FOA43_002229"
                     /db_xref="GeneID:62195630"
     mRNA            complement(<539500..>540723)
                     /locus_tag="FOA43_002229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922529.1"
                     /db_xref="GeneID:62195630"
     CDS             complement(539500..540723)
                     /locus_tag="FOA43_002229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778457.1"
                     /db_xref="GeneID:62195630"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="PFAM:PF01399"
                     /translation="MSQMDVDVSDPLTALITLREEIEPTEDTQLIGSFYELEDLYERK
                     LWYQLSELLTKSIYKNENSKPIRLRLYENFVFTFAHKISQLKLVEFLLLSIGECSLED
                     SLEYLHSLELEITAVLSKQQNGSAEEGVNFNEVRQADIFVRIETARIKLEMGNVDEAT
                     TIIDESSKKIDDLVSSVDNRVNASYYRTNAQLMKINGDYSAYYYSSLLFLACITDLNE
                     LTNKTQIVRDICVSGLLGDKIYNFGEIIMHEIFQYLQDDDWLKHLVLSLNNGDLTGFK
                     EIIDSPDVQSVPELSNSVEFLKQKMCIMALIEIVFSKPTNSKTVKYSELLKEIPLLKN
                     ADDVERLTMKCLSLGLIKGHINQVSSEVEINWIQPRTMTRDQIVNMKKKMTQWSERVE
                     DLNKYMGDAGKELWV"
     gene            <540967..>543354
                     /locus_tag="FOA43_002230"
                     /db_xref="GeneID:62195631"
     mRNA            <540967..>543354
                     /locus_tag="FOA43_002230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922530.1"
                     /db_xref="GeneID:62195631"
     CDS             540967..543354
                     /locus_tag="FOA43_002230"
                     /note="BUSCO:EOG093415Q9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778458.1"
                     /db_xref="GeneID:62195631"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="PFAM:PF00570"
                     /db_xref="PFAM:PF01612"
                     /db_xref="PFAM:PF08066"
                     /translation="MSSNPLEKVAPKLVGLIRLSSALNAKDIDFYKSIDKGIKQHSEE
                     TNEEMITLLNKVVQSAVSASTDLNPKDLLITNGNDLENMKVVGNVLDSLFENVEIGLD
                     DYFKARRSGKVTTGSSSNQDGYTYLDETDRNSAHSLPEKMHYSSVPKPQLKFLDKVNN
                     FEIHPFKPLITAKPKSVVPFEESMKLITAAEDDPEHYNNPYAYEIMNMEYPEWIFSPI
                     ETPYMSVPWKGSSAPTWVDDPSQLDDLLTELVKCKVIGVDLEHHDYRTYHGLTSLMQI
                     STDTKKDYLIDPLSPALKPCLNRLNVVFADPKIIKVFHGAFMDMIWLQRDLGLYVVSL
                     FDTYWAAKELALGKYSLAFLLEKYVRFRTSKKWQLADWRIRPLSPEMMNYAKADTHFL
                     IELFCKIQADLVNKPGALRRVLYESRKVSNRRFEYSTYKPSNATNKGVVSTNGSVPLR
                     PEYQDQLFSFNSNRDAPWINLMQNNGLLMSKGPIVEALYKWRDNEARTEDESQRFVMS
                     DFVLASLANAFNPETIDQITETNVLTAINRSARFGSSLFVRKYVKELTKLIREVMKQV
                     LKMDIKAWDFTTGTDSPQMASNLVADKDDVYESIKDAERLEEEFEDFYSQYKKVNFGG
                     DGGESKGHAKFEKEKLSDVWSVEYGKKCKFVKGTEVKKRLHKAIEHLKEYEEPVLEVK
                     EDGGVEIADNVSDVEEAVEEKEDETNSSDIDEIITLRKHNKGKNKKRVVEVGEEVIDL
                     KKKIMEPLQRRDRRKKRGKKRSFDPYSASSSQNPDIARVKKRKPRDIGKNVVFKR"
     gene            complement(<543410..>544012)
                     /gene="APT1"
                     /locus_tag="FOA43_002231"
                     /db_xref="GeneID:62195632"
     mRNA            complement(<543410..>544012)
                     /gene="APT1"
                     /locus_tag="FOA43_002231"
                     /product="adenine phosphoribosyltransferase"
                     /transcript_id="XM_038922531.1"
                     /db_xref="GeneID:62195632"
     CDS             complement(543410..544012)
                     /gene="APT1"
                     /locus_tag="FOA43_002231"
                     /note="BUSCO:EOG093440VY"
                     /codon_start=1
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="XP_038778459.1"
                     /db_xref="GeneID:62195632"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="PFAM:PF00156"
                     /translation="MTGSSNESLKKIEEISRELKSALHQYPNFPQEGILFEDFLPIFR
                     SPDLFNKMIIAFKLHIDEKFKGKTIDYVVGLESRGFLFGPTLALALDAGFVPIRKKGK
                     LPGKTFKANFSKEYGEDYFEIQKEAIPDGSNVLVVDDILATGGSAEAAGRLVLACDAN
                     LMGFLFVMELDFLNGRDKLQASSFTLLRGQPESLKEGKEQ"
     gene            complement(<546779..>548857)
                     /locus_tag="FOA43_002232"
                     /db_xref="GeneID:62195633"
     mRNA            complement(<546779..>548857)
                     /locus_tag="FOA43_002232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922532.1"
                     /db_xref="GeneID:62195633"
     CDS             complement(546779..548857)
                     /locus_tag="FOA43_002232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778460.1"
                     /db_xref="GeneID:62195633"
                     /db_xref="InterPro:IPR007528"
                     /db_xref="PFAM:PF04437"
                     /translation="MSHDGSDSTIQRFLNTTFSSVDDLGHIDHLISEIEQARSTLRQK
                     AESHQEDKEDDAKVSQILDQLNKLVDTDDISGLDSLISRYGEIEMFLVVKGKMVEKLK
                     LEEAKKAHKLYVELSGKLNNFELFDLADDSEKSDGDKLAKLKELYAEVAEFIKTNAGK
                     KDLPDYSSFLNQKLSAIILENFKEMAEKSLKESLSDYDTEKKKFSTNEMKLMNTNFAS
                     LLELQSLDPIYADPHYPSTFWAMDCLCGRFKISFIYHFEGKSETNRLDKPEYALDYIL
                     GYLQKTLPLIRMLFDETFLCYHPKKSIDDAFITSLLASAREKFQHDRNLCLVNKKLLS
                     HLISELQKFDRTLLEDFNYKPVGKIEKWSGLTYDLILSDSSVFDRWLNNEKEFVNSRY
                     DEIINAKDAFIIDYDFVELGHTQPTKSAISMSNLLDGITSNYENLPLEYQLKFLSDVQ
                     LKLLNFYYTVLKQGVKALDSVARNDEVSFTERLCRIWCSAQYMVELMSRWGERLFFIE
                     LWNSINPDNDCQNTFFDSVIAGYRRDILDQLPKKLKQNEERRINKSMKDYFQNYISWR
                     NVRSINSHPVELELPIHTLSNDLEFLRKTVSGSTFYAIKLYFSEVISEYFIKNFISCN
                     TFNPLGAAQLRKHVDMFYESLQLTRDYEHYDRLCEMIDVFGSTDIDPQNFKILSEQEV
                     DDLIRRRSRD"
     gene            complement(<549009..>550256)
                     /gene="BIO2"
                     /locus_tag="FOA43_002233"
                     /db_xref="GeneID:62195634"
     mRNA            complement(<549009..>550256)
                     /gene="BIO2"
                     /locus_tag="FOA43_002233"
                     /product="biotin synthase"
                     /transcript_id="XM_038922533.1"
                     /db_xref="GeneID:62195634"
     CDS             complement(549009..550256)
                     /gene="BIO2"
                     /locus_tag="FOA43_002233"
                     /codon_start=1
                     /product="biotin synthase"
                     /protein_id="XP_038778461.1"
                     /db_xref="GeneID:62195634"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="PFAM:PF04055"
                     /db_xref="PFAM:PF06968"
                     /translation="MLNAIVSKRYFSSISSVLRSTEIRLAKQPANATFNLKKSLDPIE
                     LALTADKPIHSWTKEQIREIYNTPLNDLLFCAQLVHRKFHNPSQIQLCTLMSIKTGGC
                     TEDCKYCAQSSRNNTGLKAEKLVDLDTVFEKAKEAKSRGSTRFCMGSAWRDMHGRKSA
                     MKKIGAMVKKINDELEMETCVTLGMLDDGQAQILKEAGLTAYNHNIDTSREHYKDIIS
                     TRTFDDRLKTIKKVQDAHIGACTGGILGLGETDEDHVSFLHTLATMDRHPESLPINRL
                     IAINGTPMAEELKTKYKDRKLTTESILKTISTARLLMPKAIIRLAAGRYTMRESEQLL
                     CFMAGVNAIFTGEKMLTTMCTGWDEDINMLKKWGFVPMKSFKKTGPSSHLKINIDPKE
                     KTFTVNLSARDPEAENDQTVVSA"
     gene            <551282..>552289
                     /gene="MDH1"
                     /locus_tag="FOA43_002234"
                     /db_xref="GeneID:62195635"
     mRNA            <551282..>552289
                     /gene="MDH1"
                     /locus_tag="FOA43_002234"
                     /product="Malate dehydrogenase, cytoplasmic"
                     /transcript_id="XM_038922534.1"
                     /db_xref="GeneID:62195635"
     CDS             551282..552289
                     /gene="MDH1"
                     /locus_tag="FOA43_002234"
                     /codon_start=1
                     /product="Malate dehydrogenase, cytoplasmic"
                     /protein_id="XP_038778462.1"
                     /db_xref="GeneID:62195635"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00056"
                     /db_xref="PFAM:PF02866"
                     /translation="MFSRIAARNFSSSAANAYKVSILGAAGGIGQPLSLLLKLNGKVT
                     DLSLYDLKLAKGVAADLSHIPTKSVVHGFTLADDGLSRALQNADVVLIPAGVPRKPGM
                     TRDDLFNTNASIVKGLAEACAENCPSAAICVISNPVNSTVPIVREVLKRKGVFNPQKL
                     FGVTTLDTLRANRFISEIVGSDPAREDVSVVGGHSGVTIVPLISQTQYSDTIPKEKAD
                     ALIQRIQHGGDEVVKAKDGAGSATLSMAQAGARFAGSVLSGLAGEQDVLEATYIDSPL
                     FKDEGIEFFASRVTLGPQGVKEIHGLGLLSVAEEDMIATAKETLRKNIKKGIDFVKAN
                     A"
     gene            complement(<552383..>555091)
                     /locus_tag="FOA43_002235"
                     /db_xref="GeneID:62195636"
     mRNA            complement(<552383..>555091)
                     /locus_tag="FOA43_002235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922535.1"
                     /db_xref="GeneID:62195636"
     CDS             complement(552383..555091)
                     /locus_tag="FOA43_002235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778463.1"
                     /db_xref="GeneID:62195636"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PFAM:PF08238"
                     /translation="MQQPRPQHARAGYPVYQPQQPYYPPMPPQQGYPSQGYQNYGAGY
                     GYQGHQGPPGVPQGVPQGVPQGVPQGALRGQQGPPLPPPPSKQYRQGYANQPLQQGNL
                     YNNSPPRQGYPQQRIPGPPPPQQMQQQYSGPQSSQSVPQLQVTTSPSKIPQQQDNYKP
                     AIDSSLHHTNSMNPAEQERINQLEDKVQRLERALKLQEFKDANGSNLSMGSSVLSVDG
                     PAASSRSGKKKRKDMTGGSSNSLIPDEDKLADGDILNTDPPDEPFVYEELESPGSMTY
                     SKSIYRTGFEKAGFNMDHFKNTQQRRRYNDDKADPQLRANVVPPPPEIHDEPTEPLRV
                     VTDQTLSSSVYSDRTASNANAHDVEGYLDKYEFARDQPREKHRNQTRYQDSLQDHSPD
                     TYEPYRQPQQPPQPRSASSSHSDLTRRKESAPRMDSVPRIDSRANSIPNSLQTGPKER
                     SPMDSIIRYTLRTSFKKLNNGIIEPILPSKSSEPLENVMARFRSTREKASNDYKSFTP
                     RIQFYWAIMLLETMARPDVLSKMAIDGKLRRRPIPIKSLQPQRRQFLSTSVKVLEKLV
                     QVSPTETRARLYLADIYSGGIHPGVIEKDEKKGFNMFYDAAVKQHDPVACYRIACCLE
                     AGVGCRKDVEKSCDFFNIAARLGDPSAMCQLGMMYFAGVNGYPLSIAKSIQWHMEASE
                     TLRSEKVMGSDPLISARSFSDSRGALYTLAKLHQTDLSILCLDNDSSQALFAVDELRK
                     LHVFRNKAKALRYYLDAAKIGHAESQASLGYYYSKGFFPTSSFKPDKDSFEGQSDSID
                     PRRSIYWFSKAAQNGHAYASLGLAKWYGSGAPDGTLKKDDQQAFLWGRKAADEGQLPE
                     AEFMIGQCFEQGFGTNKNQQMAVNYYKHSASKGYKKAIVMLKRMNK"
     gene            555975..556091
                     /locus_tag="FOA43_002236"
                     /db_xref="GeneID:62195637"
     tRNA            555975..556091
                     /locus_tag="FOA43_002236"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:62195637"
     gene            complement(<556249..>556941)
                     /gene="RPL43A"
                     /locus_tag="FOA43_002237"
                     /db_xref="GeneID:62195638"
     mRNA            complement(join(<556249..556525,556898..>556941))
                     /gene="RPL43A"
                     /locus_tag="FOA43_002237"
                     /product="60S ribosomal protein L43A"
                     /transcript_id="XM_038922536.1"
                     /db_xref="GeneID:62195638"
     CDS             complement(join(556249..556525,556898..556941))
                     /gene="RPL43A"
                     /locus_tag="FOA43_002237"
                     /codon_start=1
                     /product="60S ribosomal protein L43A"
                     /protein_id="XP_038778464.1"
                     /db_xref="GeneID:62195638"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="PFAM:PF01780"
                     /translation="MQILIFFKGLPSTGRAKRTKKVGITGKYGVRYGSSLRRQCKKLE
                     IQQHSKYDCSFCGKKTVKRDSTGIWTCKSCKKTVAGGAYTISTAAAATIRSTIRRLRE
                     LAEA"
     gene            <557069..>558022
                     /locus_tag="FOA43_002238"
                     /db_xref="GeneID:62195639"
     mRNA            <557069..>558022
                     /locus_tag="FOA43_002238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922537.1"
                     /db_xref="GeneID:62195639"
     CDS             557069..558022
                     /locus_tag="FOA43_002238"
                     /note="BUSCO:EOG09344DLY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778465.1"
                     /db_xref="GeneID:62195639"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="PFAM:PF05182"
                     /translation="MDDDDAFLYGEGGGKGNTGSTGIEAKDGDAVKAISTEDKETNNE
                     ENKKAESEEAENEEEDSSDSDVEFVIGSLESKPITDLVQEKDKEEDDVSGDGSVKAQT
                     VPILTESKGLNIDEVGKYHDIPVNSLTFEELKDKPWRLPGADLSDYFNFGFDELSWLA
                     YCKKQNTLRKDFNPAKVIAELMGGGAMPPPPAASSGGQGRVGGGPNMPPPPFMMPPMG
                     MPFMPPNMQMPGMFNGINNNNNNNNSMNNTGGSRTPSLPNIPKLPSRPTSNSKSPEPS
                     NRTSSMPQNSSYRDRADKATEMRSSGHSGNQNYRDRPSRRR"
     gene            complement(<558104..>559213)
                     /locus_tag="FOA43_002239"
                     /db_xref="GeneID:62195640"
     mRNA            complement(<558104..>559213)
                     /locus_tag="FOA43_002239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922538.1"
                     /db_xref="GeneID:62195640"
     CDS             complement(558104..559213)
                     /locus_tag="FOA43_002239"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778466.1"
                     /db_xref="GeneID:62195640"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="PFAM:PF02668"
                     /translation="MPGVTVSPLNRAFGAKITLPSYTNDPSKLNEEDFEELKKALLTY
                     SVLVVPNQAGLSPESQYALTVRFDPTTGAHYGHDEKIFHSPLSVLAKDGKCVPRRPEV
                     MMVGNGTFPAGHEGMKEFSLEHPSQSTFHKKVLTEEEIANHHTRFYRWHIDAALYEFS
                     PPVVTTLLGVIVPPKTEKQVIYYEDSDEKLEVFTGATAFTSGKVAFSLLSEEDKKFAL
                     NTTVVYAPHPYIYIHNCRATSDGLTMVSEGKEMPLDKLPHWEESKLKKLPMVWTNPIT
                     GNPHLEFHSCCVYRLVNSTTGETVAELEKAREICHRLMRPAISPDHVYAHAWTEGDLC
                     FFHNRGVIHSVTGEMPKDEKRLMHQCNVASGKDPK"
     gene            complement(<559489..>563707)
                     /locus_tag="FOA43_002240"
                     /db_xref="GeneID:62195641"
     mRNA            complement(join(<559489..563400,563702..>563707))
                     /locus_tag="FOA43_002240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922539.1"
                     /db_xref="GeneID:62195641"
     CDS             complement(join(559489..563400,563702..563707))
                     /locus_tag="FOA43_002240"
                     /note="BUSCO:EOG093408CJ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778467.1"
                     /db_xref="GeneID:62195641"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="PFAM:PF00169"
                     /translation="MSMLKEIRSQSPQVIRTDARNVSIDSNNTSIDADNTFMSQQSHQ
                     SAKYSLDLPNLSTTSSTEPLQVPIIPSPNGKKSLDDSNAFLVRQNRHISGPRNYSIHR
                     KRVAFDSEPSKIHTYHQQPVNGDTTIQHADVRWNTVPVIRSANSQIVKQIPQTHKPLP
                     SIKPSESNYSIKSMPNMEAGLIANPLFSTGDSIKKRKKKKKTVFNHITSENCPNLAYD
                     HIEYMEQVKRGELKESQDVRENKQYRARVKESILPGSRFGRPSERTVDDAINDLGDLY
                     ETNIRNTDGNTLNLRRIASVKSTKSISAADRKLKTTIVNRRMRSLDLREGIQGFTDDD
                     VREIIAKQSKDNDIADSNINTHSTAPRLSNVVGNFTKSFPGENKPENTDAERSHMTKR
                     ERRSISARSTSTIMTNESDFVSATEGESEDDDNIHEFSSENSSEKIADSVDDIEDDTE
                     RDDTVNEEVEEEPDNATVHEKVIVVDAPVILSKASVIATPAHDSATSSRNVSSSTNSS
                     FAPDKFVLEVPQFDQEEPVSDLQSFKYDPNFPMLTSDVEVISKLRLKKTRDRRNGSEL
                     SRRGDVLDIWSRQDSFRRVSSHSDDFEPISPPSESRFIVHTKSPKVVQVVPSQRLSWS
                     GVDSAVYGPKTWAERRKDVKDEEEHEVVTEEEVDENKPAAEPEPAAEPEPEPEPAAVE
                     ETTERDSPPPVEDSIDMETYLDHHISIDDDSFLKDAFFWNPDADDRVASEDKHRESDQ
                     TDREVSKLWRDGTLSKKTKVMSHSASNSVNFAHLSVDEMEKFMIRKRLASEDFEIKTV
                     NATAEIGSYVPLQCEQRGQMIDPHFTQDEASVMVSDLAIPGGINDGSSLSEFETSPEA
                     KENMDLFADDINPDTFKGKLMPVRKGDPVLLKEVEMKPQTSTLGSSDSQALFEGATIS
                     DQRNEIIKVESEPEQAPKQDEHKTEGVNASSELIDGEQGRMFIRIFNMHSLNFPDISR
                     RQAKFQLVIDNGLHVLTTHYFDIGDQASIPIDKEFEFIVAKQLDIIITLKLRYQKLND
                     TLVEVKERKMVKSKNFFARLFGMKSIVTTTKYVNHPAKFDPLGKIVATDGSFSKIRIN
                     FDDYKSQIVCRPLNFNLNGFNEWNMKKSGKGDSMKPQPFRICSLGVQMLFIPRRSQYE
                     VLPVSIKNAVSQVREVNKVMEYEHKGYMFQEGGDLDIWTRRFFKLKGYELFAYNDDTM
                     KLKAKINLKRVVEIIYPEKQSAIYPPEEEGLDNRVISETLILNDGYKLRFSNEETIDF
                     GCDSREDRDEWIQLLEEVILKNNFRRQPWVKEMSRVIKKSIEI"
     gene            complement(<563765..>564499)
                     /locus_tag="FOA43_002241"
                     /db_xref="GeneID:62195642"
     mRNA            complement(<563765..>564499)
                     /locus_tag="FOA43_002241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922540.1"
                     /db_xref="GeneID:62195642"
     CDS             complement(563765..564499)
                     /locus_tag="FOA43_002241"
                     /note="BUSCO:EOG09343QQ8;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778468.1"
                     /db_xref="GeneID:62195642"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="PFAM:PF04707"
                     /translation="MRIFESKQVFEYPWEQVSAANWQKYPNEVSTHVKSVDVLRREYD
                     SNKQILTTERLIGCSQKVPKWLICIMGCSDKSYVREICTVDLKKRTVTMRSCNLTWSN
                     FLKVWETVVYSPDKKDPRSMTSFSQEAEITAHLTFQRVCDQIEEWSVQRFGQNAEKGK
                     MGFDSVLEKLDPVWHAKFDDISGKTSKLFDQVNNRTSCVLKELNSRTGSVLKELTDRS
                     ECALHDVNDRTHSTVSQLADSILHKN"
     gene            <566675..>567472
                     /locus_tag="FOA43_002242"
                     /db_xref="GeneID:62195643"
     mRNA            <566675..>567472
                     /locus_tag="FOA43_002242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922541.1"
                     /db_xref="GeneID:62195643"
     CDS             566675..567472
                     /locus_tag="FOA43_002242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778469.1"
                     /db_xref="GeneID:62195643"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR036910"
                     /db_xref="PFAM:PF00505"
                     /db_xref="PFAM:PF09011"
                     /translation="MSEQSPIGNDSRVDGVNVNDGVNVNININDNKADNDTNNGSGSP
                     SSSNTNSPTTSTAAFLQLIASLFELSKAANEASKAAVDFFNVVDAKPQYMAPPLFDQS
                     LLAPQPQHMQQGNGATGLSLSSGGQPQQIVVDVPKKKKKYRDPNAPKKPLTSFFLYSN
                     FMRDVIIKERMRSGADPLSQPQIAQETSRRWKMIPDHEKMGWKELYEDQKKDYDLELK
                     KYNLAKETGQPYTAPKRRDNVAPSLYGKKRLLDEDMKRKDKKKKRKE"
     gene            complement(<567581..>569395)
                     /locus_tag="FOA43_002243"
                     /db_xref="GeneID:62195644"
     mRNA            complement(<567581..>569395)
                     /locus_tag="FOA43_002243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922542.1"
                     /db_xref="GeneID:62195644"
     CDS             complement(567581..569395)
                     /locus_tag="FOA43_002243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778470.1"
                     /db_xref="GeneID:62195644"
                     /translation="MLLDVLKIDSAEKLADRSFIEGLDTSDVISKLLLSVYSLEGQVG
                     KLKDRLSQYEKLNRLLDLEDVSAGDVVVGDGDGDVSGIVPGSRAVLNSPEGEPGSAPG
                     SEPGSASGSVPGSASVPSLHEPTVIQGITVNTSPEDTKVPIGFTPMYSAPAVTEDEIQ
                     PSLAAGIVDDKHFVRPWPEVTLNQLALRFKIPRELLSKTARKLGASKDLDDSNLKPIR
                     GSDIQGQHRPVGRPRKHPGHVGRPRRGPGRPRKSETDNIDAIDATDATDATETPTEAA
                     STGDSTEPEDSAQVSNGSSLATETEIKLESTYQIPAKRTHETSDAESTAAKKIRLEND
                     PNPAALRYTITGDMKYSCDTCKQSGSASYIFNNYMDLYTHKHEDHPEEFLQKQSPDGI
                     DEAVGEAVENVVSANSSTVFSVMEGDKRKALQFRFVDDMPSRDPMLPSRGRPIGIASN
                     AKSLTAFYSRGSGKSFLCRLCYRKPFTSYHGVYAHLQSVHYNTSTGNYDLEVVGEDQS
                     HQEGHQEGHQEGHQEGHQEGHQEGHQEGHQEEWPEQPEQHEQPEQHEQPEQHEQPEQH
                     EQQQPPVPEIAFKTQSSRVQADFKDVFNVSNTSNTSTN"
     gene            <569975..>571042
                     /locus_tag="FOA43_002244"
                     /db_xref="GeneID:62195645"
     mRNA            join(<569975..570284,570348..>571042)
                     /locus_tag="FOA43_002244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922543.1"
                     /db_xref="GeneID:62195645"
     CDS             join(569975..570284,570348..571042)
                     /locus_tag="FOA43_002244"
                     /note="BUSCO:EOG09343U97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778471.1"
                     /db_xref="GeneID:62195645"
                     /db_xref="InterPro:IPR019349"
                     /db_xref="PFAM:PF10213"
                     /translation="MLLRLSHRGIIPISRLLTCSSRYFCVSSSLLKEISDAAKTSEGP
                     APSESLVEKMAKINKEIHQVEKDSRYSLNDASLIHRPDLWKGLPDDTIIKLYRKRVVS
                     LAEAAYIQSVYYDTESDQFDADTETDYDNYITEGEYMDDLAEPNEYDEYPTIAQDIVR
                     DFRDQLEFNRKAAFELPALAKLREEYQPVSNKDKPVIYKYTSFLGEKNPAERKVVLKL
                     KITDLQLSEDASHKLKLLAGPRYDYTTDILKMSSDKFLEQAQNASYLSDILKDLIAES
                     NKDPQEFADVPLDTRSVDARLNKKRHKNKKVYEFPKDWERPIDKLDRKLDLQKLVELK
                     "
     gene            <571175..>573544
                     /locus_tag="FOA43_002245"
                     /db_xref="GeneID:62195646"
     mRNA            <571175..>573544
                     /locus_tag="FOA43_002245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922544.1"
                     /db_xref="GeneID:62195646"
     CDS             571175..573544
                     /locus_tag="FOA43_002245"
                     /note="BUSCO:EOG09340ROR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778472.1"
                     /db_xref="GeneID:62195646"
                     /db_xref="InterPro:IPR019340"
                     /db_xref="PFAM:PF10198"
                     /translation="MAARGYGRSRRSRTPKKVTKKIVEVKKEPKTEIKEEDKEIDPKD
                     DKKDKDKDKDKGNGNDNDNDKDKDKGNDNDNDNAEKENPKIKLTLNFNNDAPIPSKET
                     SEALADVSPATVIAAEEPSVSDCKPSAILGDVLTLLDLSYDDTSGLIQGDAMFKVPEL
                     NELEKANDLFQKLIVKLGDGVARDTELLQRFSVDEPENAEKQPESPHGRRHTIIKISG
                     GSDGESKIRIRTETTMTAEDDEDEVGPPVKRRRRSIILTANGLRREITPNIADSEEEE
                     EEEETTDGGSIAKKEAELEDSDDVHFLPSVYAHKPNPNFPIREMLKPAIEQLDLYDDE
                     KAKEESSDEREYLKQKLAVTDFPQSDLKDYLPGEIPTKDLSVNRPTNQVAFNSFQNYV
                     EPFFRNFTDEDVSFLRQNGVFISHLPKDFDDKRDTFEIPGLGPWYGDVWKEEERISGE
                     MNGEQVLSGNYISEIRASAQKRMDLRMHELTAARGSAEALDNNALEGEEQVSCGPLTS
                     RLLSAIVGEEEFVRHKEEEQEQATGIPVYQDLSNSGGPKGSSSELPGERAFQSEYTGT
                     DYKTLDDRLKRELRYIGVYMNVQQTLDDPGFEQDWSQKKEDDEICCEMRKLQKQLKEV
                     QKRNIRRKKVMIPIIEEQIAWQEYMSVLEDLDKQVEQHYRRRINVTPRKSRKRALHHK
                     DKDITNDHKEDSINHLVTSASFQSLLAKRAKWIEKIGPLFKSQREMRRMPDESIFKNM
                     NEEDENDGEEGEDIEGDGEDEDDDDDDVLGAHKNDDDQVEGESLNMVEE"
     gene            <573667..>574236
                     /locus_tag="FOA43_002246"
                     /db_xref="GeneID:62195647"
     mRNA            <573667..>574236
                     /locus_tag="FOA43_002246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922545.1"
                     /db_xref="GeneID:62195647"
     CDS             573667..574236
                     /locus_tag="FOA43_002246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778473.1"
                     /db_xref="GeneID:62195647"
                     /db_xref="InterPro:IPR000717"
                     /translation="MNSTVLRTLEDARFDSYNRLRNEVSDKSLELILEIFAFGDISDY
                     YRHKQCLIELNDQQLMRIRQLTLLSLCRNRTEVSFEDISKRLMIPRDHVINYLVILGD
                     SAVIRFRIDELEKKIDIEEICQSRDVYCSQDKPLEIVSIPSEQTVVRLIEELKRFRDE
                     RVKKVKKDISKEIKKTIKSGTGIKRPLES"
     gene            complement(<574286..>574801)
                     /locus_tag="FOA43_002247"
                     /db_xref="GeneID:62195648"
     mRNA            complement(<574286..>574801)
                     /locus_tag="FOA43_002247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922546.1"
                     /db_xref="GeneID:62195648"
     CDS             complement(574286..574801)
                     /locus_tag="FOA43_002247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778474.1"
                     /db_xref="GeneID:62195648"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="InterPro:IPR034804"
                     /db_xref="PFAM:PF05328"
                     /translation="MLAFSRLGLSVPLRSAFRPALRPVLISALTTRSLFVKTITQPPG
                     DIIGTVNEAYVVPTPNKFTGSRAWTMERLAVVAMTPLMLAPFIAGSAYAPLDAAMSTL
                     LLYHCYAGFESCIIDYIPARVYGVWHSVAMGLLALGSLFAGCGIYVIETTEEEGLFGL
                     CKKLWTKQKAI"
     gene            <575350..>577302
                     /locus_tag="FOA43_002248"
                     /db_xref="GeneID:62195649"
     mRNA            <575350..>577302
                     /locus_tag="FOA43_002248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922547.1"
                     /db_xref="GeneID:62195649"
     CDS             575350..577302
                     /locus_tag="FOA43_002248"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778475.1"
                     /db_xref="GeneID:62195649"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="PFAM:PF01150"
                     /translation="MAVTLDTTKGVDTSHTAAEDFSRTHDNQTLHDSDTGEGPSFDSN
                     GIPYNYIIIIDAGSKGSRAYIYNYLNTGYMEKNGFLTPGKLVDGITMANKLPYVHSEA
                     GWNKKIRPGLSSFRKNVHDEDSTLLVKTIGEKYLSKLLKKAVEIVPTNLQNKTPIFVH
                     ATAGLRLLDESEQNAILSATCQYIQSSTEFYMPKCSEHVSTIQGDEEGLYGWIAMNYL
                     AGTLRKGEKSHGLLELGGASTQISFVPNETERKEHHNELMTLKLANIGSKEADMEYEV
                     YSKSFLGYGMHQIHLKYLEQLSKEVTGDYASLVDPCLPYGYHKEMQLNVRKRRIVGSG
                     DSSECQSIVYRTLASGNLGGCDEKNKLEVSKCLLNDTIPAFDFNFENFYGVSGYWDTI
                     SNLLDLGKVSSSEYEKYGKMYSYSEIQQETSKVCSLGWKQLQSYRDIDNEEDLADLCF
                     KSTYMTSLLHNGLGLTKNGTAKFQINDKINGTDFTWTLGRAVLYASDEAQLETGGESV
                     GYSRNSAAEVFIKGSEEIPGSLASGTKKTGSSSNESYSLLSLLVLVLLAFVLLLRRPL
                     VLRIFKGIVNRLTKGKKYRRVSIDDIETANFDDDAIKLRDIHITRSVDTDSRSSMDSM
                     DPMYLTVPAHTADPFRIDDEDDELVR"
     gene            complement(<577308..>578487)
                     /locus_tag="FOA43_002249"
                     /db_xref="GeneID:62195650"
     mRNA            complement(join(<577308..577349,577429..>578487))
                     /locus_tag="FOA43_002249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922548.1"
                     /db_xref="GeneID:62195650"
     CDS             complement(join(577308..577349,577429..578487))
                     /locus_tag="FOA43_002249"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778476.1"
                     /db_xref="GeneID:62195650"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="PFAM:PF10358"
                     /translation="MAKKIPFELSLNVIELTNVPLLDNNSCYMIVTVTNHKIKNNYKH
                     YHRSKQVTNRVPISNHKCIFKQEGYVKEVLRIHIDSKTGMLANKWLCVSFIIKDKAEK
                     HEERLGSVHINLSEYVNESKKTDMRYLLDQSKTNSIAKMSIFLKHLFDDRGIKYQVPE
                     STNKNFYQGITETLSDDRFTSTATGSPSKSRSIMDPGKASSQLLPSHSSLHIPSPRPK
                     VLEKSSTASRDVPAKASTSSSVASPLDETSESLGLDPRAVKEICDDVFQDDNVLNGLI
                     NQTYRFTWQLKDKEYDEFTPVECVRDIVEFNGNGWKKNDEGLNLIDVIKGELREGGRH
                     KKSHKIFMDYEWDSSDNESRKSRSDQIFAAGT"
     gene            <578849..>580855
                     /locus_tag="FOA43_002250"
                     /db_xref="GeneID:62195651"
     mRNA            <578849..>580855
                     /locus_tag="FOA43_002250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922549.1"
                     /db_xref="GeneID:62195651"
     CDS             578849..580855
                     /locus_tag="FOA43_002250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778477.1"
                     /db_xref="GeneID:62195651"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00433"
                     /db_xref="PFAM:PF07714"
                     /translation="MSNWKKFFKGKSSSHASTNQGSTANTGASSPADLSVVSSEEATD
                     DSAAIDKSVSKPSENASYDTRKTLVDSDLKNVSESIAHLDINDTTSVTPELITKNLES
                     TDPIFEKEASEPEHSESSSSNRVKFKPGLLTVKIYSSKNLEIPVPMRINKQILRKLAN
                     LGANVDEDELLHKIESLNENLDEAANTNLSYYLPSTLRINNTGDTSKNVITTYNLVYA
                     VVEVENSSERISSIGNTIANTKFNSVTTFDITSPNTALLTVHIYVRIPGSLLDSNKQE
                     DYLIGTLNYRLSSATIQDNCQPVRILNHDWRHLVNPYTDKELAGTLNITLDFKPLSTS
                     AKKGMNMGDFDLLKVIGKGSFGKVMQVRKKDTGKIYALKSIRKAHIVNKMEVTHTLAE
                     KFVLSRVNSPFVVPLKFAFQSSEKLYLVLSFINGGELFYHLQKARRFPLIRAKFYICE
                     LLSAIETLHKMNIVYRDLKPENILLDYQGHIALCDFGLCKINMKLDQKTNTFCGTPEY
                     LAPELLLGKGYTRVVDFWTLGILLFEMLTSLPPFYDEDVNLMYRKILNDPLVFPADID
                     ATTKDLITKLLNRDPNKRLGYEGVSEIKSHPFFKDIDWDKLNNKGYIPPYKPQVRDSS
                     DISNISSEFTSEEPKDSVVDDFLSESVQKQFGGWTYVGSFSGPS"
     gene            <582359..>583144
                     /gene="RPL8B_1"
                     /locus_tag="FOA43_002251"
                     /db_xref="GeneID:62195652"
     mRNA            <582359..>583144
                     /gene="RPL8B_1"
                     /locus_tag="FOA43_002251"
                     /product="60S ribosomal protein L8B"
                     /transcript_id="XM_038922550.1"
                     /db_xref="GeneID:62195652"
     CDS             582359..583144
                     /gene="RPL8B_1"
                     /locus_tag="FOA43_002251"
                     /codon_start=1
                     /product="60S ribosomal protein L8B"
                     /protein_id="XP_038778478.1"
                     /db_xref="GeneID:62195652"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="InterPro:IPR038524"
                     /db_xref="PFAM:PF01248"
                     /translation="MTQPSKKVAPSPFANRKPKKVGSKNPLIESTPKNFGIGQSIQPK
                     RNLSRFVKWPEYVRLQRQKKVLSLRLKVPPAIAQFSHVLDRNTAAEAFKLLNNYRPET
                     RGEKKERLTKEAAAIAEGKKREDVSEKPYVIKYGLNHVVSLIENKKVKLVLIANDVEP
                     IELVVYLPALCRKMGVPYAIVKGKARLGTLVHKKTSTVAALVDVKSGDEPDLAKLISS
                     INANFIDSFDNNRRHWGGGIMGVKHNAKEAKKVKAAAIDADIK"
     gene            <583424..>583624
                     /gene="RPL29"
                     /locus_tag="FOA43_002252"
                     /db_xref="GeneID:62195653"
     mRNA            <583424..>583624
                     /gene="RPL29"
                     /locus_tag="FOA43_002252"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_038922551.1"
                     /db_xref="GeneID:62195653"
     CDS             583424..583624
                     /gene="RPL29"
                     /locus_tag="FOA43_002252"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_038778479.1"
                     /db_xref="GeneID:62195653"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="PFAM:PF01779"
                     /translation="MSKSKNHTNHNQIKKAHKNGIKKPRQFKYPSAKGVDAKFRRNHR
                     FALHGTVKVLASARKAAKAAKA"
     gene            <583959..>584639
                     /locus_tag="FOA43_002253"
                     /db_xref="GeneID:62195654"
     mRNA            <583959..>584639
                     /locus_tag="FOA43_002253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922552.1"
                     /db_xref="GeneID:62195654"
     CDS             583959..584639
                     /locus_tag="FOA43_002253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778480.1"
                     /db_xref="GeneID:62195654"
                     /translation="MNDENIDPSEEIYKQERSKDCIKVVDDGNDIVKVTEGIQDLSTG
                     DKEKKSKKKHHRKKHNNKQLKREEEEVENKKRQPLGEASGQKQANRQGEKGSHKVNGN
                     KGGKKYRKGWIPEPRYWGYYPPPGGKKPQEGRNTGYYGYYGPNPFSQKQKSRSRRYKK
                     RGGVQTGRTEQAGKPEELKEPRKPDDSKESKEPGKPDDSKESKEPGKPDDSKEPQRTP
                     VPVPKPLS"
     gene            complement(<584722..>585489)
                     /gene="RPL2_1"
                     /locus_tag="FOA43_002254"
                     /db_xref="GeneID:62195655"
     mRNA            complement(<584722..>585489)
                     /gene="RPL2_1"
                     /locus_tag="FOA43_002254"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_038922553.1"
                     /db_xref="GeneID:62195655"
     CDS             complement(584722..585489)
                     /gene="RPL2_1"
                     /locus_tag="FOA43_002254"
                     /note="BUSCO:EOG09343GJT"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_038778481.1"
                     /db_xref="GeneID:62195655"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="PFAM:PF00181"
                     /db_xref="PFAM:PF03947"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRKGAAKLRTLDFAERHGYIRGV
                     VKQIIHDPGRGAPLAKVVFRDPYRFRLREEMFIANEGVYTGQFVYCGKKASLNVGNVL
                     PLGAMPEGTIASNVEERTGDRGALGRTSGNYVIVIGHNIEDNKTRVKLPSGAKKVISS
                     DARGVIGIVAGGGRIDKPMLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGAPSTISRGAVPGQKIGLIAARRTGLLRGSKDKVEE"
     gene            <585939..>587084
                     /gene="GBU1"
                     /locus_tag="FOA43_002255"
                     /db_xref="GeneID:62195656"
     mRNA            <585939..>587084
                     /gene="GBU1"
                     /locus_tag="FOA43_002255"
                     /product="Guanidinobutyrase"
                     /transcript_id="XM_038922554.1"
                     /db_xref="GeneID:62195656"
     CDS             585939..587084
                     /gene="GBU1"
                     /locus_tag="FOA43_002255"
                     /codon_start=1
                     /product="Guanidinobutyrase"
                     /protein_id="XP_038778482.1"
                     /db_xref="GeneID:62195656"
                     /db_xref="InterPro:IPR005925"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="PFAM:PF00491"
                     /translation="MISLFWLLLASSALAQPFNFDQSSLQSGKHDTSPPSLQDLWGQD
                     WPFTGIPTFAHLNTSKCLLNPDINYDIGIIGIPFDTATTYRPGARFGPRAIRDASQRQ
                     NSMRGFNTRAGINPYEDWATFMDCGDIPVTPMDNKLALEQMTKAFEELLLRRNSSADS
                     SHPPRYVALGGDHSVILPHLRALNKLYGKLAVIHFDAHLDTWLPSKYPSSWSSEQSKF
                     THGSMLWMASEEGLLSDNYNAHIGIRTRISGADWDDFRDDDDQGWLRFSADDVWTEGI
                     DGLKTIVSQIKKRIPKDYPVYISVDVDCMDPGFTPGTGTIEPGGMMPREVIYLLRHLD
                     LDLVGADVVEVSPAFDHAEITSTNAAQIVYELITTMVQRGMPLPLRS"
     gene            complement(<587102..>588649)
                     /locus_tag="FOA43_002256"
                     /db_xref="GeneID:62195657"
     mRNA            complement(<587102..>588649)
                     /locus_tag="FOA43_002256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922555.1"
                     /db_xref="GeneID:62195657"
     CDS             complement(587102..588649)
                     /locus_tag="FOA43_002256"
                     /note="BUSCO:EOG09342SNV;
                     MEROPS:MER0011153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778483.1"
                     /db_xref="GeneID:62195657"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="PFAM:PF00246"
                     /translation="MKWLSVVFLLQLFVAATFSFHLQNVLDSVRDFSRGLQQKVIGTT
                     GSPLLSLKSQFESQNLQHVASEGFRYYTEMTQEELMSSDSKELLANLNQLEDQYVIRF
                     SHWSCSKSKDSILIQSKRLNLDIWEVSQAHKFIDVRCTREQALELVEAVTKVCPNGQY
                     HVSIMIEDLPQAIFETLDISESDYNLAAEEEDVSLLSGNIFFKRFRRLETIYKWFDIL
                     VDTYPDLLSIEWIGQTFEGRDIKALRISDHKSNDEAIKTVVITGGIHAREWISISTVC
                     YVISNILSDYENGSKKVRRYLQNLDFLFLPVMNPDGYDYSWKTERLWRKNRQETYHPR
                     CFGIDIDHSFNFHFTKGEDTSPCSEEYSGEGAFESLESYAWDNYLNETRHKHPIYAYI
                     DLHSYAEEVLYPYAYSCTELPRDEENLLELAYGLSQAVRLQSGKMYSVLSACEDRGAD
                     LLPSMGAGSALDYMYHNKAYWAFVLKLRDSGSRGFLLPKKYIVPVGKEIYASIKYFAD
                     FLLNPDN"
     gene            <589415..>590230
                     /locus_tag="FOA43_002257"
                     /db_xref="GeneID:62195658"
     mRNA            <589415..>590230
                     /locus_tag="FOA43_002257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922556.1"
                     /db_xref="GeneID:62195658"
     CDS             589415..590230
                     /locus_tag="FOA43_002257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778484.1"
                     /db_xref="GeneID:62195658"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSDVPTFRFDNEITVVTGACGGLAEPCIHALLAAGSEIALLDTN
                     IDTINKSIAGFEKFAKQTLKLAKVPEMHGYVCDVSNADQVEQTFAKVHKDFGKYALHL
                     YNTAGYCENYPAEKYPAKNAAKLIGVNLLGSFYVAQSWARPLIEHKIKGASAVMVGSM
                     SGNIVNDPQPQICYNMSKAGVIHMVKTLAAEWAKYNIRINTLSPGYISGPLTAKVIEA
                     DPKMYDRWMSMVPMHRMSDPSEFAGTILYLLSNSASSYTTGANIIADGGYACW"
     gene            <590530..>590919
                     /locus_tag="FOA43_002258"
                     /db_xref="GeneID:62195659"
     mRNA            <590530..>590919
                     /locus_tag="FOA43_002258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922557.1"
                     /db_xref="GeneID:62195659"
     CDS             590530..590919
                     /locus_tag="FOA43_002258"
                     /note="BUSCO:EOG09344KCZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778485.1"
                     /db_xref="GeneID:62195659"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="PFAM:PF08265"
                     /translation="MTFEHNDLAKLMDILETAEKFKNPDRKNSKRRYKSSRQVMNDEN
                     KRIQKKRDESEEPLPNLVTYHSLSAPPSFRPIKTYCDITGLATNYKSPNTRLRFYDKE
                     CYDLVKSLPPGVDQQYLALRNANVVLK"
     gene            complement(<590936..>591445)
                     /locus_tag="FOA43_002259"
                     /db_xref="GeneID:62195660"
     mRNA            complement(<590936..>591445)
                     /locus_tag="FOA43_002259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922558.1"
                     /db_xref="GeneID:62195660"
     CDS             complement(590936..591445)
                     /locus_tag="FOA43_002259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778486.1"
                     /db_xref="GeneID:62195660"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="PFAM:PF04628"
                     /translation="MTIYFVSLISRENQPLYIQPFSPFEEKEESKDKNKDISFVDEGT
                     RENELLKYNFLSHMALDVFDSPFMPMAETEPRPGRTYRLLFVQDSVFVFGQETNTGLK
                     IVVGGSRDENEYNKQETGLNEVFKQIYRAYLRLICNPFIDSEKIDDEIESTQFDRRIK
                     EIVKSWNTD"
     gene            <592557..>594615
                     /locus_tag="FOA43_002260"
                     /db_xref="GeneID:62195661"
     mRNA            join(<592557..593018,593098..>594615)
                     /locus_tag="FOA43_002260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922559.1"
                     /db_xref="GeneID:62195661"
     CDS             join(592557..593018,593098..594615)
                     /locus_tag="FOA43_002260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778487.1"
                     /db_xref="GeneID:62195661"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /translation="MSDSRYDYDENSETWPYFVLTGILVPLVPVTFSLISSHLGKGQV
                     KDDGFEQVSWCEPYDSKQLNQFRSKQKRSSLFTGKFFLVVLGWFLVGLLAFKIGQIDI
                     VVSETNFDPWKILEIDETANVRDIRTAYRKLSLKFHPDKVDTSNMTRPEIDAYGNPDG
                     PGDIKHGIALPKFLVDGPTSPLFVVVYILLIAVILPLCVSKWWSGVKSHTRRGIYTDT
                     ASHFLTLMLNFNPAELVQVKTVLKDVASSREYLDIDPKLNQDKVLELLLDHINRKLLS
                     PKEETLKLSVVAITPKLLLGFLDIAAAFRNTDVCNVIVEAHRCIIQALNIEDDVDNYK
                     YRQILQLPSIELDNIDKKQKIYTLGKLLKKPTDDPAKFLGVDSESTTKKVLDYAKHIP
                     LIEPLDCQFKVPGENYIPPNSHVNIDLRFIVKSPAHKSKPARENLSPEVIDTQLKEPD
                     ILENLRNPLKVVELQPLLSLKSAPMFFPDIDYVKDHCGWAAFILVQKDGRLGEAPVFL
                     SRADLSNMNLTQEQFLKSDAKVSVFKLMLTAPAPPQEGSFQFRLVLKNLVYFGSDIEI
                     PLTMNVENKPEFVGKDVYKIEEPDEDSLAGAMAQLRGEKVKKSKEYSSDEESDSEDQD
                     DDNDSDSEDDDDDDDDDDEDGDWTDINTDTETEED"
     gene            complement(<594663..>596453)
                     /locus_tag="FOA43_002261"
                     /db_xref="GeneID:62195662"
     mRNA            complement(<594663..>596453)
                     /locus_tag="FOA43_002261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922560.1"
                     /db_xref="GeneID:62195662"
     CDS             complement(594663..596453)
                     /locus_tag="FOA43_002261"
                     /note="BUSCO:EOG09341GIN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778488.1"
                     /db_xref="GeneID:62195662"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="PFAM:PF03849"
                     /db_xref="PFAM:PF18307"
                     /translation="MSAPIQSSSTSSDLFKSTINEYLDNLPEAVHSQLYRSPETCLAI
                     FRLLPSLAKFYIMTLLFQETAIPYADLNRWIKPQKATGHHRNANKIYQNESIKRLKAL
                     NLLKEIRKKVKHPTTGKLTTIVFVQLNPIFRQSFRDALTGFRDGIPRDQSEKIAETIE
                     EAEAESEKTLETSSVSSSSGPSLENLFATKFKITVGFLDSYCLAKWENILHFMVGSKI
                     KHYPSIGVLTLLRYSGLMELPSDRRHRQSVDADEDNFVVDDHYIDGERGPPSGEELKS
                     LLITKNGFQFLLQDINSQIWTLLLQYLKMSEKLMMNPVDVLNFIFMLGSLELGEGYPI
                     KVLSDTQLIMLEDLVDYGLIFYPKSENSEDTKGRIFYPTRLATSLTSESTKFKTASTV
                     LNEQISNTDSNQGKIIIETNFKIYCYTTSPLQIAILNLFVHLKIRFANMVTGIVTRES
                     VRGALINGITADQIITYLESHAHPGMVKKAEEKYAKKMEFETSIGNSYTADQIKYEVL
                     PPTVVDQIKLWQLELDRIQTFKGYLYKDFANDFEFEKLLSYGEEIGVIVWRDKIHRKF
                     FVTSDGNAQLIEYANRILRKSASRSVTPST"
     gene            <596631..>600086
                     /gene="RET1"
                     /locus_tag="FOA43_002262"
                     /db_xref="GeneID:62195663"
     mRNA            <596631..>600086
                     /gene="RET1"
                     /locus_tag="FOA43_002262"
                     /product="DNA-directed RNA polymerase III core subunit
                     ret1"
                     /transcript_id="XM_038922561.1"
                     /db_xref="GeneID:62195663"
     CDS             596631..600086
                     /gene="RET1"
                     /locus_tag="FOA43_002262"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III core subunit
                     ret1"
                     /protein_id="XP_038778489.1"
                     /db_xref="GeneID:62195663"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="InterPro:IPR037033"
                     /db_xref="InterPro:IPR037034"
                     /db_xref="PFAM:PF00562"
                     /db_xref="PFAM:PF04560"
                     /db_xref="PFAM:PF04561"
                     /db_xref="PFAM:PF04563"
                     /db_xref="PFAM:PF04565"
                     /db_xref="PFAM:PF04566"
                     /translation="MTTEDPILRNGNEAFDELLEPIYRGKSLTDPINTAKDKWNLLPA
                     FLKVKGLVKQHLDSYNFFVDVDLKKIVNANQLVLSDVDPSFYLKYLDIRVGYKSNGDR
                     KTPEVLLPPHECRLRDLTYSAPIYVDVEYTRGKKIIIHRDLEIGRMPIMLRSNKCILN
                     GRNEKEMAYLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVETDPKKDIVQASVTS
                     STHERKSKTYVIAKNGKIYLKHNSISEEVPIVIVLKAAGIVSDMEILQLVCGDDSVYQ
                     DLFAINFEEASKLGIFTQREALEYIGRKVKTIRRMNSPKLTILQEGTEAIATTIVAHL
                     TVDNLDFREKALYITTMARRVVMTMHNPKLVDDRDYAGNKRLELAGQLLSLLFEDLFK
                     KFNNDFKANLDKILKKPSRASEFDALLHINIHSNNVTSGLNRAISTGNWSLKRFKMER
                     AGVTHVLSRLSYIAALGMMTRISSQFEKSRKVSGPRSLQPSQFGMLCPADTPEGEACG
                     LVKNLALMTHITTDNEEAPIRKLCYLLGAEDISVADSAMIHTGGTFGVYLNGTMIAIT
                     RYPIEFVRKFRYLRRCGKVSAFVSIHTNVHQSAVHIAADGGRICRPLIIVENGKSKVT
                     VQHLRMLKADKWGFYDFLKHGLVEYLDVNEENDSLIALYEKDIIPMTTHIEIEPFTIL
                     GAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIGYNQFRRIDTLLYLLCYPEQPMVKTK
                     TIELVKYDKLPAGHNATVAVMSYSGYDIEDALILNKASIDRGFGRCQTLRKNTAVLKR
                     YPNHTKDIVTGMRVDKEGKPIFQHAALGEDGLAEVGTRIQSGQVFLNKCVPANAMGSV
                     MGGPQSQDGQQQQYREAPMVYRGPEPSYVDQVMMTVGDNDQALIKVLLRQTRRPELGD
                     KFSSRHGQKGVCGMIVNQEDMPFSDQGISPDIIMNPHGFPSRMTVGKMMELVSGKAGV
                     LRGTLEYGTCFGGSDLEEMSKVLVEKGFNYGGKDMLYSGTTGEALQAYIFFGPIFYQK
                     LKHMVMDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLM
                     LSSDAFDVDICQGCGLMGYNGWCPMCKSSEKIVKMTIPYAAKLLFQELISMNIAPRLK
                     LSDVF"
     gene            complement(<600137..>601165)
                     /locus_tag="FOA43_002263"
                     /db_xref="GeneID:62195664"
     mRNA            complement(<600137..>601165)
                     /locus_tag="FOA43_002263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922562.1"
                     /db_xref="GeneID:62195664"
     CDS             complement(600137..601165)
                     /locus_tag="FOA43_002263"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778490.1"
                     /db_xref="GeneID:62195664"
                     /translation="MNSDDVDASPLESRIVSDEIANESVLSEQSELYGEIKPAPKKRQ
                     EPKCLPELSNKLVIPKRRQGKNTDHKKDVSLTDFHGSHKIPMKSRNFTSPLPKRVPSL
                     GTSPIPDLSPSGSRVKNRLKAKYGNILSNRTTPIGSSSPLTLRSFSSPPAELRSNKIP
                     LQVRLNQISKSTYVGESDRQLKREILKYRTILDKLAKIKQRREHKTVDDVDRLVDKWR
                     NTAIAASNYMLNEARLKINKIGGIEEYRRKQQVSKLRKLKFQYDNNMLSEIEDYMKSD
                     VYKVLDKYEKEQVRDRKKEIEKISEGIESGDYPGSDKQQNNDNEFSMRELYAQLHLDY
                     EIVYPDTT"
     gene            <601381..>603483
                     /locus_tag="FOA43_002264"
                     /db_xref="GeneID:62195665"
     mRNA            <601381..>603483
                     /locus_tag="FOA43_002264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922563.1"
                     /db_xref="GeneID:62195665"
     CDS             601381..603483
                     /locus_tag="FOA43_002264"
                     /note="BUSCO:EOG09341SGA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778491.1"
                     /db_xref="GeneID:62195665"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF03715"
                     /translation="MAKTGKATKKFNQKHLKHTLEQRKKVKEYKKKIGDKKAKRVSKK
                     AENGQTRSNRTNTNGEIFEDMDVEKFFDKKVELPKPEKKIKKKKEDVEEDDDEESEPE
                     MDQKDIDDLKTEDPEFYKYLEENDKNLLDFEPINPLDAIDDDDDEEEEEAAKNASDDS
                     KDKVAKIKVIDVTMEMVKGWDANLRSEQPKMKEIKQLVVAFKSAVNIDADRGYKYSVS
                     NENVFNHLMVIALKQLPLGIQKLTPYKESKNGVRSLPSGNKKRVNEVSSVLKIHSGSL
                     IELLDGISNTETAALILQSIQELLPYLMSWKKILKLILQGAVNVWSSSEQFDTQIAAF
                     AFLNNAAKEYPKLLLRVELKSCYSSFIKNCRRTNIHTMASINFQKNSLAELFGENQNL
                     GYDVGFGSIRMLAVHLRDSVNNPTKESYKAVYNWQYCHSLDFWSRMLSIQCSAEKPAE
                     SVLSHLIYPLVQVTIGTIRLVPSAQFFPLRFYLIRSLIRLSRSTGVFIPLFPLLSEIL
                     NSAAFNKHPKNNTINAVDFDSCIKVNKAYIGTRVYQDGLCEQFIELCSEFFVMYCKSI
                     AFPELVTPATIYLRRFRKKSSNPKFNKMLSAFIDKLNANSKFIEEKRATVQYGPNNKQ
                     EVAKFLQEISWEKTPLGAYVVTQREVKEARLKILRESFEQAEEEEEHKNLKGKAESDE
                     DDDNDIVLDDAEEKKDEE"
     gene            <603497..>604826
                     /locus_tag="FOA43_002265"
                     /db_xref="GeneID:62195666"
     mRNA            join(<603497..603503,603535..>604826)
                     /locus_tag="FOA43_002265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922564.1"
                     /db_xref="GeneID:62195666"
     CDS             join(603497..603503,603535..604826)
                     /locus_tag="FOA43_002265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778492.1"
                     /db_xref="GeneID:62195666"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="InterPro:IPR033130"
                     /db_xref="InterPro:IPR033697"
                     /db_xref="InterPro:IPR036430"
                     /db_xref="PFAM:PF00445"
                     /translation="MYTQLGIVRDKLISEGGLRGSSGDIDFPWFFKGTMNYLAGLILL
                     AVNIVEGFTVEQGILGLNDIHQCPVDTPLSCSNKTEVDDSCCFEYPGGIILQTQFWDY
                     YPPVGPEDKFTLHGLWPDKCDGSYEQFCHNSEKIDSARDVLNKFGETDLLDKMTRIWK
                     NFNGNDDELWVHEFNKHGTCMNTLKSDCYNHFTPQQNVVDFYKRTVDVYDTLPTFEWL
                     RKGGIVPSNTKTYTRAEIEDSIASQFGHPVYISCNRFNALQEVWYFHQLKGSILSGEF
                     VPIPAMLDSRCPESGIKFLPKTFKPPQPTHTDNPGPRPTGRHGYYRGLLKPVDQPGCI
                     IGNGHWYTSGTCAKFTLIQAPFGGYNLRSSRGFCSVVDGSLICGSQIEPRQFQYDKNT
                     RSISYGGHKSWSADHVPQRFQQLDVRPGKGEVTFEIKLDA"
     gene            <604961..>605854
                     /locus_tag="FOA43_002266"
                     /db_xref="GeneID:62195667"
     mRNA            <604961..>605854
                     /locus_tag="FOA43_002266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922565.1"
                     /db_xref="GeneID:62195667"
     CDS             604961..605854
                     /locus_tag="FOA43_002266"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778493.1"
                     /db_xref="GeneID:62195667"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="PFAM:PF07950"
                     /translation="MSLQQVPPEPIQPEILEKAPGIPITSPSNTQTPFLSHSISVLAF
                     IQKYSVIPFSLFTFIHLSGVVITPALFGIDPGNEVIDIGREVYQTSLTEPIIIGSVIS
                     HASSGILLNLFRRILRYKKYGSSRYIPKEEKSTIKTTKDKEEVKDVNEGLGGLSSFLG
                     LGSKKALTYRLFGISPISFSGYILCVLLSAHVIKLRFNPLQVDGDSSYVDLSYLSYCI
                     SKVGAIIPVYTLFVFTGAYHMITGANRFFKLFSKKARKVAYFGIYSLSFLAFVSLIRI
                     ARMDPVTGTMAARFHEYLEYI"
     gene            complement(<605871..>608270)
                     /locus_tag="FOA43_002267"
                     /db_xref="GeneID:62195668"
     mRNA            complement(<605871..>608270)
                     /locus_tag="FOA43_002267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922566.1"
                     /db_xref="GeneID:62195668"
     CDS             complement(605871..608270)
                     /locus_tag="FOA43_002267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778494.1"
                     /db_xref="GeneID:62195668"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="PFAM:PF00317"
                     /db_xref="PFAM:PF02867"
                     /translation="MTLNSPPVIISHGKRRPFDQGKLRKYLESLAFGLDLRFISINEV
                     LDKVNRGLPPELTVSELIDFVAETCASMTIYHYDYSNLAARVLEKLLQDTISTRFSEN
                     IELLRRYMPNNGRKNYKHLISEQLFKIVMNHQDEIDLEIVPERDFNIDYFGFRTLQKS
                     YLLKIENKCHETPQFLLMRVALALHGENLKKAFETYRLMSERYLLHASPTLFNAGTEF
                     QNLSSCFLVALEDDSLDGIFDTVHECAMISKASGGIGVHISNVRSSGTYISGTNGVSS
                     GIVPMLRVFNSVSQYVDQGGNKRPGAICAYLEPWHSDVMEFLDMRKNYGKEEMRARDL
                     FYALWIPDLFMRRVKNDEIWSLFSEDTSPGLSDKWGSEFDQLYIRYESEKRFIRQVKA
                     RKVWEKILISQSETGTPFLLYKDACNAKSNQKNLGTIKSSNLCSEIVEYSSKDETAVC
                     NLGSLGLPMYVEIDSDDQKVFNLQRLHSVTKVLVRNLNRVIDVGDYPLKKCRVSNLRH
                     RPIAVGVQGLADAFLKMKLSFGCKESRRLNRQIFQTIYHGALEASMELSKEEGPYQSY
                     SGSPVSQGILQYDMWDDKPVETDDIWDWTALKNQISCYGVRNSLLVALMPTASTSQIL
                     GFSECFEPITSNVYTRRVLSGEHQVVNRYLIDDLIGLGLWNPEMKNEIIAANGSIQDI
                     PSIPDSLRNMYRTIWEISQRVVIDMAADRAPYIDQSQSMNLFLENCSMSKMTSMHFYA
                     WEKGLKTGIYYLRTQAASQAIKFTITPEMDRSAKHRRAAAAAAGLVCDSRDPSCDCCS
                     G"
     gene            complement(<608411..>609877)
                     /locus_tag="FOA43_002268"
                     /db_xref="GeneID:62195669"
     mRNA            complement(<608411..>609877)
                     /locus_tag="FOA43_002268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922567.1"
                     /db_xref="GeneID:62195669"
     CDS             complement(608411..609877)
                     /locus_tag="FOA43_002268"
                     /note="BUSCO:EOG09341ZM9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778495.1"
                     /db_xref="GeneID:62195669"
                     /db_xref="InterPro:IPR038274"
                     /db_xref="InterPro:IPR040455"
                     /db_xref="PFAM:PF04111"
                     /db_xref="PFAM:PF17675"
                     /translation="MPTYICQRCKLPLSVDQSLEGLSNAQKRLLTTNYSPRPKSSLMG
                     DLKAGTESLDTDDSTDASLIPPTMIVPEARKKTFREALDSSGGKPLIGNRGGIGNGSN
                     HGKVDDGSFVMLDEDKEGKEKKDTGEKGKATPIPVSDTVSTLSNVFNIVSSKYEMDYP
                     VCNDCAHTLIEEMSKRCDQMTKEKDTYVQFLKKLNAQNGPNRERCTKSLQELDKLKAE
                     EAETLQQLEQAEKENSDLKHELQEVQEQLSELSIEEQKHYLKENLYEHELTQRVSELN
                     RVKSLYESNMDQLDALRGINVFDDTFNISTQGLFGTINGLRLGSLDDVKVSWHEINAA
                     LGQLVLLLSVCLRILKLEIPEYVLIPMGSTSKIEKIERTQRNTDSRKTVLDLFSMGEF
                     SIGNIFTHNKLDAGMVALVDVIRKIAAELKSIDSNNELPFKMTKDKVAGYNISPSARA
                     SNKEWTAACKYLLTNTKWILTFTAGVYQDQSSDGSAAA"
     gene            complement(<609970..>610998)
                     /gene="GET3"
                     /locus_tag="FOA43_002269"
                     /db_xref="GeneID:62195670"
     mRNA            complement(<609970..>610998)
                     /gene="GET3"
                     /locus_tag="FOA43_002269"
                     /product="Golgi to ER traffic- protein"
                     /transcript_id="XM_038922568.1"
                     /db_xref="GeneID:62195670"
     CDS             complement(609970..610998)
                     /gene="GET3"
                     /locus_tag="FOA43_002269"
                     /note="BUSCO:EOG09342LDK"
                     /codon_start=1
                     /product="Golgi to ER traffic- protein"
                     /protein_id="XP_038778496.1"
                     /db_xref="GeneID:62195670"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /db_xref="PFAM:PF01656"
                     /db_xref="PFAM:PF02374"
                     /db_xref="PFAM:PF13614"
                     /translation="MEDFEVESSLKDLITQDSLKWIFVGGKGGVGKTTTSSSVAIQIA
                     LHHPDKNYLLISTDPAHNLSDAFDQKFGKDARVVEGLSNLSCMEIDPSSSLEEFANSN
                     KLGMDKQDPLTNVMTEVTGSIPGIDEAFSFMEVLKHIKSQKHPDDSTVQYESIIFDTA
                     PTGHTLRFLQLPHTLETLLDKFNDISSRLGPLMSMMGGDQKAELFSKLGEIKGQVAEV
                     NKQFQDPDLTTFVCVCISEFLSLYETERLIQDLMKYNMDVNSIVVNQLLFADDDQCKR
                     CQSRWKMQKKYLNQMDELYEDYHLVKMPLCGNEIRGLENLKKFSKFLISPYDPRKDGE
                     IVFSIEEK"
     gene            complement(<611198..>613729)
                     /locus_tag="FOA43_002270"
                     /db_xref="GeneID:62195671"
     mRNA            complement(<611198..>613729)
                     /locus_tag="FOA43_002270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922569.1"
                     /db_xref="GeneID:62195671"
     CDS             complement(611198..613729)
                     /locus_tag="FOA43_002270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778497.1"
                     /db_xref="GeneID:62195671"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF06733"
                     /db_xref="PFAM:PF13307"
                     /translation="MEQIIIHEHETTGRLAQAESCKFNHPFDNPYDVQLKLMNSIYET
                     IDGDFKIGIFESPTGTGKTLSLICSTMTWLREFKRMKNDAAIKKKLGEVEGSGDEEEP
                     EWIMKAYQEKIVGRMLEDAKRYEKHLIKVEKEGSKMVTGKLDGKIRWIKKRKRTAQGQ
                     SGDTDEDQLAPEDYTEESMHLEGTKFEKMDKEVKDLLKAVEGSRGSTNRSKERATEVN
                     ESPVKIFFASRTHSQLSQFCSQLKMTDFPSSIEGMDEKTKYLPLGSRKQLCINDKVAS
                     LKDTQQINERCIELQKDGNNKCPFLPKLAEEQDMELVDQFKDLTYSAVHDIEDLDTIG
                     SNLKVCPYYSSRHGVPVAEIISLPYQLLLQKEARDSLKLRLKDCIVVIDEAHNLIDTI
                     NSIYSSSIRFEELKLIRKAMRLYTRRFYSRMNAGNRINLSKMIKLVTLLAKFIAKQID
                     LGRVSPGTEVDTNLIFAGTTGDLLNVYPLQKYINKSKIAFKVQSYMDKITDSKHHSTP
                     LLFKVRAFMYSLSNTSQSGKFFFDKEEGDITLKYLLLDPSEPFKDIVEEARCVLLAGG
                     TMEPVTDFTDFLVPYVDPSQMKTFSCDHVIPDENLEVYPVSHSGNISFDFTFNGRTNR
                     TMLEELGKTIVELFQEVPSGTVIFFPSYRYLDDVMKVWKEQRLVKQMEEFKKIFIESR
                     EINVDNVLREFRSEIETGSRGGAALFSVVGGKMSEGINFSDKLARCVIMVGLPYPNVK
                     SGELIAKSHYIEKKTIENGGSRQLGKQRSQEMYQNICMKAVNQSVGRAIRNIKDYAVI
                     YLIDKRYEREEVQGKLSRWIQRRLMSTKDVLEARERTERFFKGRS"
     gene            <614646..>616403
                     /locus_tag="FOA43_002271"
                     /db_xref="GeneID:62195672"
     mRNA            <614646..>616403
                     /locus_tag="FOA43_002271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922570.1"
                     /db_xref="GeneID:62195672"
     CDS             614646..616403
                     /locus_tag="FOA43_002271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778498.1"
                     /db_xref="GeneID:62195672"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF01926"
                     /translation="MINNLICRNLIRRALFKNVEVLTGFRASRGIKTAGKPSQKDDRV
                     INRVAGTNFVKSSSIMRSPTPQQSPVSSCASCGVELQLSDSSAPGYYRPPHIKSTTFK
                     KDTDNPLVLAREKILVEKFQKLDDGLELKPVDKKLRDCRLMCHKCLDTFYRSDFSLDK
                     QSFVSVDQVMAEIPKEANVVHVISALDFPLSVSKTVSKGRDMQKVWYIVTKADAFFAA
                     KTGLERTGLHYFGDTLAQLVGVDPSHVFLVSGKLGWNTEDILHKLPASEVYFVGAINS
                     GKSTLIRTLIYRDNKNLRSFDQYGPGISEIPGFTANHIRFRMKQSNAILVDTPGFSPA
                     DRGVYRYLLKDDVKSVAKVADYASATIKGHSLHSPMVKGRKIFSGESLYSVGGLFYLK
                     PPKDSIIKVFTGLPGVEAKYKDVSRALELSEMRPVAIGHRFLVNSSAALNLVRYVIPP
                     FYGSIDLVFRNVGYLTVALCGSIDNSKLFEIYVPKEIEVIARESIFNYIYKTKSAKDE
                     TGNLLARKNVAKRGKIILRHIPKNKLIFTKLYKVPVDASTEQAVEAVVPETIFTGEQH
                     KCCSQAEFPNTFWRLPDLV"
     gene            <616676..>619461
                     /locus_tag="FOA43_002272"
                     /db_xref="GeneID:62195673"
     mRNA            join(<616676..616679,616748..>619461)
                     /locus_tag="FOA43_002272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922571.1"
                     /db_xref="GeneID:62195673"
     CDS             join(616676..616679,616748..619461)
                     /locus_tag="FOA43_002272"
                     /note="BUSCO:EOG09340GQD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778499.1"
                     /db_xref="GeneID:62195673"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="PFAM:PF04097"
                     /translation="MREIKKKAYLKRKYNKTGSDTNPYTKAHYLLIGKGITIEEIQNE
                     LDSIDFHQLDSTGIVPGNQVISVGSSVGEIEDYITAQKHENILTAIEQNLLTSARDFD
                     QYVSQSISLDWKKHNKDTRATLASILKREQSDSVPSSPEKRHKQLLGEPQQQRKQQQK
                     ALSWSSKPSRDILSPRFKFEDVQPSDNVDSVVNPNASYALRRKFELYAQVIYELNDAR
                     QKHRWYQLCTVFADLSKREMTTRSKQLHEGWLILRDFCENEEENGSSMKTQERKFAVG
                     HCSSSLSESDAIVLHKQIIAKSRNYLESQFLDHANELYLKVNSNPSDFGSSGLVSNVT
                     KVQKFLELTMKNKSGNSWKVPNLTFVNSVPIWATLFYLLRAGCYTDAVNLVSDYDDSF
                     QKLERAFPLYLKAYCESIDHKLPVELQGRLTNEFNQYFKHTSKEVDPYRYAVYKVLGR
                     CDLSRKDLPSITLSIEDWLWFHLCLIYEEDVEASNDDSSVQERYTLNDLQKSVLEYGS
                     DAFNGSSNNPMYLQALLFVGLYEVAVQYLFGLSEIDSVHLAITLAYYGLLRVPLMDSD
                     KLLNEDEKGFQSINYARQLGYYTRTFKNSDPRVAAEYLFEICLCDGLDDDLKKKQIEL
                     GQRAVRELVLDTREFVMLLGRINKDGSRIPGIIEQRKKLLHLDDEDSYLHKIAEKAAH
                     KAEEEGRPYDCILLYQLSEEYDTVLGMVNRLLGDFMVSVDFRTPLDDIISGELIKGET
                     NIVKMARRLMKTYNASPEILSKTSAKRRETCSRLLELISISTDFTSSHPDLVDILQRI
                     KKLDLIPCGASIELDKIRARAQEFSTLDESLAKNIPNVLIIEMSCISQLVYELQSGYE
                     VPAGKSSSKEYRLTDMKQMSRNCMVYAGMVQYKMPREVYRTLVNLEVDL"
     gene            complement(<620235..>622127)
                     /locus_tag="FOA43_002273"
                     /db_xref="GeneID:62195674"
     mRNA            complement(<620235..>622127)
                     /locus_tag="FOA43_002273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922572.1"
                     /db_xref="GeneID:62195674"
     CDS             complement(620235..622127)
                     /locus_tag="FOA43_002273"
                     /note="BUSCO:EOG093416G4;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778500.1"
                     /db_xref="GeneID:62195674"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /translation="MKTQNSVYYRPFPGKSLNVHPVTILNADSSPTSSTSSLAVTSTS
                     KAVTPTTSSFPRAISLGRPTQALPGITSFTKETPNMPSDSSARSTRSARATSAARAYI
                     STCGSSTSDPHHVLNSRFGSNSTLTDSSISPLGSRGSASPSSYTDSSPSSSPDSPATL
                     QHAVTVPSISDLDKSIGANASTSSDDAEKQVGSSLYPKVAKLPATSITSSRKSKSQRP
                     QKLKNSNGPLRCRWKGCNLLFQDAQHLYDHLCRFHVGRKCNRNLSLACQWENCQVVTV
                     KRDHITSHLRVHIPLKPYPCEQCGKRFKRPQDLKKHSKIHSNNKKGLKPEDPQGLQTV
                     PFLQKSHSTSVGSAPLPVYNYAHGISSHPLTSIPSLTESTDAKKRKFEISGFASQLPA
                     LYDDLKRSKVRPVYSNTMANKLNTVPLGKYSFNNNKLPSISANLGGFGNTQELMEASS
                     YFNQISTSMSSQQPTFLPLGGPISVHLAHPSNAQTSHSTGNIYPSLPCISNGYYPQYG
                     FNNSAPLNINRGSDIGTNQRTSHDDMVKRLAKMSLNEEDEDEEEDEEEEIYDIQDDNS
                     SQTDSDAEDQENDSESKIDTYMRHKELIDLIGEYLEELVENSKKEDIRNEEECPQRTL
                     YPTIKV"
     gene            complement(<622442..>623629)
                     /locus_tag="FOA43_002274"
                     /db_xref="GeneID:62195675"
     mRNA            complement(<622442..>623629)
                     /locus_tag="FOA43_002274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922573.1"
                     /db_xref="GeneID:62195675"
     CDS             complement(622442..623629)
                     /locus_tag="FOA43_002274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778501.1"
                     /db_xref="GeneID:62195675"
                     /db_xref="InterPro:IPR002889"
                     /translation="MGPFAIALLIGPSVVNSLSLSLCSSQNTGASNVEYVNQYNSNGY
                     CHDKCQGYAFGVVQGTSCWCSNYAPSDTSSLSQCDVACPGYGYEYCASQSDNLYGYVA
                     LGPDASGTLGGSSSTSGSNSESSVPSGSSFTSGSGSGSGSGSSLSSSSSSSSSSDSSS
                     TSSPTPTASSARSTSSTSSHSTSASPVISTIYSVMTISGDSKSTVTSTILQTMTMSSS
                     QSSSPSAAASSNSSSSHKSGNSFFDSKGKVAGVFTVVGIVSLGLLILLAYFIYKKCIA
                     SKVHGDDYFGYYDGDSYGGSSLGPNGAPRLDYSDLESNPHQREYEEKRESGFNVGAYS
                     VAGTTTPSGSPTTHQRGNSFPVDPRLDPGSPLYRNVQGDFSNRSLSDQVDYSRKVLKV
                     TNV"
     gene            complement(<624056..>624739)
                     /locus_tag="FOA43_002275"
                     /db_xref="GeneID:62195676"
     mRNA            complement(<624056..>624739)
                     /locus_tag="FOA43_002275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922574.1"
                     /db_xref="GeneID:62195676"
     CDS             complement(624056..624739)
                     /locus_tag="FOA43_002275"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778502.1"
                     /db_xref="GeneID:62195676"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR032640"
                     /db_xref="PFAM:PF16561"
                     /translation="MSTFTFKWPKGPESVVVTGDFDNWSKLCPLVKQPDGSFESSIPL
                     AANQEKVQFKFVVDDDKWLVSSDYEKETDKGGNVNNVLYLSNVKAASSKGSAFIPESG
                     GLPIETNDGIVTTPVMPKDPVEPNPETEAVNQSQATAAIIKGPGIAIPKNPETVDAFK
                     QVRNVNAKELNKKVELEEKAKEPKYVKKVVKKVKKEAPESNTVKTAPAVSKPVAKKGF
                     LSKLKKIFD"
     gene            complement(<625428..>625841)
                     /locus_tag="FOA43_002276"
                     /db_xref="GeneID:62195677"
     mRNA            complement(join(<625428..625719,625837..>625841))
                     /locus_tag="FOA43_002276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922575.1"
                     /db_xref="GeneID:62195677"
     CDS             complement(join(625428..625719,625837..625841))
                     /locus_tag="FOA43_002276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778503.1"
                     /db_xref="GeneID:62195677"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /translation="MEQSFEMIRLIRDKILDTMESDRPLIIVGNKADLEVQRQVSFEE
                     LKEVGKEFGGVPVMECSAKSNYNVDEVFESIVKEIEKMEGGEDEDKEEKGCVVS"
     gene            complement(<626122..>627901)
                     /locus_tag="FOA43_002277"
                     /db_xref="GeneID:62195678"
     mRNA            complement(join(<626122..627683,627895..>627901))
                     /locus_tag="FOA43_002277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922576.1"
                     /db_xref="GeneID:62195678"
     CDS             complement(join(626122..627683,627895..627901))
                     /locus_tag="FOA43_002277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778504.1"
                     /db_xref="GeneID:62195678"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="PFAM:PF03547"
                     /translation="MPDFNYLHITFLTFQAVVEVVIVCVAGFWAATHGLLNSNATKII
                     SRLNVDVFTPALIFTKLASSLSLKKLLEVIIIPILYAVTTFVSLVASTWISSFLNLTE
                     PESNFVTAMGVFGNSNSLPVSLTLALAYTLPGLEWDDVPDDNADKIASRGLVYLLIFQ
                     QLGQMLRWSWGYNSLLKKQPVNAIYAESVIPDTDPERNLNGQNDRKHTDTSQVSEVVD
                     GSDTAFSTVHDPLLSSEVPGPDTVSAVPVPVATPATGNYDSCSIDSITLLSSDLISPE
                     SANSIPTCAVRTVSRTARGDIVVQIEDKEDSDDELLPVMLATCRSMTAMSELDSPPTG
                     VVAKLKLNLKRIAGWMNPPLWSMVLAIFVASIGPIKYQFYEANGFIQNTLAKSIRELG
                     SVSIPLILVVLGANLAPSTDIPPACRHYSKMIFGALISRMVLPSMVLLPLIVMCVKYI
                     RLSILDDPIFLITSFLLITSPPAIQLSQICQLNEIYQKEMAGVLFYGYVILTLPVTIF
                     IVVTALQCMQWARG"
     gene            complement(<627997..>629139)
                     /locus_tag="FOA43_002278"
                     /db_xref="GeneID:62195679"
     mRNA            complement(<627997..>629139)
                     /locus_tag="FOA43_002278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922577.1"
                     /db_xref="GeneID:62195679"
     CDS             complement(627997..629139)
                     /locus_tag="FOA43_002278"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778505.1"
                     /db_xref="GeneID:62195679"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR036887"
                     /translation="MPVNYPIHRYSEEILTKVPADQMAFLPRPESIPKRRYSTSIDPR
                     NFLTVYEYKVGDHWIIWDYYTGLVHLTGLWKAIGNHKADIVKLVESSPELEKELRRIR
                     GGFLKIQGTWIPYSIAKVLASKFCYSIRYVLIPLFGEDFVELCLKPYDRGFGMLRLRV
                     TEADLKRRRNRRRPKGMGIGTVKVKRDKGNAIKVRRNSTKETFRVALQPTGPMISRSP
                     AFWGYPVRQDVVRNYPYILPRPTDHTLLPRPIDHTLFPLASVAPVAPSAPVVPVVPVV
                     PVASLAPKTPVTPTATAVSPHQGLLSVLKAAQAIATTLPTTSPCSASVSLASSFPTNY
                     YYNYNYVPISATRTTIPILAKPDTSKLKTQTDKIKRRMSIDCLIRS"
     gene            complement(<629457..>631388)
                     /locus_tag="FOA43_002279"
                     /db_xref="GeneID:62195680"
     mRNA            complement(<629457..>631388)
                     /locus_tag="FOA43_002279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922578.1"
                     /db_xref="GeneID:62195680"
     CDS             complement(629457..631388)
                     /locus_tag="FOA43_002279"
                     /note="BUSCO:EOG09341JGK;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778506.1"
                     /db_xref="GeneID:62195680"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="InterPro:IPR037516"
                     /db_xref="PFAM:PF09794"
                     /translation="MTSVPESTTPVPESTTPVPESPPSLSDSSMQPFEILETPNIKKV
                     KLKLDKTMDTKLNRLRNKFVFGTCIVDFHHVRGPEIEYWIDDTTTEDNEMLKIQHFTK
                     VWAQLPFQALPDGAHLFEETFSNFTLIYDDIEDGCPKLPIDKEDDIELVDGEVKAAEI
                     GEPNKGLTTLFGCACIRQLDMDRLKQEGKTLHRAVGQEEFTRSVIQKSVVVITRYPIT
                     IQLKEQLSIITKSYFDQLNFADKGIIKALYDNVSLVYNSHGYRIEDDDLYEGVNDNPS
                     GSTKIIRESDFYIGLNLKELVTKLGRKLLMVYKALLLEQRVLIFCKDLNTLSNIQYSL
                     LSLIPNLLMNLSDCGSPLLDKLSYKLQTPTSLKSSDRGSMLRFVGMPLKLFDKGGFFQ
                     PFITLQQLDYLVNKNTQWFLVGTSNDILLERKKEWFDMILYINENDSSFPTEAASAMD
                     FIFKDPEVKLEILSKDLKDWITLTSQDKQFIDYVMNEVSKGQKTTKKETRVEPASSKM
                     LNSNALDIGSYNGGDDFIRYQFEDYLIGMLSTIKYDQFLSANKDNLQTLSYLNLNQFE
                     DQVTEFNSRFIDRYMQTQNFKLFEKYTEDELFNFFEPCHVGTVLIRRARENASSSAKA
                     RLRGLFSGWKKVEVTREKK"
     gene            complement(<631506..>631955)
                     /locus_tag="FOA43_002280"
                     /db_xref="GeneID:62195681"
     mRNA            complement(<631506..>631955)
                     /locus_tag="FOA43_002280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922579.1"
                     /db_xref="GeneID:62195681"
     CDS             complement(631506..631955)
                     /locus_tag="FOA43_002280"
                     /note="BUSCO:EOG09344IOW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778507.1"
                     /db_xref="GeneID:62195681"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="InterPro:IPR036743"
                     /db_xref="PFAM:PF04699"
                     /translation="MEDWRRVDVDQYDPEKQFIADDLELPNYSAQDLEPKIQQIRQYI
                     GSNDLVNALKSCVQDPPYGSTDIVKKGYLLTVLDVLNTAKQSEVKELLSQLSIDEVDV
                     LVKFIYVLMTTEEGQKSGGALLGWFDKAITVVGEGPIVRYMSDPYRM"
     gene            <632138..>632926
                     /locus_tag="FOA43_002281"
                     /db_xref="GeneID:62195682"
     mRNA            <632138..>632926
                     /locus_tag="FOA43_002281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922580.1"
                     /db_xref="GeneID:62195682"
     CDS             632138..632926
                     /locus_tag="FOA43_002281"
                     /note="BUSCO:EOG09344DHS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778508.1"
                     /db_xref="GeneID:62195682"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="PFAM:PF09736"
                     /translation="MSSLQNYLSKYTIGTKSRKKRKRIDDVKEDVDEYIDADADIDDL
                     IDKSSVTRPKGSWKSVETKETVAVLPKLKGDGSYAGFQTKDQSERSNEAEVKTIYRDL
                     SGQKIDSRDEKLQSNKKDKPTEKAERKEQLQNVNRSEADVVRKLQELARLKKVKHEGL
                     NLYENNSELNKKKKKDVKQEDPALLFDKTIKNDYNKTRSARFVSITGRKLYKEGFPQN
                     RFDIKPGWRWDGVDRSNGLENRWFKRQAEIHESKVSHFTTAEDV"
     gene            complement(<632940..>637338)
                     /locus_tag="FOA43_002282"
                     /db_xref="GeneID:62195683"
     mRNA            complement(join(<632940..633025,633090..>637338))
                     /locus_tag="FOA43_002282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922581.1"
                     /db_xref="GeneID:62195683"
     CDS             complement(join(632940..633025,633090..637338))
                     /locus_tag="FOA43_002282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778509.1"
                     /db_xref="GeneID:62195683"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="PFAM:PF03159"
                     /db_xref="PFAM:PF17846"
                     /db_xref="PFAM:PF18129"
                     /db_xref="PFAM:PF18194"
                     /db_xref="PFAM:PF18332"
                     /db_xref="PFAM:PF18334"
                     /translation="MGIPKFFRYISERWPLTSQEVDSQQMIEFDNLYLDMNSILHNCT
                     HTNDGTIIHLSEEQMFGAIFAYIDHLFNTIRPKKVFYMAIDGVAPRAKMNQQRARRFR
                     SAVEAEQNMRKAIERGDPIPKEAPFDSNAITPGTEFMAQVTENLKYYINQKVSHDSNW
                     QNVKVVMSGHEVPGEGEHKIMEYIRVQRAQPGYDPNTRHCVYGLDADLIMLGLASHEP
                     HFALLREEVVFGRNRGQPSSDLTKQKFYLMHISLVREYLELEFQDLEDQLTFDYDFEK
                     VLDDFILIMYVVGNDFLPNLPDLHLNKGAFPLLVETFKEAMRRTDGYLNESGTINMKR
                     LKVWLDILSIFELDNFERGSVDVEWFNSQLDNISQRGAKKRAREGKELLLKQQKKMVG
                     HIKAWVFPLYNQKFSVKEMEEDESKIPSLTLPRDFFDSKVNMKFIKQFAFDAGLVILH
                     SKSKDTYSARIDIDGIDPNETDEDFEKRADDVRTQIKRYQRSVIVDSEEILDDEKDLY
                     NKKFIAWKNQYYKDKLGFTLDDEDKIKDMTENYVEGLQWVLYYYYQGVCSWPWYYRYH
                     YAPRISDVAKGMSVKIDFNKGTPFKPFQQLMGVLPARSKELMPTCYRTLMTDPKSPII
                     DFYPNDCPIDMNGKTAPWEAVVLLSFVDEKRMIEAMKPYDEKLSPEEKKRNSFGKDLI
                     YSFNPQVKTLVKSPVPEWLPDFESHCIESEFSLPSMDGLKFIQGRCKGSLMGTHALAG
                     FPTLKTIPFSYDLEYAHLVVFQQPSRSVSMILTLKNVYSGLTVEQFAKQYVGQVVYAN
                     YPYLREYKIISVTDNDKRYECARSGKSRKVISSPLEGVEHGDNDKNRREIIYQMKVKK
                     GLRFARNEEVLDSKVMDGSNQNGREDENPIKALVYARRVIGLAPTKDGAYVKMLSKEV
                     DCFPRQFIVEDVIHKDKRFEETPPIPIEEAYPIGSNVIFLGSFSYGAPAKVVGYSDGK
                     LALTVTVVAHSHEPDFGSTRAQYEKHALKFHPSNTVAKMLHISPLFLSKITSMYLIYA
                     PGGERREDVGLGLKFQGKQQKVLGFTRKSERYWEYSDLAVATLDDYMKKFPEVFKALR
                     NYHGNSIPESEELFRGVNEDVLKKNLKELKDYLRETKANFIKTSLNSDSLTKFGIGLV
                     EKQIISYSMTVLPVEKKGIKGIPRTAVFDPSKRFLLLRKQFFELGDRVEYALDSGKVS
                     LFSKGTVVGVRSYDSKVLLQVVFDQPVLTGNQFDGRLETQRGLTVDSSALLNLTHGQF
                     VYHADPKTAKAAKVKKQQHQKQKQQEKQKSKKELLGVIKKEENQTNKTEAVEDAGQTK
                     SQPSVSSGSAAVQNIYNSVLGNVLSAGQPAASTVSMTTGATPGYFPPPPPTGALYQDI
                     NQPLPVAFHETQPVAENHSEESQKLMNMLNGGGREEDGQAEPEEGVAIEKTQTTMNNE
                     LSDTRDMN"
     gene            <637771..>638808
                     /locus_tag="FOA43_002283"
                     /db_xref="GeneID:62195684"
     mRNA            <637771..>638808
                     /locus_tag="FOA43_002283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922582.1"
                     /db_xref="GeneID:62195684"
     CDS             637771..638808
                     /locus_tag="FOA43_002283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778510.1"
                     /db_xref="GeneID:62195684"
                     /translation="MNKPSGFSLTPSNSTTPGFSFGKSGTTTNTSANSGGLFDSKPAS
                     GGLFGSNTTSSGFNFGHGNVGDAVNTGNIGNIGNTGNVGNAGNAGNSGNMLNQIPQLT
                     PMTKVSDLPEQFQRQLEVLDGYIQTQVSISEYLKNNESEHRELIDSIPRDIEFLEKKY
                     VSTNQALNSDLKFIEGFKTKTLESFNDWVERLIKVYLQLTNPMSSSTSDQNQTSNSAR
                     IVIGVNGTRSAASPSVQKQKQKNAPSSDKNSPLNVTQILNSYYATKIDDFNENIHKYQ
                     LVLQDVESSINNLDRASLNGGPMTMGGNYGLEMVISTLREEFMLYVELANEFAETHHR
                     VNRFVGGSEAF"
     gene            <640333..>642513
                     /gene="THS1"
                     /locus_tag="FOA43_002284"
                     /db_xref="GeneID:62195685"
     mRNA            <640333..>642513
                     /gene="THS1"
                     /locus_tag="FOA43_002284"
                     /product="threonyl-tRNA synthetase"
                     /transcript_id="XM_038922583.1"
                     /db_xref="GeneID:62195685"
     CDS             640333..642513
                     /gene="THS1"
                     /locus_tag="FOA43_002284"
                     /codon_start=1
                     /product="threonyl-tRNA synthetase"
                     /protein_id="XP_038778511.1"
                     /db_xref="GeneID:62195685"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR033728"
                     /db_xref="InterPro:IPR036621"
                     /db_xref="PFAM:PF00587"
                     /db_xref="PFAM:PF02824"
                     /db_xref="PFAM:PF03129"
                     /db_xref="PFAM:PF07973"
                     /translation="MSEEVTKKVEKLSVEDQKHVKGSSNGKDKKAGKGKKNQVVDDKR
                     PVFIEPMPEFISRRMKIFDELKAKYEAEIALNEKKPIKITLKDGSIKEGNSWETTPLD
                     IAKAIGNSFCQRQVAAKVNGKLWDLSKPFEEDSQLEFLDFTTKDGKDIFWHSSAHVLG
                     EGCERHFGALLCFGPPTEDGFFYDMSIDESKTVVTQADFKGIEEACKRVIKEKQPFER
                     IVVTKEDLLRLFSYNKYKLVLIKKKIADGSKTTIYRCGTLIDLCRGPHLPTTGKLKAF
                     KVVKNSSSYFLGDSNNESLQRIYGVSFPDKALMKEHLKFLEEAARRDHRKIGREQDLF
                     FFNEMSPGSAFWLPHGTRIYNTLMAFMRDQYNKRGYQEVITPNMYNSKLWETSGHWGN
                     YKENMFTFDVEKETFGLKPMNCPGHCLMFKYKERSYRELPWRAADFGVLHRNEFSGAL
                     TGLTRVRRFQQDDSHIFCTEEQIGSEIMGVFDFLKYVYGIFGFDFKMELSTRPEKYVG
                     EIATWDNAEIMLKNALVEWGGDWEINEGDGAFYGPKIDIMISDALSRWHQCATIQLDF
                     QLPNRFHLEYRSNDDSGEVKRPVIIHRAILGSVERMTAILTEHYAGKWPFWLSPRQIL
                     VVPVGVKYQDYAQKVQKKLWDSGFFSEVDLTGNTLQKKVRNGQMKQFNFIFIVGEQEM
                     TTESVNIRNRDIQDLQGKNEAVKLDEVIPKLVKLKEEKRLDNKL"
     gene            <642691..>644058
                     /locus_tag="FOA43_002285"
                     /db_xref="GeneID:62195686"
     mRNA            <642691..>644058
                     /locus_tag="FOA43_002285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922584.1"
                     /db_xref="GeneID:62195686"
     CDS             642691..644058
                     /locus_tag="FOA43_002285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778512.1"
                     /db_xref="GeneID:62195686"
                     /translation="MKWTTPLLIARVLKAQANSAGELTLQELKSRLVRLAEETVASTS
                     TTTTTLQHKGKRTSKDFFVPNSSKSARDGNGLLLSSSVNQNGPSLGSSTTSTPHKASS
                     KKIKKPKRRNRVKKDEDFAPISWTNGFASSQNYRPKARTSYQAKSEFDTMIKDWITTN
                     WLNVDQVQMQKKPCHFLIHDRMAYHGLSVFEAVVKNLEDEFPDINLSRRELRQRWNDE
                     FSTMTLLNNENTSKIVSKKFLELVKTVFWPAFKTQRQDAASLLFKQYLNDPQYEQNVI
                     ATLKRSVSINARMVNYLKNFENLNINNNFTYIKDRELSLLPSLDYSQLIWDARKKNRV
                     FKKFSLLKYTYVFGNKVNDFKNLDKLKSIMNDIPSQENPYFIVLTADKETSLEYYRLL
                     KLAKQAHVGDEEKRGCVVFLNEITGNSTTTSFFPPDNKTRNYAAQTYNVIDHFSEIYD
                     ILEAL"
     gene            644330..644411
                     /locus_tag="FOA43_002286"
                     /db_xref="GeneID:62195687"
     tRNA            644330..644411
                     /locus_tag="FOA43_002286"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:62195687"
     gene            complement(<644453..>645358)
                     /locus_tag="FOA43_002287"
                     /db_xref="GeneID:62195688"
     mRNA            complement(<644453..>645358)
                     /locus_tag="FOA43_002287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922585.1"
                     /db_xref="GeneID:62195688"
     CDS             complement(644453..645358)
                     /locus_tag="FOA43_002287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778513.1"
                     /db_xref="GeneID:62195688"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="PFAM:PF00388"
                     /translation="MVNYDSWMKDINGDTHISKLAIAGTHEAPAYHKLAPPSVQCQGE
                     DITEQLNHGARFLDIRLSKNFLTVNDDKKNDLICVHGNFPVKLAGAVKFTEELEHIYK
                     FLEDHNSEAVILSIKQEGNGKWDNQNDEFPKVFRDNYLKNHEDKWYLKNEIPKLDNCR
                     GKIVLFRRFGVNNQDDSGKFGISASNWQYNTSCDDTGMFCVQDFCEFKSEDDIPKKAD
                     LVKDLLNKAKDYNNTDNDPKLFLNFCSASNFFDFDTWPHAVAKGLREAKISDAYGKGC
                     GIVVLDYVNKDDWNPVRELVDKNFT"
     gene            complement(<645709..>646185)
                     /locus_tag="FOA43_002288"
                     /db_xref="GeneID:62195689"
     mRNA            complement(<645709..>646185)
                     /locus_tag="FOA43_002288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922586.1"
                     /db_xref="GeneID:62195689"
     CDS             complement(645709..646185)
                     /locus_tag="FOA43_002288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778514.1"
                     /db_xref="GeneID:62195689"
                     /translation="MPRIATDNLTVNNLGLFNEITAPKQYSDNFITNCHELDDLCQYA
                     FFEEVPVGLVVSRYLQAANSTSPKGLIVVILRVLSAYSKRFGLEDALFDYVEKLAVQK
                     KHLNTVYLLADPTADQWLVEDAKKRGYEEDQETKPEVDGKLLDDVEGKVLLKRVMK"
     gene            complement(<646317..>646832)
                     /locus_tag="FOA43_002289"
                     /db_xref="GeneID:62195690"
     mRNA            complement(<646317..>646832)
                     /locus_tag="FOA43_002289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922587.1"
                     /db_xref="GeneID:62195690"
     CDS             complement(646317..646832)
                     /locus_tag="FOA43_002289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778515.1"
                     /db_xref="GeneID:62195690"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR036400"
                     /db_xref="PFAM:PF00173"
                     /translation="MADLILIAVLVVVVTLILKNVLFSSVSTVDVVKEIDESGKTKEE
                     EEEPTVIQDYTPRMLSNYNGFDLEKIYIGVRGKVYDVSSGRRFYGPSGPYSNFAGHDA
                     SRGLAKNSFELEVIRSWDEPIDDLSDLSEADWTSLKNWEGMFQGKYPVVGRLVSEKEY
                     KTSSNQAHVMD"
     gene            complement(<646974..>648715)
                     /locus_tag="FOA43_002290"
                     /db_xref="GeneID:62195691"
     mRNA            complement(join(<646974..647938,648004..648021,
                     648457..>648715))
                     /locus_tag="FOA43_002290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922588.1"
                     /db_xref="GeneID:62195691"
     CDS             complement(join(646974..647938,648004..648021,
                     648457..648715))
                     /locus_tag="FOA43_002290"
                     /note="BUSCO:EOG09342WOC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778516.1"
                     /db_xref="GeneID:62195691"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="PFAM:PF01008"
                     /translation="MVHVYLETIEGVNNVHLNVDDSLSTRVLVELLREHLPDKVADRS
                     IIALVGGIPVTHYQTLRELLDSGGNSGSPFVALQLRIPICKGEGKLQGRADEFIALIR
                     RIGQRIVKAQPREFTAGNILRRVLAIVREEISDSTASASANSAPVNTAMFRLLVAPLD
                     KEEEEQRKKERSAIDAENDGNSHKDVLRSVVIQGIRELIDEIDSVHENIAQMTVDLIH
                     DNEVLLTPTPGSETVLNFLLKASLKRKFTVLITENYPNDIELCHRFAKKLAEAEIETV
                     IIPDSTVFAVMSRVGKVLIGARAVFANGGCVTAAGVATACECAKEHRTPVFTVAGLYK
                     FSPSYPFDRNSLIEVGNSGKVLPYADSDLVGKCEVTTPIFDYVPPEYIDIYITNIGGF
                     SPNFVYRIVLDNYRTEDVEFS"
     gene            <649684..>654584
                     /locus_tag="FOA43_002291"
                     /db_xref="GeneID:62195692"
     mRNA            join(<649684..651157,651252..651260,651381..651463,
                     651594..>654584)
                     /locus_tag="FOA43_002291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922589.1"
                     /db_xref="GeneID:62195692"
     CDS             join(649684..651157,651252..651260,651381..651463,
                     651594..654584)
                     /locus_tag="FOA43_002291"
                     /note="BUSCO:EOG09343EHT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778517.1"
                     /db_xref="GeneID:62195692"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR036361"
                     /db_xref="InterPro:IPR038654"
                     /db_xref="PFAM:PF02891"
                     /db_xref="PFAM:PF14324"
                     /db_xref="PFAM:PF18953"
                     /translation="MTRLLEPLTDRQFNDTITALSHLRMTELKAICRALQLTVAGRKA
                     EVHDRIQRYITSGHHNADLPREHAIRELILKADQGEPLPDYYQILSSFRSMRSSSRGH
                     KYKPAQRILGINFKPSPFFSLKRRVVMNGTNSILAIRQPEGRGTARITFSLLRKDVEV
                     LHSSSTMRLFLLSGAVTESNDSEEKPLEFPQPIELTFNGTKLTDNVKGIKGVAGSAKP
                     ADLTPKLYEDKVNVLDIVYAYTKRDFLLSIYIVEITTVETLLSRVLAQPCIPREITIS
                     MIKENADQDDMVASKEIISLKCPCSYMKMQYPARSMYCEHFQCFDAYSFLKLQDQAPS
                     WLCPICTHKIPLNQLLVDDYFSEVVKITDPSVEFVELEPDGSWRPKVVMEERRVHHKP
                     ITLPNANGIKVEDRTIPQQHEGDEIEVIDLDSEPEVPANGTTENNDVVTALKADSSSD
                     IDTILPRIQKKTLRAMIPLAEPSPTTVHPPAISPSLGYCSSEIDRLASQALQNADSHE
                     TPATPAAQTVVFEAFQLHRKKQRSQPPARSVFTQSFYQGQDEPDDLPLHPLENQSAQQ
                     HMPVEYQSEQQQMRLLAGPGVISSGKRHAETADTRSSKLQKTAHVQQSTHGHPAVEDT
                     STQDEINSSLNMLLAAGREYHSLSSYDAKIHNRFLSTWSENNQDSLPMMARKSSALSV
                     VEYLDAMLGASCELLMRMCDREVRLSELFGWMLKFLRDALFKKVQTSPLDTEEYADMK
                     TQLDMMHLRSFALEATKRVNSTLNNQLLLIQQSIGHKKLKDLKKAFAGILMTTEKLIN
                     CKNSTELGAFDKLALLKAQKLLNRCNIQLKPPVNVSDKDLQCLNALNYDIETFDKSHF
                     NFEEDDKKKKTLDQEFIGTATTSVASWQAQTENAPSALPCAQPVAAFTEKLPPWSYTQ
                     HLTAVAQKRNQTAPSVFTEKKGSLQAPHERGYRSTGSLPSLSGAREVNSQNTDMTEQR
                     IRIQQNWSAEMKIRAEARRVEEVRKAEEARKAEEGRKVEEARKKARKVEETRQAEKAR
                     KVAEARRVEDARKVTEARKAEAQKAEEARRVAEARMVEEARMAEQARKVAQARKAEQA
                     RKVAEARKAEETRRVEDARMEDQARKVAEARKVEEARKAEEARKVAEARRVEEARMAE
                     QARKVEEARMAEQARKVAEARKAEEARKVAEARKAEEARKVAEARRVEEARMEDQARK
                     VAEARRVEEARMAEEARKMAEARKAEVRIAEARKAEEDRRTEQARKAEVQKAEEARKT
                     EEARKVEKVCKAEETRRAEVQKAEEARKAGGGLHLDLHSTVQQRIADTKERVAEAKKQ
                     QEQLHNSCQNGIAAFKNPVPSHIEELGKLHKTQQMLRERMNASGMFSQVKVETQGSIP
                     RPIAPAPKRVSGTMLPHGSQQSVQDLRASTEVSIPAAPAALTATTDPMTPTAPTAPAA
                     LNATTTSDDLPKGLLGFAVSLMKVKEMLSHRSFSGLRLKETGNTLESLPPLPPPSGPP
                     PGRAKTDIQNHNTEPEVIDLTLDD"
     gene            complement(<655587..>656180)
                     /locus_tag="FOA43_002292"
                     /db_xref="GeneID:62195693"
     mRNA            complement(<655587..>656180)
                     /locus_tag="FOA43_002292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922590.1"
                     /db_xref="GeneID:62195693"
     CDS             complement(655587..656180)
                     /locus_tag="FOA43_002292"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778518.1"
                     /db_xref="GeneID:62195693"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="PFAM:PF00660"
                     /translation="MKFSSTAAIATLAAVANADLTSAEVSAVNGLFLDIESNEAEYLG
                     FMETAVDFSFPTALIGLVEEMITYTDDSYTTLFETIPADEYAEITQLAVTLPWYSSRL
                     ESLFEATAAASSAAATTEAASSAAATTEAASSAAATTEAASSAAASSAAATTVAVVSS
                     AAASSTAAAVSTFTGGAAAAGMAGLSVGASILAVLLL"
     gene            complement(<657175..>657801)
                     /locus_tag="FOA43_002293"
                     /db_xref="GeneID:62195694"
     mRNA            complement(<657175..>657801)
                     /locus_tag="FOA43_002293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922591.1"
                     /db_xref="GeneID:62195694"
     CDS             complement(657175..657801)
                     /locus_tag="FOA43_002293"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778519.1"
                     /db_xref="GeneID:62195694"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="PFAM:PF00660"
                     /translation="MKFSTVAAVASTFAVAANADVDAAQATALDALFLDIKSYQEEYV
                     SYLAEASAIDFPTVLIGIYTAMTTYTDDAYTSLFSTVAQSQFYEVASLAENLPWYTSR
                     LEASMSAGIEETAAVVSSQAATTAVASSVAVSNSTVASSSAFENTTEVASSSEAESSA
                     AATSAAASSAASNSTTAASSSSSAGANAVAPVYAGLSLGASLFAYMLL"
     gene            <658562..>662653
                     /locus_tag="FOA43_002294"
                     /db_xref="GeneID:62195695"
     mRNA            <658562..>662653
                     /locus_tag="FOA43_002294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922592.1"
                     /db_xref="GeneID:62195695"
     CDS             658562..662653
                     /locus_tag="FOA43_002294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778520.1"
                     /db_xref="GeneID:62195695"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF01061"
                     /db_xref="PFAM:PF06422"
                     /translation="MDTIFEQTIPTTVWADRLTVESRIHSEGDADSSLFFGADIDSPN
                     VLTNLCSKKSNVKLLDGISMLVSPGDLCLVLGSPKHVNSLLLKELASHEKSSMVNYSD
                     LISRAQLVFCGQEDLHYPYLSVRQTLDLALSWKLPKLNRARRAAVVEELLSDVGMPHT
                     INTRVGDNFFRGISGGERRRLSLLESLIAGGAVNCFDNATRGLDSATAARMLDVFRGV
                     ATKFGPSFVMTLYQGSQEVYEKFNKVLVMFNGQQIYYGTADNVEPYFAKLGYRRNNAR
                     QTTMELVDLILDSELTFEEKRGIIVDPSRDVKEIPQSAEELARAWRSSPEYAELEAEI
                     QDAQSVSGNKPRSGSAIRGRFSRSSYRANMFSQFRTCLKRNFTNNIKSWPFYLAQLIT
                     MIFLAICIGTLFFRLKMNTIGSFSRGSLIFFALLLFTFIAVSEVKINFGNSLVITRQS
                     CNYKFYIPWIDSLSDIIAEIPFKLGEELVFLVIFYFLVNLNATAGGFFSFYLFLSVSI
                     LVVDELYHMISRLSKTIAVATSLSGLALLWLAMYATYVVQQDQIKVYFKYWLMYTDPL
                     MYAFESLITTQLHGKIMDCTNVMPSGTAYYDSIPFSDRICAWQGASLGNDFVRGDEYL
                     SSAFGYSYGHVWRNLGILFGFLIAFTAIELIGVQLTIKDTSEESLKLVHYKGNSKDDA
                     AFAAAEAAVRDDYNTAGYTTENKVAATMNKDPSSGSSDTAFSATAGPNSSITYSWQDL
                     SYSLGNGTCLLHNITGYVRTGELVALMGASGAGKTTLLNALAGRYTQGAVNCRQKPSV
                     SGSSVGYVEQQEIFVEELTVREALEMYAALQRGRAGRTLEEDNTHIALLLRLLSLTPY
                     RNFQLRGLPLEQRKKVSLGIQLVNRPSLLFVDEITSGLDDLSAFNIVRCLQDLTRNAH
                     VAILCTVHQPSPSLISQFDRLLLLKKGGFQTYYGDTVGAVDFFSHHKLRECGHNENIV
                     DYMIEVTGDESVDWAGRWSNSAEHDSVDVVVNGSAEGSSHTGNGDSEKIAAAVASSSV
                     SMVAAPASSAGEISRGSYFAQFRIILRRTTIETLRNRDYVYAKIGLYVFSGLFIGFSF
                     FHVDKSIKSLQSSMFAVFLILCVCSPLIHQIQDRCNSDKLLYELREFRDYHWSVLPLC
                     QIMIEAPLAIFSATLSYLCFFFTWGINTQATRAGYFYLDYAIMFQLYYVTFSVGVLYF
                     SPNELIADVYSSLFFALMVVFCGAMQPYSMIPSFWKYTVYYESPFTYFLQNLMTDLFS
                     GRDVVCAANEFALLMPAVNTQCKDYMKDYMNTHGGYLKDGETSIYCTYCSYDSGEQFT
                     DSLNMYFSNHWRNFGIMWIFVIGNVVLMLVAYKLMLMYRRRKA"
     gene            <662682..>664257
                     /gene="IDH2"
                     /locus_tag="FOA43_002295"
                     /db_xref="GeneID:62195696"
     mRNA            join(<662682..662690,662803..662810,663147..>664257)
                     /gene="IDH2"
                     /locus_tag="FOA43_002295"
                     /product="NAD-dependent isocitrate dehydrogenase"
                     /transcript_id="XM_038922593.1"
                     /db_xref="GeneID:62195696"
     CDS             join(662682..662690,662803..662810,663147..664257)
                     /gene="IDH2"
                     /locus_tag="FOA43_002295"
                     /codon_start=1
                     /product="NAD-dependent isocitrate dehydrogenase"
                     /protein_id="XP_038778521.1"
                     /db_xref="GeneID:62195696"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="PFAM:PF00180"
                     /translation="MLYLISLVLPAKLATASRSFATAGSSSNHIVGKYLGRPKANGKY
                     SVTLVPGDGIGPEISKAVEEIYGAADVPVDFESVDVTPSLINGITTIPKPAVDSIYKN
                     TVALKGPLATPIGKGHQSLNLTLRRTFGLFANVRPCRSVEGYETPYKDVDTVLIRENT
                     EGEYSGIEHIIVPGVVQSIKLITKKASTRVIQYAFEFAKTSGRPKVLVVHKASIMKMS
                     DGLFVQTAKEVGQQYPEIELGFELLDNTSLKLASNPGLFKDVVMVMPNLYGDILSDLS
                     SGLIGGLGLTPSGNMGEKVAIFEAVHGSAPDIAGKGLANPTALLLSSCMMLQHMKLNK
                     YGDKIQNAVLKTIASGPENRTRDLKGTASTEHFTRAVIDNL"
     gene            complement(<665262..>666215)
                     /locus_tag="FOA43_002296"
                     /db_xref="GeneID:62195697"
     mRNA            complement(<665262..>666215)
                     /locus_tag="FOA43_002296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922594.1"
                     /db_xref="GeneID:62195697"
     CDS             complement(665262..666215)
                     /locus_tag="FOA43_002296"
                     /note="BUSCO:EOG09342SX4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778522.1"
                     /db_xref="GeneID:62195697"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MTEDTSGTPKPPLESRLGRDSPFDFGQRYLKDEKQVFNCNAWDN
                     VNWDDEQLGEIKEKIRLQQEHPVSDFDKRRFNAQPEKFWDLFYKHNQENFFKDRKWLE
                     IEFPVLYEATKKDAGHKVILEIGCGAGNTMFPVLSKNENPGLMVYGCDFSKVAVDLVK
                     GKEQYEGLNRTGNCQASVWDLANEEGKLPEGLDAHSVDISVMIFVFSALNPSQWHFAV
                     ENMKKLMKPGGKILFRDYARYDLAQVRFKKDRLLEENFYIRGDGTRVYFFTEDEIRHI
                     FVDQCGFKEQRIATDRQLLVNRKKQLKMYRCWLQAVFEVGL"
     gene            complement(<667989..>670313)
                     /locus_tag="FOA43_002297"
                     /db_xref="GeneID:62195698"
     mRNA            complement(<667989..>670313)
                     /locus_tag="FOA43_002297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922595.1"
                     /db_xref="GeneID:62195698"
     CDS             complement(667989..670313)
                     /locus_tag="FOA43_002297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778523.1"
                     /db_xref="GeneID:62195698"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="PFAM:PF12927"
                     /translation="MTPVKDLSVVDSIIVNLVSVRNLYQFEYEQLGTFLSLMNQFEEA
                     KLKSRELLKKNDIFIREFNGDVKFYRERMKWLQARISKLSKDIENRKQAKQKLMQLFD
                     SLQSLDTLNDSNPNQEESNLEAGLPIMNIREELDENGNVMKSSVKPYEKSKLGIFEKN
                     ANTTKKASSISSNLHPYGVTEESDEDGNIVRSSVRKLPVSEKKKNETTDDQISLLMKD
                     MDLIPKEEPRIVELEDGIDSTKDSSLKVQQKIDSSMYAPEIDPEDLLTLEVIANEVNN
                     DDDDNDDDDNDDDCDMNNETGITSLVPPESRDLLYKRIQELRIAHRDTRDDQTAVRND
                     DSEFSKTSEKKKPSKSVSFAEDVDVKEVEDIWDDLRESEQQGGHPKVSEFKLMMEGAA
                     ALEKEEVEKPKNHETIANGLIVGDVMEHDTEARGSNIGFQETKKSSFDEPVAEETSEN
                     LVNMDRLKPEKGMMRLGGKKPIFRSRLNKVVEMGKQYQKRGASIEKQKSSSPFKKDFK
                     SLRPAKKVITKSLNSEVIESPKDDNSLVKNLPLEVEDFDIVREHITEEDGEDENSQMI
                     EDYKIVESKMSSGKELPNLEEFKDSEKVIKLTSKQLSELQKHMKNATLDYKSVGNDTD
                     TMARAYVMGLYDDDIEEDDGVIEEVDDFKKHNKEVEKNEQDEKDGKDEKDGRDEKDEN
                     EGDVEDGPIMEDNIIEHDTGALQNISDDDIDIELNSESLNSEIALDYTRAHERMLEKY
                     NGGFKKTDLEKEFEPLDDAPKVSRFKAARLGRKA"
     gene            <670526..>671614
                     /locus_tag="FOA43_002298"
                     /db_xref="GeneID:62195699"
     mRNA            <670526..>671614
                     /locus_tag="FOA43_002298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922596.1"
                     /db_xref="GeneID:62195699"
     CDS             670526..671614
                     /locus_tag="FOA43_002298"
                     /note="BUSCO:EOG093431XC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778524.1"
                     /db_xref="GeneID:62195699"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF03029"
                     /translation="MAPYGQVVIGPPGAGKSTYCLGMNHFLNAIGRHSVIVNLDPAND
                     RLPYDVSVDIRDFITLEEIMDDENLKLGPNGGLMYCMEVFEKSIDYFIKKIRSLTKIS
                     VDGDSAYILFDCPGQTELYTNNPVFSRILRKLVKDLDFRLCIVSLVDSINLTVPSQWI
                     SSLLLTLRSMLQLDLPQVNVVSKIDLIKNYVDSDKLDKIEKKKHMQIDQDVSDEYVQG
                     GLPFKLQYYTEVQDLEKLIPYMKHENNQLHHAYFNQKYEKLSEAIADLVEDFGLLQFT
                     VLAIEDKMSMISLLSLIDKANGYCFGTNEIGGDSVWTDLLRQSSMGFSDDIDIQERWI
                     DDKETYDKEAEENMQQAMANKDRGNAEN"
     gene            complement(<671627..>671962)
                     /locus_tag="FOA43_002299"
                     /db_xref="GeneID:62195700"
     mRNA            complement(<671627..>671962)
                     /locus_tag="FOA43_002299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922597.1"
                     /db_xref="GeneID:62195700"
     CDS             complement(671627..671962)
                     /locus_tag="FOA43_002299"
                     /note="BUSCO:EOG09344PB7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778525.1"
                     /db_xref="GeneID:62195700"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="InterPro:IPR036126"
                     /db_xref="PFAM:PF02970"
                     /translation="MGPSQIQIKASALQRLSKEKSIYEQELKENEEEVKKIEAQMTTA
                     SDKEKEDLKYTLKVAVRIRDESKRMIPNIKAKTQEVLKDLKEYLMTNGSENDDTVKKV
                     IKEAERASK"
     gene            complement(<672117..>673655)
                     /locus_tag="FOA43_002300"
                     /db_xref="GeneID:62195701"
     mRNA            complement(<672117..>673655)
                     /locus_tag="FOA43_002300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922598.1"
                     /db_xref="GeneID:62195701"
     CDS             complement(672117..673655)
                     /locus_tag="FOA43_002300"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778526.1"
                     /db_xref="GeneID:62195701"
                     /translation="MVVESGQYDMRNECFHWKSISTGIEEKYHPDIYADNVKTLGISS
                     KVDFVIIGAYEMTKLKVFSREVAESEFCTSDTIFLVDCTIAAGLEEEINIANCFATYF
                     DLSTKEVKRGSTVILQYENGTTVAIGSSFLKKELNQQENILKRIIEGEGVLGANLKKL
                     KELLKLQYIQTVHLIPPDRTPSVGSYCWKQVIPLINFQVLWIIYSSIDDKILNGVFKE
                     LVTIARSVGALEFPKPTDEGKMILQLQSMVEKYNKKTNSKYQMMNIQGSQLCNTTTDL
                     YAEGNQEIPDAIYNFENGNGTMIRFVLSHLLFLSSKHKVKTPYLECIQSFYLKIERLK
                     AESSFNWIRKKSTIVPVISAHPLQSSCQYPQTANNTMIGRQGWNQASAGLVSIHPRFH
                     NDDLNSSGSSIGGKSNNTPSVQQVKNSLYGKTSASSFESYEDIARNQKSLFESANVKN
                     LMHDTTSRYGEVDTLSQIERFVRIARRGPRVSVSSASAASTSDAVSSKIEEDASIYYS
                     DMEE"
     gene            complement(<673968..>676199)
                     /locus_tag="FOA43_002301"
                     /db_xref="GeneID:62195702"
     mRNA            complement(<673968..>676199)
                     /locus_tag="FOA43_002301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922599.1"
                     /db_xref="GeneID:62195702"
     CDS             complement(673968..676199)
                     /locus_tag="FOA43_002301"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778527.1"
                     /db_xref="GeneID:62195702"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="InterPro:IPR016522"
                     /translation="MLQRLLASRALSVSRSFFRYGISGLYRCLSSKPKITMEGPNEYS
                     SIDSDKAPSSEKSQLFYAYRSEGETFGQMVNETINGRNPLHNSHVVSREEAERGVDPR
                     YRDTETGELLDGATSSEARLDIKTLKGRVNRVQIAVPEELSTVIANNILYAYEPKHLK
                     QQCAQYYMDLNDEVVQTKCETELETDVSIATTFAQNYAVAYQVLDELRRRVGEDKFHP
                     TRILDYGYGPGVGMLALNELMGDDFNPDAKDVMINGCFHMTRRAKLLLSRQASEYYGR
                     GKDEKEEEEGDGESTKEIMKDEEKREDGEAHSSTSLDPTVVDDYVGKVKTKDIHIKTI
                     LLNRFRPKSKKYDLIIAENQLLTGKEHFPHQVDQQLEELVHRLLPGGHLVLLQRGNPL
                     GAEVIARARQVMMRPENNEGKLAKIPREYKSRGQLATEKQVGLDKESEEEAMKDIEPE
                     LLENYDIVEKEAKPDAAEEPINLKIMAPCPHHGKCPLQFFKPQYYEFGQVGKKLKFCS
                     FAINVARPPYLLELKRGSRLATTWSSSSSGMGIKGQAKPGKGRPYGLNYETASYSYLI
                     VERSDENPLLLQQQRDAETISRQVGFRSDLLDERPRVLAPPVKRKGLVCLDVCAPSGH
                     VEKWYVSKSVGKQEYHDARKVKMGDIWALGAKSMIQSKKENSFYFERLEKKEEALREN
                     KKRDAEKLKRKIRREYKEAVASDPKSDDLGEKLTRMARIDAYQFLAKPKEQQRITDKR
                     RYK"
     gene            <676608..>677111
                     /locus_tag="FOA43_002302"
                     /db_xref="GeneID:62195703"
     mRNA            <676608..>677111
                     /locus_tag="FOA43_002302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922600.1"
                     /db_xref="GeneID:62195703"
     CDS             676608..677111
                     /locus_tag="FOA43_002302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778528.1"
                     /db_xref="GeneID:62195703"
                     /translation="MSRPVLSESTRPSRQSFQHLTEYGPKINGYRFVATKPDEVIEEE
                     ILKEDNPDNRHYEDTPMSEIPESSYTYSTYNDLWMKITQSGKLPGFIPLPVETNSPED
                     LNDTNVARFIESKTRAKNERIRWHPDKMIVRLQKLGVTDRISPDYKRIVTRVFQIINR
                     VYNNLHV"
     gene            complement(<677127..>678017)
                     /locus_tag="FOA43_002303"
                     /db_xref="GeneID:62195704"
     mRNA            complement(<677127..>678017)
                     /locus_tag="FOA43_002303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922601.1"
                     /db_xref="GeneID:62195704"
     CDS             complement(677127..678017)
                     /locus_tag="FOA43_002303"
                     /note="BUSCO:EOG09343TU4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778529.1"
                     /db_xref="GeneID:62195704"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /db_xref="InterPro:IPR036747"
                     /db_xref="PFAM:PF04729"
                     /translation="MSIVSLLGINVLNNPAKFTDPYQFEITFECLEPLKEDLEWKLTY
                     VGSSRSLEHDQELDSVLVGPVPVGINKFILTADAPSPELIPASELVSVTVILLSCSYK
                     EREFVRVGYYVNNEYDSEELRQNPPTKVQVDHIVRNILAEKPRVTRFNIVWDNESENP
                     DDFYPPEQLEEELDEEDGGSQYGTSEGEGTEEGEGTEEGEEADEEADEEADEEADEEA
                     DEEADEEAEEEAEEEADEEVEEAEASPNKAEQVEETKVKEDDISTSAESASKKRKTEE
                     SEVTDKDEEEDETKEIDKAD"
     gene            complement(<679372..>680847)
                     /locus_tag="FOA43_002304"
                     /db_xref="GeneID:62195705"
     mRNA            complement(<679372..>680847)
                     /locus_tag="FOA43_002304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922602.1"
                     /db_xref="GeneID:62195705"
     CDS             complement(679372..680847)
                     /locus_tag="FOA43_002304"
                     /note="MEROPS:MER0011030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778530.1"
                     /db_xref="GeneID:62195705"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="PFAM:PF04925"
                     /translation="MLTPRFTVDQDDEFVYITIKLSTIRFSAHNVEMVVNDKLFIFAL
                     PPYYLRLRFPGSLEEDERATSKFVSKEECIKVRVAKKTKGENFPDLDLTAKLLARLNE
                     PTNQSISESHNYKSTTLIEEIESNENGANHVINNHMSDIAREAENFNWEVEQKSAEEM
                     DVNMGTEHPKYGFNNQYSDMLEATVSNGNDINELAEPDGLKSDDRVVQRLIKENLKFD
                     PEYYANEYLTAKYTPEESRIREILKWESPYKSIFLKLQREPKQKRDLDHVTSVAITFS
                     QKEQDLMRDLPKKSYLIDDPRPIYYTIICLLYAYCYEIRSNEGDSTVESGWTIGKLTP
                     QISCLDSQLIQSNNMTEKNMLRILVITMDRRALSYPLIRSYEVAKKCWEDVYFILRCG
                     KRSVLKASLAAREYFRFHDIYYIYCKILLDDLCNWILRDDGCNERVLRNLAHALRKEA
                     ETIVKKDLMFEKIMTEESEDMEFINIDDVEDLAEHAYKDSK"
     gene            <681163..>682431
                     /gene="DPH1"
                     /locus_tag="FOA43_002305"
                     /db_xref="GeneID:62195706"
     mRNA            <681163..>682431
                     /gene="DPH1"
                     /locus_tag="FOA43_002305"
                     /product="Diphthamide biosynthesis protein 1"
                     /transcript_id="XM_038922603.1"
                     /db_xref="GeneID:62195706"
     CDS             681163..682431
                     /gene="DPH1"
                     /locus_tag="FOA43_002305"
                     /note="BUSCO:EOG09341N90"
                     /codon_start=1
                     /product="Diphthamide biosynthesis protein 1"
                     /protein_id="XP_038778531.1"
                     /db_xref="GeneID:62195706"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="InterPro:IPR035435"
                     /db_xref="PFAM:PF01866"
                     /translation="MSSEEVKNHRRRFAGSRKMPVNGDKIGTNGSKKTVAIKGRSKVI
                     GRIMNQIPKDILEDEELNEVIKLLPSNYNFEIHKTVWNIRKKNAVRVCLQMPEGLLNY
                     SLIIADILEQFCHCEVLVMGDVTYGACCIDDYTARALDCDFIVHYGHSCLVPIAVTTI
                     KVLYIFVTIQIDEQHLINTIRRNFNQGTRLAVFGTIQFNPAIHSLKVALENPESPQDK
                     LIYVIAPQIMPLSKGEVLGCTSPSLDPKQFDAMVYVGDGRFHLESAMIHNPHILAYRY
                     DPYSRKFTKEGYDQKEMISVRREAVQTAKGAKKIGLVLGALGRQGNPITVEKLEKELR
                     KHGKIVVKIILSEIFPKKMAMFDDIGAFVQVACPRLSIDWGYAFSKPLLTPYEAMVML
                     EEDTPFTEEFYPMDYYYKEGYGRGKKPART"
     gene            complement(<682453..>687082)
                     /locus_tag="FOA43_002306"
                     /db_xref="GeneID:62195707"
     mRNA            complement(join(<682453..682474,682537..684859,
                     685556..685641,686532..>687082))
                     /locus_tag="FOA43_002306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922604.1"
                     /db_xref="GeneID:62195707"
     CDS             complement(join(682453..682474,682537..684859,
                     685556..685641,686532..687082))
                     /locus_tag="FOA43_002306"
                     /note="BUSCO:EOG09340HGL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778532.1"
                     /db_xref="GeneID:62195707"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF06419"
                     /db_xref="PFAM:PF13561"
                     /translation="MFVRNLVDMTMANFGRIDSLVLNAGRLDPIGHISNLDNDEVKNL
                     FDINFFSAIELVKQALPHLKDTANKSNRSSSCIFVSSGASTKPYDGWMAYGASKAALN
                     HLCLDLSVEEAPLIRSIAVAPGVVDTSMQVYIRDAGREKMKPEALKRFTDMHKNGELL
                     PPEVPGNVYAELALNGIPDNLNGKFTDLDIDMNNYPTNLAKDCLVQEPKRKYDTYAMT
                     MGMGDLKTGNSSSLPIPSAPLKISNFNIQKDLTKRISSLSIIQTINKGLKGRQIEQEQ
                     GEQRDQREQREQRETNLVNVPNSSTAFKYAHNTLDLLASTPSIPIADHKESNDLDSHI
                     LENRLSRVLNQNNYDSTLRQSLSMIEKRLNREENTSEAEADNYQYITSPGTQGLISRR
                     KLRDNIEEDILKQHYLTLRGFQPIAEKLEYLRNDLADMNSCYGDLNQQLRSIIDSSQG
                     VRHNMAEETKQRDVISIKKNLLSSFKANFTLNQYEEHYLMNEGIDEEYFNLLSKVSRI
                     HSNCDILLSMNNDKLGVSIMTQMARIIDIATDRMASYLKKNLNSTYQEDTVNRDSRTI
                     SSLQRALIYIRKNSMEKFNGVVADLVENRSRLLSEEFDNQLKGYSEAAQTQEDSRENF
                     QRTSKKTSRKTLFMSPYDTKRFASDMLAYVHSVIVNELEMAESLFNFDQAEVENKDLL
                     LVIKSVGNKVIDSLSLPLRASLEGILRQEAKPGVVIELYQLLDLYHMMYSKLIDVSKS
                     ELLNTLVHLKIEAKDRLFNMIHVRLKDLKVESGAEEIDDDFLGLPDWLIDFYSNFLVI
                     FEGDDGDMLLGMDKDQRNKVESLIVDEPLKILEEQVKKLKLSRRSKLIFEINCIDFLY
                     SKIEVISRLSKKTEEISEKLQVLVKELSDNLFDDLLKHSGLFDIYNLVNMIFALEDDF
                     FDVSLYQPITENKLFNLLTFQDANTKLGDFLATYITSNDLNNLISPTILSQVSVDPSL
                     KFVKFYNKLTQIVADDVVRSR"
     gene            <687570..>689609
                     /locus_tag="FOA43_002307"
                     /db_xref="GeneID:62195708"
     mRNA            <687570..>689609
                     /locus_tag="FOA43_002307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922605.1"
                     /db_xref="GeneID:62195708"
     CDS             687570..689609
                     /locus_tag="FOA43_002307"
                     /note="BUSCO:EOG093429MM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778533.1"
                     /db_xref="GeneID:62195708"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR030844"
                     /db_xref="PFAM:PF18101"
                     /translation="MSKGPQQYDWAKNIPCRNIQIHGYCKWENKGCSFNHDIGKKDSQ
                     SAFPLQSLQDSLQQLSQSAPLMEKDSKFNFDTPAFTPSKFSPSLDDIPAFVPGNEVAD
                     EVAGDVSGAPRVAGDFIDGPVSGSATFTGSATFTGSAGPSALSASPHSARFNPEIAPI
                     FTPGPSTPADSSISSAGPHQMGPRDPHAGTLPPPPFAEEPFYQQTNLFPLNYHLYAPQ
                     PPPHVEMNKKPNERTVSDIFIPDQLREYVQQKNEASLRAIPNSQLNLPLHVGPYHSLY
                     PVDKHFDKTDKAFGYPSTVFKCVSNINGRLYCMRRLEGVPVTSGSFLEPIKKWSLVDS
                     ANVVKVYDAFTSKAFGDISLIVIYDYYPLSLNLMETHFYRIGNKDPELITENVLWSYF
                     VQLTNATVEIHSKKLFVGDYDPTKIVVTNRRRIRFSSCGISGIVEAAKKDHNQFQNGN
                     NLDSNGNKNTADEMAAIAAQKKRSWDTKIVVEQKKDLERLGNLILSLAKSTIFIKDSS
                     KVLPDEVIVKLNFSDEFKKLLRYSLDNKSTWIRFQELLAPHILKITDALENTADYMEA
                     NLTTEVENARLVRLLAKLDVISERPEFMKDGSWSETGERYPIKLFKDYVFHQVNEAGE
                     PMVDLTHIVSCLNKLDAGIEENVLLVSPDEMTCIVMSYKRLKELVDKSFREVVGR"
     gene            <691215..>692591
                     /locus_tag="FOA43_002308"
                     /db_xref="GeneID:62195709"
     mRNA            <691215..>692591
                     /locus_tag="FOA43_002308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922606.1"
                     /db_xref="GeneID:62195709"
     CDS             691215..692591
                     /locus_tag="FOA43_002308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778534.1"
                     /db_xref="GeneID:62195709"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00503"
                     /translation="MGCTTSIEANDGEYHEMMQNSQVEKILKASKQQKKNQVKLLLLG
                     AGESGKSTVLKQLRLLHKGGFTEQERIQYKNITWADTIGSMQTLIIQARKLGIKLDCD
                     KPSSYLYSDKQKILGYKPLEGVNTSAAGGAAFLKDFVLKYSESSAHTRKFKSTGKANA
                     GWNEEMDGVDGELFDGSSNATSNTGESRGTADEDLDSDSLLKDYLQEVNGSVHKNKSH
                     KKHYTKLEIAEAIGKLWQGDEGIKKCFSKSNLFQIEGSAPYFFPKAGDYASSEYTCTD
                     EDILKGRIKTTGITETNFNIDGIKFKILDAGGQRSERKKWMHCFQDITCTCFVLAVSE
                     YDQVLFEDERVNRMHEAIMLFESLCNSRWFANTPFILFLNKVDLLKDKVRRSPLRKYF
                     PDYDGKSNDVEDVLQYFEKLFLSLNHTNKPIYVHRTCATDSKSMQFVLTAVTDMLINQ
                     NLKSSGIF"
     gene            <692857..>693168
                     /locus_tag="FOA43_002309"
                     /db_xref="GeneID:62195710"
     mRNA            <692857..>693168
                     /locus_tag="FOA43_002309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922607.1"
                     /db_xref="GeneID:62195710"
     CDS             692857..693168
                     /locus_tag="FOA43_002309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778535.1"
                     /db_xref="GeneID:62195710"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00462"
                     /translation="MSKETATKIDHLINTHKVFVASKSYCPYCRATKQFFSTVYPDAY
                     VIELDETPDGDEIQDYLYQKTGQRTVPNVFIGGKHIGGNSDVQALGGKKADQMIQGVK
                     L"
     gene            <693348..>694661
                     /locus_tag="FOA43_002310"
                     /db_xref="GeneID:62195711"
     mRNA            <693348..>694661
                     /locus_tag="FOA43_002310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922608.1"
                     /db_xref="GeneID:62195711"
     CDS             693348..694661
                     /locus_tag="FOA43_002310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778536.1"
                     /db_xref="GeneID:62195711"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR038425"
                     /db_xref="PFAM:PF00790"
                     /translation="MGFLDSHAHTSVSTTINKLIEQTSPDGSDGLMVAELGNLLDMIR
                     LQNDRDEPGPTEAARAIRKKLKYGSPESQINSLNLLDLLVTNGGTGKMALLYSDRKLL
                     DRLVSTASPATESTSIDARVTKKAKILIYVWSDVYRDDEAREPLVKLFLRCGFGHRLR
                     RENRRLVPDFMADEADPDTPFEEVYGDGDVIERRSRMGGSDEEEEDDDDFQPTRGIRR
                     PKTNSELDKQFRIPRIDYEKETSRIFKIIAEADVLSTNLQNSLRTLEPGELSIHSSRA
                     NDCFDECRLIRRRILRYLQLVDREELLGALLKCNDELVASLKRYEDMSEPVGASRVTG
                     DSEGEDSLADYETDDSLDDGLDDRFKDLNEAKTKNILPEIPILKVRPPVPPKSPSLRI
                     PKEIRPGKSSTAKPVVSKLEAERKEEMDADPFGDDNQVERATVWR"
     gene            complement(<695644..>696837)
                     /locus_tag="FOA43_002311"
                     /db_xref="GeneID:62195712"
     mRNA            complement(join(<695644..696779,696834..>696837))
                     /locus_tag="FOA43_002311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922609.1"
                     /db_xref="GeneID:62195712"
     CDS             complement(join(695644..696779,696834..696837))
                     /locus_tag="FOA43_002311"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778537.1"
                     /db_xref="GeneID:62195712"
                     /db_xref="InterPro:IPR035979"
                     /translation="MIREVDRVEEVDKVKEADGVKEADGVKEADEVKKLDEVKEKPKN
                     QIQKETTSVNSSRANWSASYSPREINSPREITIDENDYDRSIKEEVIYDIVERPQFRE
                     TRALFIGNLRTTFEDTELQNLLNEEAAKVGCIIERAWLNEKRSHCIVIVSEVSGAVSI
                     QKALNGKLFPKEAQESDMGPQKALTLYIDFIPVKATQLWIDQECRGPKDAVWKVEYMK
                     FPSKQEEGSDFLVASHRMLNYPNRSLGYKSSSRGRYGRGGYRGGYRSEHRGGYRGGYR
                     GGDRGEYRSGYRDDYRDDYRNDYYQSPSRHHDYGRPEPDRYDRYERPDRYERYNRYPS
                     RPYKSRYDGTEQIEDRNSLRERSPERTPARPPARAKEAESPEWSD"
     gene            complement(<697012..>699342)
                     /locus_tag="FOA43_002312"
                     /db_xref="GeneID:62195713"
     mRNA            complement(<697012..>699342)
                     /locus_tag="FOA43_002312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922610.1"
                     /db_xref="GeneID:62195713"
     CDS             complement(697012..699342)
                     /locus_tag="FOA43_002312"
                     /note="BUSCO:EOG09343YZU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778538.1"
                     /db_xref="GeneID:62195713"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="InterPro:IPR036823"
                     /db_xref="PFAM:PF00177"
                     /translation="MLSVIHSGGARVQCFALRRCSVSHAISAGVLKSMCLVMNKSSLA
                     SSKRNEYKELKEFFKTKEIDDDGYFIRKGVYTQKDFENSTYSQYMKQLDKEKARLVEE
                     KLQVLAELCGFSVADLRKRLETKVNARIDAVKTKTSHIESVLNDFNTQLSLPEQNPVD
                     FVGEIVNSLTNFKGDIESSPVFNYIRQLDIKFANLVKNLVENDSPQEKDVEELYEYIE
                     NGGEIGEMTKPELTKLIGMIYEKYEGDEKVDQSLESDTKSSESPNSQLLVSIFDNLNS
                     FATVKDAPLYRFLEKVDNSFIKLLSEYLAVDSSDEAELRKQYDQIVTYVNNKESTLYK
                     ALEDPTSTACLEFHEIVSAPKPIDLMEIYEGLEAYKDYFSSELFLKMEKIDSTFTELL
                     KELENVADDLQAETKNQEIDKYLDNTTTAIYKAMNEVQSDEYKELRAAIDDENRKAEN
                     MISLSGIIERLINKGASSDEFNVIERIDGNFADVVKPLLVKEGEGNALEAAKRVEEAA
                     SDPESAIFEAIHEQDSPAHKVLEETFKNKEEALEASPAVGSSSSTSAVDRDVQKFVEE
                     DQMSLPKDVQSMNRMYDLTISAIDELKSDLEHNTFEPIGHNVSEQVSKLLGFQPSEAQ
                     VDEVEALKGKPLPVHKDEVLDLCVNLIMKGGKKDQARKYVNRALYLIYLQTRTNPVEL
                     LKKALDTAAPLVITKTVKTGFAKNYIVPVPLTARQRNRMAFLWILDSSDSRASNDFSV
                     RLAEEIINVYKGNSKILEKRVLSHKLAIANRSYLRI"
     gene            <699542..>700186
                     /locus_tag="FOA43_002313"
                     /db_xref="GeneID:62195714"
     mRNA            <699542..>700186
                     /locus_tag="FOA43_002313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922611.1"
                     /db_xref="GeneID:62195714"
     CDS             699542..700186
                     /locus_tag="FOA43_002313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778539.1"
                     /db_xref="GeneID:62195714"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /translation="MASAKFIKVVLLGDQGVGKTSLRSQLLYHYFSSSYKATIGADFL
                     MYKMKTSEDEFVDLQIWDTAGQERFNAVSRAFYRGADIGIFVYDISSSDSFYNLAKWI
                     DKFTANTSDSKPLIMIVGNKLDNETIRQISYRQAKEFSRTQLEEGMIENSDLDVVETS
                     AKNYRDVEKLFMRCGELGAIKMKNNDLMSMSFDGIDVAMEPSAEAAGEGSRGCC"
     gene            <700294..>701142
                     /locus_tag="FOA43_002314"
                     /db_xref="GeneID:62195715"
     mRNA            <700294..>701142
                     /locus_tag="FOA43_002314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922612.1"
                     /db_xref="GeneID:62195715"
     CDS             700294..701142
                     /locus_tag="FOA43_002314"
                     /note="BUSCO:EOG09343J5D"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778540.1"
                     /db_xref="GeneID:62195715"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR016901"
                     /db_xref="PFAM:PF03256"
                     /translation="MNGIDQDLEGGRGGRVGRVGHGGPDGNHRRDIHQSQNQLQSDDR
                     HSVIDDDDNREARDLDADIGSGSGSGSGSGSGSGSDAGSTHSDANAGPSVTFNDDLAF
                     SRGIREMESSGLVDIGNLATWNASSSKSGFGIKELREDSPANYWQSDGQQPHFITVHF
                     TKKVTVERVCLYLNYEADESYTPSKILIMAGSGDHDLVEVASREFREPLGWQNILFKG
                     IRYDNLLKCYLIKICFLSNHQNGKDSHVRSIKVMSPQNNTREAFDEGRCIGFTSVKLL
                     SESVIR"
     gene            complement(<701269..>703188)
                     /locus_tag="FOA43_002315"
                     /db_xref="GeneID:62195716"
     mRNA            complement(<701269..>703188)
                     /locus_tag="FOA43_002315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922613.1"
                     /db_xref="GeneID:62195716"
     CDS             complement(701269..703188)
                     /locus_tag="FOA43_002315"
                     /note="BUSCO:EOG09340LYN;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778541.1"
                     /db_xref="GeneID:62195716"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="PFAM:PF05794"
                     /translation="MSASIPQNDDPLGDQDAATRLRNHGVSSASASAAAAAAAAAVSA
                     VSASPLLGGLPKKRLRKSPTCSKISKASCVKLRSAPISKRFRSRSLPNIWIPSSRQTD
                     LLLTDLSRRPGLSAKGGANLIESDVSQCTSNSAPQIHSDISQALSASSSIHRRHRCRH
                     HPSSRGFGSTATSGTSSTLVLGSRTATLTHQFITRQQLLMPPVNLQSMHEIDLHEVLK
                     NPQLRHDILFDPQLQFRPNIDGERGKRKKTQADTYWSFIRGEIKSLLADSNPKPLTTG
                     SPITVMFQALKSILLSLIPSKDKASVEDILDMKLILQQLNSHCFDFTSFADWISSALK
                     HHCAPMRDVWVDNMNAIFQSACENGTDGTPPTLDVDRLVDGLRMVFSILEAMKLDVAN
                     HQIRILRPLLCSTAVSFEKEYFNNALKRGKVNFTLALLWFKKNSIVCRSSNVREVLNF
                     ASLHLLSCSSMCSEFPNTLAFDHSRLVVLRADIRHLICTKLCTILYKNLVMQYAKSRF
                     RDLCSTAHMFELKKEILNIIVDENGNSKWTRNLHNLAVHLTFKLFGNLNAQKVDFCFN
                     WLLAQTQPSSKVYTLLEQTLFEKILKALNEGTVSQIEDDCLINEELKNVAERLNQLIE
                     LNYNVFGEIYGSYLD"
     gene            complement(<705325..>707871)
                     /locus_tag="FOA43_002316"
                     /db_xref="GeneID:62195717"
     mRNA            complement(join(<705325..707742,707863..>707871))
                     /locus_tag="FOA43_002316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922614.1"
                     /db_xref="GeneID:62195717"
     CDS             complement(join(705325..707742,707863..707871))
                     /locus_tag="FOA43_002316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778542.1"
                     /db_xref="GeneID:62195717"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /translation="MSIYAMPSLGLDFSKSLLGTSSGFKSIQDLTEKGQSTQSSNSTQ
                     LKEDIQYSSSVQVVLPKEIMLSSGKTICLQPKNRGQYNEEPILEKATLASDTIQLIDM
                     GNLRRKLEIEKLIHHQEPKNTSNRFKKTFHGLKDGRRVDSLWTEKYRPKSFFDLLGNE
                     RTNRHILEWLNQWNEVVFGRPTPDQMMPEYLQANRPQTASLFSDPFHRPYKRVLLIHG
                     APGTGKTSIAHVISKQLGYEVSEINASDERAASVIREKVRNSVQNESLSGKPVCLVVD
                     EVDGATEQGFVRCLLDLLYNDRRATENIKLGDTRDTNRGKSRKRPSLLRRPIIAICND
                     VYAPALEKLRPLCEVVSFRRSGARQIKARLQKICEREGLAMNEKIMDALVMSTGGDVR
                     SCINHIQFYGADETETETEIEIETGTGTGAGTRSNRKDTEVAWYLLLGDIYTRSANVT
                     KQQQLETIRDNLSRCSPSVLDRVTGGCFNAMLECDGAGMRKLDQVSEWLFFGDLVSRN
                     YRVFDRTDVANYGSAAGLKFFKTFNEVKAMEANSRLSFRSRDEYFEHKKQAREVIKRL
                     KRKMGLVSCDRQHLASNEIPLLNSVVIPTELGIRQFEENAEKVAHSVNVAESLGLYYE
                     TTEAAMVEGEEEEEAGRYNNRYGLRRKIHRFRPNLTLFLMSRDTISKQDVFIQMLQVH
                     ETKHRERERVAAEMQRKRQVAVEARDRDMEGEPKKKQMKHPGSSVEYFQRKYNRLSTQ
                     LSHETDKSSRKHLGGLEMLAGGAKIGQKQNDEAPLRGAMSENSNRIWIKYHEGFSNAV
                     RKDITWEQIF"
     gene            complement(<707957..>708880)
                     /locus_tag="FOA43_002317"
                     /db_xref="GeneID:62195718"
     mRNA            complement(<707957..>708880)
                     /locus_tag="FOA43_002317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922615.1"
                     /db_xref="GeneID:62195718"
     CDS             complement(707957..708880)
                     /locus_tag="FOA43_002317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778543.1"
                     /db_xref="GeneID:62195718"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00970"
                     /translation="MASAEDKRDLLKTPLHGIYIPTALCLGGTAILHVQYVPYMVAIL
                     AVFFGFHFVRVRMHRPIMSSTIFQPYKLTDMTIASKNTAIYRFKLDKEYDILSIPVGQ
                     HLACRVNINGKEEIRYYTPISNQFDKGFFDIMVKSYTDGTVSRYFAGLKPGQTVDFKG
                     PVGRISYQPNMASQLYMIAGGSGITPMLQVMAAIITTPEDTTEVHFLYANETRNDILL
                     KDELDDTAKRYPYFSVTYTLTHPPENWDGQTGYITKKMLEDFLPEPSPNRRVFVCGPV
                     SMRKNILQYTEELGWEKGVLNSVQDDQVFCF"
     gene            710284..710355
                     /locus_tag="FOA43_002318"
                     /db_xref="GeneID:62195719"
     tRNA            710284..710355
                     /locus_tag="FOA43_002318"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:62195719"
     gene            <710854..>713490
                     /locus_tag="FOA43_002319"
                     /db_xref="GeneID:62195720"
     mRNA            <710854..>713490
                     /locus_tag="FOA43_002319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922616.1"
                     /db_xref="GeneID:62195720"
     CDS             710854..713490
                     /locus_tag="FOA43_002319"
                     /note="BUSCO:EOG09340WTZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778544.1"
                     /db_xref="GeneID:62195720"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="InterPro:IPR038286"
                     /db_xref="PFAM:PF03770"
                     /translation="MSTSQLHEPHDPCSAAVSTNLAGRKAAKSLRLFRGETRERHEGA
                     RDEGQSASAATSSSTLFPVSDTVSDTVSDTVSESVSASKSTPTPPPAVSLAATSTYST
                     SVPAISTSSIGCPRHKSITIASLKSHKNSELLGRQFGQHKSVSPIGSFDSETVSSAIY
                     FPHAPPNAQFNLTPEHLTPAAEFDHTVDDLGDIEEIEEAIEHENKKEHNEEVEKVFKK
                     VVSAQNSFKETSAVFANNSFSPENLNEEVYPLAVELQPFKNKVGGHTAIFKFSHRAVC
                     KALVNREDRWYENIEQTHPELLKFMPKYIGVLNVRYSTLVDEAADKKLCLSPEFSNEC
                     KAQQKAAHDAAKAAQQKAISLGRMPQAVPGEEVIPEVVLEDNRHIVPESLWSHYSSPT
                     PNGSSYLSPHQEERPRFSCRIKSEDSLGSTTVNRKLQELVLTEVFAPIREYTKRNKHG
                     SHTKHRILSSEIHTNPQTTGETLEDNTIPNIRRFHRYSTNSISDSQLRETSITKSSDQ
                     GSFNREDEAVEIEPSSVHSDDIKLGVEDGNTFPDRKTIVSSIKAIRHERLGKELKTTD
                     DNDDIFMMEPSGEHCREPPEEAVEEDIPADMLSAYSFPHKLRKHTTFERFIMLEDLTR
                     GMEHPCVLDLKMGTRQYGIEAKATKLESQRRKCHQTTSLRLGTRICGMQVWDMKQNRF
                     INRDKYFGRSVTIGEMFVRSLSRYLYDGVSIFSIVKHLPKLIEELGELEKTFRTLIDY
                     RLYGSSILLIYDSNADSRSEKSTLILRILDFAQCLIGTEPLPESTTFAPTHRGKPDYG
                     FLRGLCSLIFYFKLMFGEYTGTEYKDYTGALKLIDELRKKGKLDHNCEWLDRFDEQEN
                     KCPYRFDLVPREEDDPYDDISE"
     gene            <714712..>716020
                     /locus_tag="FOA43_002320"
                     /db_xref="GeneID:62195721"
     mRNA            join(<714712..714716,714841..>716020)
                     /locus_tag="FOA43_002320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922617.1"
                     /db_xref="GeneID:62195721"
     CDS             join(714712..714716,714841..716020)
                     /locus_tag="FOA43_002320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778545.1"
                     /db_xref="GeneID:62195721"
                     /db_xref="InterPro:IPR010286"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF05971"
                     /translation="MEQLDFQYLVSLNPKLSKYYDEKLNKYDFQSNDAVILLTETLFI
                     TNLNLDVHISNDRLCPRYFNRLDYIYFIQELMEGSSLSPESKYFGLDIGTGQMAVYPL
                     MAVKIISELTWILATDIDQISVNMALKNVQNNHLSEKILIELVDKDDNCFRAVNQKDT
                     DDAVGFTMCNPPFYSSIWEMQSKRALKQANEDRETVVGTNQELIYSDGGELGFIQKLL
                     KDSRTASKKILWFSSLAGNYHTVKTLVKEFDSDFNYGIYEFQSGLTKKATKRWIVYWS
                     FQFLRPSISLFNSKVCAPPFRFIMNRKIDFAAAYTRIRDLPYLEISTDEDLSVFVKLP
                     GNCWSRSYRRKRQQNSQKRTKLDGSCWFEVVFYQDQTLIYWKYGQKYQTFESFCGWLN
                     NT"
     gene            complement(<716029..>716640)
                     /locus_tag="FOA43_002321"
                     /db_xref="GeneID:62195722"
     mRNA            complement(<716029..>716640)
                     /locus_tag="FOA43_002321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922618.1"
                     /db_xref="GeneID:62195722"
     CDS             complement(716029..716640)
                     /locus_tag="FOA43_002321"
                     /note="BUSCO:EOG09343SKY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778546.1"
                     /db_xref="GeneID:62195722"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="InterPro:IPR036224"
                     /db_xref="PFAM:PF05916"
                     /translation="MYGDQANKLISEAKRALNLDKIPLYERDLIRSIVRETRDLQREA
                     DILTQEAQQNSASQTGDNIIPSNTDKVKQCQLFVTHLCMRRNKRCVLAYQRQRAKQID
                     GLVWSNVEIDKDTTENFSQHEQDYLARYNELVSEFKGAMTDVNLGGSLEPPSDVFIDV
                     RVLKDAGEIQTEYGVFNLTKDSQFFVRQADVERLIQQGYLKKL"
     gene            <716867..>718732
                     /locus_tag="FOA43_002322"
                     /db_xref="GeneID:62195723"
     mRNA            <716867..>718732
                     /locus_tag="FOA43_002322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922619.1"
                     /db_xref="GeneID:62195723"
     CDS             716867..718732
                     /locus_tag="FOA43_002322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778547.1"
                     /db_xref="GeneID:62195723"
                     /translation="MPTYGRSGKCSQLRTGSRSFLLSPTKHTVSSDDHESSLVVSSSE
                     PKRIKLSQTSLSSPLNSWKLFTSDTDFPRSIDDNHSTLHIESIQSTTPDSADLMQDTN
                     ANLESLFGSLDHRNLPNKPSARSTKTTFFNIRTPTYNSEDEEKDPEETAGGSVTQISR
                     QLNLSVQKLDSESHIEQNMDIKEPITNTSSLGNSLIENIARSSRTYGATRSFKADETR
                     LSEDEGENEDDYFDDQVANKTNTNIQSTLDLRISGMNNQFKEEVDIFIEDYGSEDHLH
                     NKLQILMDFKERISEDNDFGQFVGTTGLPAEFIESILKPGDYDTGIGLGLVEICNIIQ
                     RQNNNHYAVILFCRGFQHRRNALGKLLAETNQPDKVIEFLGFLAGKGEDIDISLLVDK
                     QGAEKILETIVDRLKNASKSQSQSFLHYCIQIYSSMMVSKALEPKEILLDSTDQILQI
                     VINYRQYTRDLLVSVLQSGVFITSTLDVESLPETVSSQLYSEPLFQSLLEIAMRSKDS
                     QLTLFALGYLVNFTEEDKFINRLDHKSILPMKSYLDRLNLDSRVAEDVYKVGYFCLIY
                     SRLLANNNFVKWLTVSRETRPKLIIGLRRFNETIPNEEKLKDQINYLLHITTSSD"
     gene            complement(<718764..>721202)
                     /locus_tag="FOA43_002323"
                     /db_xref="GeneID:62195724"
     mRNA            complement(join(<718764..720899,721197..>721202))
                     /locus_tag="FOA43_002323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922620.1"
                     /db_xref="GeneID:62195724"
     CDS             complement(join(718764..720899,721197..721202))
                     /locus_tag="FOA43_002323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778548.1"
                     /db_xref="GeneID:62195724"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF13959"
                     /translation="MDGSRKTFSGADRASVDDDRRKPNGNPREAQQVRGEKRSNGDEQ
                     DESEEYSKRSKRSHSDRESRGLQGDNSYVSSLFTANPEVKERDYTQKIDEGLKPSNGA
                     LLNDESATFKALGVNEALCKSLEDKMKYSKPTRIQRAVIPALLQEDRDLFVQAQTGSG
                     KTLSFTLPIIQKLMDASDGTLNRKSGVFAIILSPTRELATQTYNFLASKLCSTCHWIV
                     PGIVIGGEKKKSEKARIRKGVNILVATPGRLADHIENTGNLDLSRVRYLVLDEGDRLM
                     ELGFEEAISKLLTQLKKDFSRVLPANMNGSLPSKRINVLCSATLKDKVRKLGEISLTD
                     AKLITSQSVDSLGSDEMKAPEQLIQEVMVVPPKLRFVALSATLKNLTSEEPVSGTSKT
                     IVFFSCSDSVDFHFIALTRTGRRLTMEKGRQKLEKNRKKGEDSDTTNKITATTAPLIN
                     PDTVIYKLHGSLSQQTRAATLNHFSKSTSHKHAVLFCTDVASRGLDLPGIENVVEFDP
                     PFTLEDHLHRVGRTARVGSSGLSVLFLLPGDEEGYIKKIEPLHGNDKENLKFLSYEDV
                     LKKAFKEDAKPEHKNAEDSDIPTRTDRNKKKIPFREGNWDTHATTFQLNMERWLLEDA
                     RSREIATSAFVSHARAYTTHLASERDCFNIKKLHLGHLAKSFGLREAPKKLAGRNSQE
                     HHKKPRENSKRKMLRMAKIAVASQSSEFNTI"
     gene            complement(<721277..>723072)
                     /locus_tag="FOA43_002324"
                     /db_xref="GeneID:62195725"
     mRNA            complement(join(<721277..721916,722255..>723072))
                     /locus_tag="FOA43_002324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922621.1"
                     /db_xref="GeneID:62195725"
     CDS             complement(join(721277..721916,722255..723072))
                     /locus_tag="FOA43_002324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778549.1"
                     /db_xref="GeneID:62195725"
                     /translation="MTKILGLSGNEFNQRLQKFESRHQSNYQNTFQSTIDKSIREYEN
                     EIIANVNKISNVITFCVKHSFYIESLTKNLEYIVKICNQFDESIKNNKSVPAYYWLQS
                     ENSDFHLDIYISTLLEIYMLVFKVPNQLAAYLSKIKQAHLILLKFWADIDNQRRTELS
                     VKARLYEEKQTKKKKEAKGFMKGIRHYEKELEAAFNDSNYFDFDFARTMLAANWKKLK
                     DLIGLAYQFLNVLFISGTLIQSCHLEAARVMCLLIGKFGNDSQKNIYLIGLLKDLVRY
                     EIKGIQEMKPKEIHQTEVVLDSPKCAVLSQRVIGNYSSRDNISKKQIQDQASVFTPGK
                     ENKQIFETSRYGFETLRKVTTCLEPVEILEYKPEQSISDLSEQLSHNRFNGDVPSMSS
                     GRSILKSRINPNFADESMSVANVTDDENDSDDEYQKEVSGNCEHNSDDEEEDENDTDV
                     EIHSQASSKRLWFKEKASHFFKSIYDVENKESKIT"
     gene            <723262..>724122
                     /locus_tag="FOA43_002325"
                     /db_xref="GeneID:62195726"
     mRNA            <723262..>724122
                     /locus_tag="FOA43_002325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922622.1"
                     /db_xref="GeneID:62195726"
     CDS             723262..724122
                     /locus_tag="FOA43_002325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778550.1"
                     /db_xref="GeneID:62195726"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="PFAM:PF04801"
                     /translation="MPSLFVSDDAEVEVTVKQEEEEILMEVDEEVTEKEEEETEDDDP
                     VLREIPIHLNTTDPQKLDLMLLQYTTRKNSGGSVPTSIEYKPNSKVVEMELPFEQTKF
                     FNEDKSKGWNKLEGQMLRGVVCRNETSGYFMGRVGQDGELYFNPITGGTAQLRPSFRY
                     IDDLRQKKIQKEAEEAKQLANDSSTKVIGERERQGNLAAARAAALHVVQMTAKSSNQT
                     IPRLGGALLSKKQEDDETAETYEVLPREKYDVKQMEMQLGGSDSDAAVLKPAATQAEY
                     IEMLMKKMGI"
     gene            complement(<724333..>725699)
                     /gene="LSC2"
                     /locus_tag="FOA43_002326"
                     /db_xref="GeneID:62195727"
     mRNA            complement(join(<724333..725578,725695..>725699))
                     /gene="LSC2"
                     /locus_tag="FOA43_002326"
                     /product="succinate--CoA ligase beta chain"
                     /transcript_id="XM_038922623.1"
                     /db_xref="GeneID:62195727"
     CDS             complement(join(724333..725578,725695..725699))
                     /gene="LSC2"
                     /locus_tag="FOA43_002326"
                     /note="BUSCO:EOG0934210W"
                     /codon_start=1
                     /product="succinate--CoA ligase beta chain"
                     /protein_id="XP_038778551.1"
                     /db_xref="GeneID:62195727"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="PFAM:PF00549"
                     /db_xref="PFAM:PF08442"
                     /db_xref="PFAM:PF13549"
                     /translation="MHMFARTFNKNLVKRVSQVRYLSIHEFRSATLLRQYGVGTPKGI
                     AAFTPEEAYQAAKKLGTDDLVIKAQALTGGRGKGHFDTGYKSGVHLINGAKEAKEVAE
                     QMLHHNLITKQSGPAGKPVSAVYIVERKYAEHEAYFSIVMDRQNQSTMVIASSEGGMS
                     VEEVAKKNPDAIKKFSVGIDEGISDELATKIASGMGFTDDAVSKAATAIKTLFQIFRE
                     KDATQIEINPLTETKEHDIECVDAKFNFDNSAAYRQKEVFSWRDESQEDPDEVTASQY
                     GLNFIKLNGNIGCLVNGAGLAMATMDVVKLYGGAPANFLDVGGASTPATIEKAFELIM
                     TEKNVSAIFVNIFGGIVRCDYVADGLISATKNLGLKVPVVARLRGTNLELAQKKIAES
                     GLNKLHLFSDLDEAAAKVVELGKK"
     gene            complement(<726580..>728568)
                     /locus_tag="FOA43_002327"
                     /db_xref="GeneID:62195728"
     mRNA            complement(<726580..>728568)
                     /locus_tag="FOA43_002327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922624.1"
                     /db_xref="GeneID:62195728"
     CDS             complement(726580..728568)
                     /locus_tag="FOA43_002327"
                     /note="BUSCO:EOG09341TKC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778552.1"
                     /db_xref="GeneID:62195728"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="PFAM:PF06602"
                     /translation="MEYLKITKVDHVTLHRRGRSFEGSLHLTTHHLIFTLTPAGDGST
                     TVSSGSSGFRELWCCYPMIERVEFRKGSALMYIKGDYDEEIVDRADRADRDRADRADR
                     ADRADKAESVHRTDISNSTLLQGANLKLYCRDYNFSSFDFADKGQCHDAFESILRLTC
                     IDSIEKCYAFIYEPIEIEAPFDSWKNYDVVREFQRQGLHFEEGQNDSLGSYGWRMTDI
                     NSDYSLCDTYPARLCVPQTISDTILSHTVRFRSKNRFPALTYYYKKNGCTIVRCSQPL
                     VGIKQNRSFQDEKLVYEVFRTNCKEDKRNLIVDARPLTSAMAQVAMGAGTENMDNYCG
                     DKNRKVFLGLENIHTMRESIGKVKQVLKNSDVSSRKEENLEADYEKLDRSGWLEHISR
                     LLRSTDLLIKWIHLQGVHIVIHCSDGWDRTPQVVSLVQICIDPYFRTLEGFVVLVEKD
                     WCSFGHRFNERCGHLQKDTKFYNYTSDSNFQRIRQLNQAFKHQQSTKFESPIFQQFLD
                     CLYQLMRQYPSKFEYNERFLRRLVYHLFSCQYGTFLQDCEKERIQELRLPQRTRSVWD
                     YFRARKAQFLNPNYEKIEEVESPHESEETETILYPNFTDVIFWYELYGKRYEELNVEK
                     AVIKKGTTTTTTASTATVTSVASASTPPVTQLEQLQIS"
     gene            complement(<729687..>731351)
                     /locus_tag="FOA43_002328"
                     /db_xref="GeneID:62195729"
     mRNA            complement(<729687..>731351)
                     /locus_tag="FOA43_002328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922625.1"
                     /db_xref="GeneID:62195729"
     CDS             complement(729687..731351)
                     /locus_tag="FOA43_002328"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778553.1"
                     /db_xref="GeneID:62195729"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PFAM:PF07716"
                     /translation="MSGYNFVTQHSKSSRGESSRDNSVLSAKTGLSEGTAIVDSSSNA
                     ATTSAMATAATASSMGTSSIDDTPTALLEQLVYVDNFLQSNNNDPISDSPNFEEQLSA
                     ELAAFADDEFIFPDEDKPKKPVDDSGDAGGNNNQSSWQFIDNSTNQPSSLPISGSSRD
                     SRDPHNSVESFSGPSSFQQTAFNNVNVNSTEVPGTIQELLGHSGFSRTSQTQTRQSFN
                     ATQALLGSLGATDSSIAQVQQMLPRVEIPQGAQNTLAAAGLSQTQIEALATLIACHKN
                     DLLRQSEGSSGPTVSHSTTSTQFDTHTQSDPLASLAQNAESPLSRHAEFLAQSLLNPR
                     PFLPRMEEDYQGNSARNNGSLPPGIASNFAATAQTFPLAMSPTPVAMTMTTTENSTPS
                     STIGSNTRPSLQNSFSNVDTRSRATQRGSVSSVSTSPFSSDSKGDVEKDKRRRNTAAS
                     ARFRIKKKVKEQEMERSLKELSDMSKNLEVKIQQLQMENKLMRNLVIEKNHQRDTDEV
                     ERLKKKAKLSVAMENDEPKGYQTQQKRRGQYGYNDGNKRVLSIDGN"
     gene            complement(<732045..>732770)
                     /locus_tag="FOA43_002329"
                     /db_xref="GeneID:62195730"
     mRNA            complement(<732045..>732770)
                     /locus_tag="FOA43_002329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922626.1"
                     /db_xref="GeneID:62195730"
     CDS             complement(732045..732770)
                     /locus_tag="FOA43_002329"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778554.1"
                     /db_xref="GeneID:62195730"
                     /db_xref="InterPro:IPR029032"
                     /translation="MTVCNEPQEIPIIYHYALHLRHLNEKPSDQLYGRAHSAVEKFHE
                     IRDRGTDTLYTPYNGEGGPGSPEFLTTEKFRESILKASALSGLPRAINSLMILKDTTP
                     YNLKKHGKQATNRAPITTFDEYQKVQQRGKQFWDAVYSKVSHRIINQMASSYPDLWTY
                     AIQDVYSDLLSYCGVLSHEETSIIVISSLIPQDVNPQLKGHLKGALLNGVDIDVLRET
                     RRLAIQLSEWCGIKWKSEVADLT"
     gene            complement(<732959..>733996)
                     /locus_tag="FOA43_002330"
                     /db_xref="GeneID:62195731"
     mRNA            complement(<732959..>733996)
                     /locus_tag="FOA43_002330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922627.1"
                     /db_xref="GeneID:62195731"
     CDS             complement(732959..733996)
                     /locus_tag="FOA43_002330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778555.1"
                     /db_xref="GeneID:62195731"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00389"
                     /db_xref="PFAM:PF02826"
                     /db_xref="PFAM:PF03446"
                     /translation="MSTASKSLTVLRFGPTRFAQSAWNDLISNYHVKVVESEAHNREE
                     FLKELRSGKFADVDCVTRTFESVKKTGLVDKELISELKKYTQIKVLSHNGAGYDQVDA
                     VSCGEQGIQVSNVIGLVDAATADTHIYLLLSALRNFQLSTINMRDGKWPTAKCGGTPI
                     GHDPEGKTLGILGMGGIGRAIRDRMKPFDLNKIIYHNRHQLSSELEGDAEFCPTKKEL
                     FEQADIISISVPLNGHTQHMINKDTISQMKDGVVIINTARGAIVNEPDLIDALKSGKV
                     ASFGSDVWENEPNPDSQLYMLPNVVALPHMGTHTFETMKAMEEYVVKNVVHYIETGRV
                     LAMVPELKHKF"
     gene            <734318..>735019
                     /locus_tag="FOA43_002331"
                     /db_xref="GeneID:62195732"
     mRNA            <734318..>735019
                     /locus_tag="FOA43_002331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922628.1"
                     /db_xref="GeneID:62195732"
     CDS             734318..735019
                     /locus_tag="FOA43_002331"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778556.1"
                     /db_xref="GeneID:62195732"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR026635"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF13847"
                     /translation="MPPRVSVLGTKKHWDSVYAQEHLNYRNNSKDLGECWYSDSDAEE
                     KIGQFVLDHFKRGKTGGLCDLGTGNGHLLLTLSKMGLLNSNMVGIDYSQDSVSFATDL
                     VNSSSDDQYTGICFYRSNFLLLNDQFLNKSSARFGLIIDKGTLDAIYLSTTKYEDGKR
                     SGIQIYPARVASMMKPAGILLVTSCNFTAKELIKTVTKDGIFKYWTQLHYPVFEFGGF
                     KGSAVNTIAFRLIDR"
     gene            complement(<735041..>736036)
                     /locus_tag="FOA43_002332"
                     /db_xref="GeneID:62195733"
     mRNA            complement(<735041..>736036)
                     /locus_tag="FOA43_002332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922629.1"
                     /db_xref="GeneID:62195733"
     CDS             complement(735041..736036)
                     /locus_tag="FOA43_002332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778557.1"
                     /db_xref="GeneID:62195733"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="PFAM:PF00638"
                     /translation="MSDKSESIKNDDKEEKVETSKFIRKMDDVKSNTENKKRPAEDET
                     SQPVKKSKAKQETPQAETPKTEKPIAETSKTEKPIAEKPKFVFGATTPFGKAGGFGGY
                     ASMKSEKGIFNTETEKKGKNEDQHNNEVSGGKIFGSGSTFGNAFKDAVKKKSIFDESS
                     KKETSQSNEDESSETHLDSVYRTIHLQKKDMKSGEEEESTLYQVKSKLYRMDLTKMSE
                     GWRERGAGMLKVNQLKKPTESYKARLIMRQSGNLKLILNLPIVKNLEIFRGMTSSFSG
                     NKFIRVQTVEEGKPIQYALKIGQVENVSLMYETIMGEIPKEKEDKESGETKSSNA"
     gene            <736808..>739195
                     /locus_tag="FOA43_002333"
                     /db_xref="GeneID:62195734"
     mRNA            <736808..>739195
                     /locus_tag="FOA43_002333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922630.1"
                     /db_xref="GeneID:62195734"
     CDS             736808..739195
                     /locus_tag="FOA43_002333"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778558.1"
                     /db_xref="GeneID:62195734"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036961"
                     /translation="MELQLLLQSSHHAVSDDSHPTIQIADNNPNQIILQGDLSTRFTF
                     NHVYNATGDMDDLKLFENFAKPVIDDHLLKGSDSLLLSIGPSRCGKTSCLFGTPDKSG
                     SGLVAESFRYIFEKIGPVSNNLSQWKPLVSNIREDSVSPLSKSTTVDSNSAVTLSMFE
                     IQNDSIRDLLTSQSRSAKRPKSRSFLGIITDPTDNKLKPYNISQVMVDSAEAATQIVV
                     GKGLGAASDYSNSHRLVFVNVLSCSKDKQKTPISCSRFVIVDLPGFGASTDNSLPQLG
                     RCLELVATKQFNKSLLRTNKLTRFIFHDYVKSLTPLNVLVCLDSHGDSTTILQTLKYT
                     NPIEYVKLRRKSHDAMYYQTKPAPKTSSRVSSIASMASKRIPYKKEGDLSKEIEILNN
                     TKIRLESAVVKLQKEVFSNEANEKNIKELKEAHRHEIEQVQLEERQKLEDAERKLQEA
                     ELRLHEIETKVPETEMKLLNTMAKMHEMEKKMHEVEDASAQLQKIVDEEKEKEVKSKL
                     DIQQLNEDVTRLEKDLSNMKRLDEEKDASIGRTKAEKDKEVKKLRKQLKDLKLEYERK
                     LEKSKASSIDEKKMSAQEKRYEKLSQKYSSLEDEYENYKKQIEEEKEKQHDEYDEKVK
                     ELNTKMKNIHHEVASAALFGSESVKDSLSLSPCDSLGALDELSNNSQVPGILEDDSSK
                     KSPQKSPRKSPRKSPRKSSKKSPSRSASRSPTRSTTKADAARHLTNCEPLIKEPNQQL
                     CEGHLHPLNSSELNKLRPETPIDLKRRSVSPGRASKIKLRRVELDDDDDEEGLSD"
     gene            <739719..>742406
                     /locus_tag="FOA43_002334"
                     /db_xref="GeneID:62195735"
     mRNA            <739719..>742406
                     /locus_tag="FOA43_002334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922631.1"
                     /db_xref="GeneID:62195735"
     CDS             739719..742406
                     /locus_tag="FOA43_002334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778559.1"
                     /db_xref="GeneID:62195735"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="PFAM:PF11951"
                     /translation="MGAMLETRGINAESDESGNGARSSQRRQVPFMRFPSSLLYWYWD
                     DMDNDLEKLEDQNFQGETMLGPFGCFAAVNRYKSDLNLSRPVSLATFSPSISNIINNR
                     VDEKRYSAPIGHSWTSRSHKGSYLPAHMNALFRLSPISTTPSSPIPSNISVASSRECN
                     DEIIPRKIWIHPRFNIDASLTYKVLLGDANAEYKTSQNLQKVVFSDYYGTTDELHCRI
                     VDKFEISDITYTRRFEIRLQEAMEALKIHNPSKESQQTDFQSLLKASLVHDLLRLFVK
                     TSKNLFFLSFKGSILDTLVIPMVYKAVGELLIGSHGTKMYDDVIDESDEKDQEKNRVP
                     SRLYCIILHQSLILLALSIASFNQYSLLFNSFGTYQGSLDYLKCCIAFREISLMNLAR
                     IIIPLIGDYSEDEPIIVLNRTLLDKLVSLGLAEELLVTLILAIKQDESLNIILNYKLL
                     YAVLQGVREYFIGLQLDDSGLESVLVWSKYMYFFYFATATIDVAHYQIKEPGFEDLNE
                     NYNLIENFQFDDSFEHSEYAKIEINAHQEKSKGEEEDEQELERATLPKRLANRPPVED
                     KPPRSFTVKFRFNEEQESEDGGYEGESSGEDAHEKSSSSFPWRSLNEKTIINHNGDKV
                     SVLTGLSIKPSKKILKEELLKTGEMKQIDIKVPFEVDKTGEISSLEISYGIPTSLLDL
                     MIRTVTISNHKNWFQRKKAFPRNFPKFCCDLEEDLMTWKLPWNLYSQDDVVTNKSAHL
                     KFHSLFHETLHNLIFCFYNSILMFFFRIIKDTDPSLLQDYVESTLYHLEELQRISLDP
                     EFSKKVQISLPFWCFFICGSDAVSHSLQSKYDNLGRIWSGVGDKWIGKQMVMEIWRGR
                     NYGISIDEQMEESDRDASEEDKETSWLDMIKGWEMSGFH"
     gene            complement(<742458..>745200)
                     /locus_tag="FOA43_002335"
                     /db_xref="GeneID:62195736"
     mRNA            complement(join(<742458..744946,745194..>745200))
                     /locus_tag="FOA43_002335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922632.1"
                     /db_xref="GeneID:62195736"
     CDS             complement(join(742458..744946,745194..745200))
                     /locus_tag="FOA43_002335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778560.1"
                     /db_xref="GeneID:62195736"
                     /db_xref="InterPro:IPR001902"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR036513"
                     /db_xref="PFAM:PF00916"
                     /db_xref="PFAM:PF01740"
                     /translation="MKTSEKSEAREIINERYSTYDTSSGSDSLLPTYDSITENFEEGL
                     EVQGYHEDLIGVKEYARNIIRHPGRKVVNYLHSLFPIVDWIAYYPFKPSWIYSDFVAG
                     LTVAIVLVPQGMSYAQLAQLSPEYGLYSSFVGLMIYAFFATSKDVSIGPVAVMSLEVG
                     KIIIRVQNKYGDAYTASEIATTLALLCGAITLGIGLLRIGFLIELIPLPAILAFMTGS
                     AFNIMVGQIPGLMGFNKAVNTRQASYKVVINILKNLHKTKVDAAFGLVCLFILYAWRY
                     LAALLYKHHPKNKLFFYLQHIRAAVVIIFATLISYLIIKSYPSGEKPPFSIIGVIKSG
                     LGDVALFRPPAGLARDLTSELPVATIVLVLEHISISKSFGRLNDYQINPNQEFIAIGV
                     TNLIGTFFHAYPATGSFSRTALKSKCGVRTPFAGIFGGSCVLLSIYCFTSAFYYIPKA
                     ALCAIIIHAVSDLMTPWRVTWNLLKVSPIDCGIFVVGVFVAVFSAIENGIYFAIAAAA
                     AHVLWNLCITNGVFLGRIKVTEAVNPIIRRKGQPSSSSNDPSSVQIVSHYKWIPLPNY
                     AENPSKVHIRYINNRLNVESPPPGVVVYRLSESFIYPNCARQADTILNEIKTKSKDCR
                     LNREATWNNPGVLEVKNPFRGSITAIKQVAGRITSKAKREQYRIEQEEKGITDETTLR
                     FNPDDHRPELKVLHLDFSQVSSIDTTSIQALIDLKKAITLHSGYDFEIHFSGIVNPWV
                     IRGLVNAGFGGQSDQGRTTSSSPRETVPDEESQPDTDEPMSLIEIANKPQADVNKRRY
                     LDVGIEEGKLKAIYDNRHPHFHFDIPSYSEFDL"
     gene            complement(<745511..>746902)
                     /locus_tag="FOA43_002336"
                     /db_xref="GeneID:62195737"
     mRNA            complement(<745511..>746902)
                     /locus_tag="FOA43_002336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922633.1"
                     /db_xref="GeneID:62195737"
     CDS             complement(745511..746902)
                     /locus_tag="FOA43_002336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778561.1"
                     /db_xref="GeneID:62195737"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010111"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00266"
                     /translation="MSLQDKAKQLDEQFPTHKELFAFPTFESMGLKDPAQRADSSKKT
                     LLSPVNYLCGNSLGLMPKSTVEAVNNELKAWAMRGVESHFRHPMESDGLTNWVNIDLP
                     VIPLLAEIVGAKEQEVACMGTLTMNLNSLLCSFYQPTGSRYKILFEKHAFPSDYYAML
                     NQVKLHGYNEEALIQLAPRKGEFFLKTEDILETIENEGESIAVVCFSGIQYYTGQYFD
                     IARITEAAHVKGCVVGWDLAHAVGNVDLQLHEWNVDFAAWCSYKYLNSGPGGIGGIFV
                     HERLFHDQQWKPRLAGWWGNNSSVRFKMLEQFDPIPGALGFRQSNPSVIDVVSLRSSL
                     ETYKKCGGIKALREKSKALTKYLETLLENSIYYRDAEHSLDAKPHFNIITPSNPDSRG
                     AQLSLLFAPHYQDSQKNVMQSIFKFLNERGVICDDRKPDVIRLAPVPSYNSFSDCYDS
                     VKLLNEAFEQYAD"
     gene            <747501..>748160
                     /locus_tag="FOA43_002337"
                     /db_xref="GeneID:62195738"
     mRNA            <747501..>748160
                     /locus_tag="FOA43_002337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922634.1"
                     /db_xref="GeneID:62195738"
     CDS             747501..748160
                     /locus_tag="FOA43_002337"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778562.1"
                     /db_xref="GeneID:62195738"
                     /translation="MLSTQFLISLLVTLAATNASPVADPIAEALGFAKPADASYDCHS
                     YCGNAIIQARDCSPDGNTDGDYDASCLCSSGSSFLALVPDCLDCGWCLWSDYGQYLTS
                     ALSECSTSTEPTGSTCAVSATTDAAGTTAQSTSAAASSAAQSTYAAGTAAQSTSAVIS
                     SAAQSTSATFAISATSAATSASASSASASSAVQTYTGAANKISVSVTGAGLIGALALF
                     M"
     gene            <748494..>749111
                     /locus_tag="FOA43_002338"
                     /db_xref="GeneID:62195739"
     mRNA            <748494..>749111
                     /locus_tag="FOA43_002338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922635.1"
                     /db_xref="GeneID:62195739"
     CDS             748494..749111
                     /locus_tag="FOA43_002338"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778563.1"
                     /db_xref="GeneID:62195739"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PFAM:PF07716"
                     /translation="MTTRSRSEHSENGIDKDNEDSDERISLADSDFGGSVATSVSSGS
                     SNNEKDDLEMFSGNNFVSLDPQREAEEGIEEDNIIDTSIDGRTHRRAAKSDLERRKRN
                     TEASARFRIKRRLKEHEMSERLSKMWSHISEMKIKVKTLEMENQCLKRMLLGDTGMAV
                     PRDGVERSTRTGKALDKLSLSSLSNYELLNLIKQKTSESFKITSI"
     gene            <749397..>750569
                     /locus_tag="FOA43_002339"
                     /db_xref="GeneID:62195740"
     mRNA            <749397..>750569
                     /locus_tag="FOA43_002339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922636.1"
                     /db_xref="GeneID:62195740"
     CDS             749397..750569
                     /locus_tag="FOA43_002339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778564.1"
                     /db_xref="GeneID:62195740"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR036938"
                     /db_xref="PFAM:PF01569"
                     /translation="MPLDQPPDFKELANTSDMDAGLKPESFYKARMNPIRFRIRHVLV
                     RLVLSESPSLAAIQQNLRCKVLDYYFLYSANLGAHMFYVLMCPLPAWLGHTDILRDSV
                     QILGWGIFMTGCVKDFLCLPRPISPPLKRLTLSHYTAQEYGCPSSHTANATSVCLLIL
                     RLVWINWSENTPFFNYIVTFLTVFYLSTMVLGRIYCGMHGYIDLAIGALVGIVVFVLR
                     LWLIGDQWDHWVLDTSSRLVPVTTTLIYYTLVYLHSVPLDACPCNEDSVSFMGVLMGL
                     DAIHWLVANYAQAYTPIGYRPEEIPFYYEKLGPVKTILRLIFGVSTVVLWKTVSKPVL
                     MKLFGAKKQYIEKGHIVGYASKPRTDPEIFVRLIVYAGIPTMVVLQKFLFPLVGLE"
     gene            complement(<750933..>751678)
                     /locus_tag="FOA43_002340"
                     /db_xref="GeneID:62195741"
     mRNA            complement(join(<750933..751009,751072..>751678))
                     /locus_tag="FOA43_002340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922637.1"
                     /db_xref="GeneID:62195741"
     CDS             complement(join(750933..751009,751072..751678))
                     /locus_tag="FOA43_002340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778565.1"
                     /db_xref="GeneID:62195741"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MDCYFIQPIGSGNTYRLLDSNADVKPDANLQFKIVIVGDSGCGK
                     TSLFTSYIRGYFPTDYEPTIFENHRAFVSKQNTSEVLTVDLWDTAGQEDYERLRRLSY
                     QDANLIILAYSLSSRESLLNIPEVWAPEIINFCTNTPILLVGLKADIPVHQVDPYDAL
                     KVAKNIGAVAHMQCSAKQMFNVEPLFDVCFNIVYNGKKQNSSTEQYNEEFEFDYRRAK
                     KKETGISGG"
     gene            <751971..>753725
                     /locus_tag="FOA43_002341"
                     /db_xref="GeneID:62195742"
     mRNA            <751971..>753725
                     /locus_tag="FOA43_002341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922638.1"
                     /db_xref="GeneID:62195742"
     CDS             751971..753725
                     /locus_tag="FOA43_002341"
                     /note="BUSCO:EOG09342R77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778566.1"
                     /db_xref="GeneID:62195742"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR030390"
                     /db_xref="InterPro:IPR030391"
                     /db_xref="PFAM:PF05958"
                     /translation="MSSQTSSGPPVKRTSSAVSPESVLDSSNSSTAKKPKIESTHKRK
                     SRRGRKGSKRQQKQRQRLDPDPTTTEGVLTKYTIPLLMKQYDNNHGVSKDQLIVNDGT
                     MNWLLKDQVVDNVKILIMDVQGDGVAIVELPSHPDKKVICVIPFGIPGDIVKIKLNQL
                     IRIENGIGYCKADLLHVINPSQLRLAEDQIPCKYFGICSGCQLQSLDYSTQLQLKRRT
                     IVNAYRFLMDESLRSREKIEDKIGQTVGSPLLVGYRTKLTPHYDLLDMKADPPKIPSI
                     GYEAKGRPEWRVMNENQTRVVDIEDCIIGTPIVRKGLANERTRLSKKFDQEGSIGKKG
                     ATILLREDTVPKPDSKDDEMNLNGSRDTDHDDTVSTIPCIVKDQPYIKTCVTDHNSTV
                     HEYVNGLEFRFLANEFFQNNNSILPLVIDYVQKKLNFGEGRDSYLVDAYCGSGLFSIS
                     SAKSVKRILGVEISAQSIKFAKLNAELNHIDNCEFIAGKAEKLFDQIDFPRDQTSVIL
                     DPPRKGCDKVFLDQLSQFLPKRVVYVSCNVHSQARDIQSFLTETENGSKYHVESIRGF
                     DFFPQTYHVESVAVLERE"
     gene            complement(<753980..>754267)
                     /gene="NHP6"
                     /locus_tag="FOA43_002342"
                     /db_xref="GeneID:62195743"
     mRNA            complement(<753980..>754267)
                     /gene="NHP6"
                     /locus_tag="FOA43_002342"
                     /product="Non-histone chromosomal protein 6"
                     /transcript_id="XM_038922639.1"
                     /db_xref="GeneID:62195743"
     CDS             complement(753980..754267)
                     /gene="NHP6"
                     /locus_tag="FOA43_002342"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="Non-histone chromosomal protein 6"
                     /protein_id="XP_038778567.1"
                     /db_xref="GeneID:62195743"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR036910"
                     /db_xref="PFAM:PF00505"
                     /db_xref="PFAM:PF09011"
                     /translation="MARKGTRKKKDPNAPKRSLSAYMFFANEQRDIVRAENPGIAFGQ
                     IGKILGEKWKALDIKNRGPYEAKALTDKKRYELEKAEYLKTKAAAAAAAAE"
     gene            complement(<755366..>758021)
                     /locus_tag="FOA43_002343"
                     /db_xref="GeneID:62195744"
     mRNA            complement(join(<755366..757702,758013..>758021))
                     /locus_tag="FOA43_002343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922640.1"
                     /db_xref="GeneID:62195744"
     CDS             complement(join(755366..757702,758013..758021))
                     /locus_tag="FOA43_002343"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778568.1"
                     /db_xref="GeneID:62195744"
                     /translation="MVIVDTTPAVNGQHRHITRRGGPNQRYRAGPGGGQVGGQVGGQG
                     QGSDFSSLRPELKKKFETLTELFPEWTVKDFVSIKDEISNQDISEISDGILTGSIHKW
                     APVVRKEERKRERAERAAAAAATAAIAGSHITGTHTSAFMNNDQRHRFHRGGFSAPRN
                     RHREYTQASPPTSTTTTTTTTTTTPALSTATNGSSSRVTRTTGGTIPHRGSSWASALS
                     KPEAKELKKEEGEVKKEEKKVELEKGVVEEAKDTVTDSKEAKETSRQPKKYVKQQNKE
                     IPRPSKAKAMTWADALAPKKVTKKPEAEKRVEEEVKQEPEDNIEESVEVAEITSPVNS
                     RVKSAKRKQQQVVLPISAEKLGAMDGISFGSMSLEDKDDKTREAVASAPVTPVTPADQ
                     SVVQPLTPAAAPTAATSQTVTSAATVSSAAPTQQYLLNQQQQQYLQRAQAAQAAQVAQ
                     VAQAAQAAQPAQPAQPAQQPISTVPTAQQAEFGVAASPATASALPNASSTGSVNPMMG
                     LPASYYPYFNYYMPFYQQPSAAPANQYYLNYQNAQSQQAFGNGFQNKLYGQYQQQAQQ
                     AQQAQQAQQAQQAQQAQQAQQTQSPQTAQTVPNGGKSASSSSQHAHQYPQQAQQAQQA
                     QQAQQSQQQQQQQQYPQQYSQYQQYQQYQQYQQYQQQAQQAQQAQQAQQVHAEQIGDQ
                     QGQPRAQQAEQAEQAQRAQQAQLVQQAQQAQQAQQAQQAQQAQQAQQGLTGANRVNGA
                     NGANGANSTNGANGANEYPYYQSQYQQYPGVNDYSANRGWF"
     gene            complement(<758122..>759204)
                     /gene="FBA1"
                     /locus_tag="FOA43_002344"
                     /db_xref="GeneID:62195745"
     mRNA            complement(<758122..>759204)
                     /gene="FBA1"
                     /locus_tag="FOA43_002344"
                     /product="Fructose-bisphosphate aldolase 1"
                     /transcript_id="XM_038922641.1"
                     /db_xref="GeneID:62195745"
     CDS             complement(758122..759204)
                     /gene="FBA1"
                     /locus_tag="FOA43_002344"
                     /note="BUSCO:EOG09342PCV"
                     /codon_start=1
                     /product="Fructose-bisphosphate aldolase 1"
                     /protein_id="XP_038778569.1"
                     /db_xref="GeneID:62195745"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF01116"
                     /translation="MTLDFLSRKTGVIVGDDVKNLFKYAHEKGFAIPAINVTSSSTAV
                     AALEAARDANSPIILQTSNGGAAYFAGKGVSNKDQKASIAGAVAAGNYIRSIAPTYGI
                     PVILHSDHCAKKLLQWFDGMLAADEAYYKEHGEPLFSSHMLDLSAENDDYNISTCAKY
                     FKRMAKMDQWLEMEIGITGGEEDGVDNGHVHKSALYTSSETVFSVYEALAPISANFSI
                     AAAFGNVHGVYKPGNVVLQPKLLGEHEKYAKAKLGTKEDKPLFLVFHGGSGSTEQEFK
                     TAIDLGVVKVNLDTDTQYAYLTGIRDYVLKYKDYIMSQVGNPEGADLPNKKYYDPRNW
                     VREGEKTMSARINKALITFNAVGQLN"
     gene            complement(<760921..>762045)
                     /gene="ADH4_1"
                     /locus_tag="FOA43_002345"
                     /db_xref="GeneID:62195746"
     mRNA            complement(<760921..>762045)
                     /gene="ADH4_1"
                     /locus_tag="FOA43_002345"
                     /product="Alcohol dehydrogenase adh4"
                     /transcript_id="XM_038922642.1"
                     /db_xref="GeneID:62195746"
     CDS             complement(760921..762045)
                     /gene="ADH4_1"
                     /locus_tag="FOA43_002345"
                     /codon_start=1
                     /product="Alcohol dehydrogenase adh4"
                     /protein_id="XP_038778570.1"
                     /db_xref="GeneID:62195746"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF13602"
                     /translation="MLKLLPLRTLRASTLCTRRTLLLRTYASIPETQKAIVFYKNGGP
                     LKYEDIPVPKPKPNEILVNVKYTGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVAK
                     GSEVKTFEIGDYAGIKWLNSSCMSCEFCIQGAEPNCAQADLSGYTHDGTFQQYATADA
                     IQAAHISKGADLAGVAPILCAGVTVYKALKTADLRPGQWVAISGAGGGLGSLAVQYAK
                     AMGLRVLGIDGGMEKCELATKLGAEEFIDFTQVKDMVKAVQEATNGGPHGVINVSVSP
                     KAMSQSIEYVRTLGKVVLVGLPADAVVHSKVFEHVLKSIQIKGSYVGNRLDTAEALDF
                     FDRGLVKSPIKIVGLSKLQEVYELMEQGKIAGRYVLDTSK"
     gene            complement(<762254..>763297)
                     /locus_tag="FOA43_002346"
                     /db_xref="GeneID:62195747"
     mRNA            complement(<762254..>763297)
                     /locus_tag="FOA43_002346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922643.1"
                     /db_xref="GeneID:62195747"
     CDS             complement(762254..763297)
                     /locus_tag="FOA43_002346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778571.1"
                     /db_xref="GeneID:62195747"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="InterPro:IPR033647"
                     /db_xref="InterPro:IPR033648"
                     /db_xref="InterPro:IPR038514"
                     /db_xref="InterPro:IPR038516"
                     /db_xref="PFAM:PF05282"
                     /translation="MNATISLNITDINFQVGIDFLFFDVKSYSRFKGIKLIPSGCHLL
                     HITNVLTNTRIGRFVNFEKNDFVEMSFDPETETIELKTTDRITTDEQTYITKMVNYKS
                     QSEAKAQIIQSRLLNVDYKKFIDNDKNQVTSNDPTPIESLKLDEEIMKKHRQDGRKDH
                     KFVDKLLQDLEKLNSNQLKLSIIDGNDKRTFVRDGSKDRTKDYLDRTWLINKLHGGSF
                     EGFIEEFKFCFLMTIIINNYGSYLQWKTLMDLFLNSIGILNHKTEESKELMEIIKIQL
                     QVITSLRVGEEEEQPKGEFFQVDLSELHRSFKECLLNMDTVEDVGLKFRYNEIIGILN
                     GLGLDVCDELSEE"
     gene            <763412..>764890
                     /locus_tag="FOA43_002347"
                     /db_xref="GeneID:62195748"
     mRNA            <763412..>764890
                     /locus_tag="FOA43_002347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922644.1"
                     /db_xref="GeneID:62195748"
     CDS             763412..764890
                     /locus_tag="FOA43_002347"
                     /note="BUSCO:EOG09341J2R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778572.1"
                     /db_xref="GeneID:62195748"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR018027"
                     /db_xref="InterPro:IPR023168"
                     /db_xref="PFAM:PF02637"
                     /db_xref="PFAM:PF02934"
                     /translation="MSHQLKVGLEIHTQLKTARKLFSLSHNNTSILLTKPNSQVSFFD
                     VSLPGTQPRLNPQVVLYALKCAIAMNCRINAVSRFDRKHYFYGDQPLGYQITQRYHAL
                     ANEGKVVLSKKYDGLPHDTTIGIEQIQIEQDTGRSLYKLGDGSTDVDFNRSNIPLIEM
                     VTKPDFEDVEQVRSFIKKYSRMLQNLDVCTGELDTGAIRVDVNVSIDKYPRIELKNIP
                     TTSAIVNAIRYEYKRQCDVVNEGGSIRDVETRGWDGKRTYRLRSKEDSIDYRYMPDPE
                     LPALKLDIADILPKLKKTLPLSVERKMDKLMTQYGLKLRDANILLNDPILLRYYLDLY
                     DEVYSKRSLHNMDNPINWLVHDFMGCLSKSNLKFSYNILSVKEFAEFLELIDNGTVTK
                     QNAKLLLMHLVNNRNDQKVPLTKLVNDFNMNSVNDDESQDKLIEEICNKVINGNSKVL
                     KDIVERGKQSKINYLIGQCMRACRGRIEAPKFEKQLKRKILE"
     gene            complement(<764935..>765351)
                     /gene="ATG8"
                     /locus_tag="FOA43_002348"
                     /db_xref="GeneID:62195749"
     mRNA            complement(join(<764935..765257,765318..>765351))
                     /gene="ATG8"
                     /locus_tag="FOA43_002348"
                     /product="ubiquitin-like protein atg8"
                     /transcript_id="XM_038922645.1"
                     /db_xref="GeneID:62195749"
     CDS             complement(join(764935..765257,765318..765351))
                     /gene="ATG8"
                     /locus_tag="FOA43_002348"
                     /note="BUSCO:EOG09344G0Q"
                     /codon_start=1
                     /product="ubiquitin-like protein atg8"
                     /protein_id="XP_038778573.1"
                     /db_xref="GeneID:62195749"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PFAM:PF02991"
                     /db_xref="PFAM:PF04110"
                     /translation="MRSQFKDEHPFEKRKAESLRIRTKFQDRVPVICEKVEESDIPEI
                     DKRKYLVPSDLTVGQFVYVIRRRIHLPSEKAIFIFVNDILPPTGALMSQIYDQYKDDD
                     GFLYVLYSGENTFGKV"
     gene            complement(<766301..>766855)
                     /locus_tag="FOA43_002349"
                     /db_xref="GeneID:62195750"
     mRNA            complement(join(<766301..766631,766851..>766855))
                     /locus_tag="FOA43_002349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922646.1"
                     /db_xref="GeneID:62195750"
     CDS             complement(join(766301..766631,766851..766855))
                     /locus_tag="FOA43_002349"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778574.1"
                     /db_xref="GeneID:62195750"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /translation="MSDNSGNTICNACGLYYRLHGVYRPVRLKKGIIKRRKRNRNKSS
                     EEELEQTSLQSTELPEKFTSRDSEHMISPYTPRTMAVDFTKSFQEPRKVMKVESLLNE
                     EEQAERPRR"
     gene            complement(<767803..>769074)
                     /locus_tag="FOA43_002350"
                     /db_xref="GeneID:62195751"
     mRNA            complement(<767803..>769074)
                     /locus_tag="FOA43_002350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922647.1"
                     /db_xref="GeneID:62195751"
     CDS             complement(767803..769074)
                     /locus_tag="FOA43_002350"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778575.1"
                     /db_xref="GeneID:62195751"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /translation="MDASHYEYSGYSIGLPEENRFVLADNKNGLLHLFKGKVKDSQVF
                     QCVVVNGKCVFDVCGSCLVYRQADNSWESTRITPVKLSGKAGLLNKLLSDLSATTFDS
                     LGLFAEVSQLKLKKLFNDPNLRQDDHNLTRYRDVVSKMFNTKRPDSAHMVAIDLNTLK
                     PLFRFVLPDGCSKLSLSPFDAQLVTASERGDTLSLWDFTCYQNCLMLMNRFERGKTSS
                     VIYQICWLPNDRGIIALSLPNGSIHYFGNDTTEKGSEDVWCLSSFGAQSIATGPADYS
                     ILLARKNNSIMLIDLKDISNVWSLCIPENVSLNGLNVSSSGSKTSNKPTINLAVNIEV
                     ETYKAFPALYTNPGMHFARINANQWDTIKDLSRFGDCLGVKTKEVVIAGGIKTIQTAE
                     EDAKEDAKEDAKEDAKEPINEEPTDQTKNIQ"
     gene            <769917..>771533
                     /gene="CCT6"
                     /locus_tag="FOA43_002351"
                     /db_xref="GeneID:62195752"
     mRNA            <769917..>771533
                     /gene="CCT6"
                     /locus_tag="FOA43_002351"
                     /product="T-complex protein 1 subunit zeta"
                     /transcript_id="XM_038922648.1"
                     /db_xref="GeneID:62195752"
     CDS             769917..771533
                     /gene="CCT6"
                     /locus_tag="FOA43_002351"
                     /note="BUSCO:EOG09341HOV"
                     /codon_start=1
                     /product="T-complex protein 1 subunit zeta"
                     /protein_id="XP_038778576.1"
                     /db_xref="GeneID:62195752"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PFAM:PF00118"
                     /translation="MSSSAIQFLNPKAESLRRQQALQVNIAAAEGLQDVLSSNLGPKG
                     TMKMLVDGSGGIKITKDGDVLLKEMQIQSPTAVMIARAATAQDDVTGDGTTTVVLLVG
                     ELLRQAEIYLNEGIHPRVITDGYEKARAAALEFLNQFVIPKPAETVDRELLLQVARSS
                     LSTKVDAELASVLTPIVTDAVLSLRDDKNPEDVDLHMIEVIPMMHETAKDTELVKGLV
                     LDHGARHPDMPKRVENAYILTLNVSLEYEKTEVNSGFYYSNAEQREKLVQSERKFVDD
                     KIKKIVDLKNEVCGEDPSKGFVIINQKGIDPMSLDILAKNNILALRRAKRRNMERLQL
                     CCGGTAMNSVDGLTPEVLGYSGLVFEKTLGEEKFTFVTEVQNPKSVTVLIKGAHNYVV
                     LQVKDAVRDGLRAVNNVLKDHNLVPGAGAFWMSCSKHLLENKEVSKGRSKPGVKAFAE
                     ALLVIPKTLAKNSGLDSLESLSECQDEIDQGEVVGLDLESGEPIDPTLEGVWDSFRVI
                     RNAISGATGIASNLLLCDELLKAGRSSLKN"
     gene            <771743..>771996
                     /locus_tag="FOA43_002352"
                     /db_xref="GeneID:62195753"
     mRNA            join(<771743..771751,771799..>771996)
                     /locus_tag="FOA43_002352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922649.1"
                     /db_xref="GeneID:62195753"
     CDS             join(771743..771751,771799..771996)
                     /locus_tag="FOA43_002352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778577.1"
                     /db_xref="GeneID:62195753"
                     /translation="MEKLVFADEEPEETDEDDDEASISLKKSAPIGEFDLWDVASEVK
                     REEDEMEEKEVRRGGGTDVSSGRD"
     gene            complement(<772639..>774033)
                     /locus_tag="FOA43_002353"
                     /db_xref="GeneID:62195754"
     mRNA            complement(<772639..>774033)
                     /locus_tag="FOA43_002353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922650.1"
                     /db_xref="GeneID:62195754"
     CDS             complement(772639..774033)
                     /locus_tag="FOA43_002353"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778578.1"
                     /db_xref="GeneID:62195754"
                     /translation="MSLACRLLNLTNCGNEESVFRKYDLSNEETVYSALVSQHHRDTE
                     NGSTDVSKDRDATVNTLSALFLDEHGVSKRIDSGNKMVDALKLTMLLERALADNHNKA
                     EILNLSEITMIKTRVEQLGKIRAEKLKEINDETLSEVDEQIQRYETKLQNHLVGLAKF
                     GYFKDFLISSEDSIRQNIETVGSKAEDRLEKSLEDLVSSVISLSIQHGVALPEPDLER
                     MKDFIGRIEWCRECIDKLVSGIAGEPIKVHNKVMARSNSAATHSPVAASNSSSKIELK
                     RALNDLQFAHVYLTRQYEDERSRYNKSLNQLRLKLSQSQELLSCSNEQLTNQTQQSLK
                     LEMKLNDALNELREKKKILHAKSLEINMLKVDKIGERSTSSTNNGDENSSNACPSKDN
                     STVSAPILRMQFKNLVQQMNEDFEKELEKERVERKRLEELVKLYEKGSTGRRNTSASA
                     SGSLLTPASSSPTV"
     gene            complement(<774223..>775287)
                     /locus_tag="FOA43_002354"
                     /db_xref="GeneID:62195755"
     mRNA            complement(<774223..>775287)
                     /locus_tag="FOA43_002354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922651.1"
                     /db_xref="GeneID:62195755"
     CDS             complement(774223..775287)
                     /locus_tag="FOA43_002354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778579.1"
                     /db_xref="GeneID:62195755"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF00962"
                     /translation="MTMTESMKNFLRDLPKCEHHVHLEGTLEPDLLFHLAKRNNLTLP
                     SGFPSTIEDLQYKYEHFKDLQDFLDLYYAGMSVLLTEQDFEDLAWAYLVKSHDQGLKH
                     VEAFFDPQGHVERGVDMHCVIKGFNKALSRAENEFGMSTKLIMCILRHLPTKNSLETL
                     KNFKPYYEKGWIDGLGMDSTEVGFPPELFEECYAYAKDNLPEGTLLTAHAGEEGDSSV
                     VTRSVNRLNVSRIDHGIHSADDPEVMKMLADNDIMLTVCPLSNKRLNVVQEISEEPIR
                     KFLEYGVPFSINCDDPAYFGGYILDNYMAVQEAFNFDMDTWITIAKNSVRGSILDTER
                     KQVLYDSITDCYKRYADLED"
     gene            complement(<775568..>776443)
                     /locus_tag="FOA43_002355"
                     /db_xref="GeneID:62195756"
     mRNA            complement(<775568..>776443)
                     /locus_tag="FOA43_002355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922652.1"
                     /db_xref="GeneID:62195756"
     CDS             complement(775568..776443)
                     /locus_tag="FOA43_002355"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778580.1"
                     /db_xref="GeneID:62195756"
                     /translation="MDYSLFYEDWTLAIAARAQLELVRPFRVVLGFANSLLTGDLFYY
                     PAKGIQLFIEDWQNILPLYISLTFPLVLVQSVLRALCFVLLLPANILVLTITCGPLGL
                     SIALAITNEESISLADLLTSCFLPDSEIKQAKYNALFDHILCLTGNEQIVFPGKLQRV
                     VNNSPTAELFNVSKYIQFWYNLITWNSTKLLPVVGAPLLAYKVFVENVNKRMSRLFRL
                     QRLRKRQVGYYHLKEREGELLALGVSMGILESIPFIGQSFFSFTNTIGLAYMCGKRLN
                     TNLNVLVIPKSVEKK"
     gene            complement(<776695..>777485)
                     /locus_tag="FOA43_002356"
                     /db_xref="GeneID:62195757"
     mRNA            complement(join(<776695..777023,777434..>777485))
                     /locus_tag="FOA43_002356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922653.1"
                     /db_xref="GeneID:62195757"
     CDS             complement(join(776695..777023,777434..777485))
                     /locus_tag="FOA43_002356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778581.1"
                     /db_xref="GeneID:62195757"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="InterPro:IPR038716"
                     /db_xref="PFAM:PF00428"
                     /translation="MGSQDCRAVEDVRVKVLVKYLAAYLLLTKAGNASPSKDNISKVL
                     EAAGIEVESDKLDKLFSEVEGKTAEELIAAGNEKLSSVAASAPAAGSASGSASAAEGD
                     AAEEKEESEEEEESDGDMGMGLFD"
     gene            <777671..>778345
                     /gene="RPS15"
                     /locus_tag="FOA43_002357"
                     /db_xref="GeneID:62195758"
     mRNA            join(<777671..777689,777939..>778345)
                     /gene="RPS15"
                     /locus_tag="FOA43_002357"
                     /product="ribosomal protein S15"
                     /transcript_id="XM_038922654.1"
                     /db_xref="GeneID:62195758"
     CDS             join(777671..777689,777939..778345)
                     /gene="RPS15"
                     /locus_tag="FOA43_002357"
                     /note="BUSCO:EOG09344BTM"
                     /codon_start=1
                     /product="ribosomal protein S15"
                     /protein_id="XP_038778582.1"
                     /db_xref="GeneID:62195758"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="PFAM:PF00203"
                     /translation="MSEVSAVHKKRNFKAFSFKGVDLEDLLSMSTEDFAKLCGARVRR
                     KFSRGLDSKPMGLIKKLRKAKLAAGETEKPALVKTHLRSMIVVPEMIGSLIGIYNGKV
                     FNTVEIKPEMVGHYLGEFSITYNPVQHGKAATASKLKLY"
     gene            complement(<778391..>779221)
                     /locus_tag="FOA43_002358"
                     /db_xref="GeneID:62195759"
     mRNA            complement(<778391..>779221)
                     /locus_tag="FOA43_002358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922655.1"
                     /db_xref="GeneID:62195759"
     CDS             complement(778391..779221)
                     /locus_tag="FOA43_002358"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778583.1"
                     /db_xref="GeneID:62195759"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="PFAM:PF08598"
                     /translation="MDDMEDKESDLERLSKDKKEETGKEQGNESDEEMEEADEEEEIE
                     EKKKEAEEKREIEEKREGEENEREQFRTGALNELKDIEIEFATLKDKLYETQLKKLEL
                     ELKLCEMNKHPDFLYFMKMIDENFKGQIERSINLQKYRLRCLNSQTGAYRVQIHQQFI
                     RNCEDLKYGQIRKITSDWYEINKERRTMDTASLQTPEYYQYNENITADNVESQESISK
                     LVRQRNSVYKEIGNMQALIKYQKVFPSSLNNLEGCDSQDMAQDLRQMNIKPSHHNNKV
                     "
     gene            complement(<779408..>780739)
                     /locus_tag="FOA43_002359"
                     /db_xref="GeneID:62195760"
     mRNA            complement(<779408..>780739)
                     /locus_tag="FOA43_002359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922656.1"
                     /db_xref="GeneID:62195760"
     CDS             complement(779408..780739)
                     /locus_tag="FOA43_002359"
                     /note="BUSCO:EOG09343SSW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778584.1"
                     /db_xref="GeneID:62195760"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MSGISNLFGKGTKDEKVSGLFSKPSKIDTKSLVKEKKRHVIEIA
                     EEVDEEEEKQLRKQEKKLKRRERKHKDAEDTSMEDKYMSKLVEEEDRETEEQEKKDRE
                     TEEEEKKDRETLEEKSPETVSEKNSEASDFISSQKPAMPAITMDFKAKELSKADRTIF
                     VGNVPAEAMSSKKDTKRFKRVFSDFVKKSPEEEYQPIESMRFRSIHTDTNAPRRAAFI
                     TKAIEEGGVVNSYIVFKKEEDSMKALKLNGVIYENHHLRIDHLTHPMKHENKLSVFVG
                     NLDFEETEESLWKYFEDKLGDKEDKEQKTVWNVRIVRDSKTNYGKGFGIVQFTDMNYV
                     ERALLLDGKKLTTSKKPRRLRIARCKSIKKVEERGERRKKRTRDHFDNILNDKQKSTV
                     GRARKVLGKRDRREAGMPVLEGQRAHEGSRIEGITNKRRKVKKPRTKKRLN"
     gene            complement(<780893..>782485)
                     /locus_tag="FOA43_002360"
                     /db_xref="GeneID:62195761"
     mRNA            complement(<780893..>782485)
                     /locus_tag="FOA43_002360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922657.1"
                     /db_xref="GeneID:62195761"
     CDS             complement(780893..782485)
                     /locus_tag="FOA43_002360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778585.1"
                     /db_xref="GeneID:62195761"
                     /translation="MFKLISRTCRRPNLIGILNRPFLYRNVVSIASFPPKSKNSDENS
                     QPKSDADETSKASLAGTSDIKPILQQIEKIQHPRGHASSTPYRQRTDTAMDELVKEFF
                     AYTEQKAEQDVDSFYDDFFYNCRETHKGFTLFNNGLPSAPSFVDRPDADEIINKYLTY
                     ATTGRYPKKQLAQAMEKLSEYLSDLDVLSKLDKGTLTSIMNFYNRLHNPKIIQNFISN
                     KLQYTQFQKDPMPFNYLLYSTGRMSKMDPLSKITIARNTIKKMSQLEVPVTMSTWQCV
                     YQLLNPDHSKAVLDAMISRNFELDKMLWRILEKSKKQFPTCGEFLEFVKTNKKCFQNF
                     TDDELLKVYSFYNNLDGVSELLEKFAGENQLKTVHLKTLNTRFIYNNQIYSSISLIRF
                     FQDNESNIPGNLRKQLFSNMLIGYLDHCTPDREESSSQQFLIMFVRFLFNRSLQSERL
                     ERRISDKLGKEFLDKIYETPPPSEEEAEGDGSDVDKAFAMQINKTLRWYDNQVKLRLE
                     DNATDYQQLVREYIYPELNEKE"
     gene            <782854..>784413
                     /locus_tag="FOA43_002361"
                     /db_xref="GeneID:62195762"
     mRNA            <782854..>784413
                     /locus_tag="FOA43_002361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922658.1"
                     /db_xref="GeneID:62195762"
     CDS             782854..784413
                     /locus_tag="FOA43_002361"
                     /note="MEROPS:MER0002481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778586.1"
                     /db_xref="GeneID:62195762"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR004134"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF03051"
                     /translation="MGNTPSQPPHKSPTYTYYARSAGSEDDELLLKLQSMLLSDSEEN
                     HTRNGSNSTQNGKSVSPDSNPITIDKLYEWKEELLADPKNQLALNCFTGNDLSKIIAK
                     TAKINKNNQDLFNVTVKYEGKPITNQKSSGRCWLFASTNVFKEFVKGKYNLDEFEFSQ
                     NYLYFYDKLEKSNYFLNRILECTDEDIDSRLVQFLLQMPENDGGQWDMVVNLVNRYGL
                     VPKTIYTDSASSLSSNRLNYLINEKLREYALILRKMKRDDSEKMGAQSIGSAKKSMLQ
                     EIYNILSLTLGIPPKPDEEIAWEYKDKNGNYGRIKTTPLGFYKDILGFKADQYFSLIH
                     DPRNVEGLYTVDKLGNIEGGKPIEYVNTSADNLKQAAIAMLQDNHPVFFGSDVGKFED
                     TNIGLLDVNAWDYKLGFGTDINLTKKQRLLTGSSQMTHAMVLTGVHLVDGKPIRWRVE
                     NSWGEYGDHKGYFVMTDDWFDQYVFQVVTKEKYALKKLTDYWKSKDYKVLPYYDPMGA
                     LARCDCGKSRH"
     gene            <786589..>787629
                     /gene="HMT1"
                     /locus_tag="FOA43_002362"
                     /db_xref="GeneID:62195763"
     mRNA            <786589..>787629
                     /gene="HMT1"
                     /locus_tag="FOA43_002362"
                     /product="Nuclear SAM-dependent mono-and asymmetric
                     methyltransferase"
                     /transcript_id="XM_038922659.1"
                     /db_xref="GeneID:62195763"
     CDS             786589..787629
                     /gene="HMT1"
                     /locus_tag="FOA43_002362"
                     /codon_start=1
                     /product="Nuclear SAM-dependent mono-and asymmetric
                     methyltransferase"
                     /protein_id="XP_038778587.1"
                     /db_xref="GeneID:62195763"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF01209"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MTEASKDPNSLSYWEQHYFSSYDHFGIHEEMLKDRIRTLSYRNA
                     IMKNKSLFKDKIVLDVGCGTGVLSMFAAQAGAKHVYGVDMSSIIEMARKIIDLNGFSD
                     KITLIKGKLEDLELPCGKVDIIISEWMGYFLLYESMLDTVLDARDRFLKPNGLIFPDK
                     ASIHVAMIEDSEYKDEKIHFWENKNRLYGFDYSPFVEIAMEEPLVDTVEGKSVVTNHF
                     KLIEFDLNTVKKEDLIFKRNFHLRATSDDMAHALLAWFDIIFPADKPQNVVRFSTGPQ
                     AHYTHWKQTVFYLDDVLELNKGEVIDGWLSCKPNKINNRDLDIHVGWDFKASGALNDV
                     RAAKNSRIYYLR"
     gene            <787987..>788946
                     /locus_tag="FOA43_002363"
                     /db_xref="GeneID:62195764"
     mRNA            <787987..>788946
                     /locus_tag="FOA43_002363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922660.1"
                     /db_xref="GeneID:62195764"
     CDS             787987..788946
                     /locus_tag="FOA43_002363"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778588.1"
                     /db_xref="GeneID:62195764"
                     /db_xref="InterPro:IPR017946"
                     /translation="MKQKILWNTLMKAIYVSAASVQALKRDVVGIQLFNSEDSQFSGL
                     TSDVFVKQIHSHNDYWRDVPLITALSYGVQSVEADIWNFRRSNNDDDELYVGHNLNAL
                     TRDRTLDSLYLNPLYEILEEHNPRPSRTVGKLAEKLPSGVFETDIHATLYFFIDFKTE
                     GNALFNKVAAALERFKHRDWLSYYDVEKDEFVWRPLTVIGTGDTPLESVLNMRQRFIF
                     FDGPLGQLNNFQGHSITSNISPIASASLRMLVGKSTIEGLNEKQLHKLSSMISDAHNR
                     NIKTRVWDTPWWPVSREQKVWKQLLDIGSDFLNADDLELAVQL"
     gene            <789236..>790891
                     /locus_tag="FOA43_002364"
                     /db_xref="GeneID:62195765"
     mRNA            <789236..>790891
                     /locus_tag="FOA43_002364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922661.1"
                     /db_xref="GeneID:62195765"
     CDS             789236..790891
                     /locus_tag="FOA43_002364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778589.1"
                     /db_xref="GeneID:62195765"
                     /db_xref="InterPro:IPR032675"
                     /translation="MSRLLNALRALGVDEEDTEAAYNDDFLFGLQGGDNGSESCDSDE
                     ERDTDMTALLSFEDSDKMGLFREIVRPLPYELKVKIFRMSLGKFYETELLSYLHNDCI
                     LPVLKVFYDELLIGDGKLYFGGFNEYDVIKFGAEEFQSNFKQVVAQGRIRIKILKIFD
                     LDDVLDEDIKLLLSHAEKIWCASVVALAKIYDLCPDAVYKITDLSVENLDQLTRQKDL
                     RPIFQRLAKSLKDFTLPLGPDDFDRVEAIFDTLKDVDHNLTIHLPISYPIDGNGELDF
                     LHNLLDPYYSKIKLAHILFTLVSPNFHMNDLKQFLQKVGYQKFTDFCLVSFPNFRVQG
                     DLKFLSQLTNLVTIVLSGSFALNCKNFGSLTKLTHLKEFMLESCKLDSEWFNNNLPRN
                     LKDLTISYNSFTGIGTYKVPSCLKVLTILCNDSFNLKLDNLDFSESNLSVLKFRIDDE
                     SQWNKLTVSFANLPANLQEINCYKLTSFIVEKDIKLSKKKNLVVYITTYSESMLPKNL
                     RLESLKANVKVKFRCFKNYQFSSLGAIEKIDSIGGLPNRLLDC"
     gene            complement(<790992..>792029)
                     /locus_tag="FOA43_002365"
                     /db_xref="GeneID:62195766"
     mRNA            complement(<790992..>792029)
                     /locus_tag="FOA43_002365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922662.1"
                     /db_xref="GeneID:62195766"
     CDS             complement(790992..792029)
                     /locus_tag="FOA43_002365"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778590.1"
                     /db_xref="GeneID:62195766"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR002413"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="InterPro:IPR035940"
                     /db_xref="PFAM:PF00188"
                     /translation="MRFSLSVLTAIVAVLSGVSAEEYSSSEECQVNYHTVTSIEYVYT
                     SLPVETTKKTTSSSTFSPTSTISSQNEASATLSSASSIALSGPSNIASSQISSTLDAQ
                     STTPIVTPTATSSILSSSPLSSITTSTSPLPTSTLPTSKSTSISTTSKSTISTSISSI
                     SPVTSSPVTSSTPTSSTPTTSTPISTSSVFSFEDVYLDRHNYYRNLHVDTPAMSWDDG
                     VANVAQTYADSYDCDGVLTHSGNSYNGSSLGENLAYGYDFYDAGAVDAWYDEISNYNY
                     SDPQFAEDNGHFTQLVWKSSTRLGCGYKYCSPTYGYYIVCNYQPAGNVIYSGDEYKLF
                     KENVLPLKSSS"
     gene            complement(<792488..>793807)
                     /locus_tag="FOA43_002366"
                     /db_xref="GeneID:62195767"
     mRNA            complement(<792488..>793807)
                     /locus_tag="FOA43_002366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922663.1"
                     /db_xref="GeneID:62195767"
     CDS             complement(792488..793807)
                     /locus_tag="FOA43_002366"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778591.1"
                     /db_xref="GeneID:62195767"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="PFAM:PF10104"
                     /translation="METFRKLSIQDDYDSDIQENFLSGLSINEDVSMEDYEDDGRRDD
                     LRSDISMEDAEIGKEERHIQPEYLPEGQLDKQLDEQLDKQLDEQLDEQLDKQLDEQLG
                     DQNEHSVIYDVFHPTMQGCRVASGRTKMEDKDLENKNPKDEPSKDMIQRREGISMPEK
                     NGCLSEDEYTHVSTSDGVVHRQRNVEWTDTSTEEKFEYIGAKDPRARPIFINQNNYIG
                     TYNRFTAVKPTFHERHPVDQASKHDHNQEAGCGGPVWRKPYLISTYLQITMNTLISLY
                     ALYHIYLFLKIIRKDVSNSVDNELMESKFKTQTCYRQYHSNHCHDQNLPALQKQCIAW
                     MKCMNKEPYMLINYSELIVAILGSLVNTFFESFSYRSISVMLLIGGILYAWNFSCGYF
                     RAKTFYGLPLIRDAAFNMPGKSTEPQIKPSENNEQLVSSSTDFGKLD"
     gene            <793996..>795081
                     /locus_tag="FOA43_002367"
                     /db_xref="GeneID:62195768"
     mRNA            <793996..>795081
                     /locus_tag="FOA43_002367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922664.1"
                     /db_xref="GeneID:62195768"
     CDS             793996..795081
                     /locus_tag="FOA43_002367"
                     /note="BUSCO:EOG09343ZPR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778592.1"
                     /db_xref="GeneID:62195768"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="PFAM:PF12333"
                     /translation="MGTSNRHKKQKQTDFTKRKLRVGKTARQKDNFTDTSFKAKSISL
                     NQKKILSPSLNEEGALKKKLSILRKSTQNLNSRKEILAELLNALIKHYDSVSSHMDEI
                     LKISNILILDRSRKIREMNLELWKYLVDNGKISILILHLDTLLLFINSGMTHLSNGVR
                     LDSLKYLDCLLSNTELSDLIVKSDWFKLLKNFMILMNWTTDNNNGKNLVVREGSSQLL
                     EKDLARDRINELKVLEKLLLAGCTDHTQYNENGNGNPHQLSYNNIQIHAYTKYYMLPD
                     KPNPYGGLKLFTEIKKIGSMESGDFQSVSTDDMVNRIKVLCEAFGDGLQKGLTELSKE
                     ENRELANKASNLITEYDRIRKEYISAA"
     gene            complement(<795102..>796055)
                     /locus_tag="FOA43_002368"
                     /db_xref="GeneID:62195769"
     mRNA            complement(<795102..>796055)
                     /locus_tag="FOA43_002368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922665.1"
                     /db_xref="GeneID:62195769"
     CDS             complement(795102..796055)
                     /locus_tag="FOA43_002368"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778593.1"
                     /db_xref="GeneID:62195769"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="PFAM:PF04438"
                     /translation="MEEDKKVQNKPNCSVCHDNVSKYQCPACGARTCSLNCFKRHKKQ
                     KECSGKSDVTLNKTKYLPKQHMDSNNIQRDYNFLMKMDRKLELGKEEASTNKIIIASK
                     KRHRQNNRYHGGSNKRRPPPDSHSFDDLRNIITRRGVRIRQLPPGMSRNTNNKSGFDK
                     QKGRYMWTLEWILVNEKFEEIDKIIGYKNDEDSKICEIIPFRRFTKKLGGDEETTNNQ
                     FKFFIESEDDKQTLIEVPSDESLSKTIGGRLFIEFPSIYVSLTDKFDKDALNGRVIKR
                     DNSTEVEEPPFPEPISSDLPLARSPTVSEDADYCPSENYIP"
     gene            <796696..>797841
                     /locus_tag="FOA43_002369"
                     /db_xref="GeneID:62195770"
     mRNA            <796696..>797841
                     /locus_tag="FOA43_002369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922666.1"
                     /db_xref="GeneID:62195770"
     CDS             796696..797841
                     /locus_tag="FOA43_002369"
                     /note="BUSCO:EOG093434C7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778594.1"
                     /db_xref="GeneID:62195770"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF13177"
                     /translation="MSLWADKYCPRTLDDLTYHEEISKKLKKLSSSGDFPHLLVYGPS
                     GAGKKTRVMVLLRELYGSGAEKLKVDVKTFQTPSGRKLEFNVISSPYHLEITPSDMGN
                     NDRIVIQDLLKDVGQTESIDFAGLLHNDDKKIVSNNKKKFKVVVINEAELLSRDAQAA
                     LRRTMEKFSANIRLILVCNSTSSIIDPIKSRTLAVRVGLATFKETSDVFQNILKHEHM
                     ADSSFPEDEVERQASFQKVYESAEGNLRMGIMMLEALYMNNEHVTCSTAMIRPDWQLV
                     IDELARGIIKDRSVGKLQHTRSVLYELLAHAIPANLILKRLTLQLWHDLGEFAALKNK
                     DETLTKVVDAASTFDERLSLGSKDIFHLEGFITRVMVIVEEELNGRT"
     gene            complement(<797893..>798543)
                     /locus_tag="FOA43_002370"
                     /db_xref="GeneID:62195771"
     mRNA            complement(<797893..>798543)
                     /locus_tag="FOA43_002370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922667.1"
                     /db_xref="GeneID:62195771"
     CDS             complement(797893..798543)
                     /locus_tag="FOA43_002370"
                     /note="BUSCO:EOG09344155;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778595.1"
                     /db_xref="GeneID:62195771"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR020798"
                     /db_xref="InterPro:IPR036920"
                     /db_xref="PFAM:PF00252"
                     /translation="MFSRALKSSLFLSSAYRPLTCKRFGHELAPRYKQVKKKQKGRVS
                     VRTGSSDKGNSLSFGTYGMRLKTEGLRVTAPQLRAADNVLVKYVKKGNGKLWRRLCTN
                     IAVCIKGNATRMGKGKGAFDHWTVRVPTGKVVFEVDGMHQKAAKDALRRACDKLPGVW
                     EFIGKDTPIRIGLKSVKETEVTEVNYLEQLKENPTKNYLNYLKSKQSLYKEFAGRK"
     gene            <798722..>800119
                     /locus_tag="FOA43_002371"
                     /db_xref="GeneID:62195772"
     mRNA            <798722..>800119
                     /locus_tag="FOA43_002371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922668.1"
                     /db_xref="GeneID:62195772"
     CDS             798722..800119
                     /locus_tag="FOA43_002371"
                     /note="BUSCO:EOG093428YC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778596.1"
                     /db_xref="GeneID:62195772"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004530"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR036690"
                     /db_xref="PFAM:PF03147"
                     /translation="MLSLKSSLRGLLDISSPAAFVAFAAHRSVSSTTKPSKITVLGET
                     FKTDNWTNATPQILNLVGRDLYKNPDHPVGILKNLVEKRFQGLDYTFYDDFKPVVSTY
                     ENFDVLGFPQDHPGRSVHDSYYLDSKHLLRTHTSAHEHQCFQRCHTPGYFITGDVYRR
                     DEIDRTHYPVFHQMEGARHWSRKDFITGEELLAQIQSDIDAIPKTSQKDLIVKDVSYD
                     AVKNPKQKYMTMKETDLIGQHLKRTIELVVSEVFNAAKIAAKKAGSTEQYLNEPLKIR
                     WVEAYFPWTSPSWEIEVWWKGEWLECCGCGVVREEVFQNSGKGSDTVGWAFGIGLDRI
                     AMLLFDIPDIRLFWTLDSRFKNQFHEGQISLFTPYSKYPGTIRDISFWLPGKGDEELH
                     TNDLMEIVRANAGDIAESVKLIDEFVHPKTGNKSQCYRVNYQSMDRTVTNDEVNRLHE
                     KTRRDLVDKFGIKLR"
     gene            <800337..>802142
                     /locus_tag="FOA43_002372"
                     /db_xref="GeneID:62195773"
     mRNA            <800337..>802142
                     /locus_tag="FOA43_002372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922669.1"
                     /db_xref="GeneID:62195773"
     CDS             800337..802142
                     /locus_tag="FOA43_002372"
                     /note="BUSCO:EOG09341B7K;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778597.1"
                     /db_xref="GeneID:62195773"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR028879"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00258"
                     /db_xref="PFAM:PF00667"
                     /translation="MPKLLILYGSETGNAQDFAETLALNCKYHRYEPTVAAMDDFPPK
                     GLLDYHVLIVICSTAGQGELPLNSRHFWKFLLRKKLPSDLLSHIKFSTFGLGDSSYSR
                     YNWAVRKIHARLLQLGAREFSPRGECDDQSAEGPEAYYAAWSELILKNLPALYPGNDK
                     LTEQPIDEDVVLAPSFRIEIQTNKFKKLTDTELKQIAFNRASICNGGSLDQFEVTQND
                     RLTSDDHFQDVRKVVLRRKDGMPLKYSPGDTIALYPTNDARSVDALIKLQGWDDIADY
                     PIKIETVTGSGRQVSIPGGLIKKLTLRSFITHHLDIMSVPRRSFFMQIRHFVSDEREK
                     EKLIEFCSLEEAQQLYDYADRPRRSILEVVQEFFSLKIPVEYLLDVFPLIKPRLFSIS
                     SRNDNVQLELTIAIVEYKTIIRRLRRGLCTRWIKTLVCGDNIVGAIKYNRTKYGLDNL
                     APIVLAYTGTGVAPVKNFVETELAKKQHRLMYVFSGNRYPEKDYLYGDLWKEWEEKGQ
                     ITVYRTFSRDPEYAKKGYHYIYDRLYKEKQLVNDLLVKQGGVFYLCGSSGKMPTQVRI
                     TMEMIFGEENAWNKAEAKEYLSKMESSNRYIQDTW"
     gene            complement(<802173..>802973)
                     /gene="TSR3"
                     /locus_tag="FOA43_002373"
                     /db_xref="GeneID:62195774"
     mRNA            complement(<802173..>802973)
                     /gene="TSR3"
                     /locus_tag="FOA43_002373"
                     /product="ribosome biogenesis protein tsr3"
                     /transcript_id="XM_038922670.1"
                     /db_xref="GeneID:62195774"
     CDS             complement(802173..802973)
                     /gene="TSR3"
                     /locus_tag="FOA43_002373"
                     /note="BUSCO:EOG09343IYM"
                     /codon_start=1
                     /product="ribosome biogenesis protein tsr3"
                     /protein_id="XP_038778598.1"
                     /db_xref="GeneID:62195774"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="PFAM:PF04034"
                     /db_xref="PFAM:PF04068"
                     /translation="MGKGKNKDKGDKPHHSDGHHHSVTHSRRQEVKHGGKKVDFPCKL
                     AMWDFGHCDPKRCSGKKMERLGLIRDLRIGQKFHGVVVTPNATGVVCPDDEEIVLKNG
                     IAVVECSWARLDEVPFNKIGGHNERLLPYLIAANPVNYGKPLRLNCVEAIAACLAIVG
                     KEDWALDLLKHFSWGPVFLSVNKDILALYRKCTDQESVLKAQKDYLETVDKEREERRK
                     HRGDIDVWEMGNPNHVEEDESDEEISALIDNDTPNTTQIITAVNNLSI"
     gene            <803210..>806977
                     /locus_tag="FOA43_002374"
                     /db_xref="GeneID:62195775"
     mRNA            <803210..>806977
                     /locus_tag="FOA43_002374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922671.1"
                     /db_xref="GeneID:62195775"
     CDS             803210..806977
                     /locus_tag="FOA43_002374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778599.1"
                     /db_xref="GeneID:62195775"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="InterPro:IPR037191"
                     /db_xref="PFAM:PF02204"
                     /translation="MSISNLPPQRPQHTISLHSQLPSLDNPFLNALFNNTKINSNNSL
                     HDVVDQISKYPGDYIILVPDTKFLLLSVDQDTDKSYKELSTESDFIQSHIIKVNLHKY
                     ESSIPNSISSKQLTTLNNKTITIRKSLIQNVKGFKHDFSVRILDQLFFRSFANYIPFG
                     TNFHLFMIEEALIGNPLYSGLKKVKNLELVVPKKLSSYIDLDVTDDDAGIGLDTSPIS
                     FDDVLREVPQLGAEVGEPFKRLFQEFSVRNVTTEIELSDAFTGVMSKGSSVVNSLSDS
                     ICKDIYTQFPDLDLRQAIFNYIEMNIYDRFWARYLEIHPHREDSIVNKAYTRLKDLSI
                     TQVGLPERWFVDPDKFISLEKRVLSAIAEFRKLEFATTTFEKCSIICRTFRYLSDRTS
                     VASKSSNGSLIDADTLISLFLLVVSHAGVFNLNSHLNYIRSYSFMDDSLESGFVGYAL
                     SSFEAVLNYYDDKSSLKQLEQYSDKNNELWQLIISVSSDSNENNTENDASNDNNIIKK
                     VCHLIDPFDDGINIHWDCFLRSRTLNGESCLMLALLQNNFKLFKAMLDYRFVFTLDDI
                     LEDRSIDGLNLLNAALQLKHPLVGELADIILQAEEGEIESYSNAKDNKRRLLGHFLFH
                     DYRLIPKFGRYIDWRAKDITGKTPFFTIVRCYDHPNYVDLLKVTMKSISAWYEMKGMR
                     FDYKDHIDNKGNTLIHAIKDGQSLKQFLSEYLCLNLNYFNNNQQTPLMQYVRYNRLSN
                     IEAILRDSRLDLLISDHRYQLTAEDYIKVEKIQDSDDSNQRANRKIMDLLDSELNRRY
                     AVSYNGCSCCAVRVKFDANRDLCIYFRYYDDNESRMIIHSYTDFKKFFKLLKLQYAET
                     YIGNNQVWLPGYIEISDRLNINYSKKFCLNRLLLTVNLLLSCIRFNPSLRESKITKDF
                     LSVQKPLNEMNYLKKKQKNEENRRQEILGSDDSRLYMLKPEEVGNYKTFLKFSNAELM
                     RLSRSLDRFYRMECFMHMKRGDLEYVKENLVYFVARSGKKESIEENLGSIPWKLLHKL
                     ADRQRDIHNLEIATYKDIFVESLKLLRESVVELTNCILRFFQGKISCWWKLYGEIKGI
                     GDELVKILRVEKGKSAQSAAASSSSSSSSSPLSSPTVLNQVLLEVGTLIGTIDNDSAK
                     ELRSKMATTNGIYGLFESNGGYLSGIIEKRREDYTVKLIERFKKLKNEMIMLNIDLKK
                     EYEDLCIELNNFYEFRGKVMNFAFNNLAKDRIQTLRLQKEMMMNYKSWENV"
     gene            complement(<807075..>808946)
                     /locus_tag="FOA43_002375"
                     /db_xref="GeneID:62195776"
     mRNA            complement(join(<807075..808176,808394..808451,
                     808859..>808946))
                     /locus_tag="FOA43_002375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922672.1"
                     /db_xref="GeneID:62195776"
     CDS             complement(join(807075..808176,808394..808451,
                     808859..808946))
                     /locus_tag="FOA43_002375"
                     /note="BUSCO:EOG0934324F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778600.1"
                     /db_xref="GeneID:62195776"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR032374"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF16546"
                     /translation="MLITTERILKSSKAIIADFINRKDNRFNVLIEKHKAFVLVTCFN
                     IKCTNKEIASLVIKFLSESLSKGDVPADNKDSLEFAIESIGEAYGVEKGDVDNILGDK
                     FDKKGLSELIESALATKSHSNTEKSTTGRTNAPSSSSNGREKVSEETKQRAEAHKLEG
                     NKAMARRDFEEAISNYTKAIELDSTNAVYLSNRAAAYSSIRSHELALEDAKKAIEVNP
                     DYAKAWSRMGLAKYAMGDAQGAMEAYEQGMKVEGDKHSPAMQKGFETAKKRVTEKMAS
                     GLGSVDEPKGTSASSSDSATATDAGSAANPLAGLGGLGGLLNNPQVMQAAQKMMQNPD
                     ALKNLMNNPQLRQMAQSMGLGGDAAGTAGATSAAGSTDSADATGATNATGTPSLNDLM
                     NNPMLRNLANQFMNNKGNQDQQQ"
     gene            complement(<810490..>813012)
                     /locus_tag="FOA43_002376"
                     /db_xref="GeneID:62195777"
     mRNA            complement(<810490..>813012)
                     /locus_tag="FOA43_002376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922673.1"
                     /db_xref="GeneID:62195777"
     CDS             complement(810490..813012)
                     /locus_tag="FOA43_002376"
                     /note="CAZy:GH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778601.1"
                     /db_xref="GeneID:62195777"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR019800"
                     /db_xref="InterPro:IPR026891"
                     /db_xref="InterPro:IPR036881"
                     /db_xref="InterPro:IPR036962"
                     /db_xref="InterPro:IPR037524"
                     /db_xref="PFAM:PF00933"
                     /db_xref="PFAM:PF01915"
                     /db_xref="PFAM:PF07691"
                     /db_xref="PFAM:PF14310"
                     /translation="MTFDVNSLLEQLTTEEKVSLISAVDIWHTAKIDRLGVPSIRVSN
                     GPNGVTGTKCFNGVPAACFPNGTCLASTFDPKLMENAGELMALEADHKGAQVILGPTT
                     NIQRGPLGGRGFESFSEDPYLSGISTASVVSGIQKTGKVAATVKHFVCNDLEHERFSS
                     NSVVSERALREIYLEPFRLAIKLADPKCIMTSYNKVNGVHCSENYKLTQKILRGEWKW
                     NGMIMSDWYGTYSSVEAIQHGIDIEFPGPSKFRKWEIIKHLLQSKENDLREGDIDDRC
                     RHVLDLVKYVVDSRGEGPYSTLEDTKNNTPKTSATLRKIAADGIVLLKNDKNVLPLSK
                     GKSTVVIGPNAIALNTYSGGGSASLNPYYVVTPLEGIKKKVDKVDFTIGCHSHKALSG
                     LFEFMTNDLDKFKKGVSARFYTKPADERSLAEKPIDEVVVYNSYVMLFDYANPVVDIN
                     TKLFYTDFEGYFTPTETADYEFGCQVFGTALFYLNDELLIDNKTHQTKGTFCFSSGTI
                     EETAVAHLKAGENYKIRVEFGSGITSKISTDFGAGGLQVGVTKVIDAEKEIQQAVSLA
                     KSHDNVILFIGLNSEWESEGYDRDNMILPRRTNDLVSAVLKVNPNTVVVNQSGMPVEM
                     PWLKDCQTLVQAWYGGDELGNAIADVLFGDVVPSGKLSLSWPLKNQDNPAYLNFHTEK
                     GRVLYGEDVFVGYRYYDKLQLKVAFPFGYGLSYTTFRYDDLKVTVNDTTVTASFTVAN
                     SGDKYTGKEAVQLYVASLNPSVIRPVKELKAFAKTELKPGESQTIKLSLNLKEACSYF
                     DEYEDKWCLEAGKYQIQVGSSSDDIHLIGDFEVRKTVYFSKL"
     gene            <813893..>815320
                     /locus_tag="FOA43_002377"
                     /db_xref="GeneID:62195778"
     mRNA            <813893..>815320
                     /locus_tag="FOA43_002377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922674.1"
                     /db_xref="GeneID:62195778"
     CDS             813893..815320
                     /locus_tag="FOA43_002377"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778602.1"
                     /db_xref="GeneID:62195778"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MPIFNNVIGNVGGAILGCLTNGYVFGYIMSFFVNSYVVDNLGRK
                     MGIQIGNLIVVIGVIIQSCAGVWIHNLPDNNTDRDVLGMLIGARFVIGFGTGLISVAG
                     PCLVSELSYPTHKSATTAAYNSSWYLGAIVASWVSYGTKGISSNWSWRIPTILQGFFP
                     VLQSLLLPFFVSESPRYLVAKGKVEEGKAILSKWHGGDLKESEMLVDYELTEIQLALE
                     QERIQHEESSYKDFIKTAANRKRLWIFCWLSVFMQLSGNGLVSYYLSKVLTSIGITST
                     SEQLVVNAGLTIYNWGCSLIQSLFIVPRIKRRHAFNCSLFGMLICFIIWTILSAVNQE
                     RDFKDKSLGKGVLAMIFLYYFCYNFGLNGMPYMYLTEILPFTLRGKGINLFSFIGCFF
                     SIYNGFVNSIAMDAIEWKYYIVYCCILGVECCVEYFTFVETSGYTLEEVAEVFGDASE
                     IRKASGMAVMEEEKLKASREHTEYA"
     gene            <821706..>822543
                     /locus_tag="FOA43_002378"
                     /db_xref="GeneID:62195779"
     mRNA            join(<821706..821712,822272..>822543)
                     /locus_tag="FOA43_002378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922675.1"
                     /db_xref="GeneID:62195779"
     CDS             join(821706..821712,822272..822543)
                     /locus_tag="FOA43_002378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778603.1"
                     /db_xref="GeneID:62195779"
                     /translation="MSKYFTIVYIIHYMASTMRYDLAYTASTLAKLNKNTTDTHQRIA
                     LKAMIYYAIKPDVAIKYQHHNKDQFEKKNILLLNQSKENNLSNSPEPD"
     gene            complement(<825047..>828394)
                     /locus_tag="FOA43_002379"
                     /db_xref="GeneID:62195780"
     mRNA            complement(<825047..>828394)
                     /locus_tag="FOA43_002379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922676.1"
                     /db_xref="GeneID:62195780"
     CDS             complement(825047..828394)
                     /locus_tag="FOA43_002379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778604.1"
                     /db_xref="GeneID:62195780"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="PFAM:PF03177"
                     /translation="MPELKFNASRFNIEANQSNRPNRPNQANRANQADENEPSSYETT
                     SKGLMNTQFYHVYQRANRYPPLDTHSGEKILFCDSYPLINASILISNRHIYVYSANND
                     DFSSYTLKFEYTKNEFGILPQVQLITNLATPSQPDLIIVDCITGIVRYIEALKLIPSL
                     SILQNEHTLQLKLSRGELFTLTEYNEDVGLVLATNYRKVICVSLKDQFGRIQLSQDEI
                     IPSQVSFKFLRMLSYNIETYDDSNKIMALRFEHKSSLLTRLFVLEEQGTVHLVDFVKG
                     TGHHISAKTNLTELMLPQVSDPKALLSLKLKDVGSLGNDKFLVLISQNDGSMSLVVVK
                     FDSDLIVESQYHLKSVQSTDVYPRLYILFDSKVSFILVDHRLIFSDTADLSDTSTWED
                     FVSLNPEVEIYGASSLPEGGENRSMCIMTSDGVIHIDVLAPGERKTAQQFLKNRIEEY
                     LQFESAELSVNFDMAQSSYDIRQNEIEGAILDISDEILTNKSSLLQSYLVISDNLKRR
                     FELMKKLAQYISENFIVADSYKMVVVNNTERLGLASYFYDFLAENDDLTTSVDSLLQS
                     DKYRSSMNLFFSQDASRIVDLLQDFISTTFLEQIGNEASLSKLATVLNELLNAAYIAP
                     ERDVKGELLNIQYDINVKAKPIFFDHIRFLKDINGMIRKLALSYASQLDNDIDTEIKT
                     AVSKAILGLSPFLYYSCNDLLQYAECQGDDQTTAKHNLEEFYNANRKHWIDIFILLRK
                     QNEIIKFVEGFDDLQSLSELLESEREAVETISSQNALDPIEIENMSAAVEHKFDVCFQ
                     KYQYSFAEKLFALYVHSNKVDLLLTRFFKYSDYLSQFLNGDLSHYKFSWILSIQNDNF
                     DEASSKLLKYTDNSDQENIENKKLQLNIAKLSLIAENQVNPDQLCDIESQLDVLSLQE
                     KYEDVLLSRFHSLDQDSATTLLKESRYLSSNLSLLTRKVFHLIVDKLGHKIQLSLSEL
                     TDFLTLEDFSVVNCDPFDDIFKLLSNILHVTKSHSTVLIGKTFSERQIQILLALAFKR
                     LILTDDWTALKQGKDLEQSKFLKVLANLSSYNIGLPKSIDQLYISKDDLKCLGLDRTL
                     FSDYFKENDLLEHLDEQVNLMKWLSLH"
     gene            <828817..>829791
                     /gene="RPF2"
                     /locus_tag="FOA43_002380"
                     /db_xref="GeneID:62195781"
     mRNA            <828817..>829791
                     /gene="RPF2"
                     /locus_tag="FOA43_002380"
                     /product="rRNA-binding ribosome biosynthesis protein rpf2"
                     /transcript_id="XM_038922677.1"
                     /db_xref="GeneID:62195781"
     CDS             828817..829791
                     /gene="RPF2"
                     /locus_tag="FOA43_002380"
                     /codon_start=1
                     /product="rRNA-binding ribosome biosynthesis protein rpf2"
                     /protein_id="XP_038778605.1"
                     /db_xref="GeneID:62195781"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="PFAM:PF04427"
                     /translation="MIRTVKPKSARSKRAMDKKQPKIVENVKSALFIPGQNANKALHD
                     ITVDLAALKKPYCKRFQKKNQILPFEDSSSIEFLSEKNDSSIVVLSTNNKKRPNSLTF
                     IRTFNYAVYDMIELQVLSNYKLFDAFKKVTFQLGLKPMFAFQGSIFDTNPVMKQVKSL
                     FLDMFRGEVNKYVDVAGLQWIISISAIEEDDQNQAISKLPLVHFRVYKLKTYHSPEPK
                     LPRVELEETGPRLDFKIGRHESASAEVEKEALTVPKQLQPKEKKNVQTDMLGDKVAKV
                     HVGKQDLSGLQTRKMKGLKSRYDQVGVSETDEIEIKIQEEPESKKMKL"
     gene            complement(<829867..>831912)
                     /locus_tag="FOA43_002381"
                     /db_xref="GeneID:62195782"
     mRNA            complement(<829867..>831912)
                     /locus_tag="FOA43_002381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922678.1"
                     /db_xref="GeneID:62195782"
     CDS             complement(829867..831912)
                     /locus_tag="FOA43_002381"
                     /note="CAZy:CBM21;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778606.1"
                     /db_xref="GeneID:62195782"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="InterPro:IPR038175"
                     /db_xref="PFAM:PF03370"
                     /db_xref="PFAM:PF16760"
                     /translation="MPFVHSSRKKRAGFGKGLTVDGLGSIDGISGANATAGASAHSGR
                     SAGAGTGSTKGTLEIAESPFSDNPGESRGFRGSVDSEEDIPLSLSFMRRPSRSDSMDL
                     DKSIERIMKQNTLYNSRLAKFENRQSKGPSVVHGESPISPVSPVSPVSPISPTSSPGS
                     STAEALDEAAYPHLHSLIRRKSGELVKSSLKLQSLGSSRSLPATPTFKQVHFGVNIDV
                     KFFKEKDKPTSISAGNSPCTSDDEGDSSDSGRSSGSSGSGNSDYDSDIDSGSSRRSND
                     YYANFHTLFMSSRDYVEKSSLRNLNRFRKLISGWDLDLSLFPKVYYSDEIDREVPVFL
                     ESLHLNSDKTCILGQVAVKNISYSKKVTARYTFDDWTTVINIDATFTPNMPRILKRAC
                     YDRFVFQISVPLMLSQFLGSHKYSSDLIPTFSCCLRYISGGQEYWDNNFNHNYQIRFV
                     PYHKRTHGHGKSAAVPPPRVAPLDVPLRRTLSADNLKKSRKFETLKGTSSPRMLGVRA
                     SPRPTQIVSPSPEFAGNFAYTTGGSSSIDSPGTPAVLRDLRETATGIRGNFNSLSPRS
                     MVSLEKEDPFTSFSLDNMKVGREVKPSPNVTTNSEDMVSSADHQQSGNSERDAKLSRR
                     AASNKENSSSSSPTNEPSKPDIDSDSYKAMLKKYCFFKSPSTVSSFLEHDQDENGFY"
     gene            <832650..>834332
                     /locus_tag="FOA43_002382"
                     /db_xref="GeneID:62195783"
     mRNA            <832650..>834332
                     /locus_tag="FOA43_002382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922679.1"
                     /db_xref="GeneID:62195783"
     CDS             832650..834332
                     /locus_tag="FOA43_002382"
                     /note="CAZy:GT57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778607.1"
                     /db_xref="GeneID:62195783"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="PFAM:PF03155"
                     /translation="MESIQKPHGHADSSPYNFSLWNIWVASTLLKILLFPTYHSTDFD
                     VHRNWLSITKLLPLKDWYFENTSQWTLDYPPFFAYFEWFLSRLVPPLVAADGCIKLTA
                     QDGEYGYLTVIFQRSTVIASEILLFLALQWLIDTSSSLKEKKRNFVIACSISLSPGFF
                     IIDHIHFQYNGFLFSFLVLSLVNAKLGNYVSCAFWFAVLLCFKHIFLYMAPAFFVYLL
                     SVYCIKHRRFSTKDGILANLKLFLFDTVIWSHLFQLGAVVIAVFAVALGPFIYYGSMP
                     QLLKRLFPFSRGLTHAYWAPNFWALYSFIDRVLIQLAKRIPGVEKFLCLFLKKSYPID
                     YSNANSLTRGIVGDVEFLFLPEIQPKHTFFLTLFYEMLSMIQLFINPTYQRFLGAVTY
                     CAWTSFLFGWHVHEKAALLMIIPFTFCVVQDRKLLPSFQTLTAASYVSLFPLLFGSAE
                     WLFKALITFVWVVVFQTSFNEVCHFSTTRTRRVVALDRLNIIYVFLLIPMCAIIQMID
                     IESRNFPSLQKLGFASLMTYSVYCAFGIVTSWNSFSWLYFLDDSVWEEKKAI"
     gene            complement(<834397..>838735)
                     /locus_tag="FOA43_002383"
                     /db_xref="GeneID:62195784"
     mRNA            complement(join(<834397..837383,837883..>838735))
                     /locus_tag="FOA43_002383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922680.1"
                     /db_xref="GeneID:62195784"
     CDS             complement(join(834397..837383,837883..838735))
                     /locus_tag="FOA43_002383"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778608.1"
                     /db_xref="GeneID:62195784"
                     /translation="MDNFLKDCESIISELESDDGSSYTGANFDDYDHIYRFPKHQTQE
                     NVDRKRLGFETIRSFTSIFKRKNRSKGRTLAEIDINRFDSPNSQDTKPTLSSSKPNDN
                     SQGNSSNISPLSNFGSKPTSPVKFDLSEYHWDPFGVARAMYFTDLLTDLYRLHSSRNQ
                     SFYLFVNSHPSIWIQLDNLWSRIRTNPGDFNPTFLNASIVALNQSCHNLVDSNTLFKC
                     YIQHLTEENPDKLLQLHSLSEESHIPNWDNTKSEKKLFRELKVEQETIGAADKEILNQ
                     NPGKSWLWNIIKIPSRRLKQKQNKAKRAGSTRSVQEGISVSHEISNHKDQWLNEGNSE
                     AEYEDGDGDGDGDGENEVDYQEDDDYDDDDDDDDDDDDDDDEDYNYEEDEEEVEEYSF
                     DFDLKSSLRFNPLKLHRAMFRYLRIFRPNDDVAEKQDRLWKLFSTIAALSDPYTQPAD
                     TGDMNEMIISLDLVSDLVLALCYPRYLNDPEVELPNFAMAYDLATIAERSLTVLHADN
                     TSQLMLINNDADHWAQNVHLWVPDHTLSGIVNMASDFHHLKLVYSLCVVCMMVIYKLY
                     RSSDIVCLNPFLSFFLQVWKDQTRIILLGIEIDRRDEQAGFPGYPVIIRPVIKGSSAL
                     RSAISMILNDDFEKRTHDFKHESLIHFMNPWGRRMGNGSLTADMRVLVAGILALGSDL
                     QDVALLVFNLEPEDRYDEDIKYMFELELEDDPDDEYQAHHKNMFCPPHGVKPPRHSAD
                     EDMRDNDMYIEGDVYDLHPDCHCVFEEDDDGEDEDDAEDEEEGQQEEGQQEEEPNDHR
                     NADTDTSAARLTLPKDTASLFNKLNDMPMAVRSSSSKDFMFDDEGRDWRDIPRGDNSK
                     LTIEFVKLLKKSQKDSSIFITPMENLLGQLQKMMEGTLVTTQCEKIVRSIAWVVQYEY
                     EASQMTKNDKKSKKDDPTINTDIIYKFLSKGNNFHKMIRYNPSSSFCIVDELLMVEGY
                     RRVLVWFLTHLEPNQWIINYFHELLIGNRGNPEHIEDPKSTRFAFSRQGAIVLSEVEQ
                     SMLLHEFFSNSLVYLSRSAAREDTEDRSNAQRLMKVICLMLKSLDQKKVLPVNSSEYR
                     LEIQTLLVQWVGVGMVPEARELFFKSQKFDAKEDKLMNVERQVMRRKVQLETELAEID
                     LYDLFASHFERDSAELLVSVMHLGTFYPEKKNAVLSFFSDLNRVEKVFKSDASLMRVC
                     DFFFSMLNVAIRVQNMDMIIKLFNDVRLVDTSKNSVVDGIRMFLTVPESQKRISEDLE
                     IDKHDHIDGDPVDDYDI"
     gene            complement(<839363..>840472)
                     /locus_tag="FOA43_002384"
                     /db_xref="GeneID:62195785"
     mRNA            complement(<839363..>840472)
                     /locus_tag="FOA43_002384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922681.1"
                     /db_xref="GeneID:62195785"
     CDS             complement(839363..840472)
                     /locus_tag="FOA43_002384"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG093447AD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778609.1"
                     /db_xref="GeneID:62195785"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="PFAM:PF08613"
                     /translation="MGANSFTGTFQTSRMSEASQASQASQMSDNSQQSVIGFPPHPTP
                     AMATTNLSKDMAFSTNSSSSTLYQDSQQQQQQQPQQPQLLPPFPQVDQFLQFPQHPHF
                     ISSSAPVNTSVDFSDSRRQQLPQQLPPLQTQKLLQQPPPPSQEHFNVAEHPVQDLLLM
                     LSALLQKIVEANDLLHTEHYDEALQDTRQRNENSMEQNRFKANVLSFHGRNIPAISLY
                     AYLTRILKYCPVTNDVFLSLLVYFDRIAKRANNGEFSGFAGKSGGLSSESSYESRDPD
                     RGQVFVIDSYNIHRLIISGITVASKFFSDVFYKNSRYAKVGGLPLEELNHLEIQFLML
                     LDFKLMIQVEEMNRYGDLLLKFWKREQAKQAKQAQ"
     gene            complement(<841252..>842102)
                     /locus_tag="FOA43_002385"
                     /db_xref="GeneID:62195786"
     mRNA            complement(join(<841252..841685,842099..>842102))
                     /locus_tag="FOA43_002385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922682.1"
                     /db_xref="GeneID:62195786"
     CDS             complement(join(841252..841685,842099..842102))
                     /locus_tag="FOA43_002385"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778610.1"
                     /db_xref="GeneID:62195786"
                     /translation="MRADSRTDSNYARKSTSILNDLKEYKQIKKDNKIKNYSPYFSNI
                     RKFTPVYTVFTNTALNTEQHDLELFNLPISVVENLRPFQVMNRPGQELFRDDMIYTRR
                     LQLEERQLKQVKENKLRYKEDMKLAKKGLKRMQINAEEFFGFK"
     gene            <844127..>847531
                     /locus_tag="FOA43_002386"
                     /db_xref="GeneID:62195787"
     mRNA            join(<844127..846817,847219..847241,847312..>847531)
                     /locus_tag="FOA43_002386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922683.1"
                     /db_xref="GeneID:62195787"
     CDS             join(844127..846817,847219..847241,847312..847531)
                     /locus_tag="FOA43_002386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778611.1"
                     /db_xref="GeneID:62195787"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR033133"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00806"
                     /translation="MSSGTNRISPTSSSGSAAHPFASPSVTPFTSIPVTPNSVPFPST
                     TLPATPLATVPATVPANVPANVPANVPANAFGLVSNPTFSTPPFLPELQAILSRANAQ
                     QISQPQSQLASSSDFLLNSLTGNSASNLGLRTRHRSGTLPSRLSVGPAITNSAINESS
                     VSSSSFLLGSNSSASRLRSTSIQSSIWSNDGTQTSSAHNSPAFFAQQQQLQPPQRPAI
                     NTLDLDEPLASTNASVSSATLAPSISSASSGLFNSNRTRSYSANNAILKPADRQFLNH
                     CSTIREEYPQSEQLPQQQQQELRPPFQPLFSGFQTKFPAPLQLPASGIGLQRRAQSFS
                     EASEPHISVNRGPLLQDNLPESDISITSTHTNPSLGPTSTLLIINVPRDHNLTNAANF
                     YRMMIQFGIIVSVRVVACTDSSDLVVAVEFQDIDSAVRCRAKMNYQELVPGLSCVVAF
                     AKIIYVNGGKCPMIQKQAPVAVAASVPALVPVSLEAPKSAPVSTASTILTASASPSNS
                     ASAAPPQASIHASPDPQTRDTNLNEEFDRFKRICSALQFTNTSLSDSQQEQLSILVRR
                     ALRYNTVRDYGLGKLPEPLVVRKFDTPRLREIRKQLNSNQLSKLAVEELALAMYDELP
                     ELASDYLGNTIVQKLLEICGVPVRDIIVKHLAPYLAQMGSHKNGTWAAQKMINTVTSD
                     REKWLISKSLYKYCTQLFNDQYANYVVHGVLKFGGPCNDFIVEAILATFMEIARNRFG
                     ARAIRTCIESESISQEAIVLVSVCVLTWCWDLMADPNGSLLITWFLDTCTVVSDRHYL
                     LAKTLYEDDAADCAASDSMSAEARELGLNLDDSANGISAANNSRLCKVCCSKLGHLSV
                     LKVLNCRTNLAARNILLKKIFGDDILPINGSSISSSEPAYLLQPQQQQCGILGLRYED
                     LDGQNTLKSTTSSQFDYGMMLGPQFEKLTLSGPATNFYQSQGQGQDQSQNGRHSQDPG
                     QQLFY"
     gene            complement(<848091..>849056)
                     /locus_tag="FOA43_002387"
                     /db_xref="GeneID:62195788"
     mRNA            complement(<848091..>849056)
                     /locus_tag="FOA43_002387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922684.1"
                     /db_xref="GeneID:62195788"
     CDS             complement(848091..849056)
                     /locus_tag="FOA43_002387"
                     /note="BUSCO:EOG093436CV;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778612.1"
                     /db_xref="GeneID:62195788"
                     /db_xref="InterPro:IPR011990"
                     /translation="MVMLSTSQQLLNFAISKRYLSLNPEELDELYKTCSQYVNDSGQF
                     DGLDVLDQNSLLLLLYQVCLLTCHDIEANATMEKVTDLINDNQLINQQSEWLIYWRSV
                     WLETQAGKSGQLDVVFEYINNSMHKFIKDLNRKVGTTLGAAGDPGKLRSDDDLYVLKK
                     RKASMFQSDPQKYVVKLLELIDLRPLDYETWCELADVYLANGELEKCHYCYLEVLLGL
                     PSAYNIWARMGEVTLLMAKSVNGKASTKYLKNCVRYFSRSVELCELFSRGWCGLYVTL
                     SRLSDKGGDYTTLKQLTNDKLNHIVNAKLANHTEIANIEWILHNY"
     gene            complement(<849311..>850420)
                     /gene="GLN1"
                     /locus_tag="FOA43_002388"
                     /db_xref="GeneID:62195789"
     mRNA            complement(<849311..>850420)
                     /gene="GLN1"
                     /locus_tag="FOA43_002388"
                     /product="glutamate--ammonia ligase"
                     /transcript_id="XM_038922685.1"
                     /db_xref="GeneID:62195789"
     CDS             complement(849311..850420)
                     /gene="GLN1"
                     /locus_tag="FOA43_002388"
                     /codon_start=1
                     /product="glutamate--ammonia ligase"
                     /protein_id="XP_038778613.1"
                     /db_xref="GeneID:62195789"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="InterPro:IPR036651"
                     /db_xref="PFAM:PF00120"
                     /db_xref="PFAM:PF03951"
                     /translation="MVYTEHTTTLEKYMSLPQKGKVIAEYIWIDSQGGLRSKGKTLSK
                     AVTDLSQLSEWNFDGSSTGQAVGTNSDVYLRPVAYYPDPFRKGDNILVLCECWNSDGT
                     PNKFNHRHECNKLMTAHFDEKVWFGLEQEYTLLDPDDGYIYGWPKGGFPAPQGPYYCG
                     VGAGKVFARDVIEAHYRACLYAGVTITGINGEVMPAQWEFQVGPCLGIKMGDELWMAR
                     YLLDRVAEEFGVKVTLHPKPLKGDWNGAGCHTNVSTELMRHPGGMKYINDAIDKLSKR
                     HSEHIALYGTDNALRLTGKHETASMENFSAGVANRGASIRIPRSVQATGYGYFEDRRP
                     ASNIDPYLVTGIMVETVCGSIPDADMSKEFKRESQ"
     gene            complement(<850993..>851859)
                     /locus_tag="FOA43_002389"
                     /db_xref="GeneID:62195790"
     mRNA            complement(<850993..>851859)
                     /locus_tag="FOA43_002389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922686.1"
                     /db_xref="GeneID:62195790"
     CDS             complement(850993..851859)
                     /locus_tag="FOA43_002389"
                     /note="BUSCO:EOG09343NMA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778614.1"
                     /db_xref="GeneID:62195790"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /db_xref="PFAM:PF05019"
                     /translation="MVGYFLKDSVKLADKVENNQIDQNKSNNELVLEQSSKTKPRFTR
                     PPKNYANHIPLYTSEKIAMFVVSAIGSFLHPEKNQYIVALGESTAIPPFLKHLRQQML
                     DDPTGRQILRDRPNITSETLNLEKLASYGENTFGRTYYDWLKREKVSPDTRVPVRFID
                     DEELAFVFQRYRQCHDFYHALAGLPITREGEIAVKFFEFLNIGTPFAGMGAIFAPWNM
                     KKRSQRRRLLSIYYPWAIESAAHCKNNLINIYWEKIMDKDVGELREELGITKPPDMRE
                     LRRRERAERHNK"
     gene            <854553..>855401
                     /locus_tag="FOA43_002390"
                     /db_xref="GeneID:62195791"
     mRNA            <854553..>855401
                     /locus_tag="FOA43_002390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922687.1"
                     /db_xref="GeneID:62195791"
     CDS             854553..855401
                     /locus_tag="FOA43_002390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778615.1"
                     /db_xref="GeneID:62195791"
                     /translation="MNKVVDQVIGTPETFTTVSSDTQSHSHGSVSPQPGLSYTPSESL
                     DSYAGYNTVKQDPFDDEWSAELTMLIGDAKLSQAQTEVHAPTEAPTIANLAPLFIPLT
                     PNNSVQYSSLQANVDDSNPTTEHQVNEWDMCLQDIQIACASNTPITHKRSHDMQQIPM
                     KMVKRQRCISSKPELETPKSDESKNPEKLEDPSEKLKTRPRQENKFLKCFSYLKTNYL
                     NLCSTYNCLLVKYDNSEAEKVKLKIQNRELKGLMDGLLHEVNVLRAKERREKRATING
                     TWTQKL"
     gene            complement(<855513..>855977)
                     /locus_tag="FOA43_002391"
                     /db_xref="GeneID:62195792"
     mRNA            complement(<855513..>855977)
                     /locus_tag="FOA43_002391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922688.1"
                     /db_xref="GeneID:62195792"
     CDS             complement(855513..855977)
                     /locus_tag="FOA43_002391"
                     /note="BUSCO:EOG09344DQK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778616.1"
                     /db_xref="GeneID:62195792"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006262"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="PFAM:PF00383"
                     /db_xref="PFAM:PF08211"
                     /translation="MPPSIQPYTGKSPIANISDGQFKTLVEQAVDARKLSYSPYSHFA
                     VGCAILTEDNQIVIGSNVENASYGAAICAERTAIVKAVTSGHLLFKALVVSTNSDSCS
                     SPCGICRQVIREFSGPDLKLPIVMLDNKGEKLVVMSIEELLPVSFGPEDLVD"
     gene            complement(<856158..>856892)
                     /locus_tag="FOA43_002392"
                     /db_xref="GeneID:62195793"
     mRNA            complement(<856158..>856892)
                     /locus_tag="FOA43_002392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922689.1"
                     /db_xref="GeneID:62195793"
     CDS             complement(856158..856892)
                     /locus_tag="FOA43_002392"
                     /note="BUSCO:EOG09343GYX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778617.1"
                     /db_xref="GeneID:62195793"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF01121"
                     /translation="MLVVGLTGGIASGKSTVSKRLQNRYDLTVIDADRIAREVVVPGK
                     AAYSKIVKYFGPKIPDLVEAPNSVLNRAALGRYVFSHKEELKVLNSFTHPAVRNEILR
                     QILGCYIHFEKMCILDVPLLFEAGMDKMCGITLCVVCDRKIQLERLMNRNSELSKQDC
                     ENRIDSQMSNSEKICRADIVIDNETTIDQLYESLDHSIRQIQPSALWAYLEVICPPIA
                     VVSAGFCLLGRLLPVGIAAWLTSQVK"
     gene            <857518..>858467
                     /locus_tag="FOA43_002393"
                     /db_xref="GeneID:62195794"
     mRNA            join(<857518..857523,857577..>858467)
                     /locus_tag="FOA43_002393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922690.1"
                     /db_xref="GeneID:62195794"
     CDS             join(857518..857523,857577..858467)
                     /locus_tag="FOA43_002393"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778618.1"
                     /db_xref="GeneID:62195794"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="PFAM:PF00856"
                     /translation="MKTVPLTWMFSDHGSRFVEMLPSTTAKYVKSQHRQFLCDYSKVV
                     EFIHLYKTKLKITRSEFLWAWLACNTRCLYMELPNFLHCNVKENFTLVPYVDFLNHTL
                     EDHCTISINSQCFSVTTAKSHYGKSEQLFFSYGAHSDKILLCDYGFMLPYGQNRWNDL
                     DISSIILKLLKPHQKLFLQNENYYGDYTITKDSLSFRTEIALATLQEKDNTFIQLGLS
                     KQFKCPERLRKLIDGYSDGNYYKNRSEQLMEKIRRKIKDYYQKQLMVAKQMDSSITTD
                     KVIKSRLNTIKACYLNILLILS"
     gene            complement(<858555..>860876)
                     /locus_tag="FOA43_002394"
                     /db_xref="GeneID:62195795"
     mRNA            complement(<858555..>860876)
                     /locus_tag="FOA43_002394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922691.1"
                     /db_xref="GeneID:62195795"
     CDS             complement(858555..860876)
                     /locus_tag="FOA43_002394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778619.1"
                     /db_xref="GeneID:62195795"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MSRYAISQRFNSTIVEPVKGEKGHVVETGEVVDETDDVVNEFEG
                     SEIVEEVRASVEVLVESKVGGAGEAKGEADAGEAEVEADTEARADADAQAAPVSHDFA
                     PTSQVEDSLMHPKVKAAFMKIIGSTLTAVQQKSMNDFIESKAGIVVRAKTGTGKTYAF
                     GIPVMHDMVIHSYSKKNMNVNHFVNTVIFSPTRDLATQTSESLSKVWKLVSPRTYKND
                     IALIMGQMPKSINLRSFHKSDRIPRIVVATPGRFIDLFENESSFRNSMKHLKNIIIDE
                     ADELLNSNFKEDMTDIISGLQKVREPIPDAKDDIGRAKTMLFSATMDSDVFDLAKTAI
                     GEHFPFIDITDHGSEVNENISQSLEITDKIFESYAAAAKFIEDNKEDPNFKAIIFVST
                     TAGVDLAYRLIKDSVDNTIPIFQLHGKLAQGRRNSQQKGFRFRKNAVLVASNVAARGM
                     DFPNVSHVLQIGISPEASSHTHRIGRTGRAGKKGQALLIVTKSELPYVDTLKKQGNKF
                     TVEKEYEQDEEFESKLQNFTKEYEDLEQIIHSCLSSYASVPQEVARVKKDRIARDCSE
                     FYQSLIADETKKPYMSYRTASKIGMDTRILMKFFEVPRQRDNRGGNRDGDSDKGGYRG
                     GNSGGYRGGNSGGYRGGDRGGYKGGNSGGYRGGDRGGNSGGYRGGDRGGDRGGYRGGS
                     SGGYKGGNTGGYRSENRGGYKGDSSSSSHRYNNKRSDYSDKKFSEDAPEYTSDRTGNR
                     DFKSNSDHSFDKTNDSPKKDDWMTRTSKYRSED"
     gene            <861239..>862369
                     /locus_tag="FOA43_002395"
                     /db_xref="GeneID:62195796"
     mRNA            <861239..>862369
                     /locus_tag="FOA43_002395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922692.1"
                     /db_xref="GeneID:62195796"
     CDS             861239..862369
                     /locus_tag="FOA43_002395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778620.1"
                     /db_xref="GeneID:62195796"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="PFAM:PF02558"
                     /db_xref="PFAM:PF08546"
                     /translation="MSKNLYIFGSDANARFLASQFASRHDSWLRTSLLFHKDPILKNY
                     FINGSKITYENALNRFNPVRITYEIPALLRPEQERSSRQVPDRHIDNLIVTNPDLEKS
                     TALQEYKEYISEDTNVIFVNPGLGAVETATRGLLGHPHIWQALSTHIVENGKNFDIKH
                     LKAGDFRVCACPTSESFLDFVQLQEKLFPNDREVPMVIKKLLELPMLGALYFPYKEVY
                     TSQLEKVMVDCCIYPLVSLFETDLQRLSSIRSIERTISSIIDECLLVLGNLNRVKSLR
                     KVDPTINAILDKQRMFDIILQIIGTVNVKSPSFRNSKSTILQAKMLPSVGFSRRFDLR
                     STNGYIVKLGREQNIDTPVNRTLMDLVVGRQSIDNDNGEVIL"
     gene            <862696..>863970
                     /locus_tag="FOA43_002396"
                     /db_xref="GeneID:62195797"
     mRNA            <862696..>863970
                     /locus_tag="FOA43_002396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922693.1"
                     /db_xref="GeneID:62195797"
     CDS             862696..863970
                     /locus_tag="FOA43_002396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778621.1"
                     /db_xref="GeneID:62195797"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MLFVETIIDLEPAFKEACSESVTIDVTHNRVESRVESRSIRIDF
                     ESRTIETNDSFGSKSIFNLFADNNRVNKTLQRFDSKEFNYGYNQKLLNVFRDSPTRDV
                     ITPAKLMYRNETTVEPQQTFQSLFGVGMLDNLLQRAHLESIYDDVQLPDSWMIGGEHN
                     DHTEEFLFEGISFKSENTEKLLANRNGFNPNDSKFRIASSLAGSGGIDYLEGISTRPT
                     TQDFRIPVFNFNESMKLGMKEKKGNGKKPKTPEAADLPEVSINTDDSIDEDYREGSSC
                     SIFEPVKRKKGRPKGSKNSVKKIRLPKKRGRKPKRETSEEPSIKKYKKTSGPRKKTGC
                     WTCRLRRKKCTEERPECAECIRLGLTCQGYNKDRPVFMTNPSLAREMTDEIKKITLTQ
                     KRRGCKQRYEEKMRMKNSIKLVSQDATIDEPI"
     gene            complement(<864106..>867002)
                     /locus_tag="FOA43_002397"
                     /db_xref="GeneID:62195798"
     mRNA            complement(join(<864106..866960,866996..>867002))
                     /locus_tag="FOA43_002397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922694.1"
                     /db_xref="GeneID:62195798"
     CDS             complement(join(864106..866960,866996..867002))
                     /locus_tag="FOA43_002397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778622.1"
                     /db_xref="GeneID:62195798"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="InterPro:IPR019458"
                     /db_xref="PFAM:PF10373"
                     /db_xref="PFAM:PF10374"
                     /translation="MIPSNVSNVSNTSTDAPNASIDSIDSLLISNKAKIKEILNHSYS
                     NDDSLLFGTLSLLQSRCISYILHGFVNASKDDDSSSIQLAQNVNPSSPIMSSEEVIGR
                     IWIDIHHPSIKYFQAQFLYANKDLSNRRDRRGRHSGSPSSSIVEIRKLFDHFVKFISR
                     CREFYLTLLHDILRRYDLSIYIPVRKVCTTLKLDETEFISHSDCQTASDIVPKVVYVV
                     HKCVLYIGDLSRYRAFIAKTYLPSTAISKEDNNNYSKSIELYKLSLLILPSLGDPYNH
                     IAIIDNFKDDKFNVVYNFVRSSMTSSPLSVGFNNLINLLAKQPKQNSILHKFESHNAL
                     DRDTITKNDRMELLKSQFLVLLSYYLLPNKWKMKEGFLVKGYDIHGIETDFYHLLAKL
                     DFHKQIFNDFYFKQLAILTGGFEILIDRRMAHLDLRQTPQSISSYLDFIFRYLLTLLK
                     VLLLNLNKRSTTPNISTSLLPVTRLMLCWMKERELARYYLLQNLPCTNALAEIFNSAV
                     IFFKENSGVLDEVDSGSYKELLTSGKLFEDRPSRRRLFKEDVTLKEFKPVNFYLSDFD
                     DDHLYRKDETATLALIGELPNESHKSMKLNDNMLRLIAICCLAKKLVMQNTVGIVFSE
                     DTGLFSLKYETDLCLESGTNSNVVKPISERATDGVIGGNEYSAERFRRRKPAVRSNTY
                     RAQKQYEADITEGQGLEDSLFNAEARRTDTKGGVAQSGRFVDMVSSLVSKDSVSSEKQ
                     APPVTGKQPLTNSGVDQPFNLLSRSIWSNQPAKSDSSAPIKVADSIHSSTSSNSPSIA
                     PEASNQVPMKPMLFPQYNLNYLNGFNGLSVPTQVQPPMQQTNQTQPQEQPYMFNSGGM
                     ATPVMAPAMSPMDLNLNMNMAMSSLMLNTGSNLSGIPFNSFQQSSSDQAQRTRTQTQP
                     QQNQQVLNEPVNATIRHNTHSLFRDEFGTNQGTGHQYSF"
     gene            <867464..>869800
                     /locus_tag="FOA43_002398"
                     /db_xref="GeneID:62195799"
     mRNA            <867464..>869800
                     /locus_tag="FOA43_002398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922695.1"
                     /db_xref="GeneID:62195799"
     CDS             867464..869800
                     /locus_tag="FOA43_002398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778623.1"
                     /db_xref="GeneID:62195799"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="InterPro:IPR032880"
                     /db_xref="PFAM:PF02714"
                     /db_xref="PFAM:PF13967"
                     /db_xref="PFAM:PF14703"
                     /translation="MARLNYLSASNRKYLPPAIKRTSLFGWISTLYRITEDEVIEYAG
                     LDAYVFLGFFKMAFKLLSVCWLVSAIVISPIRYYFTGDYDDDNGKDPEVPEYRLQTDG
                     TLLIDSKKAYLVLYLIFTYVFTFVALHFLMEQTTKVIQKRQQILGQQNSVTDRTIRLT
                     GVPPELRSERALKETIDSLGIGKAEKIVICKEWKKLDGLFRQRSDVLERLERAWAEYL
                     GNDSKQTFNIRPFATTSYPMVYRDEESLPGEQVVPGEQTGLGEQTEPAVDAVPGEQTE
                     PAIDAVGSVDSISSVSGIRKRPLIRLGLLGLWGRKVDAIDHYTKQLHAVDNEILSARE
                     RHYASTPTAFVTLDSVAAAQMFAQAVVDPRIGYMITTPAPAPRDIVWENLTLPSHSRK
                     LKQSYITVITGILAVAFIVPVGYLATLLNMKSIRRFWPALGELLDDHPWAQDFVIDLL
                     PVYLYTLLNFVIPYIYVWLSSKQGFVSYGEEELSVVSKNFFYVFVNMFLVFTMAGTAS
                     NYWGYLSDSKKLALQLAASLRGLSAFYVDTILLQGLALHPLKLLLTGQLFRFPVFRAN
                     CKTPRHYMNLYTPPDFNFGLNLPIPMLTLIITLLYSVMSTKILSAGLAYFIIGFYVYK
                     FQLIYSCIHPQHSTGQVMPIIFRRVILGLLLFQLTVAGSLVLSNAWFFSVCLTPLPFI
                     TLTYLWYFQKNYQPLSYFIALRAIERSDEEVEGSESHSEIAQKSSTIDERRELNQTYE
                     YPNLIQELDGPWLAVEGNQIVMATGDGIARKRLTFEEY"
     gene            <870869..>871810
                     /locus_tag="FOA43_002399"
                     /db_xref="GeneID:62195800"
     mRNA            <870869..>871810
                     /locus_tag="FOA43_002399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922696.1"
                     /db_xref="GeneID:62195800"
     CDS             870869..871810
                     /locus_tag="FOA43_002399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778624.1"
                     /db_xref="GeneID:62195800"
                     /translation="MFGQHGFNNTSSPFGGSAASNPFGGSAAPSSLGGSTAPNPFGSN
                     SASPFSTQNPVASSFGQAASPFGQSGFGQHGFGQSGQSGPTGQAGQNPFGSSAFNKSA
                     FGNFAQSTTQSTSPFATLMSQSNGKSTPTASTAFGSNAFQSTGGAAFGGSGGASKSAF
                     GASSSPFGAATSTGGAQPAFGASSSPFGTATSAGGDRPTFGASSSPFGAATSAGGAQP
                     AFGASSSPFGAATSTGGAQPAFGASSSPFGAATSTGGAQPAFGASSSPSGTFKQAPVD
                     DPPTEKNSLSQEILNYFKADSFQLGKVPDIPPPLEMC"
     gene            complement(<871813..>873696)
                     /locus_tag="FOA43_002400"
                     /db_xref="GeneID:62195801"
     mRNA            complement(<871813..>873696)
                     /locus_tag="FOA43_002400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922697.1"
                     /db_xref="GeneID:62195801"
     CDS             complement(871813..873696)
                     /locus_tag="FOA43_002400"
                     /note="BUSCO:EOG09340SPF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778625.1"
                     /db_xref="GeneID:62195801"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013825"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="InterPro:IPR034144"
                     /db_xref="PFAM:PF01131"
                     /db_xref="PFAM:PF01751"
                     /translation="MHILCVAEKPSIASSVARTLSGGNSRTRQVKGKAGRFARNIDFT
                     FDFPEFGRCDVTMTSVAGHVTNIDFPDQYSWGHCNPEALFDAPTIIKVGNPVIADNIT
                     KEAQNCDLLMIWTDCDREGEYIGWEIVQQASIRNRGMTLESAYRARFSHLERSHVIYA
                     AKHPVRLDKKAIEAVKTRMELDLRTGACLTRFLTGLFGRVLDKGSPMVSYGGCQFPTL
                     GFVVDRYKRIKMFKKEPFWQISLAFKKKQKQCLMTWERGHLFDRLVTVCIYQNCLKLE
                     PESATVIGVDTKPTSNWAPLPLTTVEMQKDCGRFFKLTAKDTLSAAETLYTKGFISYP
                     RTETDTFPKAMDLRKLVEKQVESSKWGAYARSLLDDTGNFRQPRTGKHSDEAHPPIHP
                     IILAGEQASLTSVQKTVYEYVVRRFLACCSPDAKGLKSSIRVKWGTEVFRAAGLVVTS
                     NGYLEIFIYSKWKSSRTSLPEVELNERVKLCKVLVTEGSTEPPKKLTETELIALMDAN
                     GIGTDATIAEHIDKIKSRNYVIMQKTSEGRSKTSVIVPTELGYGLVEGFNRLGLIKIS
                     LTKPFLRRMLETKLKYICEGQVSRKDVLAETISLYREAYTLMTRQQSLLLQSYKEAIR
                     TND"
     gene            complement(<874781..>876103)
                     /locus_tag="FOA43_002401"
                     /db_xref="GeneID:62195802"
     mRNA            complement(<874781..>876103)
                     /locus_tag="FOA43_002401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922698.1"
                     /db_xref="GeneID:62195802"
     CDS             complement(874781..876103)
                     /locus_tag="FOA43_002401"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778626.1"
                     /db_xref="GeneID:62195802"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="PFAM:PF00498"
                     /translation="MPTSSQHPRSISPLKTHVHVVKLSSFEKPSEYLKILAVPESPES
                     LKIGRQNMPKATNKITDGFFDSRVLSRNHAELFIRDNKLFIRDLKSSNGTFINDVKLD
                     PYKDCQLKIGDKLDLGTTLESQVAHKKITCTIAEFNYVSLQDYQKLVSKTLQKDDFAA
                     KRLELFNSTVDALIFGELVDERQEDSLLALLGSEDDETKAKVKVEVKENGASSRPSFG
                     DPFVSGLHVKPSSSMQDIIRKLAIAVNNEFVQQQRLQQMGVFLRNYNDLLMRSDHSAD
                     SLRPSTSSRPSTSSHPSSSSVSRIKSLEQEFEQELVELRKTKGLLKEKETETEQLKRQ
                     IQGYKQQLSEQQRKTTEMNLKQVDLEQKLDIAMAEVSEYSKQLNQSRTVEKKLNSQLE
                     ELQTKQKVSLVDERVDVEVASRYIHWQGRLFIVSLSVVFLAYIGTQLV"
     gene            <876595..>877746
                     /gene="HOG1"
                     /locus_tag="FOA43_002402"
                     /db_xref="GeneID:62195803"
     mRNA            <876595..>877746
                     /gene="HOG1"
                     /locus_tag="FOA43_002402"
                     /product="MAPK protein hog1"
                     /transcript_id="XM_038922699.1"
                     /db_xref="GeneID:62195803"
     CDS             876595..877746
                     /gene="HOG1"
                     /locus_tag="FOA43_002402"
                     /note="BUSCO:EOG0934257A"
                     /codon_start=1
                     /product="MAPK protein hog1"
                     /protein_id="XP_038778627.1"
                     /db_xref="GeneID:62195803"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR038783"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSLQDFVRTQIFGTVFETTPRYTDLNPIGMGAFGLVCSARDNLT
                     DKSVAIKKVMKPFSTPVLAKRTYRELKLLNHLRHENLISLEDIFLSPMEDIYFVTELQ
                     GTDLHRLLASRPLEKQFIQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKIC
                     DFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDTEVDIWSAGCIFAEMIEGKPLFPG
                     RDHVDQFSIITKLLGSPPADVINTICSENTLKFVQSLPHRDPVPFEERFKGVDPEAID
                     LLSKMLIFDPKKRITAAQALDHPYLAPYHDATDEPIAEERFDWSFNDADLPVETWKIM
                     MYSEILDFHEIEGAEALQNNNLVQGQYESDMVQQQQLLQQQSNGDQPEK"
     gene            <877879..>879030
                     /gene="MVD1"
                     /locus_tag="FOA43_002403"
                     /db_xref="GeneID:62195804"
     mRNA            <877879..>879030
                     /gene="MVD1"
                     /locus_tag="FOA43_002403"
                     /product="diphosphomevalonate decarboxylase"
                     /transcript_id="XM_038922700.1"
                     /db_xref="GeneID:62195804"
     CDS             877879..879030
                     /gene="MVD1"
                     /locus_tag="FOA43_002403"
                     /note="BUSCO:EOG09342TER"
                     /codon_start=1
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="XP_038778628.1"
                     /db_xref="GeneID:62195804"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="InterPro:IPR036554"
                     /db_xref="PFAM:PF00288"
                     /db_xref="PFAM:PF18376"
                     /translation="MYSVSVTAPVNIATLKYWGKRDSVLNLPTNSSISVTLSQDDLKT
                     TTTVSCSDSESYSVDQLYLNGKLESLESLRSQKCLGELRKYRSEMEAKDGSLPRISEW
                     PLRIVSVNNFPTAAGLASSAAGYAAMVYGIARLYRLPLDRSELSKIARQGSGSACRSL
                     YGGFVAWEMGSKKDGTDSRAVQIADVGHWPGIRAAILVVSASKKEVPSTGGMQLTVGS
                     SDLFEYRVKNVVPPRYKEMEQSIIKKNFEKFAELTMRDSNSFHAVCLDSYPPIFYMND
                     TSKRIVKLINELNKSQGRNVAAYTFDAGPNAVIYYEEKDEHLVLGVLNEFFGHLPGWD
                     KKRSINYSLPDRFPIDLFNKDIFSQGVSSVILTGIGEGPKETQEVLKMP"
     gene            complement(<879836..>880392)
                     /gene="COF1"
                     /locus_tag="FOA43_002404"
                     /db_xref="GeneID:62195805"
     mRNA            complement(join(<879836..880173,880205..880254,
                     880327..880337,880390..>880392))
                     /gene="COF1"
                     /locus_tag="FOA43_002404"
                     /product="cofilin"
                     /transcript_id="XM_038922701.1"
                     /db_xref="GeneID:62195805"
     CDS             complement(join(879836..880173,880205..880254,
                     880327..880337,880390..880392))
                     /gene="COF1"
                     /locus_tag="FOA43_002404"
                     /codon_start=1
                     /product="cofilin"
                     /protein_id="XP_038778629.1"
                     /db_xref="GeneID:62195805"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="PFAM:PF00241"
                     /translation="MSRSGVGVSDEALKAFNDLKLVSDDKTKIVVDKTSSDESYDVFL
                     EELPENDCKYAVYDFEYEIGPNEGKRNKIVFFQWSPDTASIRAKMVYASSKDALRRAL
                     NGVSADIQGTDFSEVAYDSVLDRVSRGAGSH"
     gene            complement(<881088..>882362)
                     /locus_tag="FOA43_002405"
                     /db_xref="GeneID:62195806"
     mRNA            complement(<881088..>882362)
                     /locus_tag="FOA43_002405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922702.1"
                     /db_xref="GeneID:62195806"
     CDS             complement(881088..882362)
                     /locus_tag="FOA43_002405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778630.1"
                     /db_xref="GeneID:62195806"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023382"
                     /db_xref="PFAM:PF03054"
                     /translation="MLRTITTLSRFHTSYSLPPGYIQPRPNPQDEIVISMSSGVDSSV
                     SALLYSQKYEHVRGIFMANWSSSADGHVGSACNRDDGQKGKNSSCSVDQDWDEVQATC
                     SQLRIPCERVNFEKEYWTDVFEPMLEMYSKGLTPNPDVGCNKYIKFGKMIEHLQSYYE
                     RRQLLSSSKWWLVTGHYARVLQKESTGEFQLFRAGYKPKDQSYYLSQIPESVLGRILL
                     PMGHHTKPEVRRMAGENGLVTRDKPDSQGLCFVSPSVKFDDFLDEYIEANPGDIVDTS
                     GKIWGRHRGLWHGTIGQRSGISMPQGDPRYKGVWLISDKDIDRNRMIISRKDDREAFI
                     KRRIEVQDWHWMNAGLKIGEVAKGRSLNAQIRSLQQPSKVIRVIQKQQNPEQLVVDVE
                     DGIFGVAPGQDLVLYDGDRVLGCGMISGQALG"
     gene            <882711..>883538
                     /locus_tag="FOA43_002406"
                     /db_xref="GeneID:62195807"
     mRNA            <882711..>883538
                     /locus_tag="FOA43_002406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922703.1"
                     /db_xref="GeneID:62195807"
     CDS             882711..883538
                     /locus_tag="FOA43_002406"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778631.1"
                     /db_xref="GeneID:62195807"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="PFAM:PF02453"
                     /translation="MSSKPTKSSCCAADPCTRTSGKDLLTWKDPVASAEIFVASTSLL
                     LIYKYTDFVSWTFYLTTLLLSFTALAEYSGKLLTGEGLVTKFKPAQSTSIGDFLQAHA
                     SILASAFKDLEIKIQNLFTAVNIETTLKAALASYFLYFLTSLLSVWTILFASTVSAFS
                     VPPIYLANKDTIDSSIKECSELAKEKSANAYKSVKAQAEPTLKKVQHAISPVTDYVKS
                     KIPVRTAGSTVKTTIDEIPVAKPPKATEVSEEVPAAHVASAADIKSASTSEKEPLLN"
     gene            complement(<883574..>884442)
                     /gene="RAS1"
                     /locus_tag="FOA43_002407"
                     /db_xref="GeneID:62195808"
     mRNA            complement(join(<883574..884371,884434..>884442))
                     /gene="RAS1"
                     /locus_tag="FOA43_002407"
                     /product="Ras GTPase"
                     /transcript_id="XM_038922704.1"
                     /db_xref="GeneID:62195808"
     CDS             complement(join(883574..884371,884434..884442))
                     /gene="RAS1"
                     /locus_tag="FOA43_002407"
                     /codon_start=1
                     /product="Ras GTPase"
                     /protein_id="XP_038778632.1"
                     /db_xref="GeneID:62195808"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MSTSKEFRLVVVGPPVVGKSALTIRLTQSEFANEYDPTIEDSYR
                     HYCEINGVQSSLDILDTAGQEEYSSMRDLYMKTGEGFLLVFSLVDRHSFEEISTFYNQ
                     IMRVKGELVSFVPLMLVGNKNDLENERQVSKEEAISLAKKFNASYIETSAKTGENVVE
                     AFHGLVKVIMHNSVLGAGLAGTLYPNLKEEREAQAREIAEQKKKQKAGRKNDNSGSTA
                     GSGGNDDAGNGNQRVGSSTRGAQGNKSGGKRARSSEQPESKEGGGCCLIV"
     gene            <884783..>886495
                     /gene="HAS1"
                     /locus_tag="FOA43_002408"
                     /db_xref="GeneID:62195809"
     mRNA            <884783..>886495
                     /gene="HAS1"
                     /locus_tag="FOA43_002408"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_038922705.1"
                     /db_xref="GeneID:62195809"
     CDS             884783..886495
                     /gene="HAS1"
                     /locus_tag="FOA43_002408"
                     /note="BUSCO:EOG09341GAQ"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_038778633.1"
                     /db_xref="GeneID:62195809"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF13959"
                     /translation="MARTGRKRSRKSTGNVPETKKLKKDDDNGTLEDVESTNTDEIVD
                     KIDNEFADVEKLLEKNENSHRSREPEAESEVELEQSEADRAPKPKPNSPTNPLTEASS
                     DPNLPNLFTELELSAATLKGIKDMGFEKMTEVQARTIPPLLAGKDVLGAANTGSGKTL
                     AFLIPAIELLYSLKFKPRNGTGAIVITPTRELALQIFGVARELMANHSQTLGIVIGGA
                     NRRQEAEKLSKGVNLLIATPGRLLDHLQNTEGFVFKNLRSLILDEADRILEIGFEDEI
                     RQIVRILPNENRQSMLFSATQTTKIEDLARASLKKAPVYINVQESKDTATVAGLEQGY
                     VVCESDKRFLLLFSFLKRNMRKKKVIVFFSSCNCVKYFAELLNYIDIPVLSLHGKQKQ
                     QKRTNTFFEFCNAKSGILLSTDVAARGLDIPDVDWIIQFDPPDDPRDYIHRVGRTARG
                     TKGKGKSLMFLIPQELGFLRYLKAAKVPLNEYEFPNSKIANVQSQLEQLIKNNYWLHQ
                     SAKDGYRAYLQAYASHHLKTVYKVDLLDLAKVGRSFGFLVPPKVNITIGSSTTKPRTK
                     KRRQ"
     gene            complement(<886590..>888377)
                     /locus_tag="FOA43_002409"
                     /db_xref="GeneID:62195810"
     mRNA            complement(<886590..>888377)
                     /locus_tag="FOA43_002409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922706.1"
                     /db_xref="GeneID:62195810"
     CDS             complement(886590..888377)
                     /locus_tag="FOA43_002409"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778634.1"
                     /db_xref="GeneID:62195810"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF13520"
                     /translation="MMSSAFRKFQGFALGAIIGSPITSSSVDEEKGNQITKDDVAQDT
                     NGAPVEKKSPLGYDVTAFSTFYLIVQGVLGTGIFATPATILESMGSIGSTYVIWTVGF
                     IVVLLQVFMYVEYSSYFRHRSGAEVVYLEQAYPKPRFMIPVLYAAISVCLSFATSSAS
                     AFATYIFKASGRDATAWERRGLGVLSLVLAAAITATNTKFAIKLNNLIGFVKVVFILF
                     VALSGFATLAGSTQTPKAAAHAVFKDAWKGTTTDGNSISNAILKVIFSFEGCNYAFGV
                     VAESHPKNTIRTYSILIPFTMFFIYILYILAITAYYAGVADITEIKESGNLIAAVYFE
                     KIFGTNSAVTAMSAFVAISAFGHLLTVYISHSRTLRECGRQGVLPYPRIWTSVKPLGT
                     PLFPILVTFIVNLIVLLAPPPGDAYNFVVDLGSYSTYIFNAMLSFGLFKLRRHRSKIG
                     LGYQEFHIPAPLLALLFLFSLFVIAMAFVPPEGTLIGSDVSFFYATYPITTIGIFLFC
                     IGYYFVWEYVLPKIGKYRHRLSKFELAKGENGHKVIKVALSDLEEWDREHKDQDQDQE
                     TSAGPEQDIDGIYKNDSVQITSTSASGKD"
     gene            <889056..>890318
                     /locus_tag="FOA43_002410"
                     /db_xref="GeneID:62195811"
     mRNA            <889056..>890318
                     /locus_tag="FOA43_002410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922707.1"
                     /db_xref="GeneID:62195811"
     CDS             889056..890318
                     /locus_tag="FOA43_002410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778635.1"
                     /db_xref="GeneID:62195811"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="PFAM:PF02668"
                     /translation="MTTKLLFGKLPVNFEESDLKKSQNEGKDLIARSGKKEGVYTLSS
                     ELLEKLQSPRFAPVWETNQELAFKPIKPFRHTDRGYFGDPSFDSLFKKTGARKKLLSP
                     KLGLEIDGLQLSKLTPRQKDDLALLVEKKGVIVFRNQDFKELSFEDLKKWGQYYGPLH
                     VHNSSGAPLNEPDFHLIFDFRDKEGKNRFFDRHNSFITWHSDVTYESQPAGITALAML
                     QTGEGGDTQFIDTIEAYDRLSPTMKVFLDGLQAVHTSKEQIEGAKSGGGIERKPIVHT
                     IHPVVRYHPVLKKKALFVNGSVGGSLGGFTRKILGLKDEESDALLRFLLGHLRTCLDA
                     HIRASWDDKTVVVWDNRRVIHTATSDLEADSIRHAFRVTPVAERPVANEKEFNEWTPE
                     KEKELIKHTQEYLQLTPEEYYNKFYSTK"
     gene            complement(<890378..>891439)
                     /gene="FOL2"
                     /locus_tag="FOA43_002411"
                     /db_xref="GeneID:62195812"
     mRNA            complement(<890378..>891439)
                     /gene="FOL2"
                     /locus_tag="FOA43_002411"
                     /product="GTP cyclohydrolase I"
                     /transcript_id="XM_038922708.1"
                     /db_xref="GeneID:62195812"
     CDS             complement(890378..891439)
                     /gene="FOL2"
                     /locus_tag="FOA43_002411"
                     /codon_start=1
                     /product="GTP cyclohydrolase I"
                     /protein_id="XP_038778636.1"
                     /db_xref="GeneID:62195812"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="PFAM:PF01227"
                     /translation="MSRKDFIDKDIDRRVAQINISSASTEPTGLPVSTGSAGSFTSVG
                     SVGSVGSMSSIGSNKHTSSPLSRPVKPSYSHEGLPNSAIDYCVPNDMNDRYNENPDDT
                     VPTLPYQPKPIRNQSHSRAFSTPLNTRPASPYTLNPPIDADGLSWPSIGARKRIDSTP
                     EEAVQRQKKIEDAIRTILIELGEDVNREGLIRTPERYAKAMLFFTKGYEDNIKDVINQ
                     AVFEEDHDEMVMVKDIQIYSLCEHHLVPFYGKVHIGYIPNKRVLGLSKLARLAEMYAR
                     RFQVQERLTKQIALALSQILHPRGVAVVIEATHMCMVSRGIQKTGAVTCTSCMLGCFR
                     SQQKTRDEFLALLNRNASI"
     gene            <892167..>893396
                     /locus_tag="FOA43_002412"
                     /db_xref="GeneID:62195813"
     mRNA            <892167..>893396
                     /locus_tag="FOA43_002412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922709.1"
                     /db_xref="GeneID:62195813"
     CDS             892167..893396
                     /locus_tag="FOA43_002412"
                     /note="CAZy:GT21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778637.1"
                     /db_xref="GeneID:62195813"
                     /db_xref="InterPro:IPR025993"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF13506"
                     /db_xref="PFAM:PF13641"
                     /translation="MQLCLRSSFEQDYPVDQLEIIFCIQDPHDPAIEIVQYLISQYPK
                     IDAKLMIDDTSGGFPDNYGPNPKINNLSKGYKAAKYDVLWVIDSNAWARPDTLKRSIY
                     SMVHNLHNGRKVNGSKRVKMMNHIPLAVALDDTSMGCYLDEMFLSSSHAKFYVSLNTL
                     AVAPCVNGKSNIYRRSDLDHAVARMGEQASHESVDGLSGNNFSDARYYGSHPGEGIRF
                     FARYIAEDNMIGQALWDYVGGRAGMSTDAVVQPLGGTNTLSDYINRRVRWLRVRKYMV
                     LAATLVEPATECLMSGLIGSFSLSVIFWQCKFNVLYFSLHVLIWFLVDYCQFHLLASY
                     VKALPTDGTSWQFPYFLRTSYHCQGGLMSVAQFIPVWITRELLAFPIWLIAMIGSRID
                     WRGQPFKIKADLTAERL"
     gene            <893590..>895059
                     /locus_tag="FOA43_002413"
                     /db_xref="GeneID:62195814"
     mRNA            <893590..>895059
                     /locus_tag="FOA43_002413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922710.1"
                     /db_xref="GeneID:62195814"
     CDS             893590..895059
                     /locus_tag="FOA43_002413"
                     /note="BUSCO:EOG09341Y2Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778638.1"
                     /db_xref="GeneID:62195814"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01704"
                     /translation="MIASTMNSVKRAYLSAGQEHLFKYWNELTDDERSSLMEQLSNIP
                     DPAKFLQDVQNAMDYSSSISESREFEPLPKSTSYSSVLDSSKDTLEAWNNKGLELIAK
                     SKVAVVLMAGGQGTRLGSCNPKGIYDVGLPSHKSLFQLQCERIIKLKQLAASKSLKKD
                     FQISLPLYVMTSCPTRVATETFFVDHAYFGLPSGDVIFFNQGTLPAVSLDGKKFLLSS
                     KSSLYQSPDGNGGFYKALHDNQIVEDFEKRGIEHVHAYCVDNILVKVADPVFLGYSAL
                     GNYQVTTKVVRKSDPLEKVGLIVLDKNTQAPCVIEYSEITEQLSQKRDPTDAHLLYFR
                     AANIVTHYYKVDFLKQMVPEWISSRKHLPYHIAKKKINYLDSTSDSILTPKEVNGLKM
                     EQFIFDVFQSVKLDRFGCLEVDRSLEFSPLKNSSGTGFNCPETCRKDCLRRSTGWIIA
                     NGGKVDTSDSLVEISPLTSYNGEGLEFSSGRIYKNEEII"
     gene            <895345..>897930
                     /gene="GPH1"
                     /locus_tag="FOA43_002414"
                     /db_xref="GeneID:62195815"
     mRNA            <895345..>897930
                     /gene="GPH1"
                     /locus_tag="FOA43_002414"
                     /product="Non-essential glycogen phosphorylase"
                     /transcript_id="XM_038922711.1"
                     /db_xref="GeneID:62195815"
     CDS             895345..897930
                     /gene="GPH1"
                     /locus_tag="FOA43_002414"
                     /note="BUSCO:EOG09340BGW;
                     CAZy:GT35"
                     /codon_start=1
                     /product="Non-essential glycogen phosphorylase"
                     /protein_id="XP_038778639.1"
                     /db_xref="GeneID:62195815"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="PFAM:PF00343"
                     /translation="MSFDSGLSGRFHKRSMTGFTPTEIKAIDQSIPIKAREAWTKYAA
                     REFTSPDQLESQIINHVETTLARSMYNCDSLAAYQALSTSIRDKLILHWNKTQQMHTL
                     REVKRIYYLSLEFLMGRALDNAMINLGIKELCCKSTDELGFNLEDVIDVEPDAGLGNG
                     GLGRLAACFIDSMSTGNYPGWGYGLRYNYGIFSQKIVDGYQVEAPDYWLKFGNPWEIP
                     RHEIQIPVDFYGYVSTTTDPKTGKSKKQWQGGEQVLAVAYDFPVPGYNTSNVNNLRLW
                     SSQPTSEFDFQKFNQGDYDSSVAQQQRAESITAVLYPNDNFYQGKELRLKQQFFWVAA
                     SLHDIVRRFMKTKKKWSEFPDLVAIQLNDTHPTLAVVELQRILVDLEGVEWNEAWEIV
                     TRTFGYTNHTVMQEALEKWPLDLFGNLLPRHLEIIYSINMQFLQMVAKRFPQDRELIR
                     NVSIVEESDPKNIRMANLAIIGSHKVNGVAELHSELIKTTIFKDFVKVYGAEKFTNVT
                     NGITPRRWLKQANPMLSDLITSKLGSDEFLTNTVRLKQLEKFIDDPEFREAWIEVKLH
                     NKKRLAQLIKKLTGIEVNPSSLFDVQVKRIHEYKRQQMNIFGVIYRYLQIKATPESER
                     AGKFFPRTSIIGGKAAPGYYAAKKIIKLVNSVAEVVNNDPDSKGFLQVVFIPDYNVSK
                     AEIICPASDISEHISTAGTEASGTSNMKFVINGGLIIGTVDGANVEITREVGEDQIFL
                     FGNLAEDVEELRQDHQMGKLEVPEPLEQVFDEIEKGTFGPYDEYKSLVDSVKYHGDYY
                     LVSDDFESYLEAQSTIDKEFRDRENWVKKSIICVANMGFFSSDRCIREYAENIWNVEP
                     VTDQV"
     gene            <898150..>898468
                     /gene="RPS21B"
                     /locus_tag="FOA43_002415"
                     /db_xref="GeneID:62195816"
     mRNA            join(<898150..898173,898229..>898468)
                     /gene="RPS21B"
                     /locus_tag="FOA43_002415"
                     /product="ribosomal 40S subunit protein S21B"
                     /transcript_id="XM_038922712.1"
                     /db_xref="GeneID:62195816"
     CDS             join(898150..898173,898229..898468)
                     /gene="RPS21B"
                     /locus_tag="FOA43_002415"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S21B"
                     /protein_id="XP_038778640.1"
                     /db_xref="GeneID:62195816"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /db_xref="InterPro:IPR038579"
                     /db_xref="PFAM:PF01249"
                     /translation="MENDKGELVELYIPRKCSATNRIIKSDDHASVQINVANVDENGR
                     AIPNSYITYALCGYVRVRGEADDSLNRLAQQDEIVHNVWTYSR"
     gene            <899473..>900810
                     /gene="TIF1"
                     /locus_tag="FOA43_002416"
                     /db_xref="GeneID:62195817"
     mRNA            <899473..>900810
                     /gene="TIF1"
                     /locus_tag="FOA43_002416"
                     /product="translation initiation factor eIF4A"
                     /transcript_id="XM_038922713.1"
                     /db_xref="GeneID:62195817"
     CDS             899473..900810
                     /gene="TIF1"
                     /locus_tag="FOA43_002416"
                     /codon_start=1
                     /product="translation initiation factor eIF4A"
                     /protein_id="XP_038778641.1"
                     /db_xref="GeneID:62195817"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MSEETTPVAPIAETIETTEKTPVTEVDAAAAAPADAAAPVEAAA
                     PKEHENITAGPQIDANGMETNYDKIVYTFDELNLKPEILRGIYAYGYEHPSAIQQRAI
                     APIIEGRDVLAQAQSGTGKTATFAIAALQNIDEKLKETQALIIAPTRELAMQIQKVVL
                     AIGMHLDITVHASIGGKAVSDDIEALKKGAQIVVGTPGRVYDMIERGFFRTENVKMFI
                     MDEADEMLSSGFKEQIFNVFRFLPQETQVVLLSATMPQDVLEVTSKFMRNPIRILVKK
                     DELTLEGIKQFYVDVDEEEFKFDCLCDLYASISVTQAVIFCNTRRKVEALTEKLIENK
                     FTVSAIHADLSQQERDTIMTEFRTGSSRILISTDLLARGIDVQQVSLVINYDLPTNKE
                     NYIHRIGRGGRFGRKGVAINLLAKNDIPAMREIEKFYSTQIIELPANISELFD"
     gene            complement(<900923..>902233)
                     /locus_tag="FOA43_002417"
                     /db_xref="GeneID:62195818"
     mRNA            complement(<900923..>902233)
                     /locus_tag="FOA43_002417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922714.1"
                     /db_xref="GeneID:62195818"
     CDS             complement(900923..902233)
                     /locus_tag="FOA43_002417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778642.1"
                     /db_xref="GeneID:62195818"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="InterPro:IPR033122"
                     /db_xref="PFAM:PF07766"
                     /translation="MLSRSLCSVRFVSRRVPSLLLVSRNSYVGFRGYSTGLNKGAEPT
                     KVSKPAKPTKSTPASTSKLITTTATSPKLTLGQKVSREVKHYWHGTKLLGYEIKLSTR
                     LLIKMLSGYELSRRETKQLTTTTADILRLIPFSVFVLVPFAELLLPVALKIFPNLLPS
                     TYESEAEKKKKVKVLGQTRKKASTFIRKTVQESGLQIPKVDDDKKKLFTEFFQTLNKG
                     LKPSHEHLIQIARCFKNDQVLDNLSRPQLMAMAKYMGLTPYGTDELLRYQIRNKLVRI
                     IKDDRAIDYEGVDSLTIPELKTACSSRGIRTSDASPARLRDDLNTWLDLRLRRKIPSA
                     LLILSSTFTYGEHANDMESYYDALLSVLSSIPDELYNMTKLEMFQDDDKLKLNILKEQ
                     DMLIQEENEQSKGIVKNVKDDLNVDDIENEHEGSSEQSEQRPQK"
     gene            <902781..>906381
                     /locus_tag="FOA43_002418"
                     /db_xref="GeneID:62195819"
     mRNA            join(<902781..903246,903905..>906381)
                     /locus_tag="FOA43_002418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922715.1"
                     /db_xref="GeneID:62195819"
     CDS             join(902781..903246,903905..906381)
                     /locus_tag="FOA43_002418"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778643.1"
                     /db_xref="GeneID:62195819"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013715"
                     /db_xref="PFAM:PF00169"
                     /translation="MVEYFLYNYDPLEQRKMLAVIMENSGIGDARNAPNLDRQVAVWK
                     RILFSQLIFINFLAIMDHIYNYQGEFFPKRVVNSEKLPNWAEWVANWINQDCRYRLDN
                     YSDGRNHFKFGSVFISFIGEMSPYNKSALLIMDLMIPLFQYVMFIMALGQERDTFNAS
                     LYGPNPSTTSIPPQPSMFANSAVLPLDDYHSPYYMPIRSIDDPRPVEQLIRRFSVWKM
                     ILKQIIFYFKETSIFKKQTYLGNKAMLENLEILRKQNSGKFKLKGSNFSSSTAAKNLK
                     KSMSTSDLSQISQQHMYIDMQQQQSGSDPFRECTTLGKFIQKAFLPPGDHSIMSLSTS
                     LYNNHAALAERELITYNQLTLKLIPRLENLKESLNDAIKQMFSVKGSSHFKTRELKIE
                     IAKTGAILSDYISSVELLTKGESKTSLGTVIKFDHIDPKFDPYLLRLKLDLQLKDQLF
                     TEAHLKEAYADLQRKAVQLEAILYGEMQSCMGIFSNLINAELDTVKDNLVADLSDGFL
                     RNGPNIDWDYFVANDNSHNLLNLTAKQSLDRVKQIRKKSDVVYPYQIDKISSCILSGY
                     MEKKSKYLKNYSKFYYVLTFNFLHEFKTKDRKHETTPVNSYLLDDMTVMPSDDDSHKF
                     VIRIHPRDESKSKYTFRCHSEEVASHWLECLADLCSFSSPLERNNTLNEVMVEEEQAQ
                     QVEEGQLPSNSSMAQQSVQTGQTGQTTQSSQSAQSAQSAQSCQSAQSGQSALASDSSS
                     SNSQKESCYAERNESSSSLHLPTFRSIKPTSECSTPSTTPGSSDIQPQAHHKSSASIS
                     GLSMESLKEKVKQQQFKAQLSRAGKARIPSDDSPNSELGDYFSYVAPRPRMPYRRSHN
                     GIRSLSRSPSPVLMTPRLSVTGTSGITSPPYNLIEQMDLGVADQGSSGLERRRMILES
                     RLRTSGGISGGTFGGTPGGTPSVTSGGTRDTLLSLPSPGLAMSPPLDTPGTIPPSSVG
                     DVFSQSNK"
     gene            <906666..>907960
                     /locus_tag="FOA43_002419"
                     /db_xref="GeneID:62195820"
     mRNA            join(<906666..906669,906744..>907960)
                     /locus_tag="FOA43_002419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922716.1"
                     /db_xref="GeneID:62195820"
     CDS             join(906666..906669,906744..907960)
                     /locus_tag="FOA43_002419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778644.1"
                     /db_xref="GeneID:62195820"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="PFAM:PF08202"
                     /translation="MEITKLIKKGRKRGRPRKDGVKRPDESVGQSLLDVLEYDEAEDV
                     ESEEDSWFSSDEVEPGSGGALGGASEASEALNETLGTFEALDEMPEASEALGERLETF
                     DATPEASEALGEALDTTPETFEALGEAPGELFAPEKLVDPIIDITSKQPLKLSVEEQP
                     SRRYSRRSSLSNRGKRLSSIGNGFIAEPHSEVPIEEFYKHFDRDLPDPQKMRQLLIWC
                     CRRIDFGVSKKDPQLVDVARKVKETFTKNLMEGKMDISWWKTRQGQDKSHLPIRMRPN
                     ETNIRNLNTLKVYRRKLDRLNGEQVEWSKVTSKKPERIEQIYEKATNIDDKRLDRLQT
                     QIDMIDDSYKDKKKLRMRLVGLMEDMKYNVHKMKQTDQCLKSLIEDKMKVLNGELGKS
                     SGDSIELLKVLSRL"
     gene            complement(<908006..>908434)
                     /locus_tag="FOA43_002420"
                     /db_xref="GeneID:62195821"
     mRNA            complement(<908006..>908434)
                     /locus_tag="FOA43_002420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922717.1"
                     /db_xref="GeneID:62195821"
     CDS             complement(908006..908434)
                     /locus_tag="FOA43_002420"
                     /note="BUSCO:EOG09343XN5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778645.1"
                     /db_xref="GeneID:62195821"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="PFAM:PF04628"
                     /translation="MSYYFSIIGNNDAPLYELEIGTYHQSGDGTPHLPKEIHQLEQFI
                     VNSSLDILQDIQFKNNAIFTKNLDNFYGYQIFSYLTQGNAKFIILTDLKSHDESLRQF
                     LIEINELYVKTLLNPFYTVNNPITSSGFDTRVRLLARKYL"
     gene            <908655..>910325
                     /locus_tag="FOA43_002421"
                     /db_xref="GeneID:62195822"
     mRNA            <908655..>910325
                     /locus_tag="FOA43_002421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922718.1"
                     /db_xref="GeneID:62195822"
     CDS             908655..910325
                     /locus_tag="FOA43_002421"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778646.1"
                     /db_xref="GeneID:62195822"
                     /translation="MAGVKTFKMFGSDLQLSKIETDDNSSTKMAEEVVEAHDGSHGLQ
                     NDLDEMVRNRSKLMGDLKIDQASYQRAVDSICGEEDGEDGEDGRTASPSASTSQVPLR
                     VPPQVPSAPSSTSPSTSTSPSTSLLFNTSTAANAKAHLARMMMESYYNSLERYQNKIH
                     NDKDGNPSYPGVEGVFNPLQIIRNRRIRKKQGISLRKGDLARIKLPSQMFSRHKKPRL
                     IWQINSYEYSGDIDWRDSHWGQLVDSNGELWFPETPKGGKNLYSGFDGESPEDDDLER
                     KGSVPRTSESSASMARHEQYIKAPAAIAPLAASPSSVRAHLWSIGSDHSSTLFPPHHL
                     QGLSQSQSADSAPGARLDPSATPPVSSKSSSPYSLSNNSSMLQVSAITYSTPEEQVQS
                     INRLKYKLRLSRLKIDNAECDFGSIISDNTQAFNSKLEEFERCQVENECQSRKLGDKI
                     EEIDAAIEKLSVFNNQKSTQIEESLGYCDRTNGVINTSVTLKIRDLGERIDRLSANHN
                     NTLMNLFYNLVECGIVFLLWCIWMIVEVWRFARGIVKFLIKFLAWIVL"
     gene            910531..910603
                     /locus_tag="FOA43_002422"
                     /db_xref="GeneID:62195823"
     tRNA            910531..910603
                     /locus_tag="FOA43_002422"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:62195823"
     gene            <910684..>912150
                     /locus_tag="FOA43_002423"
                     /db_xref="GeneID:62195824"
     mRNA            <910684..>912150
                     /locus_tag="FOA43_002423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922719.1"
                     /db_xref="GeneID:62195824"
     CDS             910684..912150
                     /locus_tag="FOA43_002423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778647.1"
                     /db_xref="GeneID:62195824"
                     /db_xref="InterPro:IPR011990"
                     /translation="MEVTFLSRRLARFSVKGIASKSQTIRHFCRSITHREESDLEVNL
                     TTPMMNSRFLNESQVRSNVQEDTVIERLLDISPPEGELVTKSKYPYAEMADRPWRAYL
                     PEVPRAATAASINDYIGKLTSYRYHPSVYGVIGESLMKIVEATPEVLTKQSYLNIVSH
                     FHFMVQDRKGFDVLDKMAEATQIQQDIDFDNALLSYANCVTDYRPRITRLEKLRDHHV
                     MANNNTWYYVFRMFRRTDPKLQLLKLMDDHGISHQPILYSAVHYLSKTYTPEQLLEYY
                     RREGKTGVNMTAYLFNRLIGTYLGYNRVDEAWNLVKKTHLDPENTLQVNAGTFGVFNR
                     HFADRGELYNCIAFSDLFSKTFGMKSRQFLANDLLNKQLPYIDFFDNWFNLVNVLVDM
                     LRNNTQNKSFINKKTLHKLQDYAKLHGRTDFDPLQFDDEALLLRHELFSKLKWECVED
                     DGQLPLSLEENSEQFQKAAGLISAPRKGSTTHNPSDFL"
     gene            complement(<912182..>914161)
                     /locus_tag="FOA43_002424"
                     /db_xref="GeneID:62195825"
     mRNA            complement(<912182..>914161)
                     /locus_tag="FOA43_002424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922720.1"
                     /db_xref="GeneID:62195825"
     CDS             complement(912182..914161)
                     /locus_tag="FOA43_002424"
                     /note="BUSCO:EOG0934221K"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778648.1"
                     /db_xref="GeneID:62195825"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00447"
                     /translation="MANHMKASGGTDGPSGPNANATGSGDPFLDIPEMDAVDSLLSSN
                     NQLQPTITTPSSITTTPNSKVLNPDVSVLAIYGNDASNSYTLSKVADDTVKHESHIDM
                     TAPKEYYVNNKHDDEQLNKMISLRKPKGKKIGLSSSKRPAFVMKLWNMVNDKANKKYI
                     RWIPDGKAFQVSDRESFMKYVLPKYFKHNNFASFVRQLNMYGWHKIQDINSGSLIQGD
                     EVWQFENPNFVESREDLLDNIVRNKPSKESGDDDIDISALLAQLEAMRKSQKMIEDDL
                     SRVRQDNEMLWKENYLARERHKAQSETLEKILRFLATVYGNSSTKLLESMNVGSGGGG
                     ADALDFVAKNSPAVQNQNLFDYHYGDSSFLAASPTAAANGNRLMISNKAYTPHPSGSV
                     ISLAASSRTPHSTAIAEESPFQSIQDIQDIQDIQEIHRGPENRNLDTYPNSQLNIGQS
                     PQLVNSPRGYFPELPTTPLIQYRPLSDLPQETSQVQPVLPVQPVQLLQPVQPVQPVQQ
                     VQLVQPAQSVQPAQPAQSVQPAQLSNPGRGRSSSLSSNPEELMGNIHSQLNKNQGTLK
                     QMNEWISKLSGKPSEDILDNNQDDLNGLLMPQSFDLDGSGLDLPSNKINELYDGIRSG
                     LDINSPTDTTQSAQTVPVAKKRKAGQSSEPVKRKK"
     gene            complement(<914382..>916662)
                     /locus_tag="FOA43_002425"
                     /db_xref="GeneID:62195826"
     mRNA            complement(join(<914382..916016,916657..>916662))
                     /locus_tag="FOA43_002425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922721.1"
                     /db_xref="GeneID:62195826"
     CDS             complement(join(914382..916016,916657..916662))
                     /locus_tag="FOA43_002425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778649.1"
                     /db_xref="GeneID:62195826"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="PFAM:PF01565"
                     /translation="MRMFKYIGGKVPRFVKIFKRYKITGSKTATRRSVRSKDSSVSSG
                     SVSSGSHSSGSGSPFANSLTFQAFMIVGAMGAGYSLGKSMITENPPTDLFPSGSTTKL
                     IDLPVKNSKEYGDYDKFKRCILRILESQGYTFDQKNNKNDYLFEDSFISKDLAQVMND
                     VSHFQEIFWGKKIDDIDEKKFIFYPENASQVSSILKYCQEFRIPVFTTEQSYLHFSKK
                     IPYRMEINFSRMTGYEAVKDDDSVMDVQPGVNLHDINEYLNEKGFQNLNSTTSPLDLL
                     LSSVGIELTDSSNRLFYNKFDKSQVIQFTAVLSDGTEMTVDRNSEGYKLFELLSSIEN
                     SSAIITNLRMNVFMKSAQSKDLLVVLAFKSIDDINSTVKELSAQKRISQLGNIGFVDS
                     SKCRTLEERFEGYKTFAVLKVAADQYSRLGSKFNKGCDRFKVFKIDIKDLDGYQSSYY
                     SNRMDKPDLNRNDKPDADSKASSALIVSRDLLKQKLCSYYSTSHLLETAQTDKMIVEG
                     NPQTDLLRRIKLSLDPAKILNVNVDIIAKAGETQTKLI"
     gene            complement(<916734..>918553)
                     /locus_tag="FOA43_002426"
                     /db_xref="GeneID:62195827"
     mRNA            complement(join(<916734..918393,918546..>918553))
                     /locus_tag="FOA43_002426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922722.1"
                     /db_xref="GeneID:62195827"
     CDS             complement(join(916734..918393,918546..918553))
                     /locus_tag="FOA43_002426"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778650.1"
                     /db_xref="GeneID:62195827"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MVHLNSLDSSISNNASLQEPAQIDHSSLEASFVSLPNRIITRTS
                     TIIDAIRDDNQYASEIESNKVSPATFGATNPEENTKSPDALANYNGEYNKQDFIDRPP
                     DGTLWGWISVMCACSLNTFSWGLNSVFGVFLNYYVSSDNFPGATMEEYALIGGLSVGL
                     SFMLCNVANTLVRRFYYKYVMSAGIVLLVVCYMCAAQATTIVQFIMLQGFLLSIAYAL
                     SAGPTFVIIPTWFLKKRSIATGIATAGIGLSGVIFSRSVQAIIDSTGSYKWALRMIGI
                     VCGFMLTLSMLLIRSHRSLQIDTGRSLWGDIRASFTRWDIYRQKPVMYLILWNFIYSF
                     GYTILLFSMSSYATAIGLTSAQGSIVTTVQSVAQVIGRPLLGWLSDKYGRANVTLVVT
                     TLIGLLSFCWWIFVKSYVNLIIFAFFVGVTVGINWINFSPLCADLAGGGDDLLATVSW
                     LCLIGGPPMIVSEIIGLKMERPNDSQPFLYCQIFVGVMCFASVVALFPFREFKIHRIL
                     HARRDLIQKKSKEILDCEDRTRLNRYNLLLEKSSRGYIIRCFYPIKA"
     gene            complement(<918787..>921387)
                     /locus_tag="FOA43_002427"
                     /db_xref="GeneID:62195828"
     mRNA            complement(join(<918787..920312,921243..>921387))
                     /locus_tag="FOA43_002427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922723.1"
                     /db_xref="GeneID:62195828"
     CDS             complement(join(918787..920312,921243..921387))
                     /locus_tag="FOA43_002427"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778651.1"
                     /db_xref="GeneID:62195828"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSVHSTSIGLSYAQGSMVTTIQSVAQALGGPIFSLLATRFGKAN
                     ITKTDAIRDDNQYASEIESNKIPPAKLGVTNREENTKSQEALANYDGEYNKQDIIDRP
                     PDGTLWGWISACCVCSLNTFSWGANSVFGVFLDYYVKSNHFPGATMEDYALVGGLGLG
                     LSFMLCNIANIMVRRYYYKYVMAVGTLLLVICYMCAAEATSIVQLIMLQGLLLAIAYA
                     LAAGPGFIIIPTWFLKKRSMAMGIATSGAGLAGIIFSRPVEAIIDKTGSYKWALRMIG
                     IVCGIMLTISIILIRCRRNMKVVTGRSLWHDILTSFTRGGIYRQKPLLYLIGWNFFYS
                     FPYAILLFSMSSYSTAIGLTSAQGANITTVQSVAQCIGRPLLGFLSDYFGKVNVTIVI
                     TALVGVFSLCWWMFVKTYANLIIFAFFVGAMLGVNWVNFAPLCADLVGGGDDLLSAVS
                     FLCLAGGPPLIVSEIIGLKLKRPNDSQPYLNCQILVGIMSICSAVMLIPFREFKIHRM
                     FVARRELIEKKSKEILGCEDRKRLNRYNLLLEKSSRGYIIRCFYPIKA"
     gene            complement(<922270..>926207)
                     /locus_tag="FOA43_002428"
                     /db_xref="GeneID:62195829"
     mRNA            complement(join(<922270..923723,923865..924002,
                     924977..>926207))
                     /locus_tag="FOA43_002428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922724.1"
                     /db_xref="GeneID:62195829"
     CDS             complement(join(922270..923723,923865..924002,
                     924977..926207))
                     /locus_tag="FOA43_002428"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778652.1"
                     /db_xref="GeneID:62195829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MVKVSCKRCKSHPVYLPQLITSPLPQMSRTLSRKALVGYLRRLV
                     LNNYGWESTHIDSRIDLELKDIVLNQLVNLELYLNEESMNLIILFFARLQELDMLAIT
                     LTKFESLGIFPNTETFNTIFWCLWKLFSAEKLPETVKYRYIVPVIHKMRLNYHLAFNN
                     GTFQMLLPLISAADKRLELIRLMSFEGLDLKLHISEVSEALYEEYGQPEQFDDFVTHV
                     EKIVLQEGAQFNHRQRQKVLKSVMKVCLQSSKLNKAMTIACHNEELVSSRIISMLNEY
                     FVTQKQYWHCIACTNWYIKMREKSENASLSIQRISQVLFPILIRSGKFAASGYFLPFL
                     NNLCTREAKLYLDETTRAQIELSLTSNSENIGTIFEKDSGIRDEITANLIWVDPSNPD
                     NSFRHENFILAAKLLGFKVEAFKDDSEYVAEQDKKNAENADYGAELYAGSMMRKPSDL
                     EGATSLILAVSAVSEKRATIKPPDTGEFCKQDMLDVPPDGTFWGWTTCICVMLINTFS
                     WGTNTVYGVFLDYYVSTNHFPEANMEEYALIGGLCLGFSFMLISVANTLIRRFHYKLV
                     MSFGAMLIVICFCAASVAKTITQLIMLQGFLMSIGFALTAGPTFVMIPSWFLKKRSVA
                     QGIGAAGVGLAGVIFSKPVQVMIETDGDYQWALRMMGIICGVMLAISIALIRTRRPLQ
                     VKNDSLLKTIWHNCTRWDIYLRAPMACVIMWNFIYGLAFAVLLFSFSSYSTSIGLTQS
                     QGSMVTLVESIAQTVGRPILGLLSDRYGRANTTILVTTFLGIICLCWWTFVKSYANLL
                     IFGFVAGFFMGINWVNFSPLSADVVGGGDDLLAAISMLTFLGGMPQVVAEIIGLKLKR
                     PGMTQPFLYCQILVGVACLVSAAILLPFREWKIKKILSAREKCILAKDPILRTEKDEL
                     RLDRYKLILQSTFKGRVIRAFYPVRA"
     gene            complement(<926721..>928160)
                     /locus_tag="FOA43_002429"
                     /db_xref="GeneID:62195830"
     mRNA            complement(<926721..>928160)
                     /locus_tag="FOA43_002429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922725.1"
                     /db_xref="GeneID:62195830"
     CDS             complement(926721..928160)
                     /locus_tag="FOA43_002429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778653.1"
                     /db_xref="GeneID:62195830"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="InterPro:IPR036784"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="PFAM:PF02518"
                     /db_xref="PFAM:PF10436"
                     /translation="MSSWKLTKALRDQIYRYATVKQTGVSLRQMVQFGSKPSPGSLFH
                     ASHFAVHELPIRLSHRVKDLETLPNGLAKEPAIQTVRNWYAQSFEELTSLEEPVIKDL
                     EMADILSGEKQYEETAKRQVSSQGSKRPYFFSDDGIVIDRRSHGSVSGGGGAAGASGG
                     VSEDENEVHDLNSAHRHVLIPRPRRHYYIPTPKDIVYPSEVVDYNKLVTKVLTKIKRR
                     HDATVTTIARGVQSWKRKKNFTYLDNSVNQFLDRFYLSRIGIRMLIGQTIALNQQAQG
                     NMYSDDYVGIICLRTNVMEVAQDAIDAARFACEEHYDIMEAPPVQLYCPEDLEFMYVP
                     GHLVHMLFETLKNSLRATIEFHQRLHPNTAIEDIHYPPVKIIVAEGLEDITVKVSDEG
                     GGIPRSTIPLVWTYFYTSAEQRIEEYEPTYSSGSFKPPFMGLGVGLPHSRLYARYFSG
                     DLKLISMEGYGTDVYLHLNRLSSSSEPLQ"
     gene            complement(<928475..>932065)
                     /locus_tag="FOA43_002430"
                     /db_xref="GeneID:62195831"
     mRNA            complement(<928475..>932065)
                     /locus_tag="FOA43_002430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922726.1"
                     /db_xref="GeneID:62195831"
     CDS             complement(928475..932065)
                     /locus_tag="FOA43_002430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778654.1"
                     /db_xref="GeneID:62195831"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002909"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF01833"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /db_xref="PFAM:PF13857"
                     /translation="MDSIMISPVLSAISPQSQPQQQGMRTNSDINDVDSAYFDDDLLD
                     EFLDSRLYDDPAQLANEILATSQQQQQQQQQQQQQQQQQQQQQQQQILQEVQFNSQNY
                     DSSDLYNAELQIREIKRYQDAKNVLMKLKFGDSRHGGKQSIKQSKQKSPITPEMPEMF
                     KSTIPSEYLNALNDSELPYHLSISDLPSCSRVETQIRLKLSVSPPPPQFLLHIPRGIV
                     AKPKMTLEDPEVLDSLKANMLYLDTFVVGAQASTEDQSNLRSFNVCRRCMRRELKRAS
                     RRKSGIVEESSGWNINKPKRAIIFNCKEVVSFPQPSGGLTNESERSIEILSRIVCYCR
                     HHQEPRGFRLLFVLKDSDGVVLGKTFSDPIMIMDRKKSIKGSSSKHGSVDSVASCRTS
                     PGGVSADEAKHSNSGLSESSSDFTTSASASAASVSAAAAAIGGMTPAFVNADDIRPMK
                     RQKRPWSLSEKPGTTYFDSVSQRRARKNDSFSGMSVKKEPISPMSSDTLSPQNNLYTS
                     SATSVFSTTPEKKICISPSSQIQSLPPSQLGRHPSSVSSAGSSSAAALTSVTDMASRI
                     SPPSIQRIIPAQGPIRGGVEVTLLGSNFRPGMGVKFGANLSLATHCWSDSTLVTYLPP
                     AAQAGPVLVTIQDGTGEIMATNPASHQIFTYTDDSDRQLIELALQIVGLKMNGKLEDA
                     KNIAKRIIGNNHEGQDDGSRGSEMRGDDEGISSMSIADTSAWLEEASNRMKELSKTVI
                     IDHEQILVKFLSMVDLPNSPVVTPNWAICTLEGQTMLHLACQRGYFKLARYLIERGSK
                     VDSHDSNGLTPLHYALIYGRRNLIVLLIRCKASLASKLNNGVSLEDIADPNVLDLIDV
                     AGTGSEQGSFTSLSREQSLDSLSSLLDDSETCSFKEIPTYGSNPLGRRRFQSDSEFEA
                     DSEDNTDYSVNSLPKEDEYQGDEKSLQQLQNSGDIREDKEQAEKQLPRRKTIGSGFWM
                     AMRDAFVPKLEHSAQDLSDDAALTVTDETLTIVDDRETDNATVVADSGVAEEEEEDEE
                     EEEEEEEELPSYDDLFPNGGSWRALINFRSHDHDEKRQISTAVVTSSESEVELPRSKE
                     EEVEDAIITLKSRQQLNADKRLMFFWLPFMVVLLLIVLCNHLNLIKFSEFSAVSNAVR
                     KARDVFGSVMIGKERFTNLLNKNLNFGRERMGKVFNDMNDAVLTAVGGRQ"
     gene            <933015..>934098
                     /locus_tag="FOA43_002431"
                     /db_xref="GeneID:62195832"
     mRNA            join(<933015..933962,934027..>934098)
                     /locus_tag="FOA43_002431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922727.1"
                     /db_xref="GeneID:62195832"
     CDS             join(933015..933962,934027..934098)
                     /locus_tag="FOA43_002431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778655.1"
                     /db_xref="GeneID:62195832"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSIRAMDVGRRYLVSGSNDEHILINDLQKRKELGTLLKHQGSIT
                     KLVFSDENTKDSDEHSEYLSHKTGRWLLSAAEDGNILIWRVKDWELFGTLKGHKGAVN
                     DLCIHPSGRVAISVSNDRTVKLWNLMMARKASTLKLRGKITLGQLPYFCKFEKKTGGD
                     YFVIGLRTRLLMYKTREAKICRIYTMKKTIMCIDFVILDDKQYLVIGFDDGCLCFYLF
                     EDHIGEGKEEEKGEKKEEKEEKGEKGEKGEKKKKEEEEEEEEKDEEDSDDLSDDDSDD
                     DPITPLGEPDFKFQGHSTRVKDFSIYQEKRLSDGKIFTYIFMLQEKGLTLFQQFKNPL
                     KSQIV"
     gene            complement(<934270..>935388)
                     /gene="LYS1"
                     /locus_tag="FOA43_002432"
                     /db_xref="GeneID:62195833"
     mRNA            complement(<934270..>935388)
                     /gene="LYS1"
                     /locus_tag="FOA43_002432"
                     /product="Saccharopine dehydrogenase"
                     /transcript_id="XM_038922728.1"
                     /db_xref="GeneID:62195833"
     CDS             complement(934270..935388)
                     /gene="LYS1"
                     /locus_tag="FOA43_002432"
                     /note="BUSCO:EOG09342K3T"
                     /codon_start=1
                     /product="Saccharopine dehydrogenase"
                     /protein_id="XP_038778656.1"
                     /db_xref="GeneID:62195833"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR027281"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01262"
                     /db_xref="PFAM:PF05222"
                     /translation="MAKVNLHLRAETKPLEARAALTPTTVKKLLDTGDFNIFVEESKQ
                     SIFGIDEYREAGATIVPAGSWVDSSKDTIVIGLKELPEEHFPLKHEHIQFAHCYKNQD
                     GWEKVLERFPLGGGILYDLEFLQNDSGRRVAAFGFYAGFAGAALGLEDWAFKQIYPED
                     IDLPGVSPYPNEDLLVADVTGVLSQAVKISGRYPKVLIIGALGRCGSGAIKMCTRAGL
                     PEENILKWDLAETKKGGPFEEIAQADVFINCIYLNKPIPPFINKEMLNDDNRKLRTIV
                     DVSADTTNPHNPVPVYTIATDFDHPTVRVDVVKGPKVSVVSIDHLPSLLPREASEFFS
                     HDLLPYLKQLPQRDHIPVWTRAKKLFQHHVKRLNKSKL"
     gene            <936366..>938366
                     /locus_tag="FOA43_002433"
                     /db_xref="GeneID:62195834"
     mRNA            <936366..>938366
                     /locus_tag="FOA43_002433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922729.1"
                     /db_xref="GeneID:62195834"
     CDS             936366..938366
                     /locus_tag="FOA43_002433"
                     /note="BUSCO:EOG09341T7U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778657.1"
                     /db_xref="GeneID:62195834"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF07719"
                     /db_xref="PFAM:PF12895"
                     /db_xref="PFAM:PF13176"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13374"
                     /db_xref="PFAM:PF13424"
                     /translation="MAPNSPNNSTLTISPLVTNHRAQDYFQTPPPVEGRRIQSSHRIF
                     SSPNAKQSKKRLNGDETRISQQVVPPELSFADDPESSQAVPDNLEEIPLTQADKLRLW
                     RHDALLQHHYETAIYIGDKVLSMTNDPNDAFWLAQVYYSKGDYQIACSLLSGPQFEDS
                     VSCRYLSGLCLVKLERYDEALDIVGEVNPFKKEHTVKNPDGGIKLEASMCYLRGVIYA
                     RQNNFERAKDCFKEAILVDVKCFEAFNQLITNSMLTPDEEWDLLSHLNFDDADNNAEL
                     VRLLYTTRLSKYKNVHKFEDAELKLKDEYNLEGNLDLLLARTDLLYAQCRFQDCLDMC
                     RQIMDQNEWNLQIMPNYLSCLYETGGKNELFLSAHKLAENYPNNYITWLAIGIYYFAI
                     GRTNDARLFFSKASILNPSFGPAWIGFAHTFAVEGEHEQAISAYATASRLFPGSHLPN
                     LFLGMQYLQMNNLILAQEYLTSSLLICPTDPLLLNELGVLYYNRGQLAKAENVLQKAL
                     VASKSLDSSAKCCCSIHCNLGHVYRRLKRYKLAIEHFEDVLRMSKIDANVYSSLGLIY
                     LKLGKISIAIEMLHSALSIQSNDPIATDLLNKALEANMKVRNHRFIERANSNETPINK
                     PRKNVRFIGQDKKKDLDLVVEDLRRGEDSSEEGDDVMEMESD"
     gene            <938507..>941140
                     /locus_tag="FOA43_002434"
                     /db_xref="GeneID:62195835"
     mRNA            <938507..>941140
                     /locus_tag="FOA43_002434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922730.1"
                     /db_xref="GeneID:62195835"
     CDS             938507..941140
                     /locus_tag="FOA43_002434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778658.1"
                     /db_xref="GeneID:62195835"
                     /translation="MLRHLSCLRVGITRRSAGVRRQLYRSRWISTSDETGTKDEEAMK
                     VGEAPKVSEAPKVSEAPKVSEAPKVGEAQKVTSKPPEFAGTVAFTPLQLQKSNSATQE
                     ALGNLVTNLHLKNMLAALQTVLSDDPTKLVIRSVECVKSVEGYPVRQSLPRTFTSLES
                     DSVNDYMRQILDYTYSSQQKEVNSIVGVIMDNENVVGMFDKDTFVSLTDYFARNGRFN
                     MVFKIKNDLCAPSMYDTAFYEVLFDHLGVKKPLALLQKYFYNMKSGKLVMNSKLLYQI
                     YYLLPKTERESFTKYLESLGYTISEIVPDLSYTSIESADELLGALKAGHVAMTPGILH
                     HMVDLLTSESRFSEAWAFLHYQRARYRFKLAPAIGITFINNIMNSGQVQFVLPFARSF
                     FRLTGINLRDYGLERLLNHQLTQPVSDSWATLTKVLAKAGKQSNDTTLKYNLPRMLNM
                     YAKSNGLEEWNIEGGMSKEEKQFMRSLHWPDTPRFVVSENSSRFKQACSSFGGRVESD
                     IAVSKKMNDILGTKKPQKLEEAWNLLESLTEKDEKACGGISLISYLLNQERKPQFALA
                     VTTTLKNKYGVDIRFETYRKMAEYYLANGTRSTRSTSGTSGTSGSNGSNSTNWWFVVR
                     WLYTETYMDLKPWFKESPRLGKIAQKQNFEVHSYMDGLNHEEEALANKIVDSVQWTSS
                     ANFVEETNSALFKLYSSYLEDNAAEEMIQVLLKDSNPQGAWQTVDKDGGVNDETLNLF
                     MNYFASKKQLYNVYALARMAPKDAGKLSKVADYRCYEIILKAFLDPELSLTQQDVQLL
                     RALRSKTEYLGLWKDEEFESLLTKKLSENGLKIEDWTVSAEEQQIMDQIILNLKWNEE
                     PEFELEANSAQFQEAAKLLVL"
     gene            <941339..>941542
                     /locus_tag="FOA43_002435"
                     /db_xref="GeneID:62195836"
     mRNA            <941339..>941542
                     /locus_tag="FOA43_002435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922731.1"
                     /db_xref="GeneID:62195836"
     CDS             941339..941542
                     /locus_tag="FOA43_002435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778659.1"
                     /db_xref="GeneID:62195836"
                     /translation="MERDESGMDESELGEDEMDEDGMDEDGMDEDGMDEDETDEDGMD
                     EDKIDEDVSGREQIESVELLDKQ"
     gene            complement(<943014..>943677)
                     /locus_tag="FOA43_002436"
                     /db_xref="GeneID:62195837"
     mRNA            complement(join(<943014..943076,943204..>943677))
                     /locus_tag="FOA43_002436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922732.1"
                     /db_xref="GeneID:62195837"
     CDS             complement(join(943014..943076,943204..943677))
                     /locus_tag="FOA43_002436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778660.1"
                     /db_xref="GeneID:62195837"
                     /translation="MLSNYLTLLSILGFTFGASISLQDEYTTLVSSTCILPGICTGTT
                     YYGSVYLTTMSVYSTVVEPTITYTTLVPSVVSGYSFVGFKPTLVTEADTTEWKQVSMD
                     YTTVDGKEEIIVTYCDIDTTTNYFTTSVTETTTEIITKTRSCDEVYSKTTYTSTPIQM
                     GIVVTAIVKVLREVQFVF"
     gene            complement(<944148..>946697)
                     /locus_tag="FOA43_002437"
                     /db_xref="GeneID:62195838"
     mRNA            complement(<944148..>946697)
                     /locus_tag="FOA43_002437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922733.1"
                     /db_xref="GeneID:62195838"
     CDS             complement(944148..946697)
                     /locus_tag="FOA43_002437"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778661.1"
                     /db_xref="GeneID:62195838"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MTTLLGNDKEKLSRLSSDPTLLSGFVGQLSSSDDVSILGNSAVV
                     LTAFVRLGRTCRLEFPFSEQQLASLLISTAVRHPIELTACNLAALAELLVSGNLAAIT
                     ASDDLDKLLRRVLGRRHSTPAELRHACIVLIHLRDDPVAAAAAADTTKAAYSRDILLF
                     RPLMRRIAWEIAPFFKTIYSSNAARLDTDTEIDTDISDAASISTSRASLLPPAFTLRP
                     QEADDAARHLTPLLQALAHLLPRIHAQVSAPPALPPPLHYTLCAFLRSPNAALRLAAA
                     TVLAYYTKDFESLPSMRAPTYAKVIPALIELADTLESTAGTPAVTPSPMRVLAVVAQE
                     YPPACSQLFGVNFADRAASIVAETYAPAAEFMSAATVHRLSDALLVLSCVCSVNDAHR
                     DIVAQYDLRGVLCGPIARHTALCEDLAKTPEIRDASSASALRSLRSLRLSNELTLAAC
                     YLIRALSRSASMLRTFLVDLDPVNLLVNLAAAPVPDVAACDTDLAENEVVLRSVVLGI
                     MANLVVEFSAVREKFMEVDLYGLLLRYIGGETNAEDRTARSPRGANSRGATLLRISAL
                     QVIRNSLYSDDSLFKQKFASGSALNQIFELCEDPSDKVQQQCFNILRNISVTSFTNSA
                     HLYDAYAASAARRLTNDDSFLEFLLRHLDAAHSSDTVIAINYILVHFASSTLQSKLLL
                     TQNDALLRKLLELLKEPIRKSVSAAAEEKLWKVKLSIVWIVTNLTWREETSVSDSEED
                     VAVTARAANTADAADVLGSSDNAADAAAAHEDSAMDVDFGAITAPQTAAISSVAATSD
                     YRKTRNRARKLIDLGFYNAIKQLNNTCQISDFKERARTAIFQLVFHDNSKR"
     gene            <946924..>948171
                     /locus_tag="FOA43_002438"
                     /db_xref="GeneID:62195839"
     mRNA            <946924..>948171
                     /locus_tag="FOA43_002438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922734.1"
                     /db_xref="GeneID:62195839"
     CDS             946924..948171
                     /locus_tag="FOA43_002438"
                     /note="BUSCO:EOG09342GAU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778662.1"
                     /db_xref="GeneID:62195839"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031167"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF08438"
                     /translation="MPRDPLIGLVGKPSSGKSTTLNSLTDANAKIGAFPFTTIDPNRA
                     TGYVEIECACSRFQKEDLCKPNYGWCDHGKRHVPIELLDVAGLIPGASQGLGLGNKFL
                     DDLRQADALIHVVDVSGTTNAEGKATRGYDPLQDIEWLQDEIRLWIEGNLRKRWGSIV
                     RRHVATKSSVAETLRAQFGGYGASKEMVARAINSIPNLPPMEDWDNVWISKVVLGFMA
                     VKFPTVLALNKIDHPDADKNVSKIMLKYPETSAVLTSALTEVFLRKLVKQKFIKYEEG
                     TEFVDIYEDLDPDCGLKPMDPVLKDRIDNIRDLVLYRFGSTGVVQVLQEATKKLKLIP
                     VFTVRNILTFTGNSGKHVFRDCTLFKQGSKVASVARAIMGEVTIASVEGVGGKRVSMD
                     DVIEPGKNDILSFKVVPGKSEDK"
     gene            <949277..>950320
                     /locus_tag="FOA43_002439"
                     /db_xref="GeneID:62195840"
     mRNA            <949277..>950320
                     /locus_tag="FOA43_002439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922735.1"
                     /db_xref="GeneID:62195840"
     CDS             949277..950320
                     /locus_tag="FOA43_002439"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778663.1"
                     /db_xref="GeneID:62195840"
                     /db_xref="InterPro:IPR036259"
                     /translation="MYLFVPIFITVAQFTIMPKESYLTPPADIIPNATPQQRRLSEGV
                     EAEQLIYESNAAAFLSSLITAPPDEQTALLQGPIVAQPRPQPLPGSAVAQPQIVAAKR
                     RSSLGDAYKSAYIEEEIEAVSKNPGSAAANSIFGILHGFPSSYQFKTWWFGLICVYST
                     VQMLRLNYFVATVNSQYGYLFSSYEMADKLNRVFDIALPLGGVVSIPVVGLILDNFST
                     SVVVSILLATSLVIGVLGIVMHSFLAGLLNVLLFVCFRPFFYTTVSDYCAKVFGFETF
                     GTIYGAIMTVAGLFNILQSYLDKLTHTKFEMNPIPMNILLIVLTIVSGGGLVAYVFAQ
                     TKIYGRLRSQALS"
     gene            complement(<950472..>951536)
                     /locus_tag="FOA43_002440"
                     /db_xref="GeneID:62195841"
     mRNA            complement(<950472..>951536)
                     /locus_tag="FOA43_002440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922736.1"
                     /db_xref="GeneID:62195841"
     CDS             complement(950472..951536)
                     /locus_tag="FOA43_002440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778664.1"
                     /db_xref="GeneID:62195841"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF13173"
                     /db_xref="PFAM:PF17862"
                     /translation="MPRLDPKVITDTIFFLGASLSLYYLTSQLMSDMKGRGRSKEDKQ
                     KAKMSLQRLQTANPGINLDLNEYESSLLSCVIPPDEIDVHFDDIGGLDDIISDLQESV
                     ILPLTCPQLFDQYASLLQAPKGVLLYGPPGCGKTMLAKALASESGANFISIRMSNIMD
                     KWYGESNKLVDAMFSLAQKIQPCIIFIDEIDSFLRERSSSDHEMTAMLKAEFMTLWDG
                     LTSSGRILILGATNRPNDIDSAFMRRMPKRFAVTLPDLSQRLNILNKLMNHVNYDFEL
                     DDLARVTSGLSGSDLMELCRNAAVNSTREYIRHNVLNGKPMKPDEKVILRPLQLNDFQ
                     QTLSSSDSLLRDDMVINPVD"
     gene            <951763..>954027
                     /locus_tag="FOA43_002441"
                     /db_xref="GeneID:62195842"
     mRNA            <951763..>954027
                     /locus_tag="FOA43_002441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922737.1"
                     /db_xref="GeneID:62195842"
     CDS             951763..954027
                     /locus_tag="FOA43_002441"
                     /note="BUSCO:EOG093421SF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778665.1"
                     /db_xref="GeneID:62195842"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF02847"
                     /db_xref="PFAM:PF02854"
                     /translation="MSKRQRHSIQIPGVLLDEIKREDRYDNDERFSGKRAKKEKSGRS
                     DRNSRKRSKVKVKEKVKEREKVKEKVRVKEDDKGEEDEIGYYARKLGIDKKKGLHKED
                     EFDSVGGLLDGLDFMEEGGGGEEGGEDSEEDSEEEEEEEEEGDDDSDLDDDSDLDDDD
                     RELLKQMAEIEDSSQSKDSPPNDLPHENPYIAPSSHYVPPALRRREQPQESQEMMEIK
                     RAVKRPFNKLSEPNMLNCVDELVQLYNNHPRQLVNGAIMQVILDSVTISTPLLESFLI
                     LYASAVVAIYRMQGVDFGAYCIQTLIDKLNGYFDSDVGGYSPVNLIGLIGFCYDFNLM
                     SSSLIYDIVSKKLLVKPTEIKVNMLLKLIRSCGPKMRSDDTDALKEILAELNESIKNT
                     TTTRTRFLVETITNLKNNKLKSLESENTGQLLTRLKKQLGKLNNNRNSDPIKVSLDDI
                     EHVNDRGKWWLIGSAWSGKREDVSAAGASVDDISLDDTFADTFADSLDSTNWLEIAKE
                     QRMNTDVRRAIFVCIMSADDYMDAFSKLNKLRLKRIQNREIPNILMHCVTMESGFNPY
                     YGFLAKKICSDHSMRRTLQLNLWDFLKEMDGEDDSSTGLLVDADDDVRLIKILNLGRF
                     FGFLIGEGGESLNILRTVNFLTASSDVKIFIEIMLITFLDTIGKKSVEKSFGSGLQNI
                     PTKVEDLKFSSQLLNDKLEKCKEQPLLLKGLRYFITNNVKGSDLIKGKKQRIRVDWGV
                     EIMCDIIEEILPKM"
     gene            <955346..>956299
                     /gene="RPP0"
                     /locus_tag="FOA43_002442"
                     /db_xref="GeneID:62195843"
     mRNA            <955346..>956299
                     /gene="RPP0"
                     /locus_tag="FOA43_002442"
                     /product="ribosomal protein P0 (A0) (L10E)"
                     /transcript_id="XM_038922738.1"
                     /db_xref="GeneID:62195843"
     CDS             955346..956299
                     /gene="RPP0"
                     /locus_tag="FOA43_002442"
                     /note="BUSCO:EOG09343FTC"
                     /codon_start=1
                     /product="ribosomal protein P0 (A0) (L10E)"
                     /protein_id="XP_038778666.1"
                     /db_xref="GeneID:62195843"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR030670"
                     /db_xref="PFAM:PF00428"
                     /db_xref="PFAM:PF00466"
                     /db_xref="PFAM:PF17777"
                     /translation="MGATREKKAEYFVKLQEYVEEYQSLFIVGIDNVSSQQMHEIRKT
                     LRGEGVLLMGKNTMIRRALRNILSEHADYEKLMPFLKGNIGFIFTNGDLKSVKEVVIA
                     NKVAAPARAGATAPCDVFVPAGNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKILT
                     KDQRVGPSEAQLLNMLNISPFTFGMTIVQVFDQGQIFPATILDITDDELVADFTVAIA
                     TITKISLASGYPTVSAVSTHLVSAYQDLVALSIGTGYTFEGTEELKDRLDHPENYAAA
                     TTAAPAASDDTKEESKGDDKEEEEEEEEEGSDEDMGMGLFD"
     gene            <957216..>958418
                     /locus_tag="FOA43_002443"
                     /db_xref="GeneID:62195844"
     mRNA            <957216..>958418
                     /locus_tag="FOA43_002443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922739.1"
                     /db_xref="GeneID:62195844"
     CDS             957216..958418
                     /locus_tag="FOA43_002443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778667.1"
                     /db_xref="GeneID:62195844"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="PFAM:PF05206"
                     /db_xref="PFAM:PF05253"
                     /translation="MTRDSNAEKKIFKINSRGNRVGRIKCPLDPSHTIWEDKLKSHLG
                     KCNAVRAKRAIEEKQKNCDWFDLNLNVKEEILDGNMKLTDENIDIKEFKDFLESTLMR
                     YEVFFKNQSEVPEVPIDQQMYKEGLEERYEEISNKKHLLQQSSLIGQLVKYQLFSREN
                     LYIEFGCGRGEFSRYLSRALDEKGDAEVGSRFLMVDRESPRMKMDNKIVLDSKCSTPE
                     VHRLKVDIKDLKLSKAMENFSSRPNDYYVGISKHLCGVATDLTLRCLVNCMQDTEMHF
                     KFKGFLVAMCCRHCCYYPWLLEGSKRWLKEIFGIDETNFKYLRKMCPWATNGTNHRGE
                     LKGKEHFSGMSLEEREVVGLKMRRILDTSRCIAMKEKGFKVQLVRYVPREVTFENSCM
                     VIENDGIM"
     gene            <958543..>959295
                     /locus_tag="FOA43_002444"
                     /db_xref="GeneID:62195845"
     mRNA            <958543..>959295
                     /locus_tag="FOA43_002444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922740.1"
                     /db_xref="GeneID:62195845"
     CDS             958543..959295
                     /locus_tag="FOA43_002444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778668.1"
                     /db_xref="GeneID:62195845"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MASLLKQHALITGGSRGIGFKIAQKLCGQGCKVTLLSRSKSRLI
                     DTTDYLNESFPLVAGKKHGWVSCDLSDPEHLSERLLSQFEDYKSVNILINCAGQTQQR
                     LLVNTNDATIDAIYKVNLISPTILCHFFSRNMLRQHLENANIVNVSSILAQKYLPGTA
                     VYSASKLALNGLTLSLSQEMNRKGNQIVRVNSILPGLIRETDMGESVNMETMQQYGLD
                     QMTTKAETVANEVLKVVMDSRITGELIQVLAV"
     gene            <959511..>960020
                     /gene="TMA19"
                     /locus_tag="FOA43_002445"
                     /db_xref="GeneID:62195846"
     mRNA            <959511..>960020
                     /gene="TMA19"
                     /locus_tag="FOA43_002445"
                     /product="Ribosome associating protein"
                     /transcript_id="XM_038922741.1"
                     /db_xref="GeneID:62195846"
     CDS             959511..960020
                     /gene="TMA19"
                     /locus_tag="FOA43_002445"
                     /note="BUSCO:EOG0934421G;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="Ribosome associating protein"
                     /protein_id="XP_038778669.1"
                     /db_xref="GeneID:62195846"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="InterPro:IPR034737"
                     /db_xref="PFAM:PF00838"
                     /translation="MIIFKDIFSDDELLSDAYDTKEVNGVVIEADCQLIKVKDGADVD
                     IGANPSAEVGDDDLEDGPVETVNNVVYSFNLQPTTFDKKSFMVYIKSYMKKVKAYLTE
                     HDPDQVEVFEKGATAYVKKVLKSFKDWEFYTGESMDPDAMVILLNYREDGTTPFVAIW
                     KHGAKHEKI"
     gene            complement(<960082..>961665)
                     /locus_tag="FOA43_002446"
                     /db_xref="GeneID:62195847"
     mRNA            complement(<960082..>961665)
                     /locus_tag="FOA43_002446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922742.1"
                     /db_xref="GeneID:62195847"
     CDS             complement(960082..961665)
                     /locus_tag="FOA43_002446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778670.1"
                     /db_xref="GeneID:62195847"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="InterPro:IPR032828"
                     /db_xref="PFAM:PF01743"
                     /db_xref="PFAM:PF12627"
                     /translation="MSSIELQPIVLNENEKKITGILREYAGYYNDKIAEPQEKPPIVL
                     RITGGWVRDKLLGKESHDIDIGIDHLSGLDFVTGLQEYLDSPSSLSGIHKIKKNPEKS
                     KHLETCTTRLLGNDIDFVNLRNEQYAEDSRIPSIKTGTPEEDAFRRDATLNSLFFNLS
                     TMKVEDLTGKGLDDLRNGILRTPLDPIKTFIDDPLRCLRLIRFASNFGFIIDPEASKA
                     MKLDSIRTSLDQKISRERIGTEFRKTILGGDAVYGLKLMRDVGFIDIFGFGEKERGEE
                     KVIKGADNVSDAVLKRLSTDGVSKSLDDVVEKLPLIEEQNGGFNRLQELIKQVKSGSD
                     ITRLAFYCSLILNRWNDVKVEIGKDAKKTGKKKKVKTVGAAYLVILQGLKMPIKLAEL
                     SDQIVSNMQRFSDDFGHFKEMKRSQLALKMLIPYGENWRLNLLVYYMLRNFKEMDKIK
                     ENSVQIEELLELVDNQGLENIYKEPVKVNGRELIALTGKKPGPWLKEINEKLFKYQLD
                     HPDCTKDEMLKEVVQKYYN"
     gene            complement(<961826..>963181)
                     /locus_tag="FOA43_002447"
                     /db_xref="GeneID:62195848"
     mRNA            complement(<961826..>963181)
                     /locus_tag="FOA43_002447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922743.1"
                     /db_xref="GeneID:62195848"
     CDS             complement(961826..963181)
                     /locus_tag="FOA43_002447"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778671.1"
                     /db_xref="GeneID:62195848"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="PFAM:PF09073"
                     /translation="MKQEENTLFRLDLLQCKFEGLDPPRFHKTSQICHSRNNQFKLLS
                     VSQEEAQNLIKQYQREQFESKFNEFNEKLARLAKKLLKIEKKRSGKFSKESLEMESNE
                     EIMKKCVRAKTVRTIAKIYKRKIKEKSEIIPSAFYEDLKSIQESTSKDMESLFSVLYG
                     KEEARVCIEKMRVQFKLILGPVRKQVRPEGDVVRKQVKPQEESKESSDESSDKSSDKS
                     SDQPQEESQEESQEFSDESHDTKVESSDESSDESSDKSSDKSSDEPQEESQEESQEFS
                     DESHDTKVESSDESHEPQGPPDDFFIDPISSKKIMLPALATGYYSGDESEEELEQADR
                     DADVKTVTANKRKNRRGQRARRKIWEEKYGKNAKHVIKEREEWHSKQQRLKVEYDARV
                     VKRVQKEKEREDRKRKRYEEEKEVERRRRAPLHPSWLAKKKAEDDFAHLKFTGKKMKF
                     E"
     gene            complement(<963365..>964852)
                     /locus_tag="FOA43_002448"
                     /db_xref="GeneID:62195849"
     mRNA            complement(join(<963365..963962,964752..964757,
                     964845..>964852))
                     /locus_tag="FOA43_002448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922744.1"
                     /db_xref="GeneID:62195849"
     CDS             complement(join(963365..963962,964752..964757,
                     964845..964852))
                     /locus_tag="FOA43_002448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778672.1"
                     /db_xref="GeneID:62195849"
                     /db_xref="InterPro:IPR003103"
                     /db_xref="InterPro:IPR036533"
                     /db_xref="PFAM:PF02179"
                     /translation="MSYCSQLHKVLNYEDAEKVVTFLEDNQQRVLIGVSAVAAMLLVR
                     MVSGGGKKVKENSQSRRKKKHHKHRKHKNKQQQSVTEALKLDPVDISKLEISTIMREF
                     DNKYEPKIRAFLEKIEERETSKTSKRTDTSVSYKEAFQYKYLYFNESLLKLLMRLDGV
                     ETLGKEELRIGRKTCIKKIQEECNKLDRYKVRIENLAKQGVTA"
     gene            complement(<965151..>968870)
                     /locus_tag="FOA43_002449"
                     /db_xref="GeneID:62195850"
     mRNA            complement(<965151..>968870)
                     /locus_tag="FOA43_002449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922745.1"
                     /db_xref="GeneID:62195850"
     CDS             complement(965151..968870)
                     /locus_tag="FOA43_002449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778673.1"
                     /db_xref="GeneID:62195850"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="InterPro:IPR036964"
                     /db_xref="PFAM:PF00617"
                     /db_xref="PFAM:PF00618"
                     /translation="MTDDIVYVLSKPSFNWWDGITVDPIGTVTRGWFPPSHAKSLQPI
                     ESSSGFTGSPSSSRQQSQTRSYSELSDSPQQNNIHLVSTEEIASYFQTPNPSAQPTFA
                     FTPIWLPKITLDDEFIFHNQALNVYTRNLPLLPNDSNSEIPHLEYPDTSRYASGYYTV
                     PLSLTDSGSGQQQRQQQQQQQQQQQQQQQQQGPPESTFSVPAHSNTVDLLAKETKKYD
                     SLARYRPTDFYLAPADITNWSSLNGFFKKSLDSAVEALTKSDNASFRLRVNSVSSTVA
                     IYQMIVRMLAEVLNTDGPSEEISSLLKKLTSSLVQFIINGNIHLMTVKSQPTPSDDDE
                     LEYIGDDEGETPLHPRPSTTSYESVTSDSSISSALAYLHQAQKDASKMLKRALLISDA
                     FLNLKTPYIDDTRNIPIIYTRFLRNKFEAGNFSNQFVNENDNLANDEHPKSTILLDDD
                     VVKRLEHEASKINHLLDKTRDVLDGSTPSSIPYPLYLKDRNLNILTLVYHCIPLMTKY
                     IETIESIDFTLFSMITRLAQRGEETSAESATGSDDAVNSFTSEEDPNRGFYETTSRNL
                     QPLLDEFLQLKQEIHSVLSGLVLDCQLLTAYDPEAFRSFSTEAEKEEAESGKSDPRYR
                     SLKAEKFARGLRTVLKNKDNLIYNHDLYLHEPSWKVRSSLKIIPDKLSLMIASVGQLK
                     DQRQSILNYCSRLMDTDFNIASIFIAERHNTMVSAMSQSEYYYGHNKSSDSDQLPWFL
                     DMDDDEKELIYDPNGLKGGPVKALVSKLVDPIRKNEPAFADTFMLMARTFTTPEGLFE
                     ILLDKFNLEMPEALSYEEYGIWIEQKQHPQQQNVLAVVERLFRQYWNVNYNTEGMKKE
                     WKKWCSDSHVQEDLAELGNLVLEFKYQKDYVVALNTDDAPHYGQKVTPVPKVLTPEIK
                     QIRLHNLKIDEVAKQITLLQESFFCRISRTELFARSYNFNKIFQKNDAISTKSIGDFI
                     RNCNQLTHFVIYMVLRQGDIIERVATIKYFVLLAEKLLELKNFSSMTAVISGLGSTAI
                     SRMKTTWSLVHKDIMSQFKKMDNLMSIGKNYGEYRNMLKFIADDGDPCLPFLGMYLSD
                     LRFTTDGNSDYIHEDKSLVNFSKRAAICKIVHEVMQFGRRKYTFAGDDKTVAYLLVMF
                     NNLPNDEMLYEMSLKWEPRVSLLNEEQTAASSQKHGNSGGSTSRRNKTRSSGGTSVFS
                     RVTQAAKKINSTTGSTTRSSRSSRKRYSPRAAYGI"
     gene            <969673..>970933
                     /locus_tag="FOA43_002450"
                     /db_xref="GeneID:62195851"
     mRNA            join(<969673..970373,970623..970867,970911..>970933)
                     /locus_tag="FOA43_002450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922746.1"
                     /db_xref="GeneID:62195851"
     CDS             join(969673..970373,970623..970867,970911..970933)
                     /locus_tag="FOA43_002450"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778674.1"
                     /db_xref="GeneID:62195851"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MIMEGVCYKVNQGRDQPYQCDSPFIQKTNAQVQKWLSLTAIINI
                     LVSGKVGQMSDTHGRKPVILFIIACDLVGFIVILVVLTPRYFSARLLFLGGSIQSMGG
                     SIFVLMGVSDSYIVDVVVKQHRMQAMGKLVAFMTFGMGLGPLSASIANLSPRYTLLVS
                     VLLRVFALALVVLFLPESRSAKLRAKARRRLSRERRMSDEQIQHTFSVSGIVNLLGLN
                     QLIDSLKSIKLLWISRHPDRLDYIDRTYLVVALLCEIGMQTMGVIANTTAGFLMIAPF
                     MAFASLGTPTLHSALIKYSPSSAKNGEFFGALALFTNIIILQSIQS"
     gene            complement(<971004..>971630)
                     /locus_tag="FOA43_002451"
                     /db_xref="GeneID:62195852"
     mRNA            complement(<971004..>971630)
                     /locus_tag="FOA43_002451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922747.1"
                     /db_xref="GeneID:62195852"
     CDS             complement(971004..971630)
                     /locus_tag="FOA43_002451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778675.1"
                     /db_xref="GeneID:62195852"
                     /db_xref="InterPro:IPR006931"
                     /db_xref="PFAM:PF04847"
                     /translation="MPTNTIIITDPNYLDPKYDDLLDRLIETIDLAIGDDETVQVSKL
                     RFFNRVLVVFEDQQTAEQVYKMLQQNHIRCDYSLRDNPLTKKRDQLEANQPIGEDEKM
                     PIDSIYLEPPPQSIQMKSPPASPYLEWVDEPEEAPDEMTMTDPKSLANILYEPGEGGR
                     ERVFKEEEMDSLNLGDGLDDEKVPILMIGKEEAQNLREKSERLESNTH"
     gene            <973643..>974053
                     /gene="ELF1"
                     /locus_tag="FOA43_002452"
                     /db_xref="GeneID:62195853"
     mRNA            join(<973643..973649,973731..>974053)
                     /gene="ELF1"
                     /locus_tag="FOA43_002452"
                     /product="AAA ATPase Elf1"
                     /transcript_id="XM_038922748.1"
                     /db_xref="GeneID:62195853"
     CDS             join(973643..973649,973731..974053)
                     /gene="ELF1"
                     /locus_tag="FOA43_002452"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09344N4B"
                     /codon_start=1
                     /product="AAA ATPase Elf1"
                     /protein_id="XP_038778676.1"
                     /db_xref="GeneID:62195853"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="InterPro:IPR038567"
                     /db_xref="PFAM:PF05129"
                     /translation="MVMKKIKQKLDTQFTCLFCNHEKSVTCTMDKKSNVATLLCKVCG
                     QSFQSPINSLSEPVDIYSDWVDACEAVAEEEAKLVENGKSLLDAGDGDVDGDEDEDVK
                     AKDEDDY"
     gene            complement(<974142..>978749)
                     /locus_tag="FOA43_002453"
                     /db_xref="GeneID:62195854"
     mRNA            complement(<974142..>978749)
                     /locus_tag="FOA43_002453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922749.1"
                     /db_xref="GeneID:62195854"
     CDS             complement(974142..978749)
                     /locus_tag="FOA43_002453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778677.1"
                     /db_xref="GeneID:62195854"
                     /translation="MGPDESVESDEDASMLYAQNPEYWSKLARRANIHLNELEEEEGN
                     SNTGNSRNNNTTIIGNSTMDIVKKINNSGMDDLEWYKELKDRYKKYVNRSKIEEKQFY
                     ENLDREYREERESMKRVEESEGKMKRLERLIKQVREEEWGSEEPEEPEEPEEPEEPEE
                     PEEPEEPEELESEELGSEELGSEELESEELEQPQQSGTLRVEDTSVPDLKPTESSESP
                     EVVEILSSSEAEEPIQPKKALNLNPRLDDYYSRHEGSGSEGLEGSVSVSESEGSGSER
                     SEESEGSEGSEGSEGSEGSEGSEGSGSGSERSEESEGSERSEESGSEESRSETLDYHK
                     NWQPSITTVHTVNYGDEVPEEEVPEEVEEDSIEQSEEEVFNELEQLEKEDLKQSDLSE
                     QQNFVHSASVTHLSPQLETENEDYWMKIARITQADPSEEPQQLEESHEIIDINSPFET
                     TKELSEAALEAVPESALEAALELASESASEAGSEAGSEAASEAASESTSEAALEAASE
                     ASESALESTPQSLEETYDDEVASSEDTADKTGYIYVHPPEEPENGDSTIDPELFQTAI
                     EETTPDQEEFFSVALDEPIDTEISEVIQSEKEAQQSDHLKDDSLSVVSPPRPPTPEPP
                     RLNPSLLELLDQSINMHNRKSTEEVIDSDAIVSTQSILVDTRLTPKILEEDEKTVNLE
                     NTEVSAESIGALSESSIIASNSSDSIDQSAYVTTLYNETCNEDNSDLILANQTMYVDE
                     KESSTETEVIEVKPEESEKEASDQAEEEDSDEDEDEDEDEDEDEDEVESESESESELV
                     PIETESLADEEVDEALIAHPYDYQEKTVHNEIGLSDESENNKRKLEDEDKEASLGNKI
                     RRIFNLDWLKSKETGRSDDETDEKTFSEEIKEPRVEEIKEPKVEEEAETEKEEEEEEI
                     EEPKVEEEVESEAEAKIEEVEEVEEEAESEAEAKIEEVEEEAETEAETEKEEEVEEEE
                     EIAEEVEEESEVGSEDTDNSQTSKNKFFGVVSNFANSMMMSVSSLEADKTENEEAPLR
                     NTEDPSAAEKEVIGTIEVSPEVLKPAETEVNTETVEDSRESADTNPRGFLGSISKFAE
                     NTWNDVTSSSGVSEESEELEGAEQEEKLGEANKPKAEEHETPEGFEKAKEVEEAEGVE
                     EPPETEEYEELREPEQSITNTSEKPDEADEAEKAEKAEKAENVEEAENADETEEVKKA
                     EKAEEPQEQKLEKTDELQKLQEQPSFDASREEPNKKGLFSNLRNLLTVKTFEGRPRSE
                     PEVEVVSAEESLSSEPEVEVVSAEESLSSEPEVEVVSPEESLSSEPEAEVASAEETQI
                     IGVYEEPETTQMISVRPNADELEGDVTGQIIVREEDTPNTTEMITVKPPLDLGVIPSL
                     QPGHDSDNEQVQILEVRKRTSKEENEGGHKRRYRGPTGDRVARRTRSRSPVRRDRAYK
                     AHSRFNDRGTRIATRSEPNTSPIKPDALPKGVRDLVQEAEEFIEKKEDEGDNNEAANG
                     SPIANRVRVKTRRNGGAERRIWGTGRGGKHFKGRGRRLKKK"
     gene            <978995..>982339
                     /locus_tag="FOA43_002454"
                     /db_xref="GeneID:62195855"
     mRNA            <978995..>982339
                     /locus_tag="FOA43_002454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922750.1"
                     /db_xref="GeneID:62195855"
     CDS             978995..982339
                     /locus_tag="FOA43_002454"
                     /note="BUSCO:EOG09340K3W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778678.1"
                     /db_xref="GeneID:62195855"
                     /db_xref="InterPro:IPR022233"
                     /db_xref="PFAM:PF12584"
                     /translation="MTVSIDAAYYDPFLVFKNTLEDQFVKRIRINTLRWKFQPTDPVR
                     TIDNVELNYVQDTKAENTFVHFIFVTCSSVDEYRSKVRPVIRQWLNNVKSIQPMSMYY
                     IILYQNVSLISTTDKFLKTSLLTKIRTDFADDQLTIENAFKIKSTYSDSGVETEVWNS
                     ILNAVRLGLMDSISSKLRYFQSLDPPLLGLRKSADLFKQIGQYDDSLRCYHNLMRRLG
                     IIDEGRDGFESYDYSSCLLSNRESPQLVSSPSKFQLKCYIFKEIQFILTEDSIKSSGI
                     YMRNMASLTSSLLELVNSVYDCYKKSEFGIVMAQDFFANRRLQLLLEKKEDDVPDQLY
                     ELLGDLKLLERDQFINLGASKGYRMPGSMAEVGLSEKDDDYTVRDIELRALLSDDKTF
                     KDHVLKITEEVIKLYSESQYKANTVDTVSTEMALMIYYGFHDYEASLEVLNNSFRYFK
                     NSGWNIIAFNLLKVYIENLEKLKDKDDVVSYLLNSYLEMVSMGNKCELNRFTTLLNEL
                     VDPLSIENDELFDIKVDPHVCCGDKTDQYVINVKLASKLVDIEVDNAILYLENEDGDP
                     VEFVIGTFILKNGQNQLKLSSKQLFCVDLKAVRLKVQIGQLELLANVSESIRLYQIQS
                     YVNSDNQIVNNTLIDVRVPSLRRLNKDELLLSANVGDKGFNGCEFVFRKTDSDRLVPD
                     AKYRLTNENGELVDFKILEDDDRIIFKVEQIVESHAKLWAFVPYFFPPDVSDIKLFID
                     FSFKFGDGYSRRIQKKLDTTLEIAVSVQDIFRSSKLFSNYTINSVMVENPVRIQQVNL
                     SPLNEEGHTIVQTWLSPKNIVAYIDQGSTFFYRLEELKDESLDLIIDYDDLHSEIVES
                     LNQCYYSYLASLKSPLLMYFHLVSTMIFEKLTFKLNLYGLNGEMELIDYDISNFMETL
                     KQVNFRDLPALIESITSLLSQFTEETKELCDSVLNGARRTLVINVTLPVVNVVDTVEF
                     KFEKQLQYLVCEPINMMLSFDVFVVQFADKSKKKVRFKTESDKPKQISLKLGFTDYEQ
                     NWLIAGCKDFTAQFNLDGRQAGHKARRILECKLTLIPLRVGKLELPKVEIQNLTDYKV
                     EMELDYKNSSESLLVVSELNKVVQSF"
     gene            complement(<982350..>983129)
                     /locus_tag="FOA43_002455"
                     /db_xref="GeneID:62195856"
     mRNA            complement(<982350..>983129)
                     /locus_tag="FOA43_002455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922751.1"
                     /db_xref="GeneID:62195856"
     CDS             complement(982350..983129)
                     /locus_tag="FOA43_002455"
                     /note="BUSCO:EOG09342RCF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778679.1"
                     /db_xref="GeneID:62195856"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="InterPro:IPR036108"
                     /db_xref="PFAM:PF02602"
                     /translation="MGKIILLKNKTVPEDPYDLIFKEHGYQPLFLPLLKHTSVNEGAI
                     LEFIKSEEFLTEYKALIITSQRCIETLDTILRILREEGFDKLDGILNKPSYTVGPATS
                     QVLKRLGFTNIRGGDKAGNGSILSDLIIDDLLLEADRTKKVLFLTGEIHKDVIPRKLR
                     LANFSMKELISYRTEPLEDIASRYLRILDGVNFREDNWIVFFSPQGTQNIVEYLKEHR
                     GNFKVASIGPTTEIYLENNQMKAEVVSRKPNATELVRSIEE"
     gene            complement(<983171..>985051)
                     /locus_tag="FOA43_002456"
                     /db_xref="GeneID:62195857"
     mRNA            complement(<983171..>985051)
                     /locus_tag="FOA43_002456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922752.1"
                     /db_xref="GeneID:62195857"
     CDS             complement(983171..985051)
                     /locus_tag="FOA43_002456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778680.1"
                     /db_xref="GeneID:62195857"
                     /translation="MDRTIMEVFRLPLDNPAYAGIAAGVIVLGLLTSKLTKEEDPDIK
                     KIRELIEHDSEELSLTNNITIRRNELDKIIGDLTFQMIMGLIILSIIVLIVGALTYRN
                     NRCCKRSMNWTREKLKSLDSFLGNSRSEFEGIQLRMKIKIDKELEQLARKNKNCIDKE
                     IKKIDKSVLKATQKIDNVVSSNVERIERVKQGFIDLIETDDRLKNLVSRLKNLEKSMN
                     QLENQFATRFKKLDEQATGMNTIIHKCIDATEISTVELYKGIDMMKVNSYKCNIQLVN
                     SKILFDAALSKFELVEKSIKMIVNDDDDEEISCADNIQDLSSPQLRLENCLESAIETR
                     KKLDLLKCKKDNELSNSHQLSLILDDHDLDSSADKSSFEYFKIYSDTTDLAIADLNER
                     LKKLEHKKPIEPQDCDQWVNNWISAMYGLFSSDIIYLQSQIFGDSKLKGLELFEETGV
                     HLESDYQDIKDFVEECKEMCLKQMNSISLLVVESHMVGNHDDKSILKECTMKIELTVK
                     QVFEGFITRIGNLSLDQEEKKSLREILVHFKRRLETDLKSAASEYLGLFRHNVDDFYL
                     IQDSLVDLKKQSKSEESSKNSVSILSETAAQSENSFLSTSSWKDEKSTESEIYRPLKL
                     VK"
     gene            <985336..>989511
                     /locus_tag="FOA43_002457"
                     /db_xref="GeneID:62195858"
     mRNA            <985336..>989511
                     /locus_tag="FOA43_002457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922753.1"
                     /db_xref="GeneID:62195858"
     CDS             985336..989511
                     /locus_tag="FOA43_002457"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778681.1"
                     /db_xref="GeneID:62195858"
                     /db_xref="InterPro:IPR000331"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018515"
                     /db_xref="InterPro:IPR024584"
                     /db_xref="InterPro:IPR035974"
                     /db_xref="PFAM:PF02145"
                     /db_xref="PFAM:PF03542"
                     /db_xref="PFAM:PF11864"
                     /translation="MPSLPYSTNSSSVGGLGSVFKSLSKTFRSTTSGSSTKAKRSLPI
                     AVNPTVVGNSLIKRDQLQHTLQSGSFNEKIAVIKQLRDSLNDVNVSSIPEIWYMVNSG
                     IAKDVNSVLRKETLLLLKVCISLSDDATPTKFLFYKDIVLNFQLSTDDLIDPYFSLFI
                     DCLIELTSDGKEVYDLFLYAKCPFQDYIVKILGRISGEQDESAKEKVVSFVDSCLKLN
                     FDLFDTSVLHQVLSQLLKMTFSTKTVDTLKSCLKLIDTYVIYGYTPPNCLAIIVTLLS
                     SARMVDDNEVKELSLSVFGDLLKDTKVSYLAMEATCDIIQSKLGEKREPSSQDTRCIV
                     GCIRFLEFTLFHYDEESTLGNSITKFLDTSANYVMNSLIAAADYHDMVISIEVLKLVL
                     KLLELPIIRKHNFSLSKRTVLWRLLHVLSLQSQVNSNSHYNQNMVELFNKLQNLNTNS
                     VYVSKTVQFLEVNSSILHEYNVNYVLKYYSENLLCVYTAPDWEDNCHHLVETYYHICP
                     EDTFSVIKEGLINSLCITDSSEVVSIYVDLLCNECVIKRSRETVIEDSIVKSLVEVLC
                     GLDSHLDLFKQTMETIFVELDRKESLNNCQLAKTCVLLLVKLTQSIQNSERANYLLPR
                     MLSMAVQALESSRWDVFLVFARLFVAMRSNDGEFVYFVAVKNIYGLCDTLGRNMELIV
                     DPNRRDQLKSSALWVYPEKSLMYFPLNELQKCSRKCLRRDTHLVVEWCTICLNVLERF
                     YHWEVYSFVLSHLCPQMADYGLFGHDADVCITKIVKVICRQTQLKFPDNFEIADKSLS
                     KGDIQVAFIRTLSAITCYKSILSRADEDQLINSVIFALQSWNKTGIPCLHFLYIATYE
                     FPESIKKFLNGILTTLQTRISSPLTSSLILDFLLSLADLPNLISNFTIDEFKRVFGIA
                     FKFIQYSNDALDNKKVTSLNYDDLAMDKSPSTQNFEITKQLVMYITALSYNLISSWFL
                     KMNFDQRRRLASYIIMGLLANSKHELRDLAYVEFITRSTFAQVAMRSTVLVDNETVGD
                     MYTNRAWIYGNGIISISTHKITGESEVIIRKATTVDKFKVRLHEELFPDYVLRQISNP
                     SREAEKLVTYNPLIFTPSFLLTQLIYPTQEEKPVLKPIPLDIESSVIKRSVSILDRIP
                     LVNFFKIGIMYAGTGQTGEDDILTNEFGSIEYHEFLADLGNLIMLRDCKKHYVGGLDT
                     VNDIDGKLTVHYETENTQMCFHVATMMPNRDDDPHHDNKKRHIGNDYVNIYWNDSGLS
                     FDSFEKLSSQFSFINIVIRPLNGSNFFSVKSYRKNGIPGIFATTHFKLVSKQNLSKMV
                     RNLCSISAQFSDVWSDPNWEFSWGRRLSQLKSIAAKNRKLMAQSDGFFEQFETMGKDE
                     NVIYDRLEINSFT"
     gene            complement(989578..989649)
                     /locus_tag="FOA43_002458"
                     /db_xref="GeneID:62195859"
     tRNA            complement(989578..989649)
                     /locus_tag="FOA43_002458"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:62195859"
     gene            complement(990553..990624)
                     /locus_tag="FOA43_002459"
                     /db_xref="GeneID:62195860"
     tRNA            complement(990553..990624)
                     /locus_tag="FOA43_002459"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:62195860"
     gene            complement(<990857..>992065)
                     /locus_tag="FOA43_002460"
                     /db_xref="GeneID:62195861"
     mRNA            complement(<990857..>992065)
                     /locus_tag="FOA43_002460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922754.1"
                     /db_xref="GeneID:62195861"
     CDS             complement(990857..992065)
                     /locus_tag="FOA43_002460"
                     /note="BUSCO:EOG09342YU9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778682.1"
                     /db_xref="GeneID:62195861"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MFDITSIARPNILTLEPYRCARDDFQEGILLDANENTYGPSFTE
                     FSVREKELELNRYPDPHQIPLKKRLCGFRNSEACNPQSIIKPEIGRDVKAELLTPANV
                     CLSVGSDGGIDLLIRCFCKPGVEKVLVCPPTYPMYDTCCAVNDVEMMVEPLDLNTFQI
                     KPDRIISRLKDDPSIKLVFITSPGNPTATMIKHDLIFQVIDAVEKMSWNGLIVVDEAY
                     IDFCPIGSSMSVLVNKHKNLVVLQTFSKSFALAGIRLGVTYSTAEVSMLLNTTRDPYC
                     LNKGASHAAMKATSKKALDLMKATCQKINEQRSLVSKAFSKIPGIGKNIGGEDANFIL
                     VQVLNKDGVPDNKMAYQLYWKLATERKVVVRYRGEELACTGCLRVTIGTPEENVKLLE
                     DLESVLREGF"
     gene            complement(<992747..>993616)
                     /locus_tag="FOA43_002461"
                     /db_xref="GeneID:62195862"
     mRNA            complement(<992747..>993616)
                     /locus_tag="FOA43_002461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922755.1"
                     /db_xref="GeneID:62195862"
     CDS             complement(992747..993616)
                     /locus_tag="FOA43_002461"
                     /note="BUSCO:EOG093429BS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778683.1"
                     /db_xref="GeneID:62195862"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PFAM:PF00170"
                     /db_xref="PFAM:PF07716"
                     /translation="MLLGESVFSSISAASSNDLLVSSVATATAAANNKALVDDPLEDL
                     FRSAFGESSNQNEQHLEVEPRASSVPSASIAGTLSPLEVHASVMDSIFDPSTALSSNS
                     PMLELTSEMPTWEPLFQQSSDQNDQQIGADTDAELLALLGEPASVSTSASPASVKSEP
                     VDYVGTETRSKSVPGKRSHSDPSVSSPSHPDSSAKKTKLDKFGCVAYTRKQRNIPLSP
                     VVPQGHDLTSLKRAKNTEAARRSRARKMKRMVQLEDKCENLVKENENLRAEVENLKQQ
                     LLQQQQPSFTLNP"
     gene            complement(<994639..>995637)
                     /locus_tag="FOA43_002462"
                     /db_xref="GeneID:62195863"
     mRNA            complement(<994639..>995637)
                     /locus_tag="FOA43_002462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922756.1"
                     /db_xref="GeneID:62195863"
     CDS             complement(994639..995637)
                     /locus_tag="FOA43_002462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778684.1"
                     /db_xref="GeneID:62195863"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MSYVTVKGPTGYGLMSLTWRPTPLSQQQCFDVINYALDQGVTFF
                     NSGEFYGNNDDKVAGLKLLKAYFEKYPENRARMTICVKGSCRLDTMMPDNSKEYLVES
                     VENICSFFPDGKLDLFEPARLDLVHPIEETITNLVSLVNSGKIGGIALSEVSADSIRR
                     AYKVFPHISYVEEEFSMMSTTILHDGVNDACRDLGIPIVAYSPLGRGYLTGTVKSMSD
                     IPQGDIRRYLGRFNSDEILKANFSLVELVGKMAKKKNVTEAQIALAWIRKHNQFPEKY
                     ATYIPIPSASTVLRMKENLEVIELTDEEFDELNKGIEGIEVKGWRYNEMAEHFLEV"
     gene            <996298..>996723
                     /locus_tag="FOA43_002463"
                     /db_xref="GeneID:62195864"
     mRNA            <996298..>996723
                     /locus_tag="FOA43_002463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922757.1"
                     /db_xref="GeneID:62195864"
     CDS             996298..996723
                     /locus_tag="FOA43_002463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778685.1"
                     /db_xref="GeneID:62195864"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="PFAM:PF07890"
                     /translation="MNALLDTHLKAHDRKDPILAKSKGQFKKLESDKLEVKAKKLLLA
                     KKKKLLNKNRKKDLIPSGEDGEAAKEALTKERKLRKVAQRGVIKLFNAILVSQTQSEA
                     TSRALNNSRGYVSSSKKQEAVAEVSKERFLDMVQAAGKK"
     gene            complement(<996802..>997776)
                     /locus_tag="FOA43_002464"
                     /db_xref="GeneID:62195865"
     mRNA            complement(join(<996802..997425,997771..>997776))
                     /locus_tag="FOA43_002464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922758.1"
                     /db_xref="GeneID:62195865"
     CDS             complement(join(996802..997425,997771..997776))
                     /locus_tag="FOA43_002464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778686.1"
                     /db_xref="GeneID:62195865"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /db_xref="PFAM:PF09424"
                     /translation="MEMFRAFLSAGKSTIARGAARSTVRNSARASRMSIRWASTTPAY
                     DELMKSLRDDLKHNIRMKADPLEKNVIRSILTEVKNMEIDSRDQLQDEFKLYDLLNEM
                     IKDRRHSAEVYMKEGSPDRFKQVGLNEIREADYLVQYLERLPVATEKQVDDRVKQLAN
                     TLKNEDLLTNKQSLFKKVPWKTIQSDWNASKSAVTKSVNRVYEELVGKK"
     gene            complement(<998380..>999243)
                     /gene="PIC2"
                     /locus_tag="FOA43_002465"
                     /db_xref="GeneID:62195866"
     mRNA            complement(<998380..>999243)
                     /gene="PIC2"
                     /locus_tag="FOA43_002465"
                     /product="Cu/Pi carrier"
                     /transcript_id="XM_038922759.1"
                     /db_xref="GeneID:62195866"
     CDS             complement(998380..999243)
                     /gene="PIC2"
                     /locus_tag="FOA43_002465"
                     /codon_start=1
                     /product="Cu/Pi carrier"
                     /protein_id="XP_038778687.1"
                     /db_xref="GeneID:62195866"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MPSDRKIELYSREYFLSCALGGFIACAPTHSLVLPLDLVKCRLQ
                     VDSSLYKGNWSGIKSIVRNEGFSTLYTGFVPTFIGYGLQGTCKYGFYELFKKKFSDFT
                     GTSGVGVYLAASAGAEFLADLALCPFEAMKVKTQTTLPPALPKDLYKNMYSGLVPLWF
                     RQIPYTMVKFTTFEKIVSLIYSGLSKPKDEYTKLQQTGVSFLGGYIAGIFCAIVSHPA
                     DVMVSKVNNDTRPGESIGTAVKRIYKVIGFNGLWNGLGVRIIMIGTLTGCQWLLYDSF
                     KVYSGFPTTGD"
     gene            <999855..>1001138
                     /locus_tag="FOA43_002466"
                     /db_xref="GeneID:62195867"
     mRNA            <999855..>1001138
                     /locus_tag="FOA43_002466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922760.1"
                     /db_xref="GeneID:62195867"
     CDS             999855..1001138
                     /locus_tag="FOA43_002466"
                     /note="MEROPS:MER0902165;
                     BUSCO:EOG09341Y1U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778688.1"
                     /db_xref="GeneID:62195867"
                     /db_xref="InterPro:IPR033979"
                     /db_xref="PFAM:PF04424"
                     /translation="MQFHTKTVGWLDSTGSYHLNQILLQNRNGPCFIISFINTLILSL
                     ELKEDQDWHTVKSKNQRHKKQSIQSSVTAQNSLVTESDLRSLKELISSKNLVSLDSLL
                     YEVSNLLLEVANEGEERIDLSDILNVLPLLSTGLNVNLKFDQPIVTDFEEETKAVTQL
                     MDFFGLKMIHGFLMDDGKEKLGSEVAFDKAQEFMVKILDKYPELKEDDTNPEVVKYFT
                     LKRFFEDNRTQLTKQGLKQLEGTSSVLRNNEFAIFFRNDHFNTIYKKENKLYTLVSDE
                     GYKDESEVVWQMLGDVKGDEDDFLTGNFTKPEVQETKRTNEGAEGAPGAEGAEGAFSA
                     GAFSAGAFSAGAVSAEDPFSVEDEILAKQLQQEEDAQISRTLQNEFDKEADDRGKKKK
                     RKRKQKQDSRKQNSRKPDSKEQDPKDNPKDGCTIC"
     gene            <1001239..>1003575
                     /locus_tag="FOA43_002467"
                     /db_xref="GeneID:62195868"
     mRNA            <1001239..>1003575
                     /locus_tag="FOA43_002467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922761.1"
                     /db_xref="GeneID:62195868"
     CDS             1001239..1003575
                     /locus_tag="FOA43_002467"
                     /note="BUSCO:EOG09341OA5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778689.1"
                     /db_xref="GeneID:62195868"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MFTVFKTSGIEGSYSVSSNPLFVCDDCWTIYPAKHRTTKKKASV
                     WQFNKRDYESRLAHDGVINRSNRDLVMSDIYSNLKKYISNLSKLKHPNFLTVIEPLED
                     HKNRLLFVTEYVVNSLVTLDKSTLDEIIVTKGLLQVATGLKFLHQSISTVHLNINPNS
                     ILLTENFDWKISGLQFIRALVNDTVAEKFVDPQDSRMPQFLSLDFRFCSPNLLLNHNV
                     DYIDDLFSLACLIFYLFDDGSSLIRCDSSSLLDYERSFNRIKQLLSSVQSTGNLDHPF
                     FQRIPTNYKQVFFSLIQKTQQSNKDVIQLHKPFSVDDFINSSIFNNDLIRILNVVDEF
                     QALPNSDRVQFLSGLRNQINSFPKALLINKFIPILCQAVDPYLETAKKLQTDDEQIIS
                     LSIENLLLLSKTLSQLTFTDKVFPVLNRCLESLDLNSVKSLIITHLDIVKSKLGVTDP
                     HQGMKSKHYQNFQKLLLQLFDKSISHGSSALPSSIKLQETLLDNLKMFLDYQSYSTIT
                     NRLFPAISDLFSTTTSLKVKVLTIQAFILMINGMEEKNLDNYIIIEKILPLIRKTQES
                     NLKNADLLANLVKLYVHLFRKLRAATGKLSIGGNEVQVSDLILEGVYFEVWKLSKFVM
                     AGDELKEIFRLLTEIDGYLRGLIKVRVGSIPQIKQALQEPQEPQETLQTLQTLQTLQT
                     LEPRTPAHRTPKMAPLHLEKTPNVRFGATTNASSFHPIIKAPQGTSFMQPMKATRIGS
                     SVTPPTLSSNIDWKANGNNNSLFQPIKPTKKLYNGLSR"
     gene            complement(<1003616..>1005253)
                     /locus_tag="FOA43_002468"
                     /db_xref="GeneID:62195869"
     mRNA            complement(<1003616..>1005253)
                     /locus_tag="FOA43_002468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922762.1"
                     /db_xref="GeneID:62195869"
     CDS             complement(1003616..1005253)
                     /locus_tag="FOA43_002468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778690.1"
                     /db_xref="GeneID:62195869"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR012171"
                     /db_xref="InterPro:IPR036400"
                     /db_xref="PFAM:PF00173"
                     /db_xref="PFAM:PF00487"
                     /translation="MRVYSVDEIEQMIADGHTIVIYGKYVLKLDHWLEKHPGGDKAIH
                     HFVGRDAMDEMDSYHSPETISHFKRFSIGVIDHRWINLLPPIQGGIYSTHKEKLQTDK
                     LMSGEMKVTIKPKMPQGIIPKSGMSELCPIVQSSSTNPIRDPEVVVNNFDNRLVQKDL
                     DSIPSLDYDTQWFISLKYNELHDTLVKQGLFDCQYIEYFKQFCINFTLLMYVLIFFKT
                     EHYFLSAVFLGFFWQQLVFVAHDAGHLAITHDYQIDNIIGTIIADWIGGLSLGWWKRN
                     HNVHHLVTNDPVHDPDIQHLPFFCVSSRLFGNLFSTYYERFLWFDRFAQKLIPIQSYL
                     YYPILSFGRFNLYRLSLEYLIKGQGPRKGKGAWFRWFEFAGLFFFCYWFFYLVCGALP
                     SRWAKFQYIMVSHISTMIVHVQITLSHFAMSTSDLGTSETFASRQLRTSMDVSCPEWF
                     DFFHGGLQYQAIHHLFPRLPRHNLRKAQKYVLNFCEETGLKYSIYGFVHGNEKVLLKM
                     DDVGKQVSIFRDCLKSMKMEDIEGRNIYEKKVAQVGS"
     gene            <1005614..>1006096
                     /locus_tag="FOA43_002469"
                     /db_xref="GeneID:62195870"
     mRNA            <1005614..>1006096
                     /locus_tag="FOA43_002469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922763.1"
                     /db_xref="GeneID:62195870"
     CDS             1005614..1006096
                     /locus_tag="FOA43_002469"
                     /note="BUSCO:EOG09344NQI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778691.1"
                     /db_xref="GeneID:62195870"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF02269"
                     /db_xref="PFAM:PF02969"
                     /translation="MGREANENEEKGDNTALLDDDTYFFVLSLALVMAIYKKSSKNKQ
                     RYFSNDLKALLYAFGDSAAPNAETIQTLEDVLTSYLIDVLMEANKVRQIQKRTKLKVD
                     DIEFALRKDAVKLGRVYDLQEMDKQITMAKKMFDEEAEKPERDEGKRKKRKRAAEESS
                     "
     gene            <1006290..>1009601
                     /locus_tag="FOA43_002470"
                     /db_xref="GeneID:62195871"
     mRNA            <1006290..>1009601
                     /locus_tag="FOA43_002470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922764.1"
                     /db_xref="GeneID:62195871"
     CDS             1006290..1009601
                     /locus_tag="FOA43_002470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778692.1"
                     /db_xref="GeneID:62195871"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF11951"
                     /translation="MSDNDKDTREDKARDEGQAKLGGGPAKLDGGPAKLDGEPAKLDG
                     EPAKLDERPPEETPEELQEVSQPLRKKPKRTKTFNGCYTCRRRKIACDLGRPTCMKCR
                     KSGYVCEGYDVKLRWSQPIKFDKYGSQLPGIFNQETKYCQRRAIAFVKYSDKDAYHLY
                     DEMDRDLASLHNRHMPDMANFTVITGHFGVFRGEPYRGKKMSRAVTVETVPRSRSASR
                     ASLRTPATPSSVASASSTANGSSLMMSESDSIRQNRQIQQAQHPQPRLGASYFPAVVS
                     GSYQTQGSLERAGNPGNEWLSTELLDAALLTASAINGDTHFLDMFKPDDLDGVYGGVN
                     STTANSNVNTSSSLLAPGQGSFVTPRSGAMSAMAANMGGAGGVGGAGGAGGFTNADNT
                     NPSGATGPTGITDAYDTVSDNMLHLLFQGRDTNRPDEDAISESTTHSNGTSTLIGANE
                     STTPADATNTNNKFSRSDKPISNNLIGIHAGNGAKMPKTIMEILSTTPLPKSLAIDQF
                     GIPTTSLNVHPMTRYLLNYYIEDVADMMTVIPLPKNPWKFIYFPRALMAVGELSALGR
                     TSNARNGLLNALLAVSAFNLQSKFVRGSDEMKYYVNLGIQLRQQATNFLNKCLQEDVL
                     RQKYKDVLVAVLSMVTIDVVWGTMSACKIHLDHCEKIIEKKMKVKKKLSSKAIILHRI
                     FSSLKLIQDSTCIDNISLNEIFLNEKNYKSFLMGAKPTPEQLEKYFNNHFRDMFRGSR
                     LRRLFARSIHGRKEKRGESSSLSASASSFDDVFKQKSPSTSPVSVRRGTYNERIADNG
                     KVRIEYIMNNEEDMDTVGSHRTRDDSSTMDKGIPAFIDITRSSFQPSKNKLDDKVVSS
                     DAIYGLPNSLILMFSEVVHLAKFKRYRSENKLDMPLFFNELAAQLEFKLLTWKLEWKL
                     TKYDDIKREKNKSGSDSDTDSDTEAEAETEAETETGAETGAETEGSKHHKNFISPRHE
                     GIYHHVMSFYYGLIIYFYRFVEDVNPMYLQDRIEKVLHHLNAIQDILEKHPETSYIIP
                     LFWQGFIAGSEAMTLYLQNGFNLWGQHIAQTGIGTYWNARQIMLEIWRRKNHNVKNSS
                     WVDVLRDWKTNVMLT"
     gene            <1009784..>1011454
                     /locus_tag="FOA43_002471"
                     /db_xref="GeneID:62195872"
     mRNA            <1009784..>1011454
                     /locus_tag="FOA43_002471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922765.1"
                     /db_xref="GeneID:62195872"
     CDS             1009784..1011454
                     /locus_tag="FOA43_002471"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778693.1"
                     /db_xref="GeneID:62195872"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="InterPro:IPR037192"
                     /db_xref="PFAM:PF04137"
                     /translation="MLFSLLTYYILSWITTCLAQKFPSPSGSFPPAEAREKKPVVSYD
                     APSIHQFNSTPFKDWDNFTQTVIDESAGVTFEEINSLNDIIRPKMDLITKENFFRIFR
                     LDLYKQCPFWTGTEGFCMHRSCAVDTIDDWKDLPEIWQPEALGALENVSRVPESNKAS
                     KDYCEIDEINEDTVYVDLVENPERFTGYGGDQSFQIWKSIYSENCFNLGQDQCMEKNF
                     FYRMISGMHASISTHLSNQYLDLKTKQYGPNLKQFMFRVGNFPDRIENIYLNYILVLK
                     ALIKLESLGILDNFEFSNQDQLRDELRDMIMPSYQLGDNTEECLFDENSLFQSSDAVE
                     VKDEFKQNFRNVSRIMDCVHCDRCRLWGKVQTTGYGTALKVLFDLHNAKEIREPSRYE
                     ISNVELIALVNTFDRLSRSVESIKNFHTLYDLAIEKEERGASISSVLPVSSSSDVVDF
                     TNRDVFEAVGKGDLPIEKEETSFEAADEGHFDDIVYHTRRGNTVKEAFYTELYKVGDA
                     LKLIFTAYKVFPKIVYNWCLIRLVYYWNKFVGHVQQDFDINRLYHEEF"
     gene            <1011696..>1013276
                     /locus_tag="FOA43_002472"
                     /db_xref="GeneID:62195873"
     mRNA            <1011696..>1013276
                     /locus_tag="FOA43_002472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922766.1"
                     /db_xref="GeneID:62195873"
     CDS             1011696..1013276
                     /locus_tag="FOA43_002472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778694.1"
                     /db_xref="GeneID:62195873"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="PFAM:PF00533"
                     /db_xref="PFAM:PF12738"
                     /db_xref="PFAM:PF16589"
                     /translation="MSIQLYSTKVHSMKEPLKITSTLLPDSERSNLIKVLFKIAPNAV
                     YSSDLTSDVSVLVTNPSQSPNWLQSRKFRYIVQYRPDVLVIKYESVLSQYEAWLKGDD
                     TDNNEERLLESFDRLQVFEGLQISVGRLDSTDSLEKLRDLVETRGGIILETLSNSSDV
                     LITTVLEGKRYSKAKEWKIPVVSPDWCFDSVDRGAVLGFEYYELLCINGKGRRKDACD
                     WTKYKNWKRKEKQDRSVRLAKRNARGVSKDKTDESGGERNLKVAKLDHQDRLWNSIMK
                     DTRINSLHRSQSGFTGDDEGWKAEQRVDSESKNETHVEKTMVSTQRQEENSGEPLLFE
                     GISFLLYGFNAEEEKILRAVLAEYRADIDDGKSSQVDYVIVNSDLDKKPSELPKGQVI
                     TEFAIERCIYFHKRSSLDQSSYWGNPLFFNRDGLIREFRSCMKLDINDQKVVVAITGF
                     KGIDLSQFEKLLKGKLSRFFDFKEIFTKECELLIVADVKGDNTLKKLKMAKKWDVKLL
                     DLKRFWIISKDIELSEAK"
     gene            <1013439..>1015700
                     /locus_tag="FOA43_002473"
                     /db_xref="GeneID:62195874"
     mRNA            <1013439..>1015700
                     /locus_tag="FOA43_002473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922767.1"
                     /db_xref="GeneID:62195874"
     CDS             1013439..1015700
                     /locus_tag="FOA43_002473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778695.1"
                     /db_xref="GeneID:62195874"
                     /translation="MSSSPSGEYLYGQLRRNFSALATDKPYLTFTLRNGTEIYTVEQR
                     HIKVTRLNKASQSTRKLDLLLEFDPESLCVNRNEQLMCLYDRKHCHVISLNGPNSSIC
                     FTTVYKLKLDLKSEESVVQAVFNNVSKYQSELVLLTSTKLVCYDINESLDKPVQALPF
                     SESGFGSGSGSVDDFNNSFVYNSFSSQEMLLDPVSVCFASDDISNNEASVSPISDLTL
                     CILTSDFSIYRIFPFFPRHLSVSKIWLSSLFDTTSVLFSSLKSIESQTKFMGTMKLAA
                     RLSKTSGDIYVKDLLPKSLSCGKLLGPLPISPFFDDLYSMNALRLISLPYGVICVVAD
                     RAVVALVYEHTGTAIFADERIECEDKFTLVDSVQFDGNHTICSGFAIPPNGYSLGLVT
                     SEPKLVLVDYSTWMKPLRKAIESGDIKLFASKFASMEMLPTEVKSLGNIGIPGLFTEK
                     RQRRNNVLTCSLNNRIWLAWNEISTFALALSDQSGINMSIIPLVDESDDESCIKSLSR
                     GFATFADTTEKEYYPKISGSFMSEVEPQLTITRQKIIELKRRLSQEESSRLLDMESVE
                     DLSVLERVGQTVSMGVISIFGDIATISRRLIQEKSELKNQISTLDEVRRKEKKMIPRF
                     ETQMDRIEKAEAKQQKLRQRIDRLYEQCQNIVAEKSQIKEQDLSREEVAYVEFLNSIR
                     QFVTERQEEYKKTANFVRMVKESDSKPIIEKRLQLERDESVKNLIRTLEKKLQSRDKL
                     VDMLSDELSKVKV"
     gene            <1016368..>1018950
                     /locus_tag="FOA43_002474"
                     /db_xref="GeneID:62195875"
     mRNA            join(<1016368..1018349,1018614..>1018950)
                     /locus_tag="FOA43_002474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922768.1"
                     /db_xref="GeneID:62195875"
     CDS             join(1016368..1018349,1018614..1018950)
                     /locus_tag="FOA43_002474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778696.1"
                     /db_xref="GeneID:62195875"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR037674"
                     /translation="MKLLGILVVVVTQLVAYLIFCKGFFPTKVLLTPEELTKYTTAPP
                     PGYKEPKRQFNKVIVMLVDAMRADFVFSDQSNMNFTQYLLNEGYALGFTAFSNPPTVT
                     LPRLKGITTGSVPNFIDAVLNIAEDDTSSSLGDQDSWIKQMYLSNWKIDMFGDDTWLK
                     LFPDYFSKSDGTSSFYVSDYTIVDQNVTRHLPEELSSDGLLQWDGMILHYLGMDHIGH
                     KGGSQSANMPAKQRELDTVVKKIFDSLISKDNNTLMVLLGDHGMNDAGNHGGSSIGEV
                     SPAMVLISGKFKHEGLKNSLPVPLPVDPEFGYLAKVDQIDLVPTLTELCGLTVPINNL
                     GTFISSLLPLYATEDEKRSALIKNALQLKVLLDKAHGKSIKPLQDICNVNSEQALLDF
                     IKSAKQELSEASSDYNYFDLHLGMLIYLAVSLVVLALFLVHYRNHLLLAVANLAFFIV
                     YGLSFIGSSLIEEEHHIWWFFTSIFVLYTIELSARNKSFSFFFTLLLLASLRLIKGWN
                     NSGQKYNSVQFLKISKYISCLPVNQGPNVFAAVLMATFLMFFVVKVKDQFGLEQNLPR
                     FLEFFSLSVMTFVLFSLKMVSYLTSTFDLDTGNSGLQRWWLYFIDWLKSYGHFNDLDS
                     VSYQLYRLFQYVWALSAIAIFSIPLACRSVGIVNSDNYNLILSGILTFVANWAPSIFW
                     SVSYTVTVLDSLPKEKLQQYKWNCLYDRMVFNLAFYSVAGLLLIASCYNLRFHLFIWT
                     VFCPKLLYYLAWLGSNLLIDFGLSSLIIAMDV"
     gene            complement(<1019046..>1022593)
                     /gene="NEW1"
                     /locus_tag="FOA43_002475"
                     /db_xref="GeneID:62195876"
     mRNA            complement(join(<1019046..1022498,1022585..>1022593))
                     /gene="NEW1"
                     /locus_tag="FOA43_002475"
                     /product="[NU+] prion formation protein 1"
                     /transcript_id="XM_038922769.1"
                     /db_xref="GeneID:62195876"
     CDS             complement(join(1019046..1022498,1022585..1022593))
                     /gene="NEW1"
                     /locus_tag="FOA43_002475"
                     /note="BUSCO:EOG09340JKC"
                     /codon_start=1
                     /product="[NU+] prion formation protein 1"
                     /protein_id="XP_038778697.1"
                     /db_xref="GeneID:62195876"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023779"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00385"
                     /translation="MKKHIRKGCEMSKFDFNSKTFTPGQTGKRQPRATGNNYNGLRSN
                     KAKSYEEYLTSRAQPTRQRSRVDLSSISGSEQSSGYNTPTSRSMSDTPSVSSINSALS
                     KLEITPISDELEVLNRVQKISEAREQCNKITDVIVNSGVDCIAEWNLLKTLKALNKSK
                     NSALVRESSMILLQTLVRRFAGQMPKEAYFAPLFEAAFDVFADKERTVKRSAQVAIDA
                     LYGMFPAEAKSSIVIGEFLTYMKTGAKWQSKVAALKQFEKLVAECPADLIEMIFYKAI
                     PVLTDMATDFKPELAAEGIKTLKSFLKVLDNLDLCPRYDLIAETLADPHKVPECIKAL
                     SAVTFVAEVTEPALSMVIPILDKSLKMATSSQEQLRQTVKITENLTRLINNRREIARF
                     IPILLPDIKHVVDTAALPEVRYMASEALKVLEAADAEERDGKFHGRLDAHYTAKYLSV
                     IEKKIADGTMFDYLVTITMADANVWDWKSLAEYFEMAFPSYYDDDEEEAKQVADNIVG
                     QLKALMTPNAVKEPDDGETVIVNTDFSLAYGARMLLNKTNIRLAQGHRYGLCGRNGVG
                     KSTLLRAIANGQLEGFPDKNELRTCFVEHKLQYASGESNLVDFIKKDPELQDATSAEV
                     AKTLEEVGFDDEKRKQSIGALSGGWKMKLELARGMLMKADVLLLDEPTNHLDQQNVRW
                     LEEYLLRHVNITSLIVSHDTDFLDTICTDIIHYENKKLVFYKGNLSDFVAIKPEAKAY
                     YTLTDSNVKMHFPKPGILTGVKSNTRAVAKMSKVTYTYPGGDKPSLADVSCSISMSSR
                     VAVLGPNGAGKSTLIKLLTGELVPEEGTVEKHPNLRIGYIAQNAFHHVSQHKEKTPNQ
                     YLQWRYRFGDDNEVVMKESRKITDNAEKEMFEGTIDVADGRGARQIEALVGRQKYKRS
                     FQYEVKWLNWLPKCNSWVPRDVLIEHGFEPLVLKFDDHEASREGLGYRDLTPSAIREH
                     FAEIGLDSEIVDHTPIGSLSGGQLVKVVIAGAMWNNPHVLVLDEPTNYLDRDSLGALA
                     VAIREWSGAVAMISHNAEFVGALCPEHWIVENGELITKTVADIDPSKFEDNGGEQALE
                     SFEAAKQAALAKDDSSPADIKIKKKKKRKLTRNEKKLQVERRRLRYITWLNSPKGTIK
                     PVDSDEE"
     gene            complement(<1022707..>1025400)
                     /locus_tag="FOA43_002476"
                     /db_xref="GeneID:62195877"
     mRNA            complement(<1022707..>1025400)
                     /locus_tag="FOA43_002476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922770.1"
                     /db_xref="GeneID:62195877"
     CDS             complement(1022707..1025400)
                     /locus_tag="FOA43_002476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778698.1"
                     /db_xref="GeneID:62195877"
                     /db_xref="InterPro:IPR011990"
                     /translation="MKRYSRPLLYRSRSILQARFVRMRPFSPGLLRKAQKKGTETSDN
                     DQEKAEQTKQRAQILAQKLSGVDKMSVEEAGKWLGAKKRTESRSRSRFNKVTEENDND
                     RIKSKSPAQIDRELKSRFKKDGIEYDPLFAQQMIKRSKQEEDLINDAIKGGDKIQKVT
                     QDEVLSFVDWLIEDCKKRLPEQGKSNQEEVNEDLEKVMGVEDDDESLVDAFSSVYKLA
                     DKLGPSGLDKLFDFLKLLNQGGNGEMKKMVPLDRLVKLFEISGQLLDDRVRDQCVYLS
                     GNLIYSSTPARADPINEKLYIESLVNHGEFKKALELYTSRQSKPDVVDQRFWYELGAE
                     IYLRMSSDETVEAEKIACEIMEKFEYMHPLLISMFVERYLKLSDWDKAIGWWEKMKDV
                     MNTYGLVDHIDIPGPQIVKDSQMVYNYYNRVDPVSWDNVTDCVVDFLKFRRITEAMII
                     IETATRRDKQYLLHFVDYLEHNVSYPGREYFIMTLENDADNDKQEQKFHSAISGYIRS
                     ELDPLRNTHCSSLDEATTLDELSFFLTKQLGNSSMSSENKLIISSLISSISIGSKLMS
                     HECKDLLTILLKSHSRKGYALTSKVLDEMNKSFQLSQLHSTGLFPPASSHTYLVLVQA
                     FGRRPQPKIPEIEALISTMQKLGIPMLTVLANQIVLAYRKAKQYTKALQFIDSFLQDE
                     GSNRLKPTSEFFRNVMVTYRDSIASGGVDKGVRKLRLEKLRWMFKEMLETPGWEMNEP
                     LCNETVVTFLTFGDVASTVCVLENYGLVLDKDISNDLMLAIKLKLEASVVKMESELND
                     HEKELLTSSIKKYRTDCGLLSIKTNLKPDKEYNWRDAACVLLRYMETFHYHPNPYSFA
                     DHWLASASFEQNEETKQKFSTQLKELQKFYSLPEVEIDEIL"
     gene            complement(1025483..1025579)
                     /locus_tag="FOA43_002477"
                     /db_xref="GeneID:62195878"
     tRNA            complement(1025483..1025579)
                     /locus_tag="FOA43_002477"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:62195878"
     gene            complement(<1025871..>1027505)
                     /gene="ICL1"
                     /locus_tag="FOA43_002478"
                     /db_xref="GeneID:62195879"
     mRNA            complement(<1025871..>1027505)
                     /gene="ICL1"
                     /locus_tag="FOA43_002478"
                     /product="isocitrate lyase 1"
                     /transcript_id="XM_038922771.1"
                     /db_xref="GeneID:62195879"
     CDS             complement(1025871..1027505)
                     /gene="ICL1"
                     /locus_tag="FOA43_002478"
                     /codon_start=1
                     /product="isocitrate lyase 1"
                     /protein_id="XP_038778699.1"
                     /db_xref="GeneID:62195879"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="InterPro:IPR039556"
                     /db_xref="InterPro:IPR040442"
                     /db_xref="PFAM:PF00463"
                     /translation="MAYTKLDLEKEQEDFDKEVNAIKEWWSQPRWKGIRRAYSAEDIA
                     SRRSTIKNPNASDVMAKKAFKLFTEHAKNGTSSITFGALDPIHVAQMAKYLDTIYVSG
                     WQCSSTASTSNEPSPDLADYPMNTVPNKVQHLFYGQLFHDRKQHHERFTVSKEERAKM
                     PYIDFMRPIIADADTGHGGTTAIFKLTKMFIEDGAAGIHIEDQAPGTKKCGHMAGKVL
                     VPIQEHINRLICIRASADVFGSDLIVVARTDSEAATLITSTIDVRDHYFIQGCTNPDV
                     GSLVEVMNVAENKGIQGPELEKVEADWVSKAGVMRFNEAVEQAIKKSDLKNKDAAIKK
                     FSEKVTPLSCTSDADARKLAKEIIGKDIYFDWEKPRVREGYYRYQGGTTCAINRARAF
                     APYADMIWMETKLPIYDQAKEFAEGVEAVYPDKWLAYNLSPSFNWNTAMSPEEQETYI
                     SRLTKLGFIWQFITLAGLHTTALAVDNFARDFKKIGMRAYGQNIQANEIKDGVEVVKH
                     QKWSGAEYVDSIVKMVTGGVSSTSAMGSGVTESQFK"
     gene            <1028228..>1029517
                     /locus_tag="FOA43_002479"
                     /db_xref="GeneID:62195880"
     mRNA            <1028228..>1029517
                     /locus_tag="FOA43_002479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922772.1"
                     /db_xref="GeneID:62195880"
     CDS             1028228..1029517
                     /locus_tag="FOA43_002479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778700.1"
                     /db_xref="GeneID:62195880"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR014906"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036285"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08799"
                     /translation="MEKLTDVNKLVPTIDEEVKSILHQLEQPITRFGEGPGERRERLI
                     ELVSSDEKARNAMIKLQESSSDDLMSDLDNEEFYTPGTDDVFQIRSSIADDSLRRAQR
                     RVLGQHQLYTTTDPLENLKSRRAYYKGLKSCLQLEGSQIVSNRFTSAVQFSPDDSLIA
                     AASWNGSCYIYDSKTLDLKHTFKDLLSEKVSALDWMPDSTAKRLATGGAAGKIKLVDL
                     ENRSDGELDGHQGRITDVQFHPICKYLCSSSYDLTWRLWDLEKMQEIYYQEGHSKELT
                     VLKIHPDGSLLASAGLDAMVRVWDLRTGRSIAVLSNNGHIKAVHAMDWRPSGFQLITG
                     GADNNLKVWDLRKSNSSAAETVLAHSKMITDVKVASNDKYFVSCGYDGYLDVISCDNF
                     VTIKKFKNIDKLMTCDVSHDSKRIITGGWDRSLKLYQ"
     gene            complement(<1029533..>1030643)
                     /locus_tag="FOA43_002480"
                     /db_xref="GeneID:62195881"
     mRNA            complement(join(<1029533..1030560,1030616..>1030643))
                     /locus_tag="FOA43_002480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922773.1"
                     /db_xref="GeneID:62195881"
     CDS             complement(join(1029533..1030560,1030616..1030643))
                     /locus_tag="FOA43_002480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778701.1"
                     /db_xref="GeneID:62195881"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR035985"
                     /db_xref="PFAM:PF00899"
                     /translation="MTDSKPLTEDEIKLYDRQIRLWGVKAQGDVRNSHILVINLTSVG
                     VEVCKNLVLGGIGSLTIVDGSKVIDQDLNVNFFLDETQVGQFKLEACKSRIRDLNPRV
                     ELDTETRDWTSIVNLEEFITRFSLVVATGVCESEIVRLNGLTRRLGIPFYCSGTHGLY
                     GYIFADLIAHQSNVKYDSQSSKKVGPIDPVSSITSVKEIKENDTQTQCCTIRNEFRPF
                     DQLSGKFLKQKYPSTKKQIKKICTLLPAILALLKLPSYLNKLTEDVDVSANELQKQTL
                     KVLSQLKLPQEIALKNPETITNLARQAYCEYQPVSSILGGALSQDIINYIVKNELPIN
                     NITVLDGYSDEMPVYTL"
     gene            <1030804..>1032834
                     /locus_tag="FOA43_002481"
                     /db_xref="GeneID:62195882"
     mRNA            <1030804..>1032834
                     /locus_tag="FOA43_002481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922774.1"
                     /db_xref="GeneID:62195882"
     CDS             1030804..1032834
                     /locus_tag="FOA43_002481"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778702.1"
                     /db_xref="GeneID:62195882"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="InterPro:IPR038609"
                     /db_xref="PFAM:PF11496"
                     /translation="MDLHKILDAKPQPQVVDEDHFFIDPQYQKSNHYKIATPMSDFQK
                     ELMDQIVSLHYSDILKFFERVDDSKKVLTQTQERIVLDSLQTMLTNAQLVASHPYLLI
                     DHYFPKSLTNRDLPKRLAETSGKFEILRDILNIMDSSYNPKDKNDKSKDSSKYINVGI
                     VAKEGKTLDLVDSLCTGSKCYLRRYSGVKVRDSGAKQKEHMRLRLTVHLFPSSMENLN
                     EKELPNEDEGESLQLDYLILFDITADASKLQSYMIPKGVTKVLQLVPIYSVDHIALYF
                     RHLVHNRNYNDYLKPVVAAVVVMRDRVGQLPPILKPVYTNNLQYLMEWFENPLSIKWP
                     LPDMPSIPTFHGKDVEHSLLTEVKFNFDNKDFLKEEAESNGEPKELNLNFSFGGRKTQ
                     MVSHIIQPRFCGKDQRKLDFYQEKRWQKKYLTNPLNSDYYKLTGISREIHQNEVLTHT
                     LIYSLTMKMTDLENLNSEVKTFDHAFEARQRDFKVMREQYSKMSKDMHEMGENVSGKT
                     MRIESLDKLIEDFKRQINELKEKITKLVEAQNGKSRKWMELDTKGADLREEIGKAEEH
                     LESNGNEMKYMKQEIDRAEKSIDESRAAMQKKLENLEELQKKIGDLKEDNSGVIQRQK
                     KLQDVKEEYDKARNKKIELVDRLDLTMKRLIEASTGRSRYVNYARGSLRDAI"
     gene            complement(<1033173..>1033427)
                     /locus_tag="FOA43_002482"
                     /db_xref="GeneID:62195883"
     mRNA            complement(<1033173..>1033427)
                     /locus_tag="FOA43_002482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922775.1"
                     /db_xref="GeneID:62195883"
     CDS             complement(1033173..1033427)
                     /locus_tag="FOA43_002482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778703.1"
                     /db_xref="GeneID:62195883"
                     /translation="MKFSSVLLATAAAAYNTTDVTATTVIETITSCEESGPCHTVTLT
                     TTYCPENSTVISTFTGAAAAGHANVYVAGVAALAAGAMLL"
     gene            <1035956..>1037281
                     /locus_tag="FOA43_002483"
                     /db_xref="GeneID:62195884"
     mRNA            <1035956..>1037281
                     /locus_tag="FOA43_002483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922776.1"
                     /db_xref="GeneID:62195884"
     CDS             1035956..1037281
                     /locus_tag="FOA43_002483"
                     /note="BUSCO:EOG09342UKK;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778704.1"
                     /db_xref="GeneID:62195884"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="PFAM:PF10375"
                     /translation="MGKTKKRQHQKKKVKEEDTVKDTTDEATETEKYEEVEEAEKAEE
                     IKVRLKKLQLESDEKDQRIIDQKSEETLEQKLQQKEEECEKVKENYQNLLDRLSSMKT
                     VFTKMKTSEIEFHKTKEQVLKLEKDKIQLEKKVEKVEEMNQTIIDLQKEMNNINLECE
                     KLTRENNNLRKGSEIKDGEFLLENKRLQTANKKLMMELQESKSEMEEYLIIINEEKMS
                     KQGLQHEIDEINLKNERSEAENKRLIQENQSLEKKVAEIEGEVTNIKQQHSKEHQELK
                     NQLDTKVIELSESHAKVEDLQKLQDTLKQKSERLESLEQDFKQKQKTIGKLRHETIVL
                     NEHLTKAMKLIKQESSQDTIDRELASNLFVSFLQIPRGDSKKYEVLQLISNYLNWDDT
                     KKKHAGLLNSNQKTNSNSVMDSSANRLNTNRSFVSLWTDFLEKESTPHK"
     gene            <1037671..>1038714
                     /locus_tag="FOA43_002484"
                     /db_xref="GeneID:62195885"
     mRNA            <1037671..>1038714
                     /locus_tag="FOA43_002484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922777.1"
                     /db_xref="GeneID:62195885"
     CDS             1037671..1038714
                     /locus_tag="FOA43_002484"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778705.1"
                     /db_xref="GeneID:62195885"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PFAM:PF00294"
                     /translation="MSNLPIPVFTSLGLFIVDEIHFDDGMSIHDILGGGGTFGIVGSR
                     MILGKRMSQRCGWVVDVGNDCPPEMITTLKCWNTGAIFRYHEDRKCNHGWNKYGTNDF
                     RQFKFTTPQIDITVKDLLNYKHLLQSKSFHFILSPQNCLDVLTKLEDNAESDTKPVIV
                     WEPDPDDCTNEMLEHCLPVLKRIDVLSPNAAECASFLGLAEPVDHAGCEIVAQRFLPH
                     MSKRSDSAVVLRCGAMGCLLLTRSLREWFPPYHQGSNSIVDPTGCGNTFVGAFATGMV
                     LSGRELKIACICGTLASGASIEQHGVPGLTDGEPELWNGISMNTRAQRYLESHPELEI
                     EYEEFIKKIAPPN"
     gene            complement(<1038715..>1040136)
                     /locus_tag="FOA43_002485"
                     /db_xref="GeneID:62195886"
     mRNA            complement(<1038715..>1040136)
                     /locus_tag="FOA43_002485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922778.1"
                     /db_xref="GeneID:62195886"
     CDS             complement(1038715..1040136)
                     /locus_tag="FOA43_002485"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778706.1"
                     /db_xref="GeneID:62195886"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00202"
                     /translation="MTVKTKDHSYVFQRKISDKGLLCVGSKGDGMYIILEDPKTRERK
                     VLMDGISGAAVCSLGHNDPEIIDQLSDFARESAYTFGGHYGNYSAENLSKFLCDKSKG
                     LFSSCLWTGSGSEANENAMKIMRQYHLERGDPNRYKFISRKQSYHGFTIGSLSLGDCA
                     RKPPFKPILLSDECTPKIAQCYPYRGIKSGMTEEDYTNELLANAEKVFIENDPSTIAG
                     VVVETVGGSTMGTPTPPKGYLDGLREITHKYGALFMCDEVMCGLGRCGYPFTFLHPEF
                     GLSSGGPDLITVGKTIGSGIVTLAGVMISPKVVDAFEEGSNLIVGAQTYHCHALNCRV
                     GLAVQQKIYRDNLIENVRILGDKMKADLKEQLKDCKVAGDVRGAGNFLTVEAVKDRES
                     KEPFDHKFNIGSVMEQKCFDKGLIVMGASGTIGNEQVNDNEVIGYGDHCTIGPAFTFT
                     EGQANFMVKTIVETFKEIEREYL"
     gene            <1040606..>1041046
                     /locus_tag="FOA43_002486"
                     /db_xref="GeneID:62195887"
     mRNA            join(<1040606..1040614,1040675..>1041046)
                     /locus_tag="FOA43_002486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922779.1"
                     /db_xref="GeneID:62195887"
     CDS             join(1040606..1040614,1040675..1041046)
                     /locus_tag="FOA43_002486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778707.1"
                     /db_xref="GeneID:62195887"
                     /db_xref="InterPro:IPR019192"
                     /db_xref="PFAM:PF09812"
                     /translation="MFSRSKAGLNPEAQKVVTQLSVMSAGRKMPKMLKLCNEDYIKHK
                     TIMKAWSVKRKQEKEAEERSIKKQYRSIREAFEDLKLASPKLFEKANEHEYGKRFPLE
                     MRIPTEYPPRQIWYYDYVPRKRND"
     gene            complement(<1041101..>1042954)
                     /locus_tag="FOA43_002487"
                     /db_xref="GeneID:62195888"
     mRNA            complement(<1041101..>1042954)
                     /locus_tag="FOA43_002487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922780.1"
                     /db_xref="GeneID:62195888"
     CDS             complement(1041101..1042954)
                     /locus_tag="FOA43_002487"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778708.1"
                     /db_xref="GeneID:62195888"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSTPNSSSVSTPTTSPISPAQPLSKNVTFGVVTQKGSSSAYRRS
                     SVGTQPPSFRAGAFSCINEGSSSLAAAAGSAGAAASHSTSGSASGSTSGSFNQPVIPP
                     PIPESLPTTPGYELNGTSYFDMPGKDSFALPQQQTVLASVNDDGNSSNTHLENVSQGL
                     TLENSFRNKWRLVASIIFAMSGGLSDGAPGALLPRMESYYGINYTVVSLIWISNAIGF
                     IVIAVFSHKLEPILGSRNLQSLGCACLIIMYSMVCSAPAFPVVVVAFFFGGIGLATNY
                     SFQNLFLSRFEKSSIYLGFYHGSYGFGACVGPLVATVMVNQGVKWSYFYCIMLCLSAF
                     NMVNQFLAFKGYEKEFRAWESDDPLVERNASTPEAAEVTVGIKMVKLNTKNNAGASSG
                     EARETTFEDVNPDTRLEGRSVGIEELHAALKTPITWYLAFFVLFYQGAEVSMGGWIVT
                     FLEVYRHGSTRNTGYVASGFWGGLTIGRLFFTPSIHRFVGAKRGISILIVVSLICCTL
                     AWVLPVLIVEAVFVALFGLFTGPIYPLMITVAVRILPRKIQVISMTIITALGSSGGAI
                     FPFLVGLISQFAGTYVVMPFILGLLSSALVLWYLLPNPDRLVIRYIWQRIW"
     gene            complement(<1043336..>1044631)
                     /locus_tag="FOA43_002488"
                     /db_xref="GeneID:62195889"
     mRNA            complement(join(<1043336..1044231,1044586..>1044631))
                     /locus_tag="FOA43_002488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922781.1"
                     /db_xref="GeneID:62195889"
     CDS             complement(join(1043336..1044231,1044586..1044631))
                     /locus_tag="FOA43_002488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778709.1"
                     /db_xref="GeneID:62195889"
                     /translation="MDDANPWVAERGNADSNFRSRDYWNNTEIHKQASTKAGEWYQIE
                     KNLDEIGQRQRRPSQRNVNIFRWSSKESNKGQQSMERLRKKKQQEEKIQRKVNPKLLN
                     AAFVEARKIIDERHQKEELERARLAKEREERERRLKEQKRQKDLEVKRYEVKLEGSEK
                     SKKKKGFLQTLFGRKSKISKDHLSNDAVKEDPKVPEHDDFLAFSKKLSTKSENTDYDS
                     DSNSESESKSGYEDGAERGYDELGEVGNSSFDQDPQCTQDLKSPSLPESSSGDTISNH
                     VIISEASDYFSPKTTSTDSSSSSSSSEFGEFNQHLTT"
     gene            <1044788..>1045372
                     /locus_tag="FOA43_002489"
                     /db_xref="GeneID:62195890"
     mRNA            <1044788..>1045372
                     /locus_tag="FOA43_002489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922782.1"
                     /db_xref="GeneID:62195890"
     CDS             1044788..1045372
                     /locus_tag="FOA43_002489"
                     /note="BUSCO:EOG0934471L"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778710.1"
                     /db_xref="GeneID:62195890"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="InterPro:IPR036504"
                     /db_xref="PFAM:PF08617"
                     /translation="MAYNILQLSQFPQYKVFVSLYKGVTNHADIRDSIKSGSLPDDFD
                     FAFLNAANLLSMEQLYSALFRCFVDKRNGKMKANTIHTELISDLSPVKNIMEALTRFG
                     IPAEGEKSDLIILKVIESTTSPEKAQLDQVYDTVSKVVQNNGVAGVCLTDAALESTVD
                     LQSIRKNYKLGDMFTEDRERLNRLIIGTIQLRGL"
     gene            complement(<1046518..>1049085)
                     /gene="AMD1"
                     /locus_tag="FOA43_002490"
                     /db_xref="GeneID:62195891"
     mRNA            complement(<1046518..>1049085)
                     /gene="AMD1"
                     /locus_tag="FOA43_002490"
                     /product="AMP deaminase"
                     /transcript_id="XM_038922783.1"
                     /db_xref="GeneID:62195891"
     CDS             complement(1046518..1049085)
                     /gene="AMD1"
                     /locus_tag="FOA43_002490"
                     /note="BUSCO:EOG09340OGO"
                     /codon_start=1
                     /product="AMP deaminase"
                     /protein_id="XP_038778711.1"
                     /db_xref="GeneID:62195891"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF00962"
                     /translation="MSKSDTDSVANDLYQFHLPSTSGTKYPDTGVYSDDNSDGKDSVY
                     IPEEDNLVEGEDSVGNVSNIAAMIRAGSAHFSYQEDADLRDREAREDAYDSISSPKAS
                     PSSSVNSRRTRRSSLAGGDFIPKSTVSKKSKNPKDPLSPSAAPPALTLPVASTTTINT
                     SKETSTTSSGAKFQYNPLTHELRSVAKIAAAEASPPVDESPSKISPSIPRRLHFNVAG
                     VFASDDGVIPEPPSPELIKIYKDLDWAMKTRAKYQQLSFQNDGDNPKNQDDWKIYPRP
                     PPPFWRKGDQYALDRLLDEGDETADAFDLSKCEIPGLDTDHDFTINKEDVFQVIDKLT
                     EEPVSYIPTIKDYYLDMERLINIASDGPTKSFAFRRLEFLEAKWNLYYLLNDHEETSE
                     SKRNPHRDFYNVRKVDTHVHHSASMNQKHLLRFIKHKMRECPDEKVIKRDGKVLSLFE
                     VFESLHLTAYDLSIDTLDMHAHRDTFHRFDKFNLKYNPMGESRLREIFLKTDNYINGR
                     YLAEITKEVFCDLEASKYQMAEYRISIYGRSIDEWDKLASWVIDNKLFSHNVRWLVQI
                     PRLYDVYKKNGIVTNFQEIVINLFRPLFEVTRDPSSHPKLYVFLRRVIGFDSVDDESK
                     TDRRFHKKFPFPRKWDSEYNPPYSYYIYYMYANIASLNVWRKLRGFNTFVLRPHCGEA
                     GDPEHLISAYLTSEGISHGILLRKVPFVQYLFYLSQIGIAMSPLSNNALFLNYEKNPF
                     PAYFRRGLQVSLSTDDPLQFSYTREPLIEEYSVAAQIWKLSNADMCELAKNSVFMSGF
                     ERQLKRHWLGSKFNVLGSDGNNVEKTNVPDIRLIYRAETLKTETDLVSYYSSLDYKE"
     gene            complement(<1049276..>1050970)
                     /gene="DPS1"
                     /locus_tag="FOA43_002491"
                     /db_xref="GeneID:62195892"
     mRNA            complement(<1049276..>1050970)
                     /gene="DPS1"
                     /locus_tag="FOA43_002491"
                     /product="aspartate--tRNA ligase dps1"
                     /transcript_id="XM_038922784.1"
                     /db_xref="GeneID:62195892"
     CDS             complement(1049276..1050970)
                     /gene="DPS1"
                     /locus_tag="FOA43_002491"
                     /codon_start=1
                     /product="aspartate--tRNA ligase dps1"
                     /protein_id="XP_038778712.1"
                     /db_xref="GeneID:62195892"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="PFAM:PF00152"
                     /translation="MSEELENKVKSLEIASTQQQPKMAVGPDGKPVIGADGKPLSKKA
                     YKKLLKEQEKAQKKAEKAARLAKEQAERDAKEQTNDFATENYGELPLMQSRDDKVTGE
                     QRYYLNELTTADDGKQIIFRARVHTSRQQSSNMLFFAFRQKNDIIQGLLRADKEHVSK
                     PMVKWASGLHLESIVLVHGEVKKVQEAVKSATLQDIEIHISKIYLVEATPEKLPLLVE
                     DASRSEAESAELGLPMVNLDTRLDYRVIDLRTVTNHSIFRLQHGICSLFREFLTNQKF
                     TEIHTPKLIGSPSEGGANVFEVAYFKGKAYLAQSPQFYKQQCIAADFERVFEVGSVFR
                     AENSNTHRHMTEFVGLDMEMAIEEHYHEAIQMLCNMFIFMFTELKKRYAKEIATVREQ
                     YPVEEFKIPEKMVIVKFKDAVKMLKDAGREMGDFDDLTTENEKFLGKIVRDKYDTDFY
                     VLDKFPAAIRPFYTMPDPDDPRYSNSYDFFMRGEEILSGAQRIHEPKLLVKRMNDLGI
                     NPNQPGLEDYIQAFSYGCPPHAGGGIGLERVLMFFLDLKNIRRASLFPRDPKRLRP"
     gene            complement(<1051188..>1053008)
                     /gene="RLI1"
                     /locus_tag="FOA43_002492"
                     /db_xref="GeneID:62195893"
     mRNA            complement(<1051188..>1053008)
                     /gene="RLI1"
                     /locus_tag="FOA43_002492"
                     /product="Fe-S cluster-binding ribosome biosynthesis
                     protein"
                     /transcript_id="XM_038922785.1"
                     /db_xref="GeneID:62195893"
     CDS             complement(1051188..1053008)
                     /gene="RLI1"
                     /locus_tag="FOA43_002492"
                     /note="BUSCO:EOG09340VPX"
                     /codon_start=1
                     /product="Fe-S cluster-binding ribosome biosynthesis
                     protein"
                     /protein_id="XP_038778713.1"
                     /db_xref="GeneID:62195893"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR034348"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00037"
                     /db_xref="PFAM:PF04068"
                     /db_xref="PFAM:PF12837"
                     /translation="MSDKNTRIAVVSTDKCKPKKCRQECKKSCPVVKTGRLCIEVEPK
                     SKIAFISENLCIGCGICVKKCPFGAINIINLPTNLESQVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILSGKLKPNLGRYDDPPDWEEIIRYFRGSELQNYFTKLL
                     EDNIRAIIKPQYVDSIPHAIRGDEKRVGVLLKNRMERKDSAKHMIKALQLQHVLKREV
                     AQLSGGELQRFAIAMTCIQKAAVYMFDEPSSYLDVKQRLKAAQVIRSLLNADTFIIAV
                     EHDLSVLDYLSDFICILYGVPSVYGVVTFPAGVREGINIFLDGHIPTENMRFRTESLQ
                     FRLADASDNTLIEKTADFVYPSMARTQGEFKLTVEAGDFSDSEIIVMMGENGTGKTTL
                     CRLLAGKLEPDEGSKAPKLNVSMKPQKISPKFKGTVRQLFLKKIRASFLSPQFNTDVI
                     KPLKIQDIVDENVMHLSGGELQRVAIILALGRPADIYLIDEPSAYLDSEQRIICSKVI
                     RRFIIHSKKTAFIVEHDFIMATYMADRVMVFEGEPSMSATAHKAESLLTGCNRFLKNL
                     NVTFRRDPTSFRPRINKLDSQMDKEQKLAGNYFFLENTEL"
     gene            1053550..1053621
                     /locus_tag="FOA43_002493"
                     /db_xref="GeneID:62195894"
     tRNA            1053550..1053621
                     /locus_tag="FOA43_002493"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:62195894"
     gene            complement(<1053939..>1054595)
                     /locus_tag="FOA43_002494"
                     /db_xref="GeneID:62195895"
     mRNA            complement(<1053939..>1054595)
                     /locus_tag="FOA43_002494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922786.1"
                     /db_xref="GeneID:62195895"
     CDS             complement(1053939..1054595)
                     /locus_tag="FOA43_002494"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778714.1"
                     /db_xref="GeneID:62195895"
                     /translation="MQFKNLIILSAAVSAETVQLSTMSSKEDVNGKGISSLHEGAGIN
                     YAFLSSGSDTLDYDESTKFLSVSYDTYSEYFTIDSGFVGVSVSPAPVEVTFDKDNNLL
                     VDGSSEGFYGCKNTNDPYDNSESSYELMYYSGNSTAPDGCLPLTVVKVSGAGNKTDTG
                     TKTTTSTGTETTSSTVSCTETKCQPQTTAYLTTFTGGAEKFGSAGILALGAGAFAALL
                     "
     gene            <1055476..>1056588
                     /locus_tag="FOA43_002495"
                     /db_xref="GeneID:62195896"
     mRNA            <1055476..>1056588
                     /locus_tag="FOA43_002495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922787.1"
                     /db_xref="GeneID:62195896"
     CDS             1055476..1056588
                     /locus_tag="FOA43_002495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778715.1"
                     /db_xref="GeneID:62195896"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="PFAM:PF02146"
                     /translation="MKTLRLNEAESESDLCILTKLISKSRKIIILTGAGISRNAGIPD
                     FRSSSGLYKQTYNNGTINCKELFDVSIYREADTIELFNRFMQKMYYNKVKKAKPTKTH
                     LFISALNKRRKLIRCYTQNIDGLERQLGMKTEFDQLQDWPHLDVVQLHGDLNKLKCSR
                     CFEKYEWNEIFVDQKGAEEDAGLLIACPNCVEKYKKMQSSGKRCCASSIGIIRPNIVL
                     YGEDHPYGEILAKGMERDISRRPKLFLIFGTSLKVVGVKRLVRKLCKTIHENDPEGKV
                     AIINNTGLCQSSWGKYIDYQVLSDCDDWCNYVEKKVPRLFRETKKPENLKIGSKKRLS
                     SSLSSSLSSSSSSSSSSHTIIIENPAKRIKAEIVVV"
     gene            <1056796..>1057239
                     /locus_tag="FOA43_002496"
                     /db_xref="GeneID:62195897"
     mRNA            join(<1056796..1056801,1056883..>1057239)
                     /locus_tag="FOA43_002496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922788.1"
                     /db_xref="GeneID:62195897"
     CDS             join(1056796..1056801,1056883..1057239)
                     /locus_tag="FOA43_002496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778716.1"
                     /db_xref="GeneID:62195897"
                     /translation="MQYDLSKDGVAFNVNFCYCCRRLLIPGANMEIRVRYDKKSVKRY
                     LVYRCCGCKTEVRFYTLLDKREKKRVEERGEKESKSNDKQRNGKRRRLRELLKKKSIK
                     KEGITRGKKQLDLFDFMK"
     gene            <1058280..>1059749
                     /locus_tag="FOA43_002497"
                     /db_xref="GeneID:62195898"
     mRNA            <1058280..>1059749
                     /locus_tag="FOA43_002497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922789.1"
                     /db_xref="GeneID:62195898"
     CDS             1058280..1059749
                     /locus_tag="FOA43_002497"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778717.1"
                     /db_xref="GeneID:62195898"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="PFAM:PF10297"
                     /translation="MSTIQQQHHSEQLHSISAKPLDRSCSEVPKSTNDYTYNHKRTHS
                     HTNRVNIVSRSPQSPSPIPLAKSLSLSAIPDEPITIRTSKKWVLPPRPKPGRKPSLAK
                     KEKKRHVKKKRSTTLMSSPTPVQSSLQNAIPGPSQGSSQGSSQGSSQYLEVDSSIIQN
                     PIKQKILQINEENYYLKLEVIKMVTDLKNMREVSTDVKSGPIAIASASATRGTKRSHD
                     DDINDFLVSLVDLSHTDRQKQEQLALPHTQNPQAVPADDPLLSSPIVSPLLLERVLSE
                     DPVAAVATLPEEPRIDQFLNLDQDDIPFLLQASPTNLSEDDDLTSTLSTTPSTMLTSI
                     KTNDTLDSLSGSTVVSTNSPRFKFKLLDIPEMDVTAKTAVRDKGFSIFNGPTSLIDDA
                     LFDKPTTMDVSNMVQMTLKNGITGNNGTEIASGKTSTTATRSTTRSTTGSTTRSTTGS
                     TPSNTTNTTENDDYYEFDGLDDVEMEFENFINGNDLEMK"
     gene            <1060036..>1063545
                     /locus_tag="FOA43_002498"
                     /db_xref="GeneID:62195899"
     mRNA            <1060036..>1063545
                     /locus_tag="FOA43_002498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922790.1"
                     /db_xref="GeneID:62195899"
     CDS             1060036..1063545
                     /locus_tag="FOA43_002498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778718.1"
                     /db_xref="GeneID:62195899"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR030395"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /translation="MKFGKYLAARQLEFPEYAGNFINYKALKKLINALTQDISKPLQD
                     KKGSFFFRLERELEKVNDFYLKKESELKFRLDILISKKDRFFKSHNGGKINKNSVNFV
                     SLYDGFKKFSKDLDRLEQFVELNETGFTKVLKKWDKRSKSSTKELYLTTAVNVQPVFH
                     RSQIIELSDLVANNLMELESLAEGDTGFVRYETSSCKTDSTTGSTPTLDSSVRYHNIM
                     GSCDELYTDFYEITVQNANLSQEDQMAKFKEWSNQIISKLPDDTKKYTLSKVFLLLIP
                     NLHIPDASLLQFYQYFKEFIDLSFVDDLNGRNCLIEASTCQMNRNPIVELLLKSDLDP
                     TKKDVSGRTCLHYVTENGRDDLLLLLLSSSKAGSIIDSMDNESISPLLFAIINNHVSC
                     VSTLLQHGANGLPQQDDLKPKYLPLNVACKIGTYEVVQLVLGRYGAPEKAKQDHLLTN
                     SAQCNAEGLLPLHIVASSGHEQLVPLLLQYGADINQLDRLNKWSPIFYAVMEGYDSLT
                     HELIGYGANFKIQDEDGFDPLYYAIWEGNVEVLNVLMESYKEENSDKMSEVEEDGNEA
                     QNCIEEALAIPPMVSLGPKSQISSSDIIPFSIDMIPDLSLPPPIIPLRKYGHNFLEKK
                     IFLKLSFYTSRNSVRLNPDTFLTSIPGRITISCDRNDLIPRNLLLPVLDNDKSITFQT
                     DSFDESFNIEFELFPMFGTRLLAKATLPSSVLITSYPGSGSKLSGDLEIPLSDVKLRN
                     TGFLRFNYEIVYPYSGAPLEISLYDTYWKSSSVAEEKERQRQQQIQLQKQEEHHQNTN
                     VSFVTASSLTGIYYRVPLYLLNDGTPIVCPKYLIDVGGGVSLPICCFGFDQLHHLFYG
                     NNTEYKTLCEQLGDLKGDGFRLRFYEILSRLYMPLNEFLDIVDPEIALNLEIFYPSVY
                     ELEFYDIKLFTSFSSNELIHKCNVEAQLNTPTDNCLNNFIDLILTDVFNHVRKLRHNH
                     NSNSLRSRSLILSSDNSTVCTILNWKQPNYPVFYNLNGVKYDSQQDSFYECTANGFLK
                     KDKINLQTKNAEKLERKELQQNHHSLLIDNIDSINKDSSEYINSLQYQDKLSRSIKLA
                     ADFASTNNMLGITVPAKLLRICPTMAESIRAKGLILVAAKDENGLVVKQGQIQPLVTK
                     YGDINVNGLRFNDIVSFKDTIDM"
     gene            <1063932..>1065350
                     /locus_tag="FOA43_002499"
                     /db_xref="GeneID:62195900"
     mRNA            <1063932..>1065350
                     /locus_tag="FOA43_002499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922791.1"
                     /db_xref="GeneID:62195900"
     CDS             1063932..1065350
                     /locus_tag="FOA43_002499"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778719.1"
                     /db_xref="GeneID:62195900"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00202"
                     /translation="MTQDKSEGSESYVFQRTVSEVAPMLVDADGMYITYEDPKTKIRR
                     TVIDAMTGAAVGSLGHKDKEVTTYMGDAAKNSFYSFGMYFSNYAAEELSKFMIDRSPK
                     GHFASALWVGSGSEANENALKIAKQYHNERGDTKRYRFISRKNAYHGFTIGALSVGDG
                     VRKEDFKQILLSDEQTPKVSACNPYRGITDTVNEEQYTQQLLKELEDCFIKNDPSTVC
                     AVIFETVGGSSFGTVPPPKGYLDGARELCHKYGALFMLDEVMCGLGRSGHYHTYEKFM
                     TSGNGPDLMTIGKTIGSGFVTLAGVLISPMVKNEIVSGSNAVSGAQTYHCHEFNCKIG
                     LAVQKKILRDNLVEKAAKVGQYMFDSIKEQLKDSKIVGDIRGLPLFFSLEFCDPVTKK
                     SFPPEWKVSYKVSDKALENGITTMGMQGTNGASKDDKGEVVGLGDHLSIAPAYIITMK
                     EADIIIKDLVKAVKDTEAELPL"
     gene            <1065494..>1069656
                     /locus_tag="FOA43_002500"
                     /db_xref="GeneID:62195901"
     mRNA            join(<1065494..1066533,1066564..1066586,1066772..>1069656)
                     /locus_tag="FOA43_002500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922792.1"
                     /db_xref="GeneID:62195901"
     CDS             join(1065494..1066533,1066564..1066586,1066772..1069656)
                     /locus_tag="FOA43_002500"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778720.1"
                     /db_xref="GeneID:62195901"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /db_xref="PFAM:PF06011"
                     /translation="MTNINVGTSTDDDKLVHVPSSSIPAITGEIKYVDPMFKMPSVLA
                     PYKVAILSYSASLVSTAVGFPLDSIKTRMQTHNFASALECFKLTLRLEGFGGLFRGIA
                     APLISTSFSRSLGVSIFARTKPIISSVMVPVWGVEPLIKVNNSLTNPQLAIVINNIPI
                     SLLSGGIAGSVVSAFACPFELTKIFQQIIMLVNSDTQTNLRSEKLPTRLYEVTKSIVD
                     HEGARGLYSGYRYHILRDSLSSSLFYGLYETVKMGFQSLSGTALEKGLLSNSLKDKLD
                     IICVPVAGALAGCISWITVFPIDTVKSQYQRDVVGNIVRARSGLKRLPVVARPLRFPT
                     REMYKGLGPSITSLFEALMKTAFLGPVQSAFVRSYNSGNVSTLRFTNFLTNVSYLPET
                     GTMDFQLRAFALEEVVDVNSTTNMYTTIHFRLKYVDDLIVDQYLRLCDYASVNHMTSY
                     YVPKGVFTGIENLFSYGGTMTQTVSTLVKVNGTQTSTSLVEMTTEGPRLLNSTDGDVD
                     ILPVGIQKRYYTSGNTSAILRYHYMASGESPIMKVQHRKDDPDVYTDPAVVTLPQSFE
                     TVQVSVPTTVYSEASDSPSYSSSSSASSYATASSCPIFKNNEVIINLSAQVGHRSAFG
                     SFELEVEIISPDAEHSVIGYTGSSISTVQNAKFSAFLSIFFASLLGVIFLSNLTNIFL
                     SPYQDSQDVYLMSAAMICNAPLLNQVTPLFVDFIHYLQFIFFMAALNLNYPGFFSPLV
                     ASFRWVALLGTKSINGDSVGNVYQTIYTGGLKALLNGAGDNSMNFQWMWLLINFIIFI
                     CGYILVYNVLFAVVYLIRRLRGSPVGVGSKRSCLCYNMGVILYSFLSVAAIPLLTVSL
                     YIMATYNSNPYGGPNNNDTFAVWCVVTGALVLVMFVGLMAFFGIKYVFSDAGKNKLYT
                     KLTTILIWNLFYSSFNVAKVAFVLVDQSEFLIFSIVIGCAQSNGVAQLSVIIVTKSLY
                     LVLLVIYKPYYSKTRMNRNKMACSAASIIVSLLHVPFVYHLDASDSIRTRFIWAISII
                     HLLVIVTLFLLPTMQNIYLCFKWYYKYRKGDKGTDIPDYRDDGDFIELPFSSDNRSLT
                     SDGTFADLLTMPPLSPSVSGILHDSSSEINTSDSTESARNFDKPLPAYTQRSTKDWMA
                     REVDMYYNARRILDPDPEVRQLWEERGRKLVKANNAFAEKTRTNRRDEDVGGTNIKSG
                     SWMWLENIKKVHFSYRRRPPRSFEVMRPHPLIVNRDLARIETRYTLSTYTATFTTNSG
                     IVKDDISDVEGSPLSPVTATQDSDQLSIPSVIDPESKRLALRVVNTVSDEDEV"
     gene            complement(<1069725..>1071413)
                     /locus_tag="FOA43_002501"
                     /db_xref="GeneID:62195902"
     mRNA            complement(<1069725..>1071413)
                     /locus_tag="FOA43_002501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922793.1"
                     /db_xref="GeneID:62195902"
     CDS             complement(1069725..1071413)
                     /locus_tag="FOA43_002501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778721.1"
                     /db_xref="GeneID:62195902"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="PFAM:PF00856"
                     /translation="MSFEQDTERFDLWIKNHFSIVSRKFRIADLRDHSQGRGLIATED
                     IKKDETLFEFSRDHIINVDSATLGQLQNRSNKEILISLNQWEALILCLAYELMLAEKS
                     RWWDYLRILPQTIDKFSTPMFWKDEDLGFLKPSCVTDRLGKQEAEKTYFKLVPEYCIK
                     LGVPELAKFLTINQFHAVASLIMSYSFDVDHAEEVSEGEEERGENHADVQDDVQDDVQ
                     DDVQDDPQTDLQTDLQADLQADLQTDLGAESIKFDTYLKSMVPLADTLNANTTLVNAT
                     LHYDQEQLVMKAIKDIKKDEQIYNTYGDLPNSEILRKYGYIELPSSAAEFADIPRTVL
                     VDFYKQKYTKTFPTIKNVHHLVDILIQQIAESDYLEETLDDSDDGIVLERYEVYANGE
                     LIPEFILLLLILSTLFESFRTDSKWFRKLCRHMDKFEGEFQIFVNRVIAKCYQLLEER
                     SIVTDAFIDDLKQIVQSRLDQYPEKIVSSECILPKDFSLQLSNKQIADVVLSNEVRCL
                     QDILDGKFPPNEDGSEEPKFEVISNQKFLKNVLKRKREDDEKRSERKNRRVQRS"
     gene            <1071711..>1073465
                     /locus_tag="FOA43_002502"
                     /db_xref="GeneID:62195903"
     mRNA            <1071711..>1073465
                     /locus_tag="FOA43_002502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922794.1"
                     /db_xref="GeneID:62195903"
     CDS             1071711..1073465
                     /locus_tag="FOA43_002502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778722.1"
                     /db_xref="GeneID:62195903"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF07719"
                     /db_xref="PFAM:PF13176"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13424"
                     /db_xref="PFAM:PF13432"
                     /db_xref="PFAM:PF17830"
                     /translation="MSSAEEYKTQGNDSFRAKDFDKAIELFTKAIEASETPNHVLYSN
                     RSACYASLHRYDKALKDAEECVKINSTWAKGYNRVAAAQFGKGDLKDAQRSYEKALEL
                     DPANQMAKSGLQDIASEASQSIPGPDMGLGKIFSNPELIENLKKNPKTADYMKDPELV
                     EKVKRLQKNPSSVSQDLFSDPRLMTIVAAILGVDLKMGAGGEGGEGGEGGEGGEGEAE
                     GEAEAETGSKAEIQTEAEAEIPSQETAETIPVPSEKQQADNFKAEGNDFYKARKFDDA
                     IEKYNKAWETYQDVTYLNNRAAAEFEKGDYDGAISTCQKAVEEGRSKHADYTVISKSF
                     ARIGSCYVKKDDLKKAVEFFEKSLTEHRTGPTLTKLRAAQRELKKRESEAYMDKDKAE
                     EARERGNANFKKGDWPAAVKEYTEMVKRDPSDPRGYSNRAAALSKLMSFPDAIRDSEE
                     AIKRDPNFIRAYIRKANAEMAMKKYKSADDTLQKAREVEQKNGQLNSPQMMEIQQLLE
                     KALTQRFAPMEGETYEQTMKRVQQDPEVVEIMSDPVMQTILQQAQNNPAALQEHMKNP
                     EVYRKVMILMSAGIIRTR"
     gene            <1073676..>1075550
                     /gene="SNF1"
                     /locus_tag="FOA43_002503"
                     /db_xref="GeneID:62195904"
     mRNA            <1073676..>1075550
                     /gene="SNF1"
                     /locus_tag="FOA43_002503"
                     /product="Protein kinase"
                     /transcript_id="XM_038922795.1"
                     /db_xref="GeneID:62195904"
     CDS             1073676..1075550
                     /gene="SNF1"
                     /locus_tag="FOA43_002503"
                     /codon_start=1
                     /product="Protein kinase"
                     /protein_id="XP_038778723.1"
                     /db_xref="GeneID:62195904"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="InterPro:IPR032270"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF08587"
                     /db_xref="PFAM:PF16579"
                     /translation="MSEYVSQEDQPTVQDNESERRHHHHHHHHHHHGDEAMSPQPQPQ
                     MQSESERAQAQAQAQAQPQPQTQQPDQTNLNAISTEPVHGNRIGKYQMVKTLGEGSFG
                     KVKLAYHTTTGQRVALKIINRKTLAKSDMQGRIEREISYLRLLNHPHIIKLYDVIESK
                     DEIIMVIEYAGKELFEYIVQHGRMTDSEARRFFQQIIAAVDYCHRHKVVHRDLKPENL
                     LLDDHLNIKIADFGLSNIMSDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVI
                     LYVMLCGRLPFDDELIPALFKKISNGVYTIPHDLSPGAKNLLTRMLVVNPLNRITVKE
                     ILKDPWFTVDFPDYLKLKDMSTVKDVTIDEVDSDVVSALSSAMGYSEQEILDAIRVGR
                     QSETEEILDSYELMRNNSVLVDDIKRQSEPENGLEERVQQNSDWRTPTQQGSVVNSKY
                     ALQSNIAVLPSSLPQIHRAYMVQMHPELASIQPISTKKSKTRWHFGIRSRSYPLDVMG
                     EIYRALRNLGAEWQRPSEEELWTIKVRWKYSPNDLDAGQKEMKIPDMMKMRIQLFQLE
                     PNNYLVDFKFDGWDNADCSETEDIGLPADDDEVSSFSAYPFLHLCTRLIMELAVNSQG
                     "
     gene            <1075750..>1078416
                     /locus_tag="FOA43_002504"
                     /db_xref="GeneID:62195905"
     mRNA            <1075750..>1078416
                     /locus_tag="FOA43_002504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922796.1"
                     /db_xref="GeneID:62195905"
     CDS             1075750..1078416
                     /locus_tag="FOA43_002504"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778724.1"
                     /db_xref="GeneID:62195905"
                     /db_xref="InterPro:IPR014729"
                     /translation="MSSSASANVIDNYVSFITKANGNQLFANPFTSSSSDLKRLTKTM
                     THTGHNKYPMDQEGNDQIPALYETVHLHYPPPPQLQPITPKQLVQQTSVQVRNDEARR
                     AASPLPSPLPSPVASRTDSPVRYYLDEPSHSPSLGVAKHLKSALSKPGRAPLASAFRT
                     LVSFDTVNIGFSDDATSDNTSRVSALEDRNSALLDEEFGLHSDRRTSGSSRWRSPSPS
                     NRDISPTSSTKDLSPTTGSRELSPPNRLASSGGRSRSPARASSIFRKYPTTPIITHDS
                     CTLTKKHRQFDRLYSGALKPRTAVLPNRNILCYVSGRKHTWVAVDWCCNQLLEDGDTL
                     VIIASIRPNWRSSLRRRLSSGSIFAADHSLMTEEGIRRSPEYAKVVTENLMKYALAIL
                     NSNKIIKITVELSVGNTKDVLKDMYSLYMPSVVVTSAKPTAAPSTKSWLTSRITDRLV
                     KNFAVPVVIVPAINMDLFQLKLYKVLDKRMQLAAKGKADTKELLDELQNVGMYDLGDQ
                     RNYLRQSAAEDLLIKSDLEEFGLEKEREEEEEDDDDDDNTDTADEHSDKNSSVDSEED
                     GEEVNDGSNAGSPAESSAGNRTGSGDESDFAETTFTGGESRSRPMHLTRSLQISQENP
                     ALRHLTLLRSKTEDASENKISTADGAQSLVSDKKESTSFQLKKLEFDTQIRIYKEMNT
                     IEHQPVTEDTFKHFLGVVSDVAYNYGIELAEYAKEGGEGANMVRTMTGAPDVSYFRPK
                     SMLLGKRGVSSTPFVRKSVSNSDVTNSVGSPGSAESFSPGGSRGSRGSRESGDVRALL
                     APTIKVDSPEIRAVGEPIVSSYSEASGKHRASSLRFDLGNGASTRLSGKNISGSPDTL
                     LRSVYSAGSTLHPGVKVGARRKSFFKRLFNRS"
     gene            <1079420..>1080241
                     /locus_tag="FOA43_002505"
                     /db_xref="GeneID:62195906"
     mRNA            <1079420..>1080241
                     /locus_tag="FOA43_002505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922797.1"
                     /db_xref="GeneID:62195906"
     CDS             1079420..1080241
                     /locus_tag="FOA43_002505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778725.1"
                     /db_xref="GeneID:62195906"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /translation="MVVDENTLLLNTKDAQKKPIDGYTRSDSRNLKASNKSKTLTGNS
                     FTQKSGINEDSVILKIYDLSGQYKKQHLWKEYLASHGTKINCIVYMVDVSDTLTLDDS
                     ISKLIDIINYNNESLHIPLVIIFNKIDIVKDLEGLIRERQQKQNQLQQLLQLQLPQRN
                     QASSSNSSSSSPSFHSRNGSDSISSQLAPKLSEGSIHHNRARILLEGTGCHRLLLDYI
                     GITSDNGRLYLNRPKTTHLNMDLGLFVLSLKDDRPDLMTDSLDDVLNWIIGDIRH"
     gene            <1080462..>1082462
                     /locus_tag="FOA43_002506"
                     /db_xref="GeneID:62195907"
     mRNA            <1080462..>1082462
                     /locus_tag="FOA43_002506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922798.1"
                     /db_xref="GeneID:62195907"
     CDS             1080462..1082462
                     /locus_tag="FOA43_002506"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778726.1"
                     /db_xref="GeneID:62195907"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="PFAM:PF06398"
                     /translation="MANSVASPVNEGLSDKPDPTNHSETSSILNSTATTSSYPYFAST
                     SSLLHHHVMPSNSNTDRLTKSTSSFLDELFGTGKSKTEGSTPKKSLGGGKASKKPNKR
                     SKSPATKGSFAGARGDSSVSTAISGISPVSNIVSSTEIGNPDSAEGLVQTYTQQMADK
                     FMQRIINMAMPNTTTQDERELESVLSRIEMQKSRPPLNVQAISKNSIALLQRLSIPFC
                     IIDQIIVIFNWSNPVYTLSLLFLTTLMILKPITIVTFPLFMLCYQVILPAFIRRHPID
                     PVDGSLALGPQLNSIEYPKPVPELSREFLLNVTDLQNHVLIYVISWNYVNRWIIKYLY
                     FKDEFFSTFVFMVTFCLALFLCFFGTPLLLLLLPVLKVAAVALVWCFTVALHPKNRTQ
                     ILEWMYSEDTRLRVLTMTNRLDSKLAKELDWRESKEICQLEIFELQVMDSESKIWQPV
                     CFTDDIYPMNSYIRLSNMPINGCSSLSNISPPEGWRFIDEKSVGSSHKMTKSSSAFSQ
                     LGKSNEDESGNAAAEFTDFKVTAATISALTPASTPDLSTLKRHRKTPSNEKGGFSAAK
                     ALDGWYLDLRPNSWVQQNYLDGVLDVDEDSKWCYDKVSTESGATIRGDFRRRRWIRYC
                     IRSIWSEEINDDIGDQSNVEEDFERSQIEDDNEDDYVGNDTK"
     gene            complement(<1082479..>1083981)
                     /locus_tag="FOA43_002507"
                     /db_xref="GeneID:62195908"
     mRNA            complement(join(<1082479..1083464,1083975..>1083981))
                     /locus_tag="FOA43_002507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922799.1"
                     /db_xref="GeneID:62195908"
     CDS             complement(join(1082479..1083464,1083975..1083981))
                     /locus_tag="FOA43_002507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778727.1"
                     /db_xref="GeneID:62195908"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /translation="MWVQLLSPPEDHITSLNLSASNSDSPGLYITSFKGRIAHYNELS
                     ETSKPASVVDGFYDCALDSCLINGTAEKLVVGSLTGQIYSIDPVKRVLQQNSSFVHES
                     GVQCLVYNSYRKLVLSGSWDHSGWLLPEGSQGGIQLHFKEKVQAMDSIDNYAVYALST
                     GQNVVYDLRKVDQPVKEDDSTFKYPLTTCICMIPGCKGYTQGSMEGKVSVETFNQDVQ
                     VPSSKYTFKCHRTVLADDVEFVGPINDIVFHDSTRFFTGGSNVDRRVCMWDYLTKKRV
                     KQYKNLPLGVSKMCYDSQSGLLVVAMSDDSFKNSVSIDDKTFSSKSSIVTIIKT"
     gene            complement(<1086183..>1087298)
                     /locus_tag="FOA43_002508"
                     /db_xref="GeneID:62195909"
     mRNA            complement(<1086183..>1087298)
                     /locus_tag="FOA43_002508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922800.1"
                     /db_xref="GeneID:62195909"
     CDS             complement(1086183..1087298)
                     /locus_tag="FOA43_002508"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778728.1"
                     /db_xref="GeneID:62195909"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /translation="MNFQGVEDEELRSGISDDNQSGISGMGGMTIHKENSITEEDLEE
                     EFVQMDKEEFYKKHGISELDDENYREVYCHWDNCFLRFRELDDLVQHITKEHATSKKD
                     NGASEYLCKWVNCPRRGSPQHSRFALISHIRTHTGEKPFYCLVPECLKSFTRSDALLK
                     HLKTVHDIKSNNLVDAYELQNRENAKSMTELDQESNFKASNEADPQKILNKLHDRMKL
                     ERELDQGYDELIDDYCMSARKGEVDSFLQGPVADLFDLRGIKFNPALKDNVYKDTRLA
                     LSNYNLKKKALEEKQSGQGGVVSVREVTDDTINNKWDAKTLEKNFDILQEYYNKLTKL
                     KSVLDSELGHSTELARYWWMKKETAFDAVMKQDGINE"
     gene            <1087545..>1089032
                     /gene="FRS2"
                     /locus_tag="FOA43_002509"
                     /db_xref="GeneID:62195910"
     mRNA            <1087545..>1089032
                     /gene="FRS2"
                     /locus_tag="FOA43_002509"
                     /product="Phenylalanyl-tRNA synthetase, beta subunit,
                     cytoplasmic"
                     /transcript_id="XM_038922801.1"
                     /db_xref="GeneID:62195910"
     CDS             1087545..1089032
                     /gene="FRS2"
                     /locus_tag="FOA43_002509"
                     /note="BUSCO:EOG09341IMI"
                     /codon_start=1
                     /product="Phenylalanyl-tRNA synthetase, beta subunit,
                     cytoplasmic"
                     /protein_id="XP_038778729.1"
                     /db_xref="GeneID:62195910"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="PFAM:PF01409"
                     /db_xref="PFAM:PF17759"
                     /db_xref="PFAM:PF18553"
                     /translation="MANLQLTILRKLDEQGSIDDSGKELSTVDSPEILAALNSLSSRN
                     MVTYKSHQHDIWHLTKEAKDVAIHGSHEYRLLNKVIESLEGLKISDIESVMGKSGKVA
                     QGRAFKNGWIKKDGDKLISKVEAADKVEDSTADQLRQIEKAGTLDDSKALKDLKKRKL
                     ITADKVYTYSIAKGPEFSLEIKKLETDITSEMIQTGSWTKAAFKPYNFNSEGVLPHSG
                     ALHPLNKVREEFRQIFFSLGFSEMPSNQYVESGFWNFDTLFVPQQHPARDLQDTFYLK
                     DPVKAFPPEDKQYWENIKKVHQGGAYGSIGYRYPWKSDESLREVLRTHTTAISSRMLK
                     KLAEDPQPTRLFSIDRVFRNEAVDATHLAEFHQVEGVFADYSLTLGDLIGFMQQFFSK
                     MGVTDLRFKPTYNPYTEPSMEIYAWHSGLKEWVEIGNSGMFRPEMLEPMGLPKDLRVL
                     GWGLSLERPTMIKYGVKNIRELLGHKVNLEFIENNPAPRLEQQIF"
     gene            1089196..1089268
                     /locus_tag="FOA43_002510"
                     /db_xref="GeneID:62195911"
     tRNA            1089196..1089268
                     /locus_tag="FOA43_002510"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:62195911"
     gene            <1090275..>1097033
                     /gene="URA2"
                     /locus_tag="FOA43_002511"
                     /db_xref="GeneID:62195912"
     mRNA            <1090275..>1097033
                     /gene="URA2"
                     /locus_tag="FOA43_002511"
                     /product="Carbamoyl-phosphate synthase"
                     /transcript_id="XM_038922802.1"
                     /db_xref="GeneID:62195912"
     CDS             1090275..1097033
                     /gene="URA2"
                     /locus_tag="FOA43_002511"
                     /note="MEROPS:MER0046161"
                     /codon_start=1
                     /product="Carbamoyl-phosphate synthase"
                     /protein_id="XP_038778730.1"
                     /db_xref="GeneID:62195912"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR007159"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="InterPro:IPR035686"
                     /db_xref="InterPro:IPR036480"
                     /db_xref="InterPro:IPR036897"
                     /db_xref="InterPro:IPR036901"
                     /db_xref="InterPro:IPR036914"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00185"
                     /db_xref="PFAM:PF00988"
                     /db_xref="PFAM:PF02142"
                     /db_xref="PFAM:PF02222"
                     /db_xref="PFAM:PF02729"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF02787"
                     /db_xref="PFAM:PF07478"
                     /translation="MIKLSKPITAPLSEESKLVTLETQNGTVVCGYSFGADISAAGEL
                     VFQTGMVGYPEALTDPSYEGQILVMTYPLIGNYGVPDREARDDVVSSLPKYFESHRIH
                     ISGLVVASYTKDYSHYLAKSSLGEWLKEQGIPAIYAVDTRALTKQLREKGSTLGRLCI
                     QKPSATATDILDTSTSVYNWHQYFDVPDWVDPNTHNLVARVSAPKPVVYDPPADLARI
                     GSDGKPLRILAIDVGMKFNQIRCFVKRGVSLKVVPYNYDFSKESYDGLFVSNGPGDPS
                     VMSDTVEKLSVALADAKTPVFGICLGHQLLARAAGASTLKLKFGNRGQNIPCTCTQSG
                     RCYITSQNHGYAVDVATLPENWKELFVNANDGSNEGIYSTEKPFFSVQFHPESTPGPR
                     DTEFLFDLFIDSVADFQKTHVLKPIVFPGGTAKENEKKHPRLNIKKVLVLGSGGLSIG
                     QAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGMADKIYFLPVNPDFVRKVIK
                     HERPDAIYCTFGGQTALNVGVKLRDEFADLGVKVLGTPIETIMTTEDRELFARAMEQI
                     NEKCAKSESANNLQEALNAAHDIHYPVICRAAYALGGLGSGFAYNDEDLTKLCDKAFA
                     ISSQVLIERSMKGWKEIEYEVVRDAYDNCITVCNMENFDPLGIHTGDSIVIAPSQTLS
                     DADYNMLRTTAVNVIRHLGVVGECNIQYALNPESKEYCIIEVNARLSRSSALASKATG
                     YPLAYTAAKLGLNIPLTGIKNSVTKVTCACFEPSLDYCVVKIPRWDLRKFSRVSTSLS
                     SSMKSVGEVMSIGRNFEEAIQKAIRSTDYQNLGFNVSSEVSTEEIDQELEVPSDRRLF
                     AVANAMVKGYSAQKVHDMTKIDLWFLYRLEFLIKFGHKIASYGGKESLPLQVLRQAKQ
                     LGFEDRQIAKFLASNEVAIRRLRKDAGVLPFVKQIDTVAAEFPAFTNYLYITYNADES
                     DVTFDDHGVMVLGSGVYRIGSSVEFDWCAVRAIRTLRENGYKTIMVNFNPETVSTDYD
                     EADRLYFETIDLERVLDIYELEKSSGVVVSMGGQTSNNIALQLSRQNVNVLGTSPEMI
                     DSAENRYKFSRMLDRIGVDQPAWKELTSFSEAAEFAENVHYPVLVRPSYVLSGAAMNT
                     CWSKDDLANYLNQAVTVSPDYPVVITKYLENAKEIEMDAVAKDGKLVMHVVAEHVENA
                     GVHSGDATLVVPPQDLSKETVERIVEATAKIGKALAVTGPYNIQFMAKNNEIKVIECN
                     VRASRSFPFNSKVVGTDMIEMATRAIMDMPLTPYPGKKLPDNYCAVKVPQFSFSRLSG
                     ADPILGVEMASTGEVACFGHDTYEAYVKSLIASGFTLPKKNILLSIGSFKEKQELLPF
                     IEKLRIMGYHIFATSGTADFIHEHGIPVKYLELLNDDEEEQKAEYSLTQHLANNLIDL
                     YINLPSANRFRRPANYVSKGYRTRRMAVDYAVPLVTNVKCAKLLIEALSRDIDLQVSS
                     IDSQSSHTTIELPGLVALSTFVPNLDDRAGAKAFEDTTKVALASGFSFVSVLPYDLSG
                     AAITDVGTLARIHDLIRNSAYTDYSFSVAATEGNSERIQPTSGSVSSLFVKTDDFNIK
                     DKVINLSSHFSEWPETKPIIADANKTDLASVLLLASLFNTRIHVTNVTESGDLSLIAM
                     AKEKDLGVTCDVSVYSLFLSQKDYPNATFLPTKEDQKALWDNLDQIDCFSVGYLPTEL
                     ASFLGKPIKTGLGFADVVPLLLQSVSEGKLTVDDIRAKMHDNPIKILGLGDVNSVIEV
                     DEDRLVSSLKSKFSPSWSPFQDKDLRGAVERVLMNDQTVCLEGEFVVKEALGKEGIVS
                     AQHPSSLAQDSSKLATGSSLSETSVPPSSMASPMSPILTSSRRRSSRLSFDASKRTAL
                     KAGFRDSLAIEEIEHLTGADLVSSLPPRELSPPNAISSLISSKNPFLRKSILSVNNIS
                     RDDLHALFAVAQEMKLGVERKGVLDILKSRVLVTAFYEPSTRTASSFNTAMQRLGGRV
                     VAINSQSSSVKKGETLQDTIRTLACYADAIVLRHPSEDSAYIAAKYSPVPIINGGNGS
                     REHPTQAFLDLFTIREELGTINGITITFMGDLKYGRPVHSLIKLLKHYQVKVQLVSPK
                     ELRLPRNLVEFLKEHYKPVIESTELTKEIIARSDVLYCTRVQEERFDDKAEYERLKDA
                     YIVDNKILSYAKQHMCVMHPLPRIHEIKEEVDFDQRAAYFREMRYGLFVRMALLAMVI
                     GVEM"
     gene            complement(1097351..1097422)
                     /locus_tag="FOA43_002512"
                     /db_xref="GeneID:62195913"
     tRNA            complement(1097351..1097422)
                     /locus_tag="FOA43_002512"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:62195913"
     gene            complement(<1097767..>1098396)
                     /locus_tag="FOA43_002513"
                     /db_xref="GeneID:62195914"
     mRNA            complement(<1097767..>1098396)
                     /locus_tag="FOA43_002513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922803.1"
                     /db_xref="GeneID:62195914"
     CDS             complement(1097767..1098396)
                     /locus_tag="FOA43_002513"
                     /note="BUSCO:EOG09343JW1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778731.1"
                     /db_xref="GeneID:62195914"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="PFAM:PF04191"
                     /translation="MEAVQKLSDLITGFLGHIDFNNKAFQKAIFFIIFNPLYWNFGAR
                     LEHKTKFLSKLAFGSKKSAVYIFSATVFSLGIMRDNIYRDAILEQATSPFLDTPFFKG
                     LGIACFGFGSVLVASSMYKLGIVGTYLGDHFGFLKNERITDFPFNLVDNPMYDGSSLS
                     FLGAALFFAKPAGLWASGLVYAMYRIVELIEEPFTAKIYAERSSEKKAA"
     gene            complement(<1099001..>1100442)
                     /locus_tag="FOA43_002514"
                     /db_xref="GeneID:62195915"
     mRNA            complement(join(<1099001..1100353,1100413..>1100442))
                     /locus_tag="FOA43_002514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922804.1"
                     /db_xref="GeneID:62195915"
     CDS             complement(join(1099001..1100353,1100413..1100442))
                     /locus_tag="FOA43_002514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778732.1"
                     /db_xref="GeneID:62195915"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030379"
                     /db_xref="PFAM:PF00735"
                     /db_xref="PFAM:PF01926"
                     /translation="MVTIIESSAALRKKKILKKSVNFSVMVIGQSGTGRSTFINSLCD
                     QLIVEPSSTVRMYSPEELSNPDRELQLRKSTVELEDEEGVRINLNLIDTPGFGDSLNN
                     DLSFQIIRDYLKYQFDEILIEESKLRRNPRFKDNRIHVCLYFVVPTGHGLREIDVAVM
                     KSLGEFVNIIPCISKADSLTVEELKLNKKMIKEDIEHYKLPVFDFTNDYFNMDGSLDD
                     ESIELNKYLQKTLPFALMGSNATVKDEVTGEIKRVRKYPWGVVDIFDNEISDVLTLKT
                     TLLVTHLNDFKDFTHEVLYENYRAKTLSEVENGEYNYNSMYSGSVNSFNEATQMNRKK
                     LVAAAAQRASNVPPQASFTTAPPRSPVPPGGGRSVPGTPDTEIQAKEEQIEFEEERLR
                     AFEQRVQRDLVMKRQEIEAREKELEDIERRLAAQELSDVDADVDADADADADANADED
                     GHPVLPDQVD"
     gene            complement(1100567..1100638)
                     /locus_tag="FOA43_002515"
                     /db_xref="GeneID:62195916"
     tRNA            complement(1100567..1100638)
                     /locus_tag="FOA43_002515"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:62195916"
     gene            <1100961..>1102400
                     /locus_tag="FOA43_002516"
                     /db_xref="GeneID:62195917"
     mRNA            join(<1100961..1102139,1102383..>1102400)
                     /locus_tag="FOA43_002516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922805.1"
                     /db_xref="GeneID:62195917"
     CDS             join(1100961..1102139,1102383..1102400)
                     /locus_tag="FOA43_002516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778733.1"
                     /db_xref="GeneID:62195917"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="PFAM:PF12998"
                     /translation="MSKPSKQRLITEPKVTDIYPGLNEITDAFEAFPYDLVGYFTLLK
                     EIDAKCVYTVPYMKAYIQRFLRMKKNHPKRDQLLAKIRDMIRELMPCLEEKMHVATIA
                     SDIVSKHFARIDQCFEIVCQKEIPELVRVGSMRDPCIRPSEAQEVYKRSSDSREEVME
                     TRQKEEDDQKTKRSRKHAVNGNTLPTTQTASSHPHQQHVNGNGRGKKRMGEEGEPLPR
                     IGSKKSKSTRGPKREATESTETVSSELKDPSYTGDIGYPGGSARTRRVRRLEGVNDGF
                     ENTSMSTGVPGASVGPKETEETMEPKEPKEPKEPKELKEHKESMMHMEPTARTLPTVD
                     YIPEQDQPDPEISKKLASAVAAVRAQGKGQTTIADIATAMAGIPQDTMTGSGGARKHR
                     RAVPDE"
     gene            <1102473..>1103417
                     /locus_tag="FOA43_002517"
                     /db_xref="GeneID:62195918"
     mRNA            <1102473..>1103417
                     /locus_tag="FOA43_002517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922806.1"
                     /db_xref="GeneID:62195918"
     CDS             1102473..1103417
                     /locus_tag="FOA43_002517"
                     /note="BUSCO:EOG09342NCS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778734.1"
                     /db_xref="GeneID:62195918"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="PFAM:PF01239"
                     /translation="MTSFGSYNYSDVKTLPLDSPETKGIAVCKILYSEEYKKLMSCLR
                     GLMAVNELSPRALYMTELVIGKVAAHYTVWLYRYKNIKKIVEETDKEGWHRVLEDELK
                     WCGRVALANEKNYQIWHYREDIIELMISHLYGGDSDKYDVEKEEFPIIETLIDRDEKN
                     YHVWTHRRWLVERFKMYGSPRELEFTEKRLAEDVRNNSAWNHRFFVLFGGKGEEFEAD
                     FDTELGFVKRQVCRSPTNPSSWNYLRGICAKKGFVQLKEFVTQFTEQKETDPVIPALE
                     ILAEIYKEEKQQDKWREVYEQLKKVDPIRQNYWESYGV"
     gene            <1103976..>1104989
                     /locus_tag="FOA43_002518"
                     /db_xref="GeneID:62195919"
     mRNA            <1103976..>1104989
                     /locus_tag="FOA43_002518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922807.1"
                     /db_xref="GeneID:62195919"
     CDS             1103976..1104989
                     /locus_tag="FOA43_002518"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778735.1"
                     /db_xref="GeneID:62195919"
                     /translation="MSTLSKQTKAQLAEIAENLGIDVSGCRIKRDYYETIRDFFQEHY
                     DQFTPGSPYYDLAHASRLATASLGSPRKVVALDEDSSEGETEQEEAEDDEAEEAEAED
                     GDEEEAEEKPEDDESADENTKSFCAKYLVPLKSCFHCEKVNSVAEYISDKNQEVRDYL
                     SDPYSINDVVFILESLFLFSKFYHTVELGSISQIPPSIKEQLPNCALSLPVFDVFSLD
                     STFFATTGLWLFFALGLPKTISYYINFTYDFEYDSFTFALAKLFLGLILFRSHINTSE
                     IQRDLDFEFATKECSVSCVLQAFEHAVLKSTIFLRNTFGNWILVDALFTTLISLYANL
                     AFV"
     gene            complement(<1105125..>1105760)
                     /locus_tag="FOA43_002519"
                     /db_xref="GeneID:62195920"
     mRNA            complement(<1105125..>1105760)
                     /locus_tag="FOA43_002519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922808.1"
                     /db_xref="GeneID:62195920"
     CDS             complement(1105125..1105760)
                     /locus_tag="FOA43_002519"
                     /note="BUSCO:EOG09343P9U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778736.1"
                     /db_xref="GeneID:62195920"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR039430"
                     /db_xref="PFAM:PF02223"
                     /translation="MRAPLIVIEGLDRTGKTTQTLRLLSHLNNEGIKNHLIKFPERTT
                     PIGELINQYLTNKRLELSDQSAHLLFSANRWEFQSEIVDLLIKNQTVVVLDRYVYSGV
                     AYSSAKGLDFQWCLSPDIGMPKPDAVIFLQSRDSTATAKREGFGKERYEIESFQNKVR
                     AQFEKFEKDSNWHNIYVDGKSIEQVEREIWEVAEQYITGVQDKLDRFQRKQ"
     gene            1106212..1106294
                     /locus_tag="FOA43_002520"
                     /db_xref="GeneID:62195921"
     tRNA            1106212..1106294
                     /locus_tag="FOA43_002520"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:62195921"
     gene            <1106558..>1108159
                     /gene="GUA1"
                     /locus_tag="FOA43_002521"
                     /db_xref="GeneID:62195922"
     mRNA            <1106558..>1108159
                     /gene="GUA1"
                     /locus_tag="FOA43_002521"
                     /product="GMP synthase (glutamine-hydrolyzing)"
                     /transcript_id="XM_038922809.1"
                     /db_xref="GeneID:62195922"
     CDS             1106558..1108159
                     /gene="GUA1"
                     /locus_tag="FOA43_002521"
                     /note="MEROPS:MER0045886"
                     /codon_start=1
                     /product="GMP synthase (glutamine-hydrolyzing)"
                     /protein_id="XP_038778737.1"
                     /db_xref="GeneID:62195922"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00958"
                     /translation="MTQDTTKSVAIGDEVTKTFHTILVLDFGSQYSHLIVRRLREINI
                     YAEMLPCTQKISELKFKPAGVILSGGPYSVYDDGAPHADLAIFDLNVPILGICYGMQE
                     IAWINGKGVSRGEKREYGPANINVKSNSCPLFEGMDNSRVWMSHHDKLTELPEGFEAV
                     ATTGNTPFAGIAHKSKPIYGIQFHPEVTHTVQGKRLLSNFAVNICHAPQNWTMENFIE
                     NAIKRIRATVGPTAEAIGAVSGGVDSSVAAKLMKEAIGDRFHAIFVDNGLMRKNEAVQ
                     VKKALDDGLGINLVVVNAEDEFLDNLKGITDPEKKRKAIGYTFIHVFERVAKSIKPKD
                     GSNIEYLLQGTLYPDVIESVSFKGPSQTIKSHHNVGGLIDNMQLKLIEPLRELFKDEV
                     RHLGELLGLPEDLVWRHPFPGPGIGIRVLGEVTKKQVEIAREADYVFIDEIRKAGLYR
                     QISQAFACLLPVRSVGVMGDQRMYEQVIALRAIETVDFMTADWFVFDASFLKRVASRI
                     VNEVIGVSRVTYDITSKPPATVEWE"
     gene            <1108730..>1109965
                     /locus_tag="FOA43_002522"
                     /db_xref="GeneID:62195923"
     mRNA            <1108730..>1109965
                     /locus_tag="FOA43_002522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922810.1"
                     /db_xref="GeneID:62195923"
     CDS             1108730..1109965
                     /locus_tag="FOA43_002522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778738.1"
                     /db_xref="GeneID:62195923"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF07942"
                     /translation="MGPFFFIIKICLVLIFDYFAKSLFPEATTLWLILTSFLVCIVIR
                     NTAMFRNLVSSFTNKVSRSSDTILSSRQELLLSLYNLSQYLERSHRANDAKRARYRRM
                     PAKHQHICNSIGYPEKLTLVDTLLARNNDTIMRVYADGIVRHHVTEEDLRQSRRLARS
                     TNHYDYFRVVESLCHLTRDWSESGSTEIQPLIDYICDNSRNLDLKNTTVIVPGSGLGR
                     ISHELALMGFKEVHAVDFSWLMTLFNESIYGSRSQMASIYPYVHNYSNHWQTKDQMGL
                     ATYRYGIRQPENLHIHCQNFTEFTSPAETAAYNVLIVTCFFIDTAEDLLSYVDSINRI
                     CKPFKGKKRWINVGPLKYGTAPKVELSNEELGDLTSAMGWNRIHQLNSPTKLGYLTDT
                     IGLWQGYYGVCMWTAEKKC"
     gene            complement(<1109990..>1111336)
                     /locus_tag="FOA43_002523"
                     /db_xref="GeneID:62195924"
     mRNA            complement(<1109990..>1111336)
                     /locus_tag="FOA43_002523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922811.1"
                     /db_xref="GeneID:62195924"
     CDS             complement(1109990..1111336)
                     /locus_tag="FOA43_002523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778739.1"
                     /db_xref="GeneID:62195924"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08154"
                     /translation="MSDQVKIKLVTRDEDNSLHVAPNPLYVPVSLKRYGLSEIVNHLL
                     ETDTPVPFEFIIDGTMLKGSIQDYLVTKGLSAETFLTLEYTRAVLPPKFLASFSNEDW
                     VSAIDSIGTMTSSSSDQSTVTPPKILTGSYDGIVRIYNMQGKVETQLVGHQQPIKAVK
                     FLSPTRFITSGIDRTIRLWKAGTVSDENLDMDTQNGHTIALLDYHKSTVSSLAVDLGS
                     SRILSGSYDNTVALWSTKPKEMSTSDPLEAVDSQVLSSASRKRLKLAVRDSTLKRKSP
                     LAVLESHRQPVEGVIFDPKDSTVGYSVSQDHTIKTWDLVTARCVDSKQTNYALLSVTA
                     LNKLNLLATGSSARHINLHDPRSSKITNTQLIGHKNFVCSLATPSDNEYMLLSGSHDG
                     TAKVWDIRANKAIYTITRQSGLSQSKVFAVDWEKEIGILSGGSDKKLQINSEAELR"
     gene            <1112308..>1113594
                     /locus_tag="FOA43_002524"
                     /db_xref="GeneID:62195925"
     mRNA            <1112308..>1113594
                     /locus_tag="FOA43_002524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922812.1"
                     /db_xref="GeneID:62195925"
     CDS             1112308..1113594
                     /locus_tag="FOA43_002524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778740.1"
                     /db_xref="GeneID:62195925"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR036554"
                     /db_xref="PFAM:PF00288"
                     /db_xref="PFAM:PF08544"
                     /translation="MTVQFPFVTSAPGKVIIFGEHAAVYNRPAIAAALSLRTYLLVTK
                     DDSKSEYILLEFPDINFRCHWKKTELPLHPIHPSDTNPPVPPSELDPELINDLGPLLS
                     AIDSPLHYGAAYAFLYLFSSLCSRSTPGGLTFTMRSTLPIGAGLGSSASMSVCLAAAF
                     GYIGGHIKEATICQESKIAHDSDECVFIDRWAFMGEKCIHGNPSGIDNAVATHGGAVM
                     FQRMGNTLPSVRTAMRNLPPMHLLLTNTKTSRRTATLVAGVSKLVTDYPKSTAHILDA
                     MEAIAREAYNLMLRPFLDETSKRKLLNLIRINHGLLVSLGVSHPNLERIKLYCDEMNV
                     GETKLTGAGGGGCAITLLRDNLKPDVFEKLDKKFCEHGFESFRATLGGKGVGILISND
                     ENVLDKLNVPSFVGFNSRDEIETYVGCSSLEDWRYW"
     gene            complement(<1113771..>1114808)
                     /locus_tag="FOA43_002525"
                     /db_xref="GeneID:62195926"
     mRNA            complement(<1113771..>1114808)
                     /locus_tag="FOA43_002525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922813.1"
                     /db_xref="GeneID:62195926"
     CDS             complement(1113771..1114808)