GenomeNet

Database: RefSeq
Entry: NC_052376
LinkDB: NC_052376
Original site: NC_052376 
LOCUS       NC_052376            1127048 bp    DNA     linear   CON 13-FEB-2021
DEFINITION  Brettanomyces nanus chromosome 3, complete sequence.
ACCESSION   NC_052376
VERSION     NC_052376.1
DBLINK      BioProject: PRJNA691332
            BioSample: SAMN12257692
            Assembly: GCF_011074865.1
KEYWORDS    RefSeq.
SOURCE      Brettanomyces nanus
  ORGANISM  Brettanomyces nanus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
REFERENCE   1  (bases 1 to 1127048)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 1127048)
  AUTHORS   Roach,M.J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2020) Research, Australian Wine Research
            Institute, Adelaide, SA 5064, AUS
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP064814.
            Annotated using 1.8.1.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: OCT-2018
            Assembly Method        :: Celera Assembler v. Canu v1.7
            Assembly Name          :: AWRI2847_1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 50.0x
            Sequencing Technology  :: Oxford Nanopore MinION
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1127048
                     /organism="Brettanomyces nanus"
                     /mol_type="genomic DNA"
                     /strain="CBS 1945"
                     /isolation_source="Bottled beer"
                     /culture_collection="AWRI:2847"
                     /type_material="type material of Eeniella nana"
                     /db_xref="taxon:13502"
                     /chromosome="3"
                     /country="Sweden"
                     /collection_date="21-Jan-2014"
     gene            <1402..>3924
                     /locus_tag="FOA43_002643"
                     /db_xref="GeneID:62196044"
     mRNA            <1402..>3924
                     /locus_tag="FOA43_002643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922929.1"
                     /db_xref="GeneID:62196044"
     CDS             1402..3924
                     /locus_tag="FOA43_002643"
                     /note="CAZy:GH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778857.1"
                     /db_xref="GeneID:62196044"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR019800"
                     /db_xref="InterPro:IPR026891"
                     /db_xref="InterPro:IPR036881"
                     /db_xref="InterPro:IPR036962"
                     /db_xref="InterPro:IPR037524"
                     /db_xref="PFAM:PF00933"
                     /db_xref="PFAM:PF01915"
                     /db_xref="PFAM:PF07691"
                     /db_xref="PFAM:PF14310"
                     /translation="MTFDVDNLLEQLTTEEKVSLISAVDFWHTAKIERLGIPSIRVSD
                     GPNGIRGTKFFDGVPSACFPNGTCLASTFDAELLEKAGELMAREADHKGAQVILGPTT
                     NIQRGPLGGRGFESFSEDPYLSGISTASIVGGIQKTGKVAATVKHFVCNDLEHERFSS
                     NSVVSERALREIYLEPFRLAIKLADPKCIMTSYNKVNGVHCSENYKLTQKILRGEWKW
                     NGMIMSDWYGTYSSVEAIQHGIDIEFPGPTRFRKWDVIKHLLQSKENDLREGDIDDRC
                     RHVLDLVKYVVDSRGEGPYSTLEDTKNNTPKTSATLRKIAADGIVLLKNDKNVLPLSK
                     GKSTVVIGPNAVALNTYSGGGSASLNPYYVVTPLEGIKNKVDNVDFTIGCHSHKALGG
                     LFESMTNDLDKSKKGVRARFYTKPIDERSSAEKPIDELVVRNSYVTLFDYSNAAVDTK
                     TKLFYTDFEGVFTPTETADYEFGCQVFGTALIYLNDKLLIDNKTHQTKGTFCFSSGTV
                     EETAVAHLKAGENYKIRVEFGSGITSKLASDFGAGGLQVGVTKVIDAEKEIQHAVSLA
                     KSHDNVILCIGLNSEWESEGYDRDDMTLPRKTNDLVSAVLKANPNTVVVNQSGTPVEM
                     PWLKDCQTLVQAWYGGNELGNAIADVLFGDVVPSGKLSLSWPFKNQDNPAYLNFHTEK
                     GRVLYGEDVFVGYRYYEKLQSQVAFPFGYGLSYTTFKYDDLKVTVNDTTVTASFTVAN
                     SGDKYTGKEAVQLYVASLNPSVIRPVKELKAFAKTELKPGESQTIKLSLNLKEACSYF
                     DEYENKWCLEAGKYQIQVGSSSDDIHLIGDFEVQKTVYFLEL"
     gene            complement(<4889..>6240)
                     /locus_tag="FOA43_002644"
                     /db_xref="GeneID:62196045"
     mRNA            complement(join(<4889..5876,6233..>6240))
                     /locus_tag="FOA43_002644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922930.1"
                     /db_xref="GeneID:62196045"
     CDS             complement(join(4889..5876,6233..6240))
                     /locus_tag="FOA43_002644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778858.1"
                     /db_xref="GeneID:62196045"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MSNFPMSKQILKIGDVVVPAPGFGAMSLVDAYKTNRDDPMLVLK
                     KAYDLGCRFWDTADVYSNTGYGESERFIGEFLKKYNIPREDIFLCTKFGFKKNGSNQV
                     IDGSPEYCKMAFDRSLKNLGVDYVDLYYLHRVDPNVPIEDSVSAMAEIRNSGKAKFLG
                     ISECTAKQLRRANSITKIDAVQREYSLFDRSAEETGLKDACDELGVAFVAYSPLGRGF
                     LTGTFKKRDDINDSRKDHPRFSEGNFDKNLELVRVVEELSKAKGVKPSQFALAWILHQ
                     NAIPIPGTSHVARVVENFESRNIHFTDDELKQIRKRIDNVTLVGQRKFRMSNVDA"
     gene            <7033..>8793
                     /locus_tag="FOA43_002645"
                     /db_xref="GeneID:62196046"
     mRNA            <7033..>8793
                     /locus_tag="FOA43_002645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922931.1"
                     /db_xref="GeneID:62196046"
     CDS             7033..8793
                     /locus_tag="FOA43_002645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778859.1"
                     /db_xref="GeneID:62196046"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR038271"
                     /db_xref="PFAM:PF02133"
                     /translation="MSKVDIDVYQEPLSDDNFPNSKEVELEEPTTGVQKVLKFFKKLL
                     KKLEIDGTEELSISQLFLYNYDLKPVESARRTWRWWNFINFWIADAFNVNTWQIAGTG
                     VTAGLSWWVVWITVWLGYFFVACFITLSSRVGTYYHVSFPVSCRSSFGIWGSLWPVIN
                     RVVMACVWFGVQSAIGSNCVQLMLMAIFGNDLDTRIPNKMKGDTITSFGMLSFFIFWF
                     CQLPFIYLRPHTVRHLFTVKAIICPIAGFSFLIWTMVKAGGGGPVIRQKSTLSGSAFA
                     WAFINSTMNALANFATLIVNAPDFTRMATTSRAPLWSQFFTIPICFSITCLIGVLVSS
                     ASTILYGETYWNPLDVLGKFLVTEKSGSRAGVFFISLGFAIAQVGTNISANSISAGTD
                     ATALLPKYMNIRRGGFICAIVGYCICPWNLLSSSSMFTTYLSAYAVFLSSIAGVIFAD
                     YFVLKKGYLKLKDLYVADNSSSYYFWKGINWRAFGAYICGILPNIVGFVGATKTHKVP
                     DGAMKIYYLSYFTGYISAAGMMIVLNLIWPSKGIPGKILEKKWLEEWQEVEDFDIFFA
                     AKRGDAEPVMSNPNDDFICG"
     gene            complement(<8828..>11158)
                     /locus_tag="FOA43_002646"
                     /db_xref="GeneID:62196047"
     mRNA            complement(<8828..>11158)
                     /locus_tag="FOA43_002646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922932.1"
                     /db_xref="GeneID:62196047"
     CDS             complement(8828..11158)
                     /locus_tag="FOA43_002646"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778860.1"
                     /db_xref="GeneID:62196047"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PFAM:PF04082"
                     /translation="MLCTRRGGNCSFNESIQVTRPKKKPSEPQIHFYVPKVKQNDTDV
                     VREIDEDCRGEKEMSNTNEAHRDVTSAEDDNDSVRPTELTDSINYSTQMKSVGRNSSS
                     EAIDVCTTTVNSIDSGVPLGASESLLSTSEYIPNLENQPPVTPIQSYEFDLPLTIDMW
                     NIMFQDLQNDSLHVDMKNTRLSSKAEANSQVSTVSSPFSSSVTKAGSSALAPTITVGD
                     IQQLPSFHLQSQGINRFGVCSLQQIRKYIKGSVDADEAIKVQYLTENSYMDPYIYTKL
                     AHEDEGPVEGEFSGGEFPVPTSRRSPTSRLGSFSQMDLSGVSSASDESVFYRKLVEQT
                     PDNIHSTGSSILLVRNDPGMSRQDVATKEKIRALIGSFGPRLLLIYFRYINPFLPLFS
                     RGLFYFGTNQNMLEFHNSLLATLLTLGMDYWAIDPVLQQYTPPSDITLFKIARSAMME
                     EQEMPNYSSLQACILLSQKRPVDLSKPDTPFVWTVLGMAASLAETMGYNHECLEWHIP
                     SWDKRLRRRIWWCFLVQDTWFAACYGLPLHIASRYWHVSPLTPNDFESYSMNERDSEN
                     FKLSVVSFCFMVNISSLVATICDEFLYSHMSSFSFETIYRMGWQLLDKVTAMEEDSPR
                     SLQVSSQITGQIAWANASIQLAIQAAKLIILRHLLHKLKASDERSQHRYRDSIFDSSL
                     DCLRSILCLVGKIKADHFQYFWYSWSRLNFALAANFFLLVYSLVESAQERDTVKGLLD
                     NYRWWLRCNNSSFSDLSLALAVLDRAYAEGLERIAR"
     gene            <11781..>13310
                     /locus_tag="FOA43_002647"
                     /db_xref="GeneID:62196048"
     mRNA            <11781..>13310
                     /locus_tag="FOA43_002647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922933.1"
                     /db_xref="GeneID:62196048"
     CDS             11781..13310
                     /locus_tag="FOA43_002647"
                     /note="MEROPS:MER0015112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778861.1"
                     /db_xref="GeneID:62196048"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="PFAM:PF01979"
                     /translation="MEYDLVIYNGVIVNASTVINPPAYIGIKKEKIACISTEPLNGKI
                     MIDAEGGIITPGGIDAHVHVSQPCTSDTFDSATRSSICGGTTSFICFATQERGVESSI
                     PDLKNYIKLAHGKSFCDYGMHMIVTDPTDQFLEEEMPVLVKDYGITSVKVYMTYEIWS
                     VSDKQILKVLLMGRKLGVTTMIHAENNDIIEYLIEKFEKAGTTQPFFHSASRPLVCED
                     EASYRAISLANMVDQALLIVHMSTSESMKHVHDAQTKNCPIYSETCPQYLFLTSEYLK
                     SHINSNYSEGSVIDDGLHINVDKNDSFQGAKYICSPPIRDSQDELQGIWQAVENGTVT
                     IYSSDHSPCNYDDRKGKKKGLKTDGTMDFAVVPNGLPGVETRLPLLFCYGVETGRISP
                     QKFVEVSCTNPASLYGMSSFKGSIDIGLDADIIIWYPKNKIKPFQLTNRMLHHDIDHT
                     PFEGMTFTNWPRYSILRGKIIWDRDHGGLNESKPKGKFLKRGKSTFTLNKNKAPPKYF
                     D"
     gene            complement(<13492..>14796)
                     /locus_tag="FOA43_002648"
                     /db_xref="GeneID:62196049"
     mRNA            complement(<13492..>14796)
                     /locus_tag="FOA43_002648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922934.1"
                     /db_xref="GeneID:62196049"
     CDS             complement(13492..14796)
                     /locus_tag="FOA43_002648"
                     /note="MEROPS:MER0026469;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778862.1"
                     /db_xref="GeneID:62196049"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR036264"
                     /db_xref="PFAM:PF01546"
                     /translation="MTLLSGALKINSGELVDTIHQTAEKFGAKNRWGPEPTQTGVRRL
                     ALSDYDKEVKDWFIQQAKSLGCKVIVDEVGNIFATFPGKNRDAKPTGMGSHLDTQPTG
                     GRYDGIFGVLSGLQVLRTLKANDYVPNYPITLVDWCNEEGARFPMSLMSSSVWAGIST
                     KEHVYGLKDVYDNKTTVLEELNRIGYKGSVESSHVANPLNCHFEIHIEQGPILEMMGK
                     RIGVLTSAQAFRWLDVTFKGMPQHTGTTPLEYRRDALLATAKVITGINEIGKKHHGVA
                     SVGMMSLSPNVVNVIPGEVSFVVDIRHHTDEGLHKIYTDVRALIDEITLNKAGNGIPL
                     EVEIGDPYPIPTTVFHTDLVDLIEECAYSVVGEENTHRMVSGAGHDSCATGSVIPTAM
                     IFVPSKNGISHNPEEYTKPDELEAGFRVLLETILRYDQERVE"
     gene            complement(<15480..>17123)
                     /locus_tag="FOA43_002649"
                     /db_xref="GeneID:62196050"
     mRNA            complement(<15480..>17123)
                     /locus_tag="FOA43_002649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922935.1"
                     /db_xref="GeneID:62196050"
     CDS             complement(15480..17123)
                     /locus_tag="FOA43_002649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778863.1"
                     /db_xref="GeneID:62196050"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSSSSETNSKLDSPSQVQEGSKNDQFVDRSQLKKELDEAPVAAA
                     EIPQSGSSYWFSAMMTLLISFGGFVYGWDTGSIGGFTNMPDFVQRFGTWSESEQTYVM
                     TKVRQGLVISIFSIGCAVGSTTLSKVGDVYGRKKGIMLTMVVYIVGIVIQIASVSSWI
                     QYFIGRIVAGLAVGSISVLCPMFISETSPKAIRGALVSSYQLMITLGIFLGYCCVYGT
                     YHSYDGSKQWRIPLGLCFAWALFLIFGMTFMPESPRYLVEKQKIEEAKKSIAKVNKCA
                     VDSAFTLQEVNNLIDGIETERLAGNASWNEMFTGKPKLFYRLFVGIMLQSLQQLTGDN
                     YFFYYGTTIFKSVGLNDSFQTSIILGIVNFASTFPSLWIVDRFGRRKTLLGGCFGMMI
                     SLVIYASLGYKSLYAGEFGVDPNKSVGDAMIFLSCLFIFFFATTWGPCVFVVVSETYP
                     LRIRSKGMGLAQTSNYIWGFLIAFFTPFINGAIHFAYGYVFFGCVVFATFFVYACVPE
                     TKGLSLEDVDDLYRHFTPGMAFRKEYSSTADEEENKESN"
     gene            complement(<19237..>20883)
                     /locus_tag="FOA43_002650"
                     /db_xref="GeneID:62196051"
     mRNA            complement(<19237..>20883)
                     /locus_tag="FOA43_002650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922936.1"
                     /db_xref="GeneID:62196051"
     CDS             complement(19237..20883)
                     /locus_tag="FOA43_002650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778864.1"
                     /db_xref="GeneID:62196051"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR038271"
                     /db_xref="PFAM:PF02133"
                     /translation="MEVPKDSNAFYDNDSLTNRDIIPIPPERRTWTAFAYATYWAIEG
                     VSISGYTTGSSLVGIGLSVKQSIACSVAAGIIYGIMAVVMGWIGSHHHIGFPLIARFM
                     YGIKGAPFGIVIRITTGIIWWGVQAVYGGEAIRVCLGAMSPSFLTWDTFNNKNGITSS
                     TFVGLFLYCIFMIPCIRIPPEKLQFMFRVVMFITLGAFFGLLGYSVKSAGGAGTMFNA
                     PSTTYKTRSSLAWACVKGIFSIVGTTGTGILGQSDFTRYSKRKHSPVLAQLIGAPVAL
                     TFSCVIGIITTSCANDYLGYIQWNPVNLLGDIQQHEHNSSAARAGVFFGGLAFVLQQM
                     AINLLLNTLSSSMDMVGLWPKYINIMRGSTIVMIVGILIWPWKILSSAKAVIIFGSGW
                     GCFCSAQTGIIIAKYYIIYKRKVLLKDLYINSKDSIYWFYHGVDWRSLVAFVIGTVFL
                     MPGLALDVDDKSSSFWTGIYKVSYAWGLFISMGVIISLHLLFPKISVSPVTKVDDVYT
                     DDGTPIAWADESESSEGLVEEVEVHIESKGDTFNYSKLEA"
     gene            <21571..>22533
                     /locus_tag="FOA43_002651"
                     /db_xref="GeneID:62196052"
     mRNA            <21571..>22533
                     /locus_tag="FOA43_002651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922937.1"
                     /db_xref="GeneID:62196052"
     CDS             21571..22533
                     /locus_tag="FOA43_002651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778865.1"
                     /db_xref="GeneID:62196052"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MLKAYPDVLNVSLNNGVAMPTFGLGTWQSQPDEVSRAVEYAIRK
                     GYKMIDTAAIYGNEYEVGEGIKNSGVDRNDIFVTTKLWNSHHAPEDVPKALDESLSKL
                     GLDYVDLYLMHYPCANDKAQFLEGNNIKVDIDYVTTWKAMENLLGTGKVRAIGISNFS
                     QEEIENLLAKCQIVPQVHQMEMHPYLKQDKFLKFHKDHNIIVTAYSPFGNQNSCYELN
                     GEPKILQHPTIVEISEKLAESPAHILIAWGIQRGTIVIPKSVTFERIDENLLGQNLKL
                     CKENFDAVSSLGFSKRYSDFGPAVGYWYYKDLECPGKQPEGYTE"
     gene            <22998..>24005
                     /locus_tag="FOA43_002652"
                     /db_xref="GeneID:62196053"
     mRNA            <22998..>24005
                     /locus_tag="FOA43_002652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922938.1"
                     /db_xref="GeneID:62196053"
     CDS             22998..24005
                     /locus_tag="FOA43_002652"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778866.1"
                     /db_xref="GeneID:62196053"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="PFAM:PF03171"
                     /db_xref="PFAM:PF14226"
                     /translation="MTTDEIKKEVTVPVIDFKPFLEGTAEGKENVGKKMIGAMRDIGF
                     MYIINHGIPQSDQKRMLEWSASFFKLPDDKKMLCEHPKDGAHHRGWSAIGMEKVVQMV
                     FDRAKISELRQHPDVKESFDSGNENNKECFNIWPRDEDIPGFREFCNYYFKVCETTAD
                     RLLRALALGLNLDENYLLKHHEESNNQLRLLCYPPTLEKNLREGKTERIAAHTDFGTL
                     TMLLQDDCGGLQVEKPSNPGVFIDAPVIPGSLVINTGDFLMRWSNDQLKSTFHRVTAP
                     PVDSRTGISKIRYSIPYFVSADRHKVIDALPGTFSEQNPKKYEPITSGEYLAKRLNAT
                     Y"
     gene            complement(<24272..>27241)
                     /locus_tag="FOA43_002653"
                     /db_xref="GeneID:62196054"
     mRNA            complement(<24272..>27241)
                     /locus_tag="FOA43_002653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922939.1"
                     /db_xref="GeneID:62196054"
     CDS             complement(24272..27241)
                     /locus_tag="FOA43_002653"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778867.1"
                     /db_xref="GeneID:62196054"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="InterPro:IPR010318"
                     /db_xref="InterPro:IPR027479"
                     /db_xref="PFAM:PF01968"
                     /db_xref="PFAM:PF05378"
                     /db_xref="PFAM:PF06032"
                     /translation="MKKALLIGVDVGGTNTDCVLIDPSEFGNENKGVLSWNKVVTTAD
                     VSKGIERGILKLLDDCSQIEKHDIISVTIGTTHFINAVIEQDQARLDRVAVLRLCGPY
                     SHNAPPFSDFPRRLKRILNGYIGFLNGGYQVDGNEIQQLDEAEIINHAEEIKRLHLRA
                     VAIVGIFSPMKADQELKVKQILQREIPGIRIAISNEVSGIGYLERENATILNAATMNF
                     ANKIITSFMTAMATLGLSCPLFLTQNDGTVLPAEECRRLPIKTFSSGTTNSMRGASFL
                     GDVHGKSVVVVDVGGTTCDVGLLLPTGFPRQSSSYSIVGGVRMNFSMPHVESIGLGGG
                     SYVRTDTKSGLTVGPDSSGCDIVNQALVFGGGRITATDVAVAVTKDDQGIDLEIGDAA
                     KTVGVFTEEFKADFKDTIKNMLEKVIDRMKTSPDDISVLAVGGGSFMVPETLEGATQV
                     IKPLYYSVANAIGAAMGKISSEVHVIKILLPGGITKEHIIEELKAEAVEKAVAKGAVK
                     ESVSIVYISAEPIPYVSNTFEFFIKTIADVDYSRIQLESEPKVGSTVSEINLLETSLE
                     SEEVTKNASTAKESIEAPGVNYVTYQPFINEKRQWLLSETDLEYICIGCYIVGSGGGG
                     NPYSFFLEARNLLRGGDTITVVDVKDASKYVHGDGCIASICYAGSPTVSHEQLSGDAL
                     KVCYDYMAKYLQKNPELLFPIEIGGGNGLSPFEISSSSRLNIPVVDCDLMGRAYPTHW
                     QTIPVVYAKPNESCYPPTVISNGNSNTMIIADSKTDALLERCMRAALSEIGATVGVMN
                     PPMTQRELELKTIHNSLSLCWRIGKAVKIARQKSEIDSLPLTILSSINDSGKHLFSGK
                     IVGVERTLRKGHIYGEVTIEELEEPRRKMVIPFKNENIYCKLQNNDGSDSKVVCSVPD
                     LIAVIDADTGEAVGTPDYRYGLLVFVLGIAPSNKWTDSERGLAIGGPEGFDLDLEYHP
                     ISNYSPPLSVIDEYGQE"
     gene            complement(<27502..>29925)
                     /locus_tag="FOA43_002654"
                     /db_xref="GeneID:62196055"
     mRNA            complement(<27502..>29925)
                     /locus_tag="FOA43_002654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922940.1"
                     /db_xref="GeneID:62196055"
     CDS             complement(27502..29925)
                     /locus_tag="FOA43_002654"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778868.1"
                     /db_xref="GeneID:62196055"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF04082"
                     /translation="MRDKKQAVVSRFKCPFPNCSKFFKRRDYLQRHEANHAAVRPFRC
                     ELCGISFSRKDLVRKHKTSKSHRKQVESLQNPSSPIFVNTFLDAKVFKNTRTSNKRAR
                     FKVNKDEKGRPAGVQHDSAVLGLERLNFTNLVNFEDSYGWLFDGSDSSSTIQDDEYSG
                     GTAMVHSGQLSPENTNTLDSEAHCWDVSLPPVLQQHAVELITQILVDDSLSMTSKLRT
                     SKINTYFAHYYKYFDTTCPIVHRQIFTSGNADDNLLALLVVAVLTIGMSFTDGGTQKY
                     SEEYMLAIEIHRKLRTALFVEIEKYQNINDISLELLLTLELTDFFNIYMGSGSQSRSA
                     NIFHPMVMSLFQELDLYLNVEEPNIESNEEVSRDKWISWIRYESLKRVAYFAYLMDAQ
                     RTFFYSKNPCMSIFEIQLELPYTDRAWYAPDPAEFMLYYSKQPRGLFSRNRKLPDDHT
                     PYVIGTRDLTTNGLLIPNVKSEGKWPNFLWSLRRLMQSYSKNQKEYHTDCFSQFSRYI
                     LLHGVLSLIRELRNLSILDLGNQKSRLSTMAAKIEQSLFNWKGYLNKHIADMNASSLD
                     GKLPLGQMNDYGTSPSFWSNVIMFKTGLLGLYCDFDLLFKYRSSIRKLEGQGGGCNGT
                     FAEIFSPERTKFYELGMAKSEMMVRSWACSKSGLHSNIEACNILRMIFYNEELLSSLP
                     HAPFSMYISVLTCWFYQHNGSLSPSGSDMPVNSPELDIVTQGDEIRKKALEYISYTLD
                     EVSVEMAYQEGPAQVSISTPAAQTGNEKLLLVKALVLHSIVVLERSSRWANSNSTIDD
                     LCSLLNVKP"
     gene            <31657..>32670
                     /locus_tag="FOA43_002655"
                     /db_xref="GeneID:62196056"
     mRNA            <31657..>32670
                     /locus_tag="FOA43_002655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922941.1"
                     /db_xref="GeneID:62196056"
     CDS             31657..32670
                     /locus_tag="FOA43_002655"
                     /note="CAZy:GT32;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778869.1"
                     /db_xref="GeneID:62196056"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF04488"
                     /translation="MRRSLKVIIWAHITIAAFLLYCSLDLLLLPLDDLTKDALLDSEL
                     NSADDKIEKPAIIPKIIHQTYKTEDVPEIWRAGQQRCKDLHPEYEYILWTDDMARKLI
                     EEEYDWFLETWDSYKFPIERADAIRYFALVRYGGIYIDLDDGCERKLDPLLTVPAFAR
                     TTTPTGVSNDVLGSVPGHPFFVKVLNNLQNYNRNWLVPYITIMFSTGPLFLSVILEQY
                     RRNNIPEEANVRIMLPDDYTGKENSFFVISKGSSWHLDDARFIKALGRHIPLAVFCGI
                     TTGCFIFLMEWYFYQWCIRTNFFRSLDHMSSKVGWKTLRTRPRKDSNLPVNTVINKED
                     DMV"
     gene            <33312..>35816
                     /locus_tag="FOA43_002656"
                     /db_xref="GeneID:62196057"
     mRNA            <33312..>35816
                     /locus_tag="FOA43_002656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922942.1"
                     /db_xref="GeneID:62196057"
     CDS             33312..35816
                     /locus_tag="FOA43_002656"
                     /note="CAZy:GH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778870.1"
                     /db_xref="GeneID:62196057"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR019800"
                     /db_xref="InterPro:IPR026891"
                     /db_xref="InterPro:IPR036881"
                     /db_xref="InterPro:IPR036962"
                     /db_xref="InterPro:IPR037524"
                     /db_xref="PFAM:PF00933"
                     /db_xref="PFAM:PF01915"
                     /db_xref="PFAM:PF07691"
                     /db_xref="PFAM:PF14310"
                     /translation="MSVQFSVEEVWDQLSTDDKIKFLSLDDTWHIHSIERLHIPAIRL
                     SDGPNGVRGSKFFRGTPSACLPCGTGLGSTWDKELLQRAGKLMAEEAKHKGAHVILGP
                     TVNIQRAPIGGRGFESFGEDPYLSGWCAASVIKGIQSKEISATIKHFVCNDMEDDRTS
                     FSALVTERALREVYLMPFQLAIKYANPWSIMTSYNKVNGTHVSENKFLLTDILRDEWH
                     YNGLLMSDWFGVYSSENSINAGLDLECPGPAVSRKFDSIKHQITSRELKLSAIDKRAK
                     HVLKFIENAQHCSVSKNGKEDTLNNTPETQKLLREITQSGIVLLKNDDSILPLAKNDD
                     IVIIGPNAKSARTSGGGSASLTPYYETNVYDSICHLLGEKKTYALGCSIDKGAGDLGK
                     NVVSGSHKGFDIRVFKEPPETANRTLIEQFYIESSMLKLFDYQPVEDSELFYMDMDGE
                     FTPETSGEYTISEKCFGSALVYLDGKILIDDKTDQVLGGDADEVTSVGYKKKVQFKAG
                     QTYKFHLEFGSAPTFPFQSEDLTSMNGGGSIYVGLMLDYDEERFIADAVAKASKANTV
                     ILCTGSSKQYESEGFDRKNMDLPGLQDRLVQEILKVNSRVILVNQSGTPVTLPWIEKV
                     PAFVQAWFGGCESGNAIADIIYGLANPSGKLSLTYPKKLEDNPAFLTYKSNNGEVVYG
                     EDVFVGYRAYEKTRREPAFPFGFGLSYTSFKFTDLKVALAGDDLHITVKVTNTGARAG
                     SEVVQVYVAPQTEVSVERPVKELKGFDKVHLQPSESASVTVTIPYLYASSYYNVDENS
                     WCAQKGDYNVLVGDSSQGPFVEENYTLSTTKNWSGI"
     gene            37858..37941
                     /locus_tag="FOA43_002657"
                     /db_xref="GeneID:62196058"
     tRNA            37858..37941
                     /locus_tag="FOA43_002657"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:62196058"
     gene            complement(<38037..>39317)
                     /locus_tag="FOA43_002658"
                     /db_xref="GeneID:62196059"
     mRNA            complement(<38037..>39317)
                     /locus_tag="FOA43_002658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922943.1"
                     /db_xref="GeneID:62196059"
     CDS             complement(38037..39317)
                     /locus_tag="FOA43_002658"
                     /note="BUSCO:EOG09342FUD;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778871.1"
                     /db_xref="GeneID:62196059"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="InterPro:IPR036034"
                     /db_xref="PFAM:PF04495"
                     /translation="MFGLAKKFVSSIETQASVYLNSSSSDGRNYTPNTIGLRVVNVEK
                     DSVAEQYGLESWFDFVTSINGRDVLSFFRHGKALDSNPYSGAQPGEVVSMQTSGLIVD
                     PSNVDYSVMLEFLAMEVNDKKNDLVLTTWSAKGGITRDICVPNGEFQAGASELDEVSL
                     DKPDKDGPTVHNSAFRKLKVTFQLTPLSSAFYVWHILRVQQNSPAYVAGIIPDEYILN
                     CEGGKLSTGGEDLLGRVITSVHNKWIQEQQQQIQNSTAVSPCSLVLYMYNHDYDTVRP
                     VTIYPNTQWGGRGLLGCDIGYGLLHRVPEVIGKFQGSESSSKIDLTPGSVVFNQDESL
                     PAATNNLLKPAARAPLFSDSQVHLDDTSIATKPPPKPTRRIKHGSKPSSAKANALEEY
                     FKEEEEKSHAVDNVVRSNGSNDSIATVPLPPKII"
     gene            <39586..>40770
                     /locus_tag="FOA43_002659"
                     /db_xref="GeneID:62196060"
     mRNA            <39586..>40770
                     /locus_tag="FOA43_002659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922944.1"
                     /db_xref="GeneID:62196060"
     CDS             39586..40770
                     /locus_tag="FOA43_002659"
                     /note="BUSCO:EOG09342FFD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778872.1"
                     /db_xref="GeneID:62196060"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="InterPro:IPR038385"
                     /db_xref="PFAM:PF01300"
                     /db_xref="PFAM:PF03481"
                     /translation="MAKPLQQYKDDFDTKVLKVDRDSIHFDDHGRLSISDPDTEKALR
                     MATEIIKKPGGVVGFPTETVYGLGGSSLSTESVKAIYAAKHRPADNPLISHISSIDQL
                     KRRLLIPGQKIPAVYEGLIEKFWPGPLTIIMPIEDENKSPISPCVRANQPTFTVRMPV
                     HPIARALIAMSDLPLAAPSANASTRPSPTLASHVYHDLKGRIPLILDGGACDVGLEST
                     VIDGTVDPPMLLRPGGIPVEMIRKVGGPFWQKIVIAKKTAGKNEPVKTPGMKYKHYSP
                     TAEVVLFLDCGDGVHSIKKYIKDHHLEAEKIGLLRSEYFADSSKMSGLISLERDLGQT
                     GLDIQKNMFAELREVDELGVDYIFVEGVHEDHEGLAIMNRLTKAASVVVKNDEVTVRG
                     PQ"
     gene            complement(<40855..>42618)
                     /locus_tag="FOA43_002660"
                     /db_xref="GeneID:62196061"
     mRNA            complement(<40855..>42618)
                     /locus_tag="FOA43_002660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922945.1"
                     /db_xref="GeneID:62196061"
     CDS             complement(40855..42618)
                     /locus_tag="FOA43_002660"
                     /note="BUSCO:EOG09341CWW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778873.1"
                     /db_xref="GeneID:62196061"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR005792"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00085"
                     /db_xref="PFAM:PF13848"
                     /translation="MLFTSLVSLLVTSLSVVRGEDSAAVAPEDSAVVSLNADNFEDFV
                     SQHPVVLAEFFAPWCGHCKHLGPEFVAAADVLSKKDIPLAQVDCTEERDLCSKYEVRG
                     YPTLKVFRGSPSDYSDYNGQRKSDSIINYMTKQTLPAVSVYEDAADLLEAISEVKDSF
                     ILQVLPKGVTVGNGTFYEIADAQRDLFSFATTSNEEYVKKYAPKSGKKPGYVIFRPDE
                     EISDASVYDDKLIDEEHLNKFIEVETKPLLGELDGSSFRSYMGANLPLAYYFYNDLTQ
                     RDEIKPLLSKLAKTYRGKMNFVALDATKYGVHSQNLNMEEKFPLFSIHDIPSNLKYGI
                     SQEKELNNKDISSFVTKFFAEKLEPIVKSEPIPDTQNSSVYHLVGYEYEKIVASPKDV
                     FVKYYAPWCGHCKRLAPIYESLADLYAEDDKASGKVLLAEIDHTANDINGVDIQGYPT
                     LILYPADGSDPVLFEGQRTLEGMADFIKENGSTGVDGTALYVKQQENSKDEENEDEDE
                     EVEAEEEKVAKLVEKIEKAQKPVADVAEKVKAAAGSIGQKIQEKYEQAKDLLLAKKEE
                     WTEKLQGVQKAPEEEEDHDEL"
     gene            <42896..>44650
                     /locus_tag="FOA43_002661"
                     /db_xref="GeneID:62196062"
     mRNA            <42896..>44650
                     /locus_tag="FOA43_002661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922946.1"
                     /db_xref="GeneID:62196062"
     CDS             42896..44650
                     /locus_tag="FOA43_002661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778874.1"
                     /db_xref="GeneID:62196062"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MGTKRRQVNTNSPETRASASERAIQSVLSRSIGNGTNGTNKEML
                     KLISQYFYNLGNPVFSQLADEISERTGVKLIDGPIGRLQEMITSPKRYNLSQLEVQSE
                     LIRLIAEIDPSSNDLSRYSFAMSCFAKHLFLEALLISNNVQRAVSVLRDFSGNIEESL
                     SGDLTDLLMDEKPNGISVDGIFQKKLQRLNWPADCTIKQSRELLLGEIMQLVPSADTP
                     APNRLVKLMGEALSYEQITNPYYFPPFKDSSTLSLPSVSPIYRDNSLVLPVETRLNSL
                     PVHLKRSLLLHENEVWFVKYSHTGHFLASASTDKMIIIYDADDNYSVYKKLTGHEGSI
                     IYFSWSDDDTKLITSSFDQNTKIWDVESGTCTTIHNESFFASNARVWSIEFLGEDNIF
                     VVGSPDKELGIFDKDGFMVHNFSPNYRVDDLTVINNDILCAVTHSCNLMIFNLKDKDY
                     KLLSTVKITQKPTAITHSPSDPKHILINVKPDQIQLWNIEDPERPYLQNKYYGLQQSD
                     FIIRGCMSDRNLILSGSEDGLVYVWNTRFGNLITSLAGHKSLINCIAWRPNPNGTKAG
                     CEWASCGDDRRVNIWGFK"
     gene            complement(<44701..>46455)
                     /gene="ATG22"
                     /locus_tag="FOA43_002662"
                     /db_xref="GeneID:62196063"
     mRNA            complement(<44701..>46455)
                     /gene="ATG22"
                     /locus_tag="FOA43_002662"
                     /product="Autophagy protein 22"
                     /transcript_id="XM_038922947.1"
                     /db_xref="GeneID:62196063"
     CDS             complement(44701..46455)
                     /gene="ATG22"
                     /locus_tag="FOA43_002662"
                     /codon_start=1
                     /product="Autophagy protein 22"
                     /protein_id="XP_038778875.1"
                     /db_xref="GeneID:62196063"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR024671"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF11700"
                     /translation="MPLDLPLEEDADADTSFDVTSQTPLVSSYNKSHNNNNPDAIESS
                     PSSPFTSKLEILGWCLYAWASEPFIVSAVGTYVPIILEQIARDNGVKNSDKISPCKGS
                     RNEPVPRPPPPGFQLTNSNTTESVSCVLPVLNGKIYIDTSSYALYTFSFSVLVQTICV
                     ISMSGAADRGSHRKSLLIGFAIFGALTTICYWFVRPDGYYMASFLAIVANSAYGCVSV
                     CGNSFLSVLVNNSAEIRQLTEDSSDRSSKWGVLSSKISGAGAASGYVAALIVQVGTMF
                     MLILIKNKTNVSSIMGPIKTVIGFVGLWWLVFQVPVSTFLKPRASPDLNLDNLHMPAV
                     GESKYWLRMAHYKWKVVRAYVLQGYKTLVLAFKQASQLRDISFFLLGWFIVSDSLTTI
                     NSTAILFAKSDLQMTTIQLSRISILAMISAVCGSIIIPNYIQPRFNVDVKTMLIFIIL
                     WSVMIPFYGILGFYFKRFGLHHSEEMYLLAIWYGFSLGGVATVSRSIYSMLIPTGQES
                     VFFALFSITDKGSSILGPLLVGVVIDMTHNIRQCFWVLLALLLVSIPVLWYGVDINRG
                     MREATALSEDSPTEERSP"
     gene            <47668..>48065
                     /locus_tag="FOA43_002663"
                     /db_xref="GeneID:62196064"
     mRNA            join(<47668..47712,47766..>48065)
                     /locus_tag="FOA43_002663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922948.1"
                     /db_xref="GeneID:62196064"
     CDS             join(47668..47712,47766..48065)
                     /locus_tag="FOA43_002663"
                     /note="BUSCO:EOG09344MU8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778876.1"
                     /db_xref="GeneID:62196064"
                     /db_xref="InterPro:IPR008831"
                     /db_xref="InterPro:IPR038089"
                     /db_xref="PFAM:PF05669"
                     /translation="MSSDELPTRWEIELEFVQSLANMQYLTYLAQTGHLEDPEFLNYL
                     EYLEYWRQPEYAEQLVYPDCLHVLTLLKSKEFRRQISKFEVSSVIYNDMVKRWKSEDH
                     GDHSEQVQPATN"
     gene            complement(<48126..>49736)
                     /locus_tag="FOA43_002664"
                     /db_xref="GeneID:62196065"
     mRNA            complement(join(<48126..49699,49733..>49736))
                     /locus_tag="FOA43_002664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922949.1"
                     /db_xref="GeneID:62196065"
     CDS             complement(join(48126..49699,49733..49736))
                     /locus_tag="FOA43_002664"
                     /note="BUSCO:EOG093410S7;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778877.1"
                     /db_xref="GeneID:62196065"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF13000"
                     /translation="MNRPRFLLLVLLYMIQGIPIGLAFGSVPFLLKSAGLSYSQVGIF
                     TLATYPYSLKLLWSPIVDSLFSKKMGRRRSWILPIQALSGVCLLVMGRSIDHLMDSDS
                     LANNLIKLTCWFFLLIFFCATQDIAVDGWALTILSRGALSYASTAQTVGINLGYFLSF
                     SIFLAFNSPDFVNEYIRSTPNDNGVISLGQYMTLAGVFYLIITIIIALFVPEDPPFIK
                     NAASAASSSAIELNNMGDGNSDSPDSSQYNSSAAVVDSPVEVYHRMLSVVKLSNVKTF
                     ILLLLVCKIAFQANEGATDLKLLDKGFAREDLAITVLIDFPFELIFGYYVARWSSGSR
                     PLQPWLFGYLGRIVAAIFGQVLVWYFPESGKIGSFYFICVICQHLLSSFMSTIQFVSL
                     SAFHTIIADPAIGGTYMTTLNTLSNLGGQWPKTIVLFLIDKFSEARCVPEKPEGQLNP
                     FATDDFYNCYSADMKKKCLASGGLCKMEKDGYYITNFLCIAIGIILYYGWIRRTAIRL
                     EGLPVGAWRTKKGVLPL"
     gene            complement(<50031..>50483)
                     /locus_tag="FOA43_002665"
                     /db_xref="GeneID:62196066"
     mRNA            complement(<50031..>50483)
                     /locus_tag="FOA43_002665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922950.1"
                     /db_xref="GeneID:62196066"
     CDS             complement(50031..50483)
                     /locus_tag="FOA43_002665"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778878.1"
                     /db_xref="GeneID:62196066"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="InterPro:IPR035946"
                     /db_xref="PFAM:PF08987"
                     /translation="MSESLYINEQQPSNDHLDTDFRVLVLIQNKETSTTKNDGKNTTT
                     DISVEQADMKGKLLEGIHTFTGINKFFDEFDRKIAYPNEGSLKYDVGSDGFIVIVVER
                     DQLRKEVGDFIDDYLKNVTKESSENGDADNDEESEDDLSLLPAKRPRK"
     gene            complement(<50684..>54226)
                     /locus_tag="FOA43_002666"
                     /db_xref="GeneID:62196067"
     mRNA            complement(<50684..>54226)
                     /locus_tag="FOA43_002666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922951.1"
                     /db_xref="GeneID:62196067"
     CDS             complement(50684..54226)
                     /locus_tag="FOA43_002666"
                     /note="BUSCO:EOG093405Z4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778879.1"
                     /db_xref="GeneID:62196067"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="PFAM:PF00289"
                     /db_xref="PFAM:PF00364"
                     /db_xref="PFAM:PF00682"
                     /db_xref="PFAM:PF02222"
                     /db_xref="PFAM:PF02436"
                     /db_xref="PFAM:PF02785"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF07478"
                     /translation="MSVSEYPSLKKLRNESVILPNANKILVANRGEIPIRIFRSAHEL
                     SMHTVAVYSYEDRLSMHRFKADEAYQIGKKGQYSPVQAYLQMDEIIKIAKEHGVSMIH
                     PGYGFLSENAQFAAKVEAAGLIWVGPSAKVIDDLGDKVSARILAAKCGVPTVPGTPGP
                     VDDISQAKEFVKQYGYPVIIKAAFGGGGRGMRVVKEGDDIADAFHRASSEAKSAFGNG
                     TCFLERFLDHPKHIEVQLLADNYGNTVHLFERDCSVQRRHQKVVEMAPSKTLPDEVRN
                     AILADAVKLAKVANYRNAGTAEFLVDRKGNHYFIEVNPRVQVEHTISEEITGVDIVSA
                     QIQIAAGASLEKLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGKIDVYRSAGGNGI
                     RLDGGNGFAGSVISPHYDSLLVKCTAHASNFEVTRRKMVRALIEFRIRGVKTNIPFLI
                     ALLTHPVFKSGDCWTTFIDDTPSLFDMISSRNRAQKLLAYMGELCVNGSTIKGQVGVP
                     RLQTDAKVPDFHDPKTGELVDVSTPVPSGWRNVLLEEGPEAFAKKVRSHKGSLIMDTT
                     WRDAHQSLLATRVRTIDILNIAPTTAHAFSGAFALECWGGATFDVAMRFLHEDPWDRL
                     RKMRAAVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQ
                     LKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLNYYLETVGKIVEMGTHFLGIKDMA
                     GTMKPAAARLLIGAIRKAYPDLPIHLHTHDSAGTGVSTYVAAADAGVDVVDCAINSMS
                     GLTSQPSLSAFIAAVDGSFEPGIPESAARELDAYWAEMRLLYSCFGTDLKGPDPEVYQ
                     TEIPGGQLTNLVFQAQQVGLGEQWAETKKAYVAANQLLGDIVKVTPTSKVVGDLAQFM
                     VSNKLSSKDVEKLASELDFPDSVLDFFEGLMGTPYGGFPEPLRTNVIKGKRRKLTHRP
                     GLELEPFDLQRVRNDLRARFGPDITECDVASYNMYPRVYEDFKAVQEKYDDLSVLPTR
                     AFLAAPKIGEEIQVNIEQGKTLILKVAAIGNLNEETGTREVYFELNGEMRKVSVDDKN
                     ASVDKVTKAKADAHNPNEIGSPMAGVIVEVKTHTGADVKKGDPLCVLSAMKMEMVISA
                     PITGRVADVLIEKNENVDGGDLLVKLTQPEEKKD"
     gene            complement(<55399..>57014)
                     /gene="ADE13"
                     /locus_tag="FOA43_002667"
                     /db_xref="GeneID:62196068"
     mRNA            complement(join(<55399..56856,57009..>57014))
                     /gene="ADE13"
                     /locus_tag="FOA43_002667"
                     /product="adenylosuccinase ade13"
                     /transcript_id="XM_038922952.1"
                     /db_xref="GeneID:62196068"
     CDS             complement(join(55399..56856,57009..57014))
                     /gene="ADE13"
                     /locus_tag="FOA43_002667"
                     /note="BUSCO:EOG09341JAA"
                     /codon_start=1
                     /product="adenylosuccinase ade13"
                     /protein_id="XP_038778880.1"
                     /db_xref="GeneID:62196068"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR019468"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="PFAM:PF00206"
                     /db_xref="PFAM:PF10397"
                     /translation="MIKRMTSDNDIYLTPLSSRYASKEMSQIFSMRNRYSTWRKLWYN
                     LAKAEQLMGLDVITDEALEQMSQHFIITDEEIDAAKKEEARVRHDVMAHVHVFGETCP
                     AAAGIIHLGATSCFVTDNADLIFLRDAYDLLIEKLVNVIDRLAKFAFEYKDMPTLGWT
                     HFQPAQLTTVGKRACLWLQELLWDLRNFQRARDDIGLRGAKGTTGTQASFLSLFHGDD
                     AKVEAMDKKVVELLGFKHAYPVTGQTYSRKIDIDVLHPLASLGATCHKMATDIRLLAH
                     MKEMEEPFEKSQIGSSAMAYKRNPMRCERVCSLSRHLSALFQDAFNTASVQWFERTLD
                     DSAIRRISLPEAFLTADILLSTLINITSGLVVYPKVIEKRIRSEIPFMATENIIMAMV
                     EKGESRQECHEQVRVLSQQASAVVKQEGGENDLIERIKRTDYFKPIWGDLEKLLDPTT
                     FIGRAPRQVEKFVGEDVKEALSPYRQLINSEEVKLAV"
     gene            complement(<57047..>60577)
                     /locus_tag="FOA43_002668"
                     /db_xref="GeneID:62196069"
     mRNA            complement(<57047..>60577)
                     /locus_tag="FOA43_002668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922953.1"
                     /db_xref="GeneID:62196069"
     CDS             complement(57047..60577)
                     /locus_tag="FOA43_002668"
                     /note="MEROPS:MER0001879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778881.1"
                     /db_xref="GeneID:62196069"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR035927"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00443"
                     /translation="MSESSDTTEAYEEAKETQDNTDSNGEPGLESNVEPNVEPNVESA
                     YNILQQRRVEARKIESEESQKTKEGDKLCAVPKGWLERFFSESFDESAQDIDNELGRL
                     SSRGILDETGVVLTKDFDFISRKLFDLLCQWYGWKDGDPVVEREAYFNAEKAQMDVET
                     WPLYIILHVLTANASQVNRFSSVDATPFLVSSHSTAKHLKETVERTYDVDRRAKTRIW
                     QIAVKDGYNFPSVVLPSFEETITESMLIHTGGKYGLRTLEESKVRSGHILMELQQPDG
                     SYLMDTASELMLDDGLVGLNNLGNTCYLNSALQCLVHIPELTYYFLYDYYKKEINKEN
                     PLGSQGKMAEAYGTLAKHLFDRRLIGQQTSFAPRDFRYTIGFFNSIFSDYRQQDSQEF
                     IAFLLDGLHEDLNRVIQKPYVEKPELPQGKVEDQEEIRKLARQCWLAHKKRNNSVVID
                     LFVGQYKSTLVCPECGYVSITFDPYNDLTLPLPITRKWNHKVKILFQEGRPKLFEVDL
                     PRSATFYDLKAYVSRAIDVPMNEIICLEVFQSQVYKNYEDKDSDTRYLPISDLISKGD
                     DIWFYQVCHEPGDLVVPVFSTVLGGPLLKNKVFGIPFFITLNEKERNSYGAIREKLEK
                     RYTQLSTYQYFEKVRSQSKGEYSLDDFDKLDDILKKELEEYDEEDDLASIISSANPEL
                     PGDCAFHVKLLGGGPKVRTRRSFGSRYGHHVGYHSFAFGQQARCKEIGKDEDDEDDGE
                     GDDDNLWIPETNGNFDGLQDLLDKLDPLKAALYTYHAIDDKDETEKGEEGEEGEEVEE
                     EDELMRRDQDGEEDSDAMDEEAEEEEEETGETAEVIEVDGNDKDMAISDSSSGSNVTE
                     EVKYISLVEDKMALVCQWEPELFDVFFTGLEDEEDGGRETWTHPPILHNAELEDNRKE
                     AALKRKKTIDLDDCLDMFSRPEVLGERDLWYCPYCKGHRQATKKIEIWSVPDILTIHL
                     KRFESSRSFSDKIDAVVEFPIEGLDLSKYVTDGEAHDDLLYDLFAVDNHFGGMGGGHY
                     TAYVKNFVDDKWYYYDDSRVTVANPVDSIRGSAYLLFYRKRTSGPVGGEYFRKMEEEI
                     SQKRAERDEKLKELSKMEELLGDEDGEREDTSEYGSSGSDIDGTVKRRKKMGAIMMGR
                     SSSDNVNSPLSDREEVMSTVSSTANAPDIE"
     gene            <60831..>67268
                     /locus_tag="FOA43_002669"
                     /db_xref="GeneID:62196070"
     mRNA            <60831..>67268
                     /locus_tag="FOA43_002669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922954.1"
                     /db_xref="GeneID:62196070"
     CDS             60831..67268
                     /locus_tag="FOA43_002669"
                     /note="BUSCO:EOG093400NY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778882.1"
                     /db_xref="GeneID:62196070"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="InterPro:IPR036372"
                     /db_xref="PFAM:PF02138"
                     /db_xref="PFAM:PF14844"
                     /translation="MSDAIDALFGCLQLPDYSEQSEVFVFLHNWKLMANDPNFIFDFI
                     QSCHDLLLFRTHQSQSILRILGSVLSSVSDCDCDLSNFIFSFISSILNASPINKIRVF
                     SSELIQFLLDQILSDHFSSLLRNSLTQIFYSLTELGLSYTQLAQIYKASLTDDYALDL
                     LYNCFHLYPTSFKSLILTNTSSLHFRNLHFHDVRKGFTLSTRFQLHSGFHNVDHPEID
                     PFTLMEISNEDNCSIIRYSIEDSKLVIQCKDTSYAFESFSFELGNLYNVCLLHRCDSK
                     KSSVVDLYIDGEFIQSRTVVPIFLHLSTSKSLFGSHVPSNLNLTLSVSSSSNATNVIP
                     ELANLIVINGIQSRNWILLAHSLGPNYAGTYQDTHLASLLDPKSVMTIKLKLREYLET
                     DGRSKKDFDPFVSNIIVDPRDLVLNFHCSNVERSDRGIKINIQTSILRTERPQPVFIT
                     RPEDGDVLYWNPYSLINRLFSVGGFGIVLRLIAESTTTDQLVKSLELLFHVLETDSRS
                     LAEFGSKSGYDVLATLLKTKKSLIQMEVLMVILKFIGYNEDSPADSIIANGLAYCSLI
                     ADFEIWQPQQTIDCQIDPKSKDTFKFVLFQLSMFGEGSKYHSYNLKKLGDMKIVKRVI
                     QALKYRLVDEDLLPILCNSLLILVRLNPTPSVIRAMSLYVVYALQAKDSDISSDLDKK
                     CGASILDIIVSLVCDPVDIMTPGNFRKVLKSINAKWLMILLDSGEEGVVKMALQLLIR
                     VLSILGPRARRAFNDSGGLVMLRKSLSLKWRDDDLITILFAGSFGVSYSLEKLSVDFG
                     TVNFLKRLCEDPAELSLIMPGFLSVINGLLETSINEVQDLIDDDKFSLLDDTVLDALS
                     SLELYYQVLTISFNEIPALRVFIKDDMNWTSEFLLIVLSLYSLDHIDEFSSFYHRYSE
                     FSGSIFIGKLFDPSSSSANDKKYLWKFCSRDPALFSLTVMPRVFEHIHSFQQTEQSFI
                     KDTIAASCFFRIMSDYFGTGSDFIFDDNDFLQSLDVVGSILFEADRTEYPARSDSTFK
                     ICRAAFARSYLRFFTRCTEEEIKEPFSRLSHIKFCFSNFMLYGKVISEGLEEEEQGVI
                     FLLSLLFKNLLVDDEEISSLAANCLRMIVMNGGDLPELSKKFALSFKESVSLNDLELK
                     VYLCSEMDLKNMLNGKFNEALTASRQAKASKLKSEFIKELIANYRLKIHVQHLKRWNL
                     ESISKAITEAELHKFNRHIQDDNDDLSYYISTYDRICSKIPVDDIKFKLYLDSTEGRF
                     RMRRKILREPTLESTVLPRGADTITLDESENALLGIESDTDTASYEFVSEQVDLETSL
                     EDKNRKVVRSLYVHDKIVQISNVTQILGLETFEMIVIIGLTHLYLIENYFHTDDGNIV
                     DIDDAPKSVRDPYVQLIAKNDPNNATFSSATHNIEPTKRDKLHRTRSWRLDRLVSISK
                     RKFLLRDVAAELFFADGSSVLITCGTKSRRNLLLGQLSSKITAKYTDEDLEEAMKLAS
                     KQKITFVNRRDNGKLSSILFNTFINTGVPPSANVSFSRITKKWKHGELSNFYYLMLIN
                     TMAGRTFNDLTQYPVFPFVIADYESDELNLDDPSSFRDLSKPMGAQASKRAGKFKERY
                     EASAEMAPDVPPAHYGTHYSSAMVVASYLIRMEPFVRSYLILQGGKFDHADRLFYSLA
                     KTWKSASCDNTSDVRELIPEFYYLPEFLVNCNNFDFGDLQDGTAVNDVILPPWAHNDP
                     KIFVEKMRQALESDYVSQHLPEWIDLVFGYKQRGEEAVLSLNVFHHLSYAGAIDLEAV
                     ADEREKAVVISTIHNFGQTPLQIFSKPHPKRWTLLAKFSFDVNSLVGFPVSRGRHTLK
                     GAVDEIVFDLEHKEWKTLSADVRSNGKLTIRKYSSCNLILNESLVFEQLSQDRITKFE
                     LIGSDNLFVVGFEDGSLILYKLTADTLSSITNSQRSSIQQTRMYSGLANPNCLRLQSM
                     DVMRSHSDAIKDIKVSHYNGVLLTLSDNGEAMLWNLADCEKIRDIGNGNENLVNISEE
                     YGYIATVDGENYLKLFTINGDLISQVLLKKGAIVVEFSEFNLPFGCKVNNSPWMHVAI
                     VAVGFEDGTVLIYQLMLEKTWNLAKIGELGTENKITALKLKLGIALDGEGNKVGRGQL
                     LAGTDDGKLLIWG"
     gene            complement(<68574..>69146)
                     /locus_tag="FOA43_002670"
                     /db_xref="GeneID:62196071"
     mRNA            complement(<68574..>69146)
                     /locus_tag="FOA43_002670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922955.1"
                     /db_xref="GeneID:62196071"
     CDS             complement(68574..69146)
                     /locus_tag="FOA43_002670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778883.1"
                     /db_xref="GeneID:62196071"
                     /translation="MLPWILLLFAFSVLALTGHLELPANAINVLDPARASIILIDDST
                     ETQNVYHFLRDGSFNLPVSHKGTYRLFFQSLDFNFIRGNEFSLLVKNSTYYELHEFYS
                     KNKDLVPAGLQFAIDQIHFKNFVDVDPSDSFLNSLPLVPLIRRYPIIGGLLGAGILLM
                     VSPMIISQFDPEFNTKFIDAQKELRTKKSQ"
     gene            complement(<69531..>71060)
                     /locus_tag="FOA43_002671"
                     /db_xref="GeneID:62196072"
     mRNA            complement(<69531..>71060)
                     /locus_tag="FOA43_002671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922956.1"
                     /db_xref="GeneID:62196072"
     CDS             complement(69531..71060)
                     /locus_tag="FOA43_002671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778884.1"
                     /db_xref="GeneID:62196072"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013235"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="PFAM:PF00149"
                     /db_xref="PFAM:PF00515"
                     /db_xref="PFAM:PF08321"
                     /db_xref="PFAM:PF14853"
                     /translation="MVDTSQQAEAEAFKNQGNEQLKKKNYDKAIDFYTKAINLNATAV
                     YYANRAQAQIKHENFGLALNDANDAIRLDPDYLKGYYRRAVAHSGMLEYKKSLKDVDT
                     VLSHAPGDKNAQSLKKNLAKVVNRIRFEKAIQVDEDGKSVFDEIDYESMVSTEENGLE
                     LKIHVENTTKGSSKQIVTVEMTEKYIEKMIEVFKNGGTLPKRQAYAIVAATKELFHKE
                     KALVEIGIPRKATADSGEFQYRPVKKITICGDTHGQFYDVLHIFETFGKLNEEHSYLF
                     NGDFVDRGSWSCEVAFLLYSLKLLYPKNVYIDRGNHETDDMNQVYGFQDEVKAKYTDR
                     LFKCFSESFNSLPYCTLIGQEYLVMHGGLFSSDDVTLDDLRNIDRFKHRQPPKEGIEM
                     ELLWTDPQPEPGRGPSKRGIGLQFGPDVTKKFCDSNHLKMVIRSHEVRDGGYEIEHDG
                     RLVTVFSAPKYCDSQSNLGAVINLTLNDKEEYEEEFKTFEAVSHPDIPPMAYCKSNLG
                     F"
     gene            complement(<71185..>72573)
                     /locus_tag="FOA43_002672"
                     /db_xref="GeneID:62196073"
     mRNA            complement(<71185..>72573)
                     /locus_tag="FOA43_002672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922957.1"
                     /db_xref="GeneID:62196073"
     CDS             complement(71185..72573)
                     /locus_tag="FOA43_002672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778885.1"
                     /db_xref="GeneID:62196073"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="InterPro:IPR036168"
                     /db_xref="PFAM:PF00928"
                     /db_xref="PFAM:PF01217"
                     /translation="MASVVYFLDNRGRPLLHRDYKWDIPSTAVEKFPILLLEKSSNGD
                     AVGSLEDGSTVPVLNSDGVHYIYLMHKNLYILALTREDTNAFAILCYLDSLVRVLEGY
                     LKSLEEESIRDNFSIIYELLDEMMDYGVPQITDQKILKEYITQESFTLKTMFRPSGSK
                     KKPGSTTVFKERMAPSAVTNAISWRSSGIVHKKNEAYLDVVESIDMLINPKNQILSSE
                     IHGEIKLRSTLSGMPELVLGLNEKFMNSCINAVKGLPPIDNTKKSIEVEDVKFHQCVR
                     LGKFESEKMISFIPPDGECNLFSYRVHSSTLKPMFLIDYKVRNHSNTRLEIMVKVRAN
                     FKSRISARKLEIRVPVPRDVDSPKYHYNKGSLKYLPNESVILWKFHKIDGAKEYVMIA
                     ELLLPSVADELELNKFRKIPLNLKFEMQGFVTSGLQVKYLKIREPKMNYQSYPYVRYI
                     TKSGDHYEVRVK"
     gene            <72870..>74549
                     /locus_tag="FOA43_002673"
                     /db_xref="GeneID:62196074"
     mRNA            <72870..>74549
                     /locus_tag="FOA43_002673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922958.1"
                     /db_xref="GeneID:62196074"
     CDS             72870..74549
                     /locus_tag="FOA43_002673"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778886.1"
                     /db_xref="GeneID:62196074"
                     /db_xref="InterPro:IPR019417"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF10313"
                     /translation="MTIESLSDPTDIQIHSSRAYRSNFLMPKSSYFNVNITINHWQLK
                     DLVCRSSSSNSIYFPSGTKVSRLDFDPQSPVSLSKKQDHLKHARLTAKQSEAISNPSS
                     NVFIDASSHVDPLVANFESSPRCLKEAGGVVVVGGVVNTSRTPVHSSGGAGNATSNNT
                     TYRAPGKWKGLFGIHVNETGYSENGHIGTLINNSVTINKISNTCYRSLVCNNDQNLYI
                     VDVLNRGDGLAPEFSVNMGVALNHASLSPDLKTIVTLGDSSRIFVLHPEENLRDITNR
                     EVISTQSDCGFSTSWNDSGYQFSACFQEGVNFIYDIRHMARPMHEIYSTRRQSQNGAF
                     RVCKYSSGTDDLLFISEHQGRVHVVDTRDFMTHQVVLLPKMLYDYEEGYYNQPIVKDY
                     QDVCDIQNELGYLSSSRRFIADVDVDRLHNSKFFKYTSDSCPKRYPATSSAAAAAAAA
                     AAKNDLKQSTYDPLMHSTYLRGTGTGTLATTVSRNSRGGSSESSDKLKSPLTDPFYYL
                     DSELEICGLEVLGNSQYGDGRRSLVIGTEDGLVHWNIDSWKRRCFPSYELA"
     gene            complement(<74618..>75688)
                     /locus_tag="FOA43_002674"
                     /db_xref="GeneID:62196075"
     mRNA            complement(<74618..>75688)
                     /locus_tag="FOA43_002674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922959.1"
                     /db_xref="GeneID:62196075"
     CDS             complement(74618..75688)
                     /locus_tag="FOA43_002674"
                     /note="BUSCO:EOG09344BHH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778887.1"
                     /db_xref="GeneID:62196075"
                     /db_xref="InterPro:IPR003923"
                     /db_xref="PFAM:PF03540"
                     /translation="MAKRSKGTDTRKGHVTKERVEVKKEDKVEDKEEDKEEDKEEDKV
                     EDKEEDKEEDIEEDKEEDKEEDKEEDKEESEDVEEADDAENDKEQEEDTNTKEKPVEA
                     KEKPVEDKSKLPSGALFSANDVDELMEEEDSGEKRSAEPSSEEPSAKKVEIETSDNTR
                     TSSAAEIVASPASAESPSPEDPNLTKKEPPIHSLPVLTREDKTLEEVLEMMDDEDFTP
                     IIPDAVTDYYLAKNGFATDNRKIKRLLALATQKFISDIATNAYEYSRIRSNSAVYNSS
                     NPQVRARALMMATMMNSQEKKQTSEDTDSDGNGNNENSLTGALGGGLNQSQNQKVTLT
                     IEDLSSALDEYGLKVNRPQFYR"
     gene            complement(75791..75862)
                     /locus_tag="FOA43_002675"
                     /db_xref="GeneID:62196076"
     tRNA            complement(75791..75862)
                     /locus_tag="FOA43_002675"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:62196076"
     gene            <76957..>78348
                     /gene="GLR1"
                     /locus_tag="FOA43_002676"
                     /db_xref="GeneID:62196077"
     mRNA            <76957..>78348
                     /gene="GLR1"
                     /locus_tag="FOA43_002676"
                     /product="Glutathione reductase"
                     /transcript_id="XM_038922960.1"
                     /db_xref="GeneID:62196077"
     CDS             76957..78348
                     /gene="GLR1"
                     /locus_tag="FOA43_002676"
                     /note="BUSCO:EOG093423XZ"
                     /codon_start=1
                     /product="Glutathione reductase"
                     /protein_id="XP_038778888.1"
                     /db_xref="GeneID:62196077"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006322"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF00070"
                     /db_xref="PFAM:PF02852"
                     /db_xref="PFAM:PF07992"
                     /db_xref="PFAM:PF13738"
                     /translation="MRSHYQYLVIGGGSGGVASARRAAGYGASTLLIESKEMGGTCVN
                     VGCVPKKVMWYASDMASKIGIAKDYGFFKVDSSFAHDFDWSTFKQKRDAYIKKLNGIY
                     ERNMSNEGVEYIYGLASFTKDGIVQVRDKSDPSKVSTFTADNILIATGGRPVMPTKIP
                     GYELGINSDGFFKLEKQPKRVALVGSGFVGVEFSGVFNALGSETHMIIRHDTVLSKFD
                     DLIKHTITDKYEKEGVFIHKNSNIKSVEKLADGSKKVTLDTGVVIEVDELIWCIGRRS
                     MIEMHPENINLKLNDRGQVVVDEWQQTNVPNVYSLGDVVGNVQLTPVAIATGRKLSNR
                     LFGPEQFKNQKMDFENVPSAVFSHPEVGAIGLAEHDAKAKYGEENIKSYTSRFNSMAY
                     AMTEHKSPTAYKLVCLRTEKERIVGLHIVGDGASEILQGFGVAIKMGATKADFDNCVA
                     IHPTSAEELVTMK"
     gene            complement(<78402..>79917)
                     /gene="NMA1"
                     /locus_tag="FOA43_002677"
                     /db_xref="GeneID:62196078"
     mRNA            complement(join(<78402..79638,79913..>79917))
                     /gene="NMA1"
                     /locus_tag="FOA43_002677"
                     /product="Nicotinamide/nicotinic acid mononucleotide
                     adenylyltransferase 1"
                     /transcript_id="XM_038922961.1"
                     /db_xref="GeneID:62196078"
     CDS             complement(join(78402..79638,79913..79917))
                     /gene="NMA1"
                     /locus_tag="FOA43_002677"
                     /codon_start=1
                     /product="Nicotinamide/nicotinic acid mononucleotide
                     adenylyltransferase 1"
                     /protein_id="XP_038778889.1"
                     /db_xref="GeneID:62196078"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF01467"
                     /translation="MPQLIPNHTPIQSYVLSDDVDEDEPLHVEQSSSSEMLISTSVCT
                     THKERSEKRKAQTLKHKIPKLPTELEPSSSSSSTSAEEDNPDGEIVPNIISDGEISEE
                     NSIVSIDQLRRMDKRQYSTASTDVDYDNEPIVHSFQIADLEEVPHGIPRQSTTMKNYQ
                     FPTHRLKKRLSDANKYPLVIVACGSFSPITYLHLRMFEMALDSIRESTKFEVIGGFYS
                     PVSDNYSKPGLAPSSHRVRMCELACERTSSWLMVDAWESLQPKYTRTALVLDHFNREI
                     NIKRGGVFKAGSSTEKIGVKVMLLAGGDLIESMGEPNVWADQDMHHILGNYGCLIVER
                     TGSDVRSFLLSHDIMYEHRKNILVIKQMIYNDISSTKVRLFIRRNMSVRYLLPNSVIR
                     YIQENHLYVNDKEPVKVVLNK"
     gene            complement(<80047..>81507)
                     /locus_tag="FOA43_002678"
                     /db_xref="GeneID:62196079"
     mRNA            complement(<80047..>81507)
                     /locus_tag="FOA43_002678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922962.1"
                     /db_xref="GeneID:62196079"
     CDS             complement(80047..81507)
                     /locus_tag="FOA43_002678"
                     /note="BUSCO:EOG09341455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778890.1"
                     /db_xref="GeneID:62196079"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032705"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF13191"
                     /db_xref="PFAM:PF14629"
                     /translation="MTFQEVYGTKLRGRVLGKLSAKTTLGDKLIRLYDLDKEQHQMYK
                     VLENTVKYREGKSVLLIGPRGIGKTTMVNNCLLELGSKYEGQFLVIRISGLYERDDKT
                     AIREIARQLDFIMEEEDDGDEENEDVQDGFEKVSSNATMRMIMSLLDRTQLNEEEDVA
                     GGKREADQIPLIFVIDEVDKYASNSKQTLLYNLFDIAQASEGRKSDNGGGGGGGSTLT
                     VIGISSKATVREQLEKRVKSRFSQRMIQLNKCKTLTDYCGAIGCMLKLEDDDNDDEWV
                     SKYNKKVDEMINTTGSALRKIIVENFYTVKDLNALKNSLVPYMKYGFVRGSEQLLKSN
                     LEVYDDRNFELLGSLTELELKLLICTARVKSRNSIDRVNFNVAFEEYLKMAANETNTL
                     NTQLETMGVSLRRNGEFTGNGYSSSRELMLGCWERLAEIGVMGEPMKQINGVNAESYT
                     GGEFNKMYVCDIELNEIMKYFREEREEAWVEKWCRI"
     gene            complement(<81590..>83506)
                     /locus_tag="FOA43_002679"
                     /db_xref="GeneID:62196080"
     mRNA            complement(<81590..>83506)
                     /locus_tag="FOA43_002679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922963.1"
                     /db_xref="GeneID:62196080"
     CDS             complement(81590..83506)
                     /locus_tag="FOA43_002679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778891.1"
                     /db_xref="GeneID:62196080"
                     /translation="MIYARSIGSVGLASTADLNLPMVEPGKMKILNGDNGEVIDANKK
                     LKGSQKSLESIKSYKSSLFVKDETSEKKIPKNLVLSDSDEYVSELDEEFGEGVRTVPA
                     GSNLLKVEKALFEEGDKLKKRNSNNKDKPTNKVESIELVKVKKSPKSRPVISTASLVR
                     RTRSATRKPTIIDLTVDSSNEGSSDEGSSDEVIDLDEDEDETSESESESESEDNLITN
                     PDGVILSDKVTRVLKELNYTNKDSLDVESLLPKIKGDEEGISEKKEGKKLDLQKQNVV
                     KSRPKIVSNRKIDSDIISLLRSRKSRSGRTFNGVPVDYNIPHEPPRPIYSSSCVTCLN
                     VSKQRYCNRQYRCDICVKSRRPCKYPQSSKVINRDEIEIYANAISMRDNGIWDKRFEG
                     ADNANENKDEGKKVEETQSVNKRRYRESKKESKRRKVVEETKKTKTGTNKSTREGDAD
                     WVDDNSDVFEDATERLTQYSPIEESDSEFSEDTSYDGDSETEKKKKNNNRNKRRNRYE
                     GSESDSEGSTGARGLIDEFELEQEEENLQAMKDIAGSNEKALRILKELDFENRDVREL
                     YMNYGERNRRLATKENYVELEGDMSDLSEGAQAYKNAEDAAEPIILSDDEAERRMLRG
                     HLPLEYVHEMRNEH"
     gene            complement(<84518..>85852)
                     /gene="VPS4"
                     /locus_tag="FOA43_002680"
                     /db_xref="GeneID:62196081"
     mRNA            complement(<84518..>85852)
                     /gene="VPS4"
                     /locus_tag="FOA43_002680"
                     /product="Vacuolar protein sorting-associated protein 4"
                     /transcript_id="XM_038922964.1"
                     /db_xref="GeneID:62196081"
     CDS             complement(84518..85852)
                     /gene="VPS4"
                     /locus_tag="FOA43_002680"
                     /note="BUSCO:EOG09341UP6"
                     /codon_start=1
                     /product="Vacuolar protein sorting-associated protein 4"
                     /protein_id="XP_038778892.1"
                     /db_xref="GeneID:62196081"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036181"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF04212"
                     /db_xref="PFAM:PF09336"
                     /translation="MSSEFLDKGVDLVKKAIEADSDTRYEEAYKLYYNGLDYLMLAMK
                     YEKNPKSKETIRAKFTEYLARAEQLKEHLDTKQQQTQTGEANASSGSVKARKSNGNAE
                     SGNDDIDSETKKLRSALEGSIMSEKPNVTWDDVAGLDQAKDALKEAVILPVKFPQLFT
                     GKRKPVSGILLYGPPGTGKSYLAKAVATEAQSTFFSVSSSDLVSKWMGESERLVKQLF
                     QMAHEQKPSIIFIDEVDALCGPRGEGESEASRRIKTELLVQMNGVSSDSDGVLVLGAT
                     NIPWQLDSAIRRRFERRIYIPLPDSEARIDMFKLDIGDTPTALSSQDYHTLAQMTDGY
                     SGHDVAVVVKDALMQPIRKIQTATHFCKVEETVKEEDGSEEIRVRYQACSPGMQGAIE
                     MNWMDLDGDQMKEPELTMKDFIKSVKTNKPTVNKKDLEKFEEFTRDFGSEGN"
     gene            <86918..>88897
                     /locus_tag="FOA43_002681"
                     /db_xref="GeneID:62196082"
     mRNA            <86918..>88897
                     /locus_tag="FOA43_002681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922965.1"
                     /db_xref="GeneID:62196082"
     CDS             86918..88897
                     /locus_tag="FOA43_002681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778893.1"
                     /db_xref="GeneID:62196082"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08581"
                     /translation="MQDRTHLDELLEAVKKEFESLSRETTLYKDHHQEYEMKINQQHQ
                     ELASIRNTVYELEQAHRTMKDAYEKEILRLKQDLENRDRLLEQQSIQQQQQVQAQAQA
                     QHQQQQAAAVAQAQAQAQAQVQAHSQTQQFGRPGVNQPQIAPPNLSTPSSSVPDAARG
                     FLSQPPGAPGTAATASATSPAAAAQALSQPAIQPATAAVPTIATNAFSANSTTTNTTK
                     QQQSPAPDATKNGTSPVTASPTTASPAATTNAAPSFTETPATTSPTSTHIKPIKQETV
                     SQEALVKRAQHNKPIPAFLKDFDSYNSLPYKKQQSEYYVVYNPKVPKKAEISLVHSFD
                     HTSVVCCVRFSKDGKFLATGCNKLTQVFSVETGDLVARLSDESSASANGSYDTGSGDL
                     YIRSVSFSPDGKFLATGAEDKIIRIWDLATRTVVKYLKGHEQDIYSLDFFPDGTKLVS
                     GSGDRTVRIWDVFTGQCSLTLSIEDGVTTVAVSPDGKLIAAGSLDRTVRVWDANQGFL
                     VERLDSANEAGNGHMDSVYSVTFTHDGHEIVSGSLDRTVKLWSLKDLQRQQGAASKSN
                     CEVTYVGHKDFVLSVCCTPDDEFILSGSKDRGVILWDKLSGEPYIMLQGHRNSVISVS
                     VSPVMSTSRGLNGGYFATGSGDCKARIWKWERVSS"
     gene            complement(<89162..>89989)
                     /locus_tag="FOA43_002682"
                     /db_xref="GeneID:62196083"
     mRNA            complement(<89162..>89989)
                     /locus_tag="FOA43_002682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922966.1"
                     /db_xref="GeneID:62196083"
     CDS             complement(89162..89989)
                     /locus_tag="FOA43_002682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778894.1"
                     /db_xref="GeneID:62196083"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF10294"
                     /translation="MSDSDTFSIDGAGLFDEPDNFLPKPPAAHFTNYERTENSPEDEH
                     SIKTIKLRLVGKSPLWGHLLWNAGIYTANYVESHARELVKSKKVVEFGSASGLPSLLC
                     CIDGAEKVVATDYPDADLLYNINYNVDLLPFDKLIKDRVLSVEGFIWGNEIKPIKDLL
                     GGDGYADFLIMSDLVFNHTEHHKLLTSCKQLIRPLADKSKPRSGGKCLVVWSPHRPKP
                     QMVANDFKFFQDAKEIFQFDVEFVEMVHWDHPMFPEDPKESEELRKRVYCYILHPTW"
     gene            complement(<90113..>90946)
                     /locus_tag="FOA43_002683"
                     /db_xref="GeneID:62196084"
     mRNA            complement(<90113..>90946)
                     /locus_tag="FOA43_002683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922967.1"
                     /db_xref="GeneID:62196084"
     CDS             complement(90113..90946)
                     /locus_tag="FOA43_002683"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778895.1"
                     /db_xref="GeneID:62196084"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MSIVLNNHIRIPFIGLGTYAIRNAEEVVEKAMDVGYRMIDTAVL
                     YGNERECGQGIFKWLKKDPVHNKREDVFYVTKLWNDQNGYESAKRAIKECLNKVSDLK
                     YIDLLLIHSPTEGRQMRLETWKAMQEAVESGIVKSIGVSNYGEKHIDELLNWEGLKVK
                     PVVNEIEVSPWCMRQALCDFTKSRGLQVIAYAPLSHAYRVDDPDATIVAKAHGVTNAQ
                     VLIRWSIQKGYIPIPKTKTLSRLSSNLDVQSFTLSATDMKRLDHPYVHDPSDWDVVNC
                     P"
     gene            <91379..>92710
                     /locus_tag="FOA43_002684"
                     /db_xref="GeneID:62196085"
     mRNA            <91379..>92710
                     /locus_tag="FOA43_002684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922968.1"
                     /db_xref="GeneID:62196085"
     CDS             91379..92710
                     /locus_tag="FOA43_002684"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778896.1"
                     /db_xref="GeneID:62196085"
                     /translation="MSTPSTPPFIKDSDANDDLQSQPVISSLGSCLSSSKTHLKTPSS
                     YTRSHDQLFTPNTPQSKKANVTAVVASTNSSSSMLSPSDSCKQSSLNQTQSSQLQTPR
                     QTPRRFGSGSSTNSSSSSSRKRLSGAIEFKASENVGLKPSLFPPAPSTVGFGRKWPTS
                     LHTNLFNNNQQDMLDVKGSIKVDIAEGEEVSQPKLIVKRRRPNLRQQQLQQKQSLDDY
                     SSEESGDETLEEGLRKVSKRLEFEAPSTPKAQVMDINYAYENHIKEHNSMSPEEDFEQ
                     EKNIPSVVENPFIGDFPKRTSKIPLNYIRFENEMELVNSRTGKKIIKPLDDFQKSIKP
                     RQLFLNEKEDDKKEDLLRTPQNKILLPNLSHRSFNDEEDDTDERIRKERIFNPFRHAD
                     KSGRINKRKSVRPKRYDEIEYINHTSGDRVTRKMNDEELSIKPKKLNFDNC"
     gene            <92961..>94460
                     /locus_tag="FOA43_002685"
                     /db_xref="GeneID:62196086"
     mRNA            <92961..>94460
                     /locus_tag="FOA43_002685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922969.1"
                     /db_xref="GeneID:62196086"
     CDS             92961..94460
                     /locus_tag="FOA43_002685"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778897.1"
                     /db_xref="GeneID:62196086"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="PFAM:PF00892"
                     /translation="MNSPPRSPISISSAETYIPEALRLRSPVVRLRTSLIHDPVINQS
                     YVKSPIIRERTASLQEHQVLDQVLDIIKTDEHTRWIKGLFYLAVLIITWVIAVQLANN
                     LMKNTDYDHPLFIAAVDGVFFLLFGIRSLLRHIYSALTRTFGYRSPLIRQPVINYQAA
                     QSEPDSILLEALSYQLSYYEILSVGAQVAIVYFISGACATTALKYTSASNQTILSTTS
                     SLFTLMLGVLTHVERFSVAKLVAIVVSIIGICLITMEDSIKLKYSTSNLEILGDLIAL
                     AGALAYSAFLIILRLKLGGQTDSQRDILVYVCLGICTILFVTPLLGIADLIGLEKFSF
                     PPDRTTLLIILLCGFLNAVSDYCASVASLLTSPLITSLSLSMAIPVSMLCDSFFFHTI
                     HTSATYYLGIILIFSSFIFTSLSDQEDVINTAVKEAVSEAVNYNDALSPILTPHLSIT
                     SPFSSPALLTYDEIPGFNIDNSSNIAVSQQQLVVAGGHNRKYFIREVKT"
     gene            complement(<94557..>97949)
                     /locus_tag="FOA43_002686"
                     /db_xref="GeneID:62196087"
     mRNA            complement(<94557..>97949)
                     /locus_tag="FOA43_002686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922970.1"
                     /db_xref="GeneID:62196087"
     CDS             complement(94557..97949)
                     /locus_tag="FOA43_002686"
                     /note="BUSCO:EOG09340IKT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778898.1"
                     /db_xref="GeneID:62196087"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR036598"
                     /db_xref="InterPro:IPR037239"
                     /db_xref="PFAM:PF01237"
                     /db_xref="PFAM:PF15409"
                     /translation="METFEVRSKSFTIKWVDAPDNSVIRWELKPLKRSINLGIYRHNK
                     PEPPTTASSSQSRDRSVTELSNESTGSLSTHAVDSVTDNNAADSFSMSENLSVDTVNR
                     VPRKMFNAMHENFFSSDPMAATASNPAIAITRAATSTAMTSLTTISALSNTQNGAVDG
                     DSANKPTISSKRKSSSASLASKNRLRRRASSRSSIRSNDGTDSNLDEHIDHHLIREKW
                     VGRCAGDEFVSDAFHVTSGGLFAFVFDNTFSRTKAKKVMFGQWVESEKRSNRSFKNDF
                     GVVPTPAAVADLSIDSLSSSIHPATSVSSRDQQQALEDAETTLDSPISVHTRKLRFQL
                     PEEKQLGKNTFMIRLKGVQYLQGFMKKKRRRAGGNFAKRFFNLNFKYAVLDYYADETS
                     NNIRGNMLVTQTVISADPKLQMLYLDSGMEQWVLKALSQEDFDVWVQAFNYIKRRDKK
                     IRMEGTSVAIDEPMSPYSDQLSYFDDAGVTADEYLDAISGGRSLHDHAAIQKHHAQLN
                     DAFESLQNLADNAMELARCQQQVINRLEESSTSASNSCSEPHRRRSNSLFWKKGHRNS
                     SDTELARTTSNSVSVGPNQFTQSTDSLQSSMTKQGKSQSLLSVIDQLQAGITDIHADC
                     NALLSRMSSIKHPLTRTTTAATSYISQDFFDAQEVIQEMNDSVMIVSDDERAPEQPSK
                     TYDEKDNIFETQLSTPVSSTSLSSDMEEDEDEQSSQLIRSVKHLSVLQEEALPEKPHD
                     MYPLTFDYDISYRKDVPPSVAEPPSLISIFRKSLGKDLTSITMPIASNEPLSFLQKYA
                     ESYEYADLLNDAYNSPVDNGERILKVACFAISYLSSYRSNVRSLRKPFNPLLGETFEM
                     VRPELGIRLISEKVVHHPVIFAAYVESEHWSIGHCFSPEQKYYGKTAEINIDGKVCLQ
                     YDLGETYEWTQPTTVLRNMIAFTGEKYTEPVDKMTVRCNSGYMATVTFVPERSHFTNR
                     RSEKVVVKVTAPDNKKLVKTVSGTWTSSMQFDDTGYPVWQVHKLVSDYENKYGFTEFA
                     ASLNDMTTIDEECAPTDSRRRPDQKMYEQGDVEHAEELKLDLEQRQRLRRQDEDGAPT
                     VHNPVFFKKAGPGRLDYQYIQGEESYWERRKGQKWNGLIKLW"
     gene            complement(<98498..>99995)
                     /locus_tag="FOA43_002687"
                     /db_xref="GeneID:62196088"
     mRNA            complement(join(<98498..99600,99992..>99995))
                     /locus_tag="FOA43_002687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922971.1"
                     /db_xref="GeneID:62196088"
     CDS             complement(join(98498..99600,99992..99995))
                     /locus_tag="FOA43_002687"
                     /note="CAZy:GT50;
                     BUSCO:EOG0934272Q"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778899.1"
                     /db_xref="GeneID:62196088"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="PFAM:PF05007"
                     /db_xref="PFAM:PF06728"
                     /db_xref="PFAM:PF09594"
                     /translation="MDVDYYVFTDAARFIYNGQSPYLRATYRYTPLLGWLLVPTAWQA
                     ANDYWFEFGKAVFVVCDLITGYLILRLLILMHKDTNWSLLWFFNPMVITISTRGSSES
                     LLTAVVMAAVYRAVQRKNWQAGLWLGLAIHLKIYPFLYVPSILLFIDAGQPLWKPITR
                     ERVKFLLGVLVTFCGLTYLMFHWYGQVYLDEAFLYHLIRLDHRHNFSIYNISLYFTSF
                     TGKSALFDGGFTLEKMAFLPQLALSAVLIPLRLCYGNYKPEVLVSSLFIQTFTFIAFN
                     KVITSQYFVWFMCFLPVYLSLSTISLFKGVILLAGWIITQALWLYYGYRLEFRGEFDL
                     FYSGLWTSATAMFIWNCVLIAEFIRDVTRKVKRD"
     gene            complement(<100002..>101245)
                     /locus_tag="FOA43_002688"
                     /db_xref="GeneID:62196089"
     mRNA            complement(join(<100002..100420,100879..>101245))
                     /locus_tag="FOA43_002688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922972.1"
                     /db_xref="GeneID:62196089"
     CDS             complement(join(100002..100420,100879..101245))
                     /locus_tag="FOA43_002688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778900.1"
                     /db_xref="GeneID:62196089"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="InterPro:IPR035987"
                     /db_xref="InterPro:IPR036967"
                     /db_xref="PFAM:PF00410"
                     /db_xref="PFAM:PF00411"
                     /translation="MGRTSVLADALKSINNAEKTGKRQVLIRPSSKVIVKFLRVIQKH
                     GYIGEFEYIDDHRSGKIVIQLNGRLNKVGVIQPRFNVKIGEIERWTDNLLPARQFGYV
                     ILTTSAGIMDHEEAKRKHVSENVTLGPQAKGSQEVFGVAHIYASTNDTFVHVTDLSGR
                     ETISRATGGMKVKADRDESSPYAAMLAAQDVAAKCREVGITAVHVKMRATGGTRAKTP
                     GPGAQAALRALARSGLKIGRIEDVTPIPSDSTRKKGGRRGRRL"
     gene            <101624..>101911
                     /gene="RPL39"
                     /locus_tag="FOA43_002689"
                     /db_xref="GeneID:62196090"
     mRNA            join(<101624..101629,101762..>101911)
                     /gene="RPL39"
                     /locus_tag="FOA43_002689"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_038922973.1"
                     /db_xref="GeneID:62196090"
     CDS             join(101624..101629,101762..101911)
                     /gene="RPL39"
                     /locus_tag="FOA43_002689"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_038778901.1"
                     /db_xref="GeneID:62196090"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="PFAM:PF00832"
                     /translation="MPSNKSFKTKQKLARHQKQNRPLPQWIRLRTNNKIRYNAKRTHW
                     RRTKLHL"
     gene            complement(<102451..>103027)
                     /locus_tag="FOA43_002690"
                     /db_xref="GeneID:62196091"
     mRNA            complement(join(<102451..102951,103022..>103027))
                     /locus_tag="FOA43_002690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922974.1"
                     /db_xref="GeneID:62196091"
     CDS             complement(join(102451..102951,103022..103027))
                     /locus_tag="FOA43_002690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778902.1"
                     /db_xref="GeneID:62196091"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="PFAM:PF03208"
                     /translation="MNFSSMSNAFSMENIKQSYSTLQNKFSTVRPAQEFFDVRRLSKP
                     ADFNEVQQRVSYNVSYFQANYISVVLLLSVYALITNGLLLFVLLFSGLGVYGISKLHG
                     EDLKLPIGSLTTSQLYTGLLIIALPLGFLASPISTMMWLIGSSAVAVVSHAALMEKPI
                     ETVFEEQV"
     gene            complement(<103233..>104369)
                     /locus_tag="FOA43_002691"
                     /db_xref="GeneID:62196092"
     mRNA            complement(<103233..>104369)
                     /locus_tag="FOA43_002691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922975.1"
                     /db_xref="GeneID:62196092"
     CDS             complement(103233..104369)
                     /locus_tag="FOA43_002691"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778903.1"
                     /db_xref="GeneID:62196092"
                     /translation="MLLRRFLSFSTTLNPSRLSVCPHHLSVLLLTTPSQLSNSIEHAS
                     VIVKSTSTTAVVACIDTILGHRNAVSQLWFRNPIQISSYLPLPEDIDNNRGLKSSFSD
                     AAPVQLDKNWKDTSKSTQLLIGFGSHSIQVNLANTLFSNGEQSTCFFIQPNNHPGNWI
                     NLAEISIQLPMDEHADEDYSITNLNKLKELAFEDTNNPTASLYQISSYTSNMIETIND
                     RPAADYLINNRKIQKTKKELYLQLINQTQPEKARPFSSLKRSPNNDMYQLVVGGLGWG
                     EKQGMIVLDPAVGEVGHRYCRLYQYDPSKSIQQVKSTEGQVKLRVQCSEPESGYHDYD
                     QQDSPVPIDGVAGLGSESGFLMDGVWHKCRGEVNEVAIKQNNKD"
     gene            <105820..>107754
                     /locus_tag="FOA43_002692"
                     /db_xref="GeneID:62196093"
     mRNA            <105820..>107754
                     /locus_tag="FOA43_002692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922976.1"
                     /db_xref="GeneID:62196093"
     CDS             105820..107754
                     /locus_tag="FOA43_002692"
                     /note="MEROPS:MER0002281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778904.1"
                     /db_xref="GeneID:62196093"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027268"
                     /db_xref="InterPro:IPR034015"
                     /db_xref="InterPro:IPR038502"
                     /db_xref="PFAM:PF01433"
                     /db_xref="PFAM:PF09127"
                     /db_xref="PFAM:PF17900"
                     /translation="MSTYPNISSHLQKILAPHFPKNGSPEIDPSTNSNYGHFKVNHST
                     LDLVVDFHKKRLIGSVTHEIETLKPAKEIILDSSFLDVKKVTVNDKDTSFQVKQRKEP
                     LGSPFVIYYKSNANDSFTLKIYYETTEKCTALQWLEPEQTDGGKLPYLFSQCEPTHAR
                     SFFPCFDTPSVKSSFTYNITSPLNVLVSGLLVSKEPSATDASLFVYSYKQPVPIPSYL
                     ASIASGNIVGAPIGPRSTVYSEPSFIDKCQYEFEADTEKFIKAAEDLVFEYEWKQYNV
                     LILPQSMPFGGMEHPNCTFATPTLVSGDRENVDVIAHELSHSWSGNLITNCSFEHFWL
                     NEGWTVYLERRIVGKIHGDKFRDFSSIIGWTDLVNSIEAMGDTAERFSRLVQDLKDGI
                     DADDSFSTVPYEKGSNMLYTIEKTVGGKENFDPFIKYYFSKYKYQSLDTYEFLNTLYG
                     FFKDKKDLLDTIDWKIWLFEPGLPPKPKFDTQMVDECYNLASKWISVASKYPEELKSV
                     FKAADIESFSANQNLVFLDTLVGSDGENGFKWNSTNGKEAIEIMGRVYAKYAKSENAE
                     VLFRWFRLQLTGRIKPSYQKLADWLGTVGRMKFVRPSYVLLNKVDRELALKTFQRWEK
                     GYHPICKALVKKDLGLAEII"
     gene            complement(<107791..>110310)
                     /locus_tag="FOA43_002693"
                     /db_xref="GeneID:62196094"
     mRNA            complement(<107791..>110310)
                     /locus_tag="FOA43_002693"
                     /product="DNA replication licensing factor MCM7"
                     /transcript_id="XM_038922977.1"
                     /db_xref="GeneID:62196094"
     CDS             complement(107791..110310)
                     /locus_tag="FOA43_002693"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM7"
                     /protein_id="XP_038778905.1"
                     /db_xref="GeneID:62196094"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008050"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="InterPro:IPR031327"
                     /db_xref="InterPro:IPR033762"
                     /db_xref="PFAM:PF00493"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF14551"
                     /db_xref="PFAM:PF17207"
                     /db_xref="PFAM:PF17855"
                     /translation="MATLAAAPVTGAILPAVQMNINYADLKEQVKDFLLHYKSSASLE
                     EAKEDNNDGIYDHSVNELRIDEEDIEGIGKGPKYMYLLQKVANRQLSALSIELDDIKM
                     YEETQKPGGAGPSSHSAGSYGSRLTDIIVKNTEHFVELFSQVIDEIMPQPTVNISHKD
                     DVLDVIIHQRKLRNARLIEERQRELVSSGLVGNSAEQQRAENAAASAVNDDSMDLFPP
                     QLTRRYNLYFCPLTGATLKGPAKALAVREVRGSHLGTLITVRGIVTRVSDVKPAIQVN
                     AYTCDTCGYEVFQEVTSNTFTPLTECTSPQCMSNQHRGRLFPSTRASKFMPFQDVKIQ
                     ELASQVPVGQIPRMLNIHVTGDLVRSMDPGDIVDVAGIFLPLPYTAYKAWKAGLLTET
                     YLEAQSVKQHKRKYETLGLTSEAEEKVAEIQSEGRVYERLASSIAPEIFGYLDIKKAL
                     LLLLVGGVTKQMGDGLRIRGDINILLMGDPGVAKSQLLKAIVKMAPRGVYTTGKGSSG
                     VGLTAAVMKDPVTDEMVLEGGALVLADNGVCCIDEFDKMDEGDRTAIHEVMEQNTISI
                     SKAGITTTLNARASILAAANPLYGRYNAKLSPFQNINLPAALMSRFDIMFVILDKPDR
                     EQDERLAEHVAYVHMYNHQPETDLQPLDATTMRQFISMARRFRPVITAEVRDYVVQQY
                     IKMRKESKKYENSKFFFGHATPRTLLGILRMSQALARVRFSNEVDVSDVDESLRLVNV
                     ARQSLSDNSDNSEDAKESDASKVFSLVREKIQDELKNNREDEKLVSIEVLRDACIGKG
                     FTEDLFKECIYRYQALNLWHLMDDKESLAILGDFDGDVDMN"
     gene            <112586..>114280
                     /locus_tag="FOA43_002694"
                     /db_xref="GeneID:62196095"
     mRNA            <112586..>114280
                     /locus_tag="FOA43_002694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922978.1"
                     /db_xref="GeneID:62196095"
     CDS             112586..114280
                     /locus_tag="FOA43_002694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778906.1"
                     /db_xref="GeneID:62196095"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MLLDTDLESPMKALRVNEVTSGDYGSDSDSMAARLGASIDPLPD
                     EDSTSTMMALEDERPSLMVIFLTFLASISGFMFGYDTGYISSALVSIGDSFGAELTYS
                     EEQLITAATSLGAFITAVISGIIVDYFGRKPVLMVSNILFVVGSIIQCAAHGVWPMIV
                     GRFIMGFGVGTGSLIAPLYIAELAPSSFRGRLVVLNCLGITGGQLIAYGIGAGLDSVH
                     NGWRIVVGLSIIPPAVQFVSFLFLPDTPRFLIMKNDIDKAEKVITRIYNGATPELVHE
                     KIREIQEANAGIRGDSVLQRYWNSVLEIHRVPSNFRALFLACSLQAIQQFTGFNSLMY
                     FSATIFKAIGFNNSTAVSLIVAGTNFFVTILAFFVIDKVGRRRMLMLSLPFMMLFLAL
                     CAIAFHFVDIKFENHAAKLNGSVSSWGIVIIVFMICFVASYAIGIGNVPWQQSELFPQ
                     SVRGLGASYATATNWVGSLVISSTFFTMLENITPTGTFALFASLTAVSIVLIYFCYPE
                     LSNLSLEEVQMVLTGGFNIKTSEKLAKKRKRQHELHRERMSKKAEELIEDEHFDSI"
     gene            <114589..>115749
                     /locus_tag="FOA43_002695"
                     /db_xref="GeneID:62196096"
     mRNA            <114589..>115749
                     /locus_tag="FOA43_002695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922979.1"
                     /db_xref="GeneID:62196096"
     CDS             114589..115749
                     /locus_tag="FOA43_002695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778907.1"
                     /db_xref="GeneID:62196096"
                     /translation="MSFIPRLRRPLSNDTSSKLKDKVRFTGTLSDEEKRRRKADAYDY
                     LRSRSMNESDSEDTITNRLRSSNSPRHQLRSILKPSSTRRTYELMGESPIRHISHPDR
                     LGSERVLESVRREASKRSPLTRRIDSNYRIKKVEHHGLLNSLSNVGSKLLSSVLFNEK
                     GEDEKLHNTSTRLTRWNREELGKMKENEDLERSIREKKIALDRLNRDLESRSLERLGP
                     NSLEQKVEGIEKKKQDLRQDDGDERVMGELASIREDLLNMRKREESSRLKFESKMEEL
                     EMEAEINEKHYKRMVKELEEKRREVDKQKDELIKELRKMKKRRREKYEGESEESDSDD
                     DRETKRRRVRVGTDLREKLERMTRKMKSMEREVSRNEQMAKRTEEMVKTNES"
     gene            <116008..>116745
                     /locus_tag="FOA43_002696"
                     /db_xref="GeneID:62196097"
     mRNA            <116008..>116745
                     /locus_tag="FOA43_002696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922980.1"
                     /db_xref="GeneID:62196097"
     CDS             116008..116745
                     /locus_tag="FOA43_002696"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778908.1"
                     /db_xref="GeneID:62196097"
                     /db_xref="InterPro:IPR031452"
                     /db_xref="PFAM:PF17056"
                     /translation="MKLSGFYLLTLLGFSLVDVVHAIAADDAIAKAVADNAATTATAV
                     TTAITAAANAATTATAVTTPTTAAVNAATTATTAVATAATTPTTTAVNAATTPTTTAV
                     NAATTPTTAAVNAATTATTGITTSTTAGVAGTALTTTSKTAATTTLDTSLTTTPTTTL
                     TTTPLTTIDTSTTATGTSAVAPTTLWVTVTVSGGITTVIPSMYTQKFQSMYETMAVPS
                     TGLIGLGTISGTVGSIKEYRTVTISTS"
     gene            <116889..>118187
                     /locus_tag="FOA43_002697"
                     /db_xref="GeneID:62196098"
     mRNA            join(<116889..117005,117098..117111,117386..>118187)
                     /locus_tag="FOA43_002697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922981.1"
                     /db_xref="GeneID:62196098"
     CDS             join(116889..117005,117098..117111,117386..118187)
                     /locus_tag="FOA43_002697"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778909.1"
                     /db_xref="GeneID:62196098"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR013083"
                     /translation="MNSPNEDGSSTEPRGFDVVDSEPVVDMRSLEYVAKYDHLVTYGE
                     FVCELVGMDGKPCKKLSERRYLEKSDKKEAFCPHIEYPCEKCEEMVSLVNQEWHLSQE
                     CTKNMVKCHGCNLEFPQKDFVKHEKYCQKIYVKCPGKKFGCSWRGSKEILQRIHLQEC
                     VFVKLSEYLTSQETKMDDLTGENNLLKSELSVLLDSVIQGRVTNLGFPLELEEVSCNL
                     HGSENEILGGMEEDYAQLITDFERLRLNAQKAKRALGELEASKQMISKLATDNLQMKE
                     ELNSQRLVINSIRQQLQFMVLDRRRNGTEDEPKL"
     gene            <118301..>119257
                     /locus_tag="FOA43_002698"
                     /db_xref="GeneID:62196099"
     mRNA            <118301..>119257
                     /locus_tag="FOA43_002698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922982.1"
                     /db_xref="GeneID:62196099"
     CDS             118301..119257
                     /locus_tag="FOA43_002698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778910.1"
                     /db_xref="GeneID:62196099"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="PFAM:PF00432"
                     /translation="MSLLIDKHVDYIKNLFRNPVYLEHWMAEHLKMNALYWGIGALFL
                     MHHEDEFKKEDVVSFIMNCYDANCGGFGSAPRHDAHLLSTLSALQVLKLYDSLDALDK
                     DKREKTIQFIVSLQLDDGSFEGDRFGEVDTRFVYTAIQSLAILETLEPKVVEPAVDFI
                     LQCQNFDGSFGIMPGAESHAAQAFTCIATLAICNALDRLPNKETLEWWLSDRQVANGG
                     LNGRPEKLPDVCYSWWVLSCLGILQKLNYVDGEKLVQFIMNSQSDTGGISDRPGNECD
                     VYHTYFGLAGLSLLGKYGLASIDPIYALPTAITKTIKKYPYK"
     gene            complement(<119258..>121393)
                     /locus_tag="FOA43_002699"
                     /db_xref="GeneID:62196100"
     mRNA            complement(<119258..>121393)
                     /locus_tag="FOA43_002699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922983.1"
                     /db_xref="GeneID:62196100"
     CDS             complement(119258..121393)
                     /locus_tag="FOA43_002699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778911.1"
                     /db_xref="GeneID:62196100"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="PFAM:PF04042"
                     /translation="MEVDRPLVLPIALKPSNLRPIAYRVLTKKYGLNIKSTALERLSD
                     YIGRNFGNEWRGPTTVSFLEQVGRMWKDQNRGLFINGDGVDELIKEITVKNRKKNKSA
                     NVSRTKTKMTEETSKARGFEVYDDLKAAQGIEEIGGSQATQATQATQETGGTQETQET
                     QETLNTQILNGSQMDIDEDEAIDWKDFFKVIDPSRYTKFKYDARRKQFELSRHDGDAK
                     RIILPTAEDTVNFHINKFHLLKEKLLRNEHFQPSTFSSMNSITGSIHPGLETQQITPI
                     KNLLGRHGQNFALFGLLTINAMGLWQLQDDTDAIVLELSQCIFPTNCYIIPGNYLICD
                     GIYSNSGKFYVSSIAPPPPEDRDISLNALGNLDFSGIYAQNGGRIDGAIKRRLPLLER
                     KFPDHKILFLGGDIFLNDLEILEALKRLFKALTEEIEESGSEPLAIVMPGSFVEKPLD
                     VTEFSSYSHITSSGLYKSYFDSLASILEKFPKICSTTKFVLLPGDKDPWSSMVTKNAN
                     AIWPKFRIPSVFGTRLRRGVKNIDWASNPCKMNYLSHDVTIVRDDIGERFRRNDITYV
                     SKQMEEQEVNNKQNNATEKLEKETQTETDNDDDDEEIILEIDKMTKPKLTPEQIESRK
                     VVKTLLDQGDLSPFSVQTRPVLSNYWPLLSLIPLPDLLILVDPSTPHFDLIYENCHVL
                     NPGKFYKDGKISYMEYTPSTRKARLRQLS"
     gene            complement(<121754..>124093)
                     /locus_tag="FOA43_002700"
                     /db_xref="GeneID:62196101"
     mRNA            complement(<121754..>124093)
                     /locus_tag="FOA43_002700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922984.1"
                     /db_xref="GeneID:62196101"
     CDS             complement(121754..124093)
                     /locus_tag="FOA43_002700"
                     /note="CAZy:GH18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778912.1"
                     /db_xref="GeneID:62196101"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="PFAM:PF00704"
                     /translation="MKFCKTAMAAIAVGTASASCLSGEVAVYWGQSEDTATLSDTCDD
                     DSIDIVILSFLTEYLDPLAINLWPAECYPDTSSGVWSYACDGTSGSTDVVSGIKYCQN
                     KGKKVMLSIGGSTGSTVLASDEEGVEFAEALWKYFGPQNDTSIVRPFGDAVLDGFDFD
                     VEGGTGVGLAATANELKVLFAEDSSKQYYISAAPQCPENDAHVGDLLDNGYVDYAFIQ
                     FYNNECSLSGTDFNWDWWANWATTESYNPDIKLMVGLPGSSAAAPSGGYVTPTVVEEV
                     LQDDVLPNSANFGGIMVWNAYYGSNNVIDGTSFIDSMADLLNQVICSEETASTSSVST
                     ASSISTASSVSTASSVSTESSLSTASSAASSVASSVASSVSTESSLSTESSVASSVAS
                     SVASSISTASSVSSIDQNSSSAILSTSSSITTSETAELSTQTSSYYSSSEYASTSSGL
                     SLSVEPTFSIESSTQPSSTFSFLTVTVSGNSSSSSILSNHFSNTTVEASTISSETVSV
                     APVITGIYDSSSLSYSLASQIPSFYTNSTESIPATSSDSSILSLSSSTDPSFSFTSDS
                     SAASSDPAVQYSSTASALDTLAGYSEYSTDAEMASMTSDYAAYTTGGRISTPTSDSIT
                     EVSTDAETEVIKPAYDTYTLTTNNVTIEIITECTTEPSTDIPASSSSSPEESKISISS
                     DETSTIIETITTVTDGQTSVFTTTISECSTDATSTLTSSAPVSTSTNAMSTSLTSSTT
                     SVGTLPYIQTYQGAAVGNYDDVSNYGIFAVVFAAFALLF"
     gene            complement(<124918..>125682)
                     /locus_tag="FOA43_002701"
                     /db_xref="GeneID:62196102"
     mRNA            complement(<124918..>125682)
                     /locus_tag="FOA43_002701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922985.1"
                     /db_xref="GeneID:62196102"
     CDS             complement(124918..125682)
                     /locus_tag="FOA43_002701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778913.1"
                     /db_xref="GeneID:62196102"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF10294"
                     /translation="MSDDDELVPIQMFAEPESYVVPTPKGKEITYHLSGSGEPVYVNL
                     LGSSPLYGHILTNACKYLAGYLENHTEDLVKTKNVLEYGAGGALPSLICAKSGASMVV
                     ATDYPDADLISNIQKNIDQNHVNANCKTVGFIWGNDPKEIMAQLDSTHAVTFDTIILS
                     DVIFNHTEHYKLLKSCKQMLTPITGKVLVTFSPHRPWLFKEDMDFFNKAEEQDFAFVP
                     ELVEMKHYLPLFKDDKDESTKEIRSRVYFYMLHASK"
     gene            complement(<126930..>127685)
                     /locus_tag="FOA43_002702"
                     /db_xref="GeneID:62196103"
     mRNA            complement(<126930..>127685)
                     /locus_tag="FOA43_002702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922986.1"
                     /db_xref="GeneID:62196103"
     CDS             complement(126930..127685)
                     /locus_tag="FOA43_002702"
                     /note="BUSCO:EOG09343PRK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778914.1"
                     /db_xref="GeneID:62196103"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR019770"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="PFAM:PF01652"
                     /translation="MSEEELNKKTQELSLSEKAEDSEDATKAEEIPESEGAPETGAEE
                     ETKETTKPGESEEKKEVTVLENKEEFTVKHPLNSKWTLWYTKPAVDNSESWADLLKPI
                     VSFNTVEEFWGVYHAVPKAADLPMKSDYHLFRDDIKPEWEDKTNAEGGKWSCQIRSKK
                     ADIHDLWTRSLLSVIGETIEPDEQNEVNGVVLNVRKNGFRIGLWTKTCNRAALKPIGE
                     RFKKVLKLSDNETIEFMSHKESGDRNAAPLIIM"
     gene            <127914..>128531
                     /locus_tag="FOA43_002703"
                     /db_xref="GeneID:62196104"
     mRNA            <127914..>128531
                     /locus_tag="FOA43_002703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922987.1"
                     /db_xref="GeneID:62196104"
     CDS             127914..128531
                     /locus_tag="FOA43_002703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778915.1"
                     /db_xref="GeneID:62196104"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="PFAM:PF03371"
                     /translation="MNIITDRGLAQNTQKLHGVNPVLLIEKILRERILDSLYWQKDCV
                     PLNILTLLDETVLHVHLLGTYSNTGRTRPTRFICITLKLLQLQPRDDIVDYLTVQADF
                     KYLTALSALYIRLTRPSVQIYEKLEPLLNDRRKINYYYDNEARVMHMDEYIDGLLTQN
                     KFCDLILPRLISRDQLEDQELLEPRQSLMQSVFDEEVQREEEKTV"
     gene            complement(<128575..>128907)
                     /locus_tag="FOA43_002704"
                     /db_xref="GeneID:62196105"
     mRNA            complement(<128575..>128907)
                     /locus_tag="FOA43_002704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922988.1"
                     /db_xref="GeneID:62196105"
     CDS             complement(128575..128907)
                     /locus_tag="FOA43_002704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778916.1"
                     /db_xref="GeneID:62196105"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="PFAM:PF01423"
                     /translation="MKLVRFLMNLPNETVQVELKNGTVIIGDIISVTPTMNMNLKNVK
                     MTVRDRNPTQLEYVNIRGNQVRLVILPDELNVDKVLSESMVRPRRTPSTLPPRVVTKE
                     RVPRRRAF"
     gene            <129180..>130133
                     /locus_tag="FOA43_002705"
                     /db_xref="GeneID:62196106"
     mRNA            <129180..>130133
                     /locus_tag="FOA43_002705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922989.1"
                     /db_xref="GeneID:62196106"
     CDS             129180..130133
                     /locus_tag="FOA43_002705"
                     /note="BUSCO:EOG09343O6T"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778917.1"
                     /db_xref="GeneID:62196106"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="PFAM:PF02544"
                     /translation="MVNLLIIPRSTNLKKINCDTEPNTRVQAIINAYAKVNNIEPNRV
                     KLCFTFDGDDTTTKKPSRKTLKNYETLEENGLDFSKSSTLSVGAKDVGRQIGWRTVYF
                     IEYLGPVIIQSLIYFGYYDATYNTITQKAAYILTLLHYLKREYETLFVHLFSSDTMPL
                     TYLFRNCGHYWVFNGLLTAFCVYSSQSSFYSGYQKWLYHVEDRPLKQVEIFAGCWLVC
                     EICNLYCHYMLRMLRSDGSREHKIPHGFMFEYVSFPNYFFESCGWLVFAIMVNNWSAY
                     LFFVIGTGTMMMWAKQKHSRYQEEFGDNYPKERKAMIPFII"
     gene            <130388..>133786
                     /locus_tag="FOA43_002706"
                     /db_xref="GeneID:62196107"
     mRNA            <130388..>133786
                     /locus_tag="FOA43_002706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922990.1"
                     /db_xref="GeneID:62196107"
     CDS             130388..133786
                     /locus_tag="FOA43_002706"
                     /note="BUSCO:EOG09340W1W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778918.1"
                     /db_xref="GeneID:62196107"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="PFAM:PF01699"
                     /db_xref="PFAM:PF03733"
                     /translation="MSSQPPFDPLLPADPKDRTAKNPRSISQPASQLAISSQPAPSTA
                     APTALSSYGSSQLPVPQLHHQNSQNSQLHPPRLQKSSRSIRSTPLPPNHILVKQHSTH
                     PPSYHRQFVLLRDRDKSANSHSPLLGCTSPNVSASGGTATPGASTAASLGPAMDSSMG
                     HGTFISTGSLPSSPLLNATVKTNKSKHPKRESSRFIFSVDDNEDEIEEDLSRDYIEGY
                     GEALRQRRRPQRTLSAQQPGDILPHSSIADLKARPKEVTATAPGSTTTGGDDNLTVLN
                     NSDDTTLRKMPSRYSVYDQSSEIDRPSEQADDFLTPAGRVSTVPLDMELEDEDYLDNE
                     SISSNESFTLRERQDAINETHPFGIRIWKPAVYKKHRSVEEAAEHDIHSTPKTAGTVG
                     KSVKLFNFLWTITFGLLLFLICIVLSSIIAICSTFTSHSTDESFEYAKLYFRLGLYFF
                     YPFGKIVFLNSEKNYLEEDAHIGTSLAEFRRWRAQNEGRLFFSAPNAMMGHASESTPL
                     STTSSNSYFLNDGNENPNHNDDDDDDDDTTFKKRLFGRGQWNIGRVVFFILFYLVIIP
                     VTSFIAIIQWLGVFTIPMAKVLIILGNHIRRHPLALSFEPEKEYYEKRLNANPKNESI
                     LICTYRSFGLHYYKYTVDGTNIFFINMNFLVAFTILDFYFVKKSLGISTWITDPSLIF
                     VLCLTSIIPLAYFIGQAVASISAQTSMGVGAVINAFFSTIVEVFLYGVALDQSKGKLV
                     EGSIIGSILGAVLLLPGMSMCSGAINRKTQRYNPASAGVSSTMLLYATLVMLSPTILY
                     QIFGRYEERCESCAVEPNAGETCKRCHLVQSSVVIDKLFLDYLRPFSMICAICLFTAY
                     CIGLLFTLKTHAALIWSTPVTGDKEKHTGTTNTPDNSSVTSMNLSKRPSKLQISMEQS
                     ALSRNLTRNATSVQQQVQPKLALQLPQEAEGNHDAPNWSRTKSTTILLLATLTYAIIA
                     EMLVDVVDDVLKKFPINAKLLGLTVFALVPNTTEFINAILFAMHGNVALSMEIGSAYA
                     LQVCLLQIPIIVVYSCWSGVKAGIFDITKIFTLIFPRWDFVACLMSVYMFTYIYAEGK
                     SNYFKGSILILLYISIIFGFYVAITIDSKYEEDILDVVQDVRWR"
     gene            complement(<133820..>135133)
                     /gene="ARG8"
                     /locus_tag="FOA43_002707"
                     /db_xref="GeneID:62196108"
     mRNA            complement(<133820..>135133)
                     /gene="ARG8"
                     /locus_tag="FOA43_002707"
                     /product="acetylornithine aminotransferase"
                     /transcript_id="XM_038922991.1"
                     /db_xref="GeneID:62196108"
     CDS             complement(133820..135133)
                     /gene="ARG8"
                     /locus_tag="FOA43_002707"
                     /note="BUSCO:EOG09342EGQ"
                     /codon_start=1
                     /product="acetylornithine aminotransferase"
                     /protein_id="XP_038778919.1"
                     /db_xref="GeneID:62196108"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /db_xref="PFAM:PF00202"
                     /translation="MLRFVFRPFSLLAQKRLLSTSKAVLNAALGSKSFIDSNGKYAVT
                     TYSRPTIVLEKGKGPYLWDLEGKKYIDFFAGIAVTALGHSNPEVAKIMFDQAKTLVHS
                     SNLYHNLWTLELSKLLVEKTKQFGGMYNASKVFLCNSGTEANEAALKFARKYGTSISS
                     DKTEFITFENSFHGRTFGSLAVTPNPKYQKPFAPLVPGVSVATPGDISSVESLISDKT
                     CGVIIEPIQGEGGVHPQSTEFLVALKKLCQKHKALLIYDEIQCGLGRSGKLWAHSRLP
                     NEGHPDILTMAKALGNGYPIGATMITEDIESVLKVGDHGTTFGGNPLGARIGCYVLSQ
                     IADKEFLDNVEKKSELFKVKLNELKEKFPQHIKEVRGEGLILGVECNENPSPVVERAR
                     QLGLLVITAGGNVIRIVPALNIDDNVIIDGLKVLEKAMEEIYSNN"
     gene            <135492..>135986
                     /locus_tag="FOA43_002708"
                     /db_xref="GeneID:62196109"
     mRNA            <135492..>135986
                     /locus_tag="FOA43_002708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922992.1"
                     /db_xref="GeneID:62196109"
     CDS             135492..135986
                     /locus_tag="FOA43_002708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778920.1"
                     /db_xref="GeneID:62196109"
                     /db_xref="PFAM:PF18126"
                     /translation="MSTRFFNLNAQQAFKKLPMKLQNFFTRYPPSPIRSYANKPTLTN
                     APDANPFLSNIHPVTKTFHDPIYSLRRQSELYKLAYKFGIVDLMPSLANGKKLFAEKY
                     ESKPVLRGVLRPKGHKWERTYDDRMKRLEEGMAKADDVLIQYRGSKYKKRLEKRKEDK
                     RTWF"
     gene            complement(<136079..>136921)
                     /locus_tag="FOA43_002709"
                     /db_xref="GeneID:62196110"
     mRNA            complement(<136079..>136921)
                     /locus_tag="FOA43_002709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922993.1"
                     /db_xref="GeneID:62196110"
     CDS             complement(136079..136921)
                     /locus_tag="FOA43_002709"
                     /note="BUSCO:EOG09343HWV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778921.1"
                     /db_xref="GeneID:62196110"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="PFAM:PF13741"
                     /translation="MNAVKNAGEVLQRTSEYLESGLVTKQPAWYRVLAYHPPVKNHTK
                     TIRPLVLRKIKEEEVSTLKKIMSHNKGDLFYKTRLRPKHMAANFLKPQKLHFIEDDLR
                     DLFYKQHPWELADPKSLIENENSIDLEKLDWSTMRQYTKKLDGESVVQRTIYLMKNED
                     QLLLNAFEQSKYEYYRLKIEDETEINVAEEQGEMFGAVYGKSMVEYGFDKEMEVLSKW
                     KEDAVEQTRVMEAKRSNSSSGGLARQENKGLEEDEGEEDATEETSGSNEGVTEEDLLK
                     ELRK"
     gene            <137570..>139126
                     /locus_tag="FOA43_002710"
                     /db_xref="GeneID:62196111"
     mRNA            <137570..>139126
                     /locus_tag="FOA43_002710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922994.1"
                     /db_xref="GeneID:62196111"
     CDS             137570..139126
                     /locus_tag="FOA43_002710"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778922.1"
                     /db_xref="GeneID:62196111"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MWDKDSTAPSATSGKLSSDDPESKLAVTTSCNSVPQILPTDKEL
                     DKVYRHLDYRIIPALWCLYFLTSFGSSAYGNTLTMNYETNHSLAASLDLKGHDLSTAS
                     ALYYVAYIIFDLPMNLIMTQLSPQVWLCRIVVTVGVCYLCYSALHNASGLIAIRFMSG
                     FAGSGTWPGMTYYISLWYPEQRTARRIGYYFTAAQLSAAAAGLVSAGFQKMDMVHGYF
                     GWKWLYIVYGTILIVDGISLIWWLPDRPQYLAVNSKWNRHILPKRFQKYFTPKQPLSH
                     EERQMHAVDMKQRYKRVSWGVKDLVRVLMDVRTWALIIMYFGVVGVGYGLAVFATTLI
                     KVNNPNLSGISISLLYAPIWLFDFASILIVTPFADRYKQKRYVFFCGAAVIIIVGLLV
                     TTYAKSSWSRWGGLLIAGFGLGPTVPICMTLASEIMTKIYGDVGCAAAAAIVSGLGNL
                     GSVTSTYALYSGWPSDEKNLYRNSNMILVLMCGVSIIACLALTLMRSHMSEEPIEVQQ
                     KKKQEQEQQE"
     gene            complement(<139204..>140238)
                     /locus_tag="FOA43_002711"
                     /db_xref="GeneID:62196112"
     mRNA            complement(<139204..>140238)
                     /locus_tag="FOA43_002711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922995.1"
                     /db_xref="GeneID:62196112"
     CDS             complement(139204..140238)
                     /locus_tag="FOA43_002711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778923.1"
                     /db_xref="GeneID:62196112"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01408"
                     /db_xref="PFAM:PF02894"
                     /translation="MPFKVAIVGTGIFATDAHLPALLKSEYFTPYSCFNRTRAKAEKF
                     AKVAGISKIYNSMEEAFEDPEVDIVDALLPVQYNLAAVRLAVKHKKSLCFEKPVAANM
                     KQAKEIVRLTKENPNLIIAIGENWSYLKAVPAMKEAISKIGKIYSFTYQSTGQFHFDG
                     KYLNTSWRLHPEHIGGYLSDGGVHQLALLTGVLGKVKKVNAHTKQVRQLSGDDDILYS
                     LLEMDSGLIGTFTYGSAFGNAEKRGMFEVMGDNGSVSFDFGPGHLEHLTLRVGGSTSH
                     SESYTKEIDIEGEDRTPLSEFTALGKALTTGDKSTIVATPEVVYHHLAVIDAALKSSA
                     KDGESVLVMQ"
     gene            <140621..>143203
                     /locus_tag="FOA43_002712"
                     /db_xref="GeneID:62196113"
     mRNA            <140621..>143203
                     /locus_tag="FOA43_002712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922996.1"
                     /db_xref="GeneID:62196113"
     CDS             140621..143203
                     /locus_tag="FOA43_002712"
                     /note="MEROPS:MER0000405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778924.1"
                     /db_xref="GeneID:62196113"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR038554"
                     /db_xref="PFAM:PF00326"
                     /db_xref="PFAM:PF00756"
                     /db_xref="PFAM:PF00930"
                     /translation="MDPEKSEQLGSQEFRGSSSTSALLRIRRSRGIISHTFSWLSLVS
                     LLLIYGSSLLLWQVNAFYRNFHELQHHQTSFSGGIIPHPHVYSGTKTPLSFQLVRNGT
                     FSPKYREIQWIRTPNSLTNDTGDYILTDDSAYILKSVQNSKFSKVLYRGTSIEYERKR
                     YSIEDIVFSDDLEHILIVCDKIHNWRHSFFAAYFIYDIKTSSIQALYDPDITLNSKIA
                     LAKWSPDSLSVAFVLENNVYLKKISDFVHPTLKQVTEDGGTDIFYGKPDWVYEEEVFE
                     SDTALWWSPNSKYISMLRINDTQVPIYPIPYFVQDDQSANDSYPELKEIKYPKAGYPN
                     PVVDFLVYDVEKSLVKSLKPEDSFYHDSEIPNETRLITEMVWVGDQQVLVKTTNRESD
                     VLKVFIIEADGDNLISILARSDNVKGQSWFEIEHNTLYIPKSGIRQEDGYIDVIDVDG
                     YDHLAYFSPPTASEPKALLTSGPWEVDGGAAAFDYVESRVYYLSTEKSSVERHLYSVD
                     LDGSNRRNITDVSEEGWYSVSFSKGSRYLLLNYDGPYVPYQKIVDLHNDTEEVLVSNT
                     ALRDRLQFYEVPESEFGELDLGDGVIVNYKQTFPLEFDPKKKYPLLFFVYGGPGSQLV
                     QKTYSMSFSSIVASELNAVVVTVDGRGTGFKGRAFRNVVRDNLSYYEVLDQISAAKIF
                     TEKEYIDSQRTAIWGWSYGGFMTLKTLEQDAGNVFKYGMAVAPVTNWRFYDSIYTERY
                     MHTPQENANYMNSSVHEPDHFKDVTRFLLMHGTGDDNVHFQNSMKFLDMMNQAGVENY
                     DVHVFPDSDHAIKYHNANLIVYDALFNWLKKAFDGMYTCYEAAATRSFSTEEYIDPEV
                     DLYG"
     gene            complement(<143229..>144662)
                     /gene="SLT2"
                     /locus_tag="FOA43_002713"
                     /db_xref="GeneID:62196114"
     mRNA            complement(<143229..>144662)
                     /gene="SLT2"
                     /locus_tag="FOA43_002713"
                     /product="Mitogen-activated protein kinase slt2/MPK1"
                     /transcript_id="XM_038922997.1"
                     /db_xref="GeneID:62196114"
     CDS             complement(143229..144662)
                     /gene="SLT2"
                     /locus_tag="FOA43_002713"
                     /note="BUSCO:EOG093422AU"
                     /codon_start=1
                     /product="Mitogen-activated protein kinase slt2/MPK1"
                     /protein_id="XP_038778925.1"
                     /db_xref="GeneID:62196114"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MNGNMDQYHVFRVFQQNFIVDKRFQLIKGLGQGAYGIVCSAKYL
                     DGEEGEDKVAIKKITNIFSKKILCKRALREIKLLHHFRGHKNITCLYDLDVVPDANGN
                     FNEIYLYEELMECDMHQIIRSGQPLTDAHYQSFVYQILCGLKYIHSADVLHRDLKPGN
                     LLVNADCELKICDFGLARGYSSDPAKNNGFMTEYVATRWYRAPEIILSFQGYTKAIDM
                     WSVGCVLAELLGGATIFKGKDYVDQLNQVLRVLGTPDEKTVESIKSPRARAYIRSLPY
                     MPRIPFETLYPNASPLALDLLGKMLTLDPQQRISVDQALEHPYLEVWHDPNDEPVCPR
                     KFDFSFEEVDDLQRMKKIIVDEVASFREYVRKPLEEQERIYQEEQEEQHQKQQEEKRQ
                     QQQFQQQQQNQSPGLPQQFQSPEQYDQSQFEYLQSPSHPSMVSSLQTPTDISRNDTDM
                     PPRPEEVTDNGQMDLEHELVYGADRYN"
     gene            <145154..>146659
                     /locus_tag="FOA43_002714"
                     /db_xref="GeneID:62196115"
     mRNA            <145154..>146659
                     /locus_tag="FOA43_002714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922998.1"
                     /db_xref="GeneID:62196115"
     CDS             145154..146659
                     /locus_tag="FOA43_002714"
                     /note="BUSCO:EOG093428M3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778926.1"
                     /db_xref="GeneID:62196115"
                     /db_xref="InterPro:IPR024738"
                     /db_xref="PFAM:PF12767"
                     /translation="MSVATESKPSVRKNDSAGVRVVDNAMRKEEIVTATGGTINPSVQ
                     GSTGESDQGPTRGSIRSSAKEYTSELHKRVNIDHLVVEFQKRLGKSWDQYQIAVSLFL
                     VGKLSRLELMEKLNSILDKTTVRFHNQLLLANLANCLRAEPSDGMSSAGFGSQSQQNK
                     KRKAGRSSQYEILKKDILSLSIRERKRLKNITRESGKKGMTNSTMALTRQAMLPKVPI
                     KTPKGDAPRTKESVGATVVQASKWAQDVANGIKAPLCSDSFELPEKDSLLTRMLGIAR
                     EHGLPGSVDPMAAQVLSVGLECHLKSIIETAIARVRKRKLETASTNHVSNKRKRVTLT
                     AEDLHDSMTFAPHLIDSYGSIYYMSDVLLKNDDDESIVQLQRQKQEMKESNDDATSPP
                     TKTKTIASTASTTTTTITTTAPQEHDNNDSHQDIKDGEATERSGTNNVTATKRPMMVH
                     PKKHSPISYLLRPKSHVDEKPQIPKPNLALSDPAIGTPNELNWLLNDLLAE"
     gene            <146872..>149930
                     /locus_tag="FOA43_002715"
                     /db_xref="GeneID:62196116"
     mRNA            join(<146872..148321,148381..>149930)
                     /locus_tag="FOA43_002715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038922999.1"
                     /db_xref="GeneID:62196116"
     CDS             join(146872..148321,148381..149930)
                     /locus_tag="FOA43_002715"
                     /note="BUSCO:EOG09340GNL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778927.1"
                     /db_xref="GeneID:62196116"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="PFAM:PF01851"
                     /db_xref="PFAM:PF17781"
                     /db_xref="PFAM:PF18051"
                     /translation="MAQIQDKSKHGDDTPKKAKKDASKKKKDGHKEEEELSEEDLQLK
                     SDLDMLVERLLGTQTDLYETALESMKKLIRESTSSMTAVPKPLKFLRPHYPALVALAE
                     KCTDQSLKDKLSDVLSILGMTYSETDGPQYKRECLKWRLRSKFDLSIGEWGHEYLRHL
                     SLEIGEAYQEALEGSGETSEEEKKKIGSAVDEESDTKKEVEKDATTLTTTATVAAVKG
                     VSSLPENSETLIKLSIIIVEYFLKHNGETEAVDLLLEIEQIEKLPQYVDKDTYGRVCN
                     YMVACVPLLAPPDDLSFLNTAFTIYLSNNQLPQALTLAIRLDDESLIRAVFDATDDEL
                     VQKQLGFMLGRQNSCFKVDNESVQECISNVKLSEYYKYLVGELNLLKPKVPEDVYKSH
                     LETSIFASTSRLESAKQNLAAAFVNAFLNAGYGTEKLIGDEKWVYRTKGEGMLSTTAS
                     LGMVNLWDTNEGLQVMDKYLYSEQIEVKAGALLEDYISAENKQDKRLTAAAITGLGIA
                     FAGSENEEVLNLLSPLVSEPSVSLEIQSLAALALGHVFVGTCNGDITSTILQALLEKE
                     PVELTSKWIRFMSLGLGLLYIGKYDQVDDVLETIEAIEHPIVKTLKVLVTICSYAGTG
                     NVLQIQQLLQMCNVEQKEEEEEEDEEEEDENENENENENENENENENENENENENEND
                     EEEEGQVNDNTESTESTEVKDDSKMDIDEAKSKIDSEESDESESSSKNAEEDDTYQGY
                     CVLGLALIAMGEEIGQEMSLRHFDHLMHYGTPLMRRAVPLAMGLVSASSPEMSVYDTL
                     SRYSHDQDLDVAYNAIFSMGLVGAGTNNARLAQLLRQLASYYINDQNGLFITRISQGL
                     VHLGKGTLTLSPFTVDRQSLSKVGLASLLTIAIALMDPRSFILDQNSSLLYYITSAIK
                     PRMLVTVDSDLKPTKVNVRVGQAVDVVGQAGKPKTITGWVTHSTPVLLGDGERAELET
                     DENIPIASSLEGMVILRKNPDYMDMDA"
     gene            <150144..>150731
                     /gene="VMA16"
                     /locus_tag="FOA43_002716"
                     /db_xref="GeneID:62196117"
     mRNA            <150144..>150731
                     /gene="VMA16"
                     /locus_tag="FOA43_002716"
                     /product="H(+)-transporting V0 sector ATPase subunit c''"
                     /transcript_id="XM_038923000.1"
                     /db_xref="GeneID:62196117"
     CDS             150144..150731
                     /gene="VMA16"
                     /locus_tag="FOA43_002716"
                     /note="BUSCO:EOG09344JHC"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit c''"
                     /protein_id="XP_038778928.1"
                     /db_xref="GeneID:62196117"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="PFAM:PF00137"
                     /translation="MSYTLSAIVITVLLSVGCYMLLTGSGELFNVGDFLETTSPYMWA
                     NLGISCCIGFSVIGAAWGIFITGTSVLGAGVRAPRITTKNLISIIFCEVVAIYGLIMA
                     IVFSAKVTPASLIYTKENIYTGHCLFWAGLTVGISNLICGVCVGVTGSTAAISDAADP
                     SLFVKILVIEIFGSVLGLFGLIVGLLMAAKAGEFV"
     gene            complement(<150861..>151925)
                     /gene="THR1"
                     /locus_tag="FOA43_002717"
                     /db_xref="GeneID:62196118"
     mRNA            complement(<150861..>151925)
                     /gene="THR1"
                     /locus_tag="FOA43_002717"
                     /product="Trihydroxynaphthalene reductase"
                     /transcript_id="XM_038923001.1"
                     /db_xref="GeneID:62196118"
     CDS             complement(150861..151925)
                     /gene="THR1"
                     /locus_tag="FOA43_002717"
                     /codon_start=1
                     /product="Trihydroxynaphthalene reductase"
                     /protein_id="XP_038778929.1"
                     /db_xref="GeneID:62196118"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR036554"
                     /db_xref="PFAM:PF00288"
                     /translation="MSREFTIKVPASSANIGPGFDVLGIALNLYLSINVKIDAHQYGE
                     LSLQDPNNCILSYEGEGADVVPLQSDKNLLTQMALYVLRCHGINHFPLGTKISVHNQV
                     PFGRGLGSSGTAVVGGALLGNAIGELGLSKQRCLDYCLMVERHPDNISATMMGGFVGS
                     FLRQLSDKGYQLVHQPLKNVLENFSADSTIDAPLNLGTHVTYNWCQKIKCVAIIPQFE
                     VSTSKSRSVLPESYKRADVVFNLQRLAVLTSAVGSDIPDPALIYPAMQDRLHQPYRKA
                     LIPGLSSVVSEFTPQTHTGLLGICLSGAGPTILCLATENFERIARDIVARFKQEKVEC
                     KWLLLEPAYDGATVEEVSKL"
     gene            <152585..>155074
                     /locus_tag="FOA43_002718"
                     /db_xref="GeneID:62196119"
     mRNA            <152585..>155074
                     /locus_tag="FOA43_002718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923002.1"
                     /db_xref="GeneID:62196119"
     CDS             152585..155074
                     /locus_tag="FOA43_002718"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778930.1"
                     /db_xref="GeneID:62196119"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="PFAM:PF08632"
                     /translation="MSRKSTHEELLAASHAVEQELNVVKALKRLSIGNSLNYDPDLPP
                     DESEFVDLNYIDVHRSPTSSSTSSSSSSIAAKHSSLCEEQSDDDDSAADNFEHFNRNS
                     NNNNDDDHSSYDAENVILDSNKLMWVPATAHPKLAPDNFRKYVQETVQEITSKLDKSK
                     TRSNRSSLSSEYTQNISTLSSSSSRPHRSSSQPSLKELSAELQNLSHLAGMDSTDAVT
                     LARTLSSSSLGFTELEMELYGKSTDLPLSRSNSLTAHQASRLRNQAPVPSSMTTLKPA
                     IDDDLPIPTSEGNGLKRARWTTYRKSGGPKMLRERRKQTRQVSAPSLTNKELPEIPIH
                     SSVSPSSSSITTPSSRLPPLPNTPNIGTQSAIPLQAFSSSPTSPLPLQSSKHSGWNWL
                     GHKEKRSPMEHVRDRHGPVEDHSASPSPSSSSSSLSSEKEPPSSPSSPPVPPQASSPY
                     RERKGSISNIFRFRSKSVDKYDSAVESNSKTIMELKAVFHHHSSRIKENSLPESPPES
                     EEGVEAQARVTKPLETPKEDLHITSRHHRYTFEAQKVIPRAPLPAQPNHQDHSASALQ
                     QQQLMQRQLQHRKKHGKHDVQGGHNHNDGRERQLVKQLDKQVDNQSLLPSLVNAQQRQ
                     QQQQQQQQQQHQRQQKSQPHHDLNHAEIQESSEEQPSRSLTSSEPFAEPSVESSTEAL
                     KQSLKLAHRNAKPNQPLEMRDSAFGFPLPPVSKSTLIMLDYRFPIHVERAVYRLSHLK
                     LADPKRPLYQQVLLSNFMYAYLNLVNHTLYLQQQQQDQMFPIDHQQEALGAGYEDGTL
                     CETVDLEKPSDETYDESRHIEEMYGRDSILN"
     gene            complement(<156117..>158036)
                     /locus_tag="FOA43_002719"
                     /db_xref="GeneID:62196120"
     mRNA            complement(<156117..>158036)
                     /locus_tag="FOA43_002719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923003.1"
                     /db_xref="GeneID:62196120"
     CDS             complement(156117..158036)
                     /locus_tag="FOA43_002719"
                     /note="BUSCO:EOG09340XGW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778931.1"
                     /db_xref="GeneID:62196120"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08355"
                     /db_xref="PFAM:PF08356"
                     /db_xref="PFAM:PF08477"
                     /translation="MDSIRVVVCGDEGVGKSSLIASLIKEKFVPNIQHVIPELVIPRD
                     FSNSSHSPNFTILIDTTPSDIFSFQYEVRKADVIWLVYSDHYTYERISLYWIPTFRSM
                     GVNLPIVLCDNMIDLDKTVESDTILNEEFIPLLREFKEIEACIRCSAKENYNVNQAFY
                     LCQRSVTHPIAPLYDYKDSSLKPLAVDALKRVFYLCDRDQDGYLNDNELLQLQEKGFH
                     KTMDINELSLIKSTLDTSLFGSAGEKGITEQGFLALNKLYVETGRHETIWGILRAFHY
                     TDSLSIEDNVLYPKMDVWPNSSVELSPKGYQFLVDLFLLFDKDNDGGLNEEELTKMFY
                     PTPGIPPSWKESGFPRSVVCNEQGDVTLQGWLSQWVMTTFLDCRTVLEYLGYFGYGDS
                     LDGSSRKDEPTTSALRITRQRKMRKHNGKSYRSTVADRTVFNCFILGARGCGKTSLLE
                     SFLSRQYSPTYSPTIQPVIAVNNVELKGGKQCYLIMQELGELESAILENKTKLETCDV
                     LCLAYDSSDPESFQYLIDLRSKYPELDEVPVVYVALKADLDRQQQRADQQPEPYTRSL
                     NLPPPLHISSSWISSLSELLSQLVEAAATPKLATPGLDPEKDTESLINPFTIGCTAVG
                     CMMLVSTWYLKGWRR"
     gene            <158174..>160729
                     /locus_tag="FOA43_002720"
                     /db_xref="GeneID:62196121"
     mRNA            join(<158174..158974,159203..>160729)
                     /locus_tag="FOA43_002720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923004.1"
                     /db_xref="GeneID:62196121"
     CDS             join(158174..158974,159203..160729)
                     /locus_tag="FOA43_002720"
                     /note="BUSCO:EOG09342Q31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778932.1"
                     /db_xref="GeneID:62196121"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="InterPro:IPR033910"
                     /db_xref="PFAM:PF00749"
                     /translation="MALHQQILKLSTLIQELVSNVDEYETLKSVSDTAPTIDSNEELT
                     STLRKIDNSLKYIEILFEDEFSENEYDALVSLLGIYDKALSSLPEVEVEGYTFDRTKI
                     EEVRENANGENGGGYDEDMVDMTLNPSISSKHKKSVRFKDNLVDAEPTKYKDDRDVLF
                     QDNESLSSQASTTSQTSSQMLSNKQIFISNQQEIINQDQTLDHLGDSVSRQHEMSLQI
                     NGEVNDHMVLLDDLENGMDRTNVRLIRGQRNIRRFREALRERGDWCTILPAEPAEPVR
                     ARFAPSPTGFLHLGSLRTALYNYLAAKSTHGQFLLRLEDTDQKRLVQGAEQNIYETLK
                     WLGMNIDEGPIQGGPYFPYRQSDRSKIYAKYVRILLDKGFAYRCYCSKHRLDQLRDSA
                     RLLKPPTTASYDRYCLNHYTKEQSDVKCANGEEFTVRFVSPKRYPIFTDLLHGEIDQQ
                     IQINPVDVRYEDPVLLKSDGLPTYHMANVIDDHLMKITHVIRGEEWLASTPKHVALYN
                     AFGWKPPKFIHIPLLTTVDNRKLSKRSGDIDIMSLKAKGYLPEALINFSVLFGWSPKR
                     TYGKKSSEIFSLQELENEFSLEGLTKGNAKVDFSKLEFFNKHYLGKKLADTESEFYKK
                     SLDDIFHKLSTTLNLPHLSKNEVDKVLTAVGSALSKVDELDTEQYWYFFIKPSYSIDS
                     FLKSTKLDTDTIRKIVQQLRDNSVGLSVENMSQTIKQIAESIPGIKRKSVYQTLRYAL
                     SGPQSGTNMHTIINILGMKETENRIADFAEALNHA"
     gene            complement(<160786..>161547)
                     /locus_tag="FOA43_002721"
                     /db_xref="GeneID:62196122"
     mRNA            complement(<160786..>161547)
                     /locus_tag="FOA43_002721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923005.1"
                     /db_xref="GeneID:62196122"
     CDS             complement(160786..161547)
                     /locus_tag="FOA43_002721"
                     /note="BUSCO:EOG09343WYB;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778933.1"
                     /db_xref="GeneID:62196122"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="PFAM:PF05603"
                     /translation="MFGSTLAGRAISLAQQIDSSQYTIKYDELSVKNVYHLSIFLLPN
                     IQFDPSFVALIYYQFQVNGRDASAPPFVSTEFKLLGGLTAQKQSAIFKINPGNIGSID
                     VASSVMPSEGDIDMDGSGEGTGGTGGTGTGTGTEGTSASIILGISIEPNDTALPQLEQ
                     LKLSGATNAAYNSQSLVTVNSPANAALAASKDLTQSQVLEFSNKIIGNAYNFLSSFAD
                     SNNKVSMNKFNDWWNRFKSRMSSDPGYLKRLCEAE"
     gene            <161972..>163672
                     /locus_tag="FOA43_002722"
                     /db_xref="GeneID:62196123"
     mRNA            join(<161972..161980,162147..162154,162166..>163672)
                     /locus_tag="FOA43_002722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923006.1"
                     /db_xref="GeneID:62196123"
     CDS             join(161972..161980,162147..162154,162166..163672)
                     /locus_tag="FOA43_002722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778934.1"
                     /db_xref="GeneID:62196123"
                     /translation="MAKGLNRQLSRFGMYQLGLRLEDFELDKSVRRSTSEPLQKKRRI
                     NQMVKYVADHLIDSQKNLSVINKRLKLKRLAPDFYLHQQFVINLGKKDLSKMVDIYFE
                     LPEPRALYLTSFEFEKFMSQVLAYKMSKEDHILDSEKLVDLFKNLLDDHIPLTGFELT
                     KYVFFTLKNMSSLHKLDKDSCFNGVMQLQSRFIFTRSIWNLILNEFPEKRDIVLKEMA
                     NKVTLNRDLLITLLKTSTSISELANLLGLVQLKHIHLDPQMFELILRKLIGFGYYFLA
                     KGMLETLLTSRRPLKMDSFSEGVPIFPTRVERKLARQYEAFNGSLLYRARSAPPRANK
                     VDFSRLIYYYFKPSPMICSVFLDSLCDSEVFTEAKKFEVNNILELMIKNKIPLINSQL
                     LNVLSKLLVSLPENLELDMKMVLQLNDLALSSIEYNERLHANSKDFKYDKKYLSSFIK
                     EQVGNSVVNELRSSFKLSFELFRKWPAEGIEGFYYEMRIEVKEKMLKIYDELEIVEE"
     gene            complement(<163749..>164693)
                     /locus_tag="FOA43_002723"
                     /db_xref="GeneID:62196124"
     mRNA            complement(<163749..>164693)
                     /locus_tag="FOA43_002723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923007.1"
                     /db_xref="GeneID:62196124"
     CDS             complement(163749..164693)
                     /locus_tag="FOA43_002723"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778935.1"
                     /db_xref="GeneID:62196124"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="PFAM:PF08598"
                     /translation="MSEYKAHHMTKKDRRRLQIQGKIQRLEQQFEADKDYHYRDALIQ
                     LQYKLSSLHSGDNPQYIQKVRDFEEQRDADLLRLRLAEEYQVQSINKQFKEDYDKASK
                     ETEDIVQTVKRKLEDRIVSKICQLKEDKALIDIATSSSSTGHVGTRYHHPINIGGNGS
                     TAVRSESGYNSGFDSSSSFFFSSDRRVRRQKRHEDGISFLLQSNADDSYDSGTGTGTA
                     TGYGSSGGRKRQRTTHGKSKSPASDDGSHKPILTNNAKLNVFLYGEEVLKRKEKASMR
                     YSSKGYEGCPSLKPQEVNEDLTFLRSATGVIQSHKRRG"
     gene            complement(<165207..>166490)
                     /locus_tag="FOA43_002724"
                     /db_xref="GeneID:62196125"
     mRNA            complement(<165207..>166490)
                     /locus_tag="FOA43_002724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923008.1"
                     /db_xref="GeneID:62196125"
     CDS             complement(165207..166490)
                     /locus_tag="FOA43_002724"
                     /note="BUSCO:EOG09343C4U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778936.1"
                     /db_xref="GeneID:62196125"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF04088"
                     /db_xref="PFAM:PF07653"
                     /db_xref="PFAM:PF14604"
                     /translation="MSSSRPKPWEVSSGTSGASVGLNTTGSTQTQQVAQSSHMNTSSD
                     NSDNAPALPEKPQTLRNASTDMNTNTNNPSAPDSYGTGYNNNPGYGSGIGSYGSYGSY
                     GSGMYGSGMYGSGMYGSGMYGSGLGMYGSGLGMGGGMFGGNNFAGSLAQGTETTFQLI
                     ESFIGAVTGFAQMLESTYYATHNSFFTMMSVAEQFSHLKDALGSLLGIYAVMGWIKKL
                     LRRLKGSKTRFSIDEFKKYQKRIEQSGLNRNNKSISNGSNDNNKNGRGSLKPLLFFLA
                     AVFGMPYLLKKLVTTVARQQQQRVLQRRQQQQQQQNQQGIAARNGNLIGNALEILDPK
                     KLEFARVMYNFNPENEQMELGLKKGDLVAILSKSGPNGEPSNWWRCRSRDGRLGFVPY
                     NYLEVIKRVRNGEKVVSAEKSDDSLKTGLKKQATE"
     gene            complement(<166770..>168662)
                     /locus_tag="FOA43_002725"
                     /db_xref="GeneID:62196126"
     mRNA            complement(join(<166770..168442,168632..>168662))
                     /locus_tag="FOA43_002725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923009.1"
                     /db_xref="GeneID:62196126"
     CDS             complement(join(166770..168442,168632..168662))
                     /locus_tag="FOA43_002725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778937.1"
                     /db_xref="GeneID:62196126"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR032451"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PFAM:PF00249"
                     /db_xref="PFAM:PF04433"
                     /db_xref="PFAM:PF13921"
                     /db_xref="PFAM:PF16495"
                     /translation="MSEKASEDPVDIDQKIRQLEEDAQKFIAKQSKPVIIPSYAKWFD
                     MNKIHDIEKRSLPEFFAVESRFKTPKVYKEMRDFMINTYRLNPLEYLSVTAARRNLAG
                     DVASIMRIHGFLMKWGLINYQIDPKTKSFRTGPQYTGHFQITLDKPTGFEPFIPEGAD
                     IKVAGDVDHTTDVASTDEPPLKKQKTSPSLKVDEIPLNLELRHNIYDSTQDAFTLRNE
                     ETSKNTKFAGIKQLYCSITGNDITETRYHNLKSKQNISSRAFEDGQFPSTFKSADFVK
                     LDKIQAESDSRPWSDQEILLLLEAIEMYGNNWNSICGHVGSRTKEQCIAKFIQLPIED
                     RYLEKQLSKETYLDYLKRLKLGNGEVSEDNHQEGIANGIHNAVSQLVSSVGDSVLTAE
                     DLKKDGEASKAIKKAYGAIMGNCDAKSEIELRKQDGLISSILELSLKKFDQKMEQLKA
                     LESQVLEEKRSLALEKHNLLIDRLSLRKQALAVRTKLIEASDLGATDEGLQLCEEAVF
                     EANRAPRIVVSKKNELITSNEQEGDDDNDSSIPDGDKQDEGKVQPISVMEPQKYSMWS
                     A"
     gene            complement(<168966..>171338)
                     /gene="TOP1"
                     /locus_tag="FOA43_002726"
                     /db_xref="GeneID:62196127"
     mRNA            complement(<168966..>171338)
                     /gene="TOP1"
                     /locus_tag="FOA43_002726"
                     /product="DNA topoisomerase 1"
                     /transcript_id="XM_038923010.1"
                     /db_xref="GeneID:62196127"
     CDS             complement(168966..171338)
                     /gene="TOP1"
                     /locus_tag="FOA43_002726"
                     /note="BUSCO:EOG09340I5W"
                     /codon_start=1
                     /product="DNA topoisomerase 1"
                     /protein_id="XP_038778938.1"
                     /db_xref="GeneID:62196127"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="InterPro:IPR036202"
                     /db_xref="PFAM:PF01028"
                     /db_xref="PFAM:PF02919"
                     /db_xref="PFAM:PF14370"
                     /translation="MPVSTSGEEDDVPLPVFSRRRHTIKTEDDDEYVAPKVSRKREEK
                     EKNDSEDEIVLYSKRKRQSKDKGDKRRKLKKVKKETKVREGVKEKRVEKESKVKKEKK
                     VKKESKESTMKKESKVKKESKVKKEIKLKKEEQIKEEVDLYKWWENQDDFDGEIKWHT
                     LEHHGVIFPPEYKTLPKSVRLIYGGEPVSLPPAAEEVAGFFGAMIGTENAKNPVFQKN
                     FFHDFIEVLKENGGCPEAEIKEFDKCDFSKMYAYFEKEREKKKALPPQERKRVRDERL
                     KSEEKYKYCLLDGRKEQVGNFRIEPPGLFRGRGAHPKTGKLKRRVYPEQVSLNLGKSA
                     PVPSPPRGHKWGEIRHDNTVAWLAMWRENISNSVKYVRFANNSTLKGVSDFKKFEKAR
                     ALKNYIDAIRTDYRKKLKSRLMIERQIATATYLIDVFALRAGGEKSEDEADTVGCCSL
                     RYEHVFLKPPNVVIFDFLGKDSVRFYQEVEVDMQVFKNLRIFKKEPKKPGDDLFDRLD
                     PSILNKYFHSYLPGLTAKVFRTYNASKTMQEQLDLIPNKGTVNEKVVQFNAANREVAI
                     LCNHQRNVSKGFEAGVQKMNEKIEEMQWRKIRLKRILLQMEKKLKKKKGDYFVEIDEL
                     SKETEKEIVERVLENEKERDEKRYTREKQKLDWDKKKLSKEEYKQKSEALKEDRKKRA
                     EKFKEKSKQLKAEARSHKYELKGSMTVEKIEKQVEKLEERITNTNLQRKDKEDNSTVA
                     LSTSKVNYIDPRLTVMFSKKFDVPIEKLFTKALREKFAWAIESADAEWRF"
     gene            <172227..>173192
                     /locus_tag="FOA43_002727"
                     /db_xref="GeneID:62196128"
     mRNA            <172227..>173192
                     /locus_tag="FOA43_002727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923011.1"
                     /db_xref="GeneID:62196128"
     CDS             172227..173192
                     /locus_tag="FOA43_002727"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778939.1"
                     /db_xref="GeneID:62196128"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MGFVYNQLFKRLPYPTGSYAGKTVIVTGSNTGLGLEAARHFARL
                     GASKLILGVRNLKKGEEAKKDIESTTKCGKNVIEVWKVDMSSYDSVKQFATKVNKKLE
                     RLDTFLANAGVAKTRFELAEENETSITVNVVSTFLLVGLIMPKLKETALKFHTRPNLT
                     ITSSEVHAWTKFPAKSAPEGKIFDTLSDKDFLEKNMGDQYQVTKLLEVLAVRYLVEHH
                     DFPVTIDLVNPGFCKSQLGREVNSWIFSLGQLILAISAEAGSRNLVFAASRDATYNGN
                     YVSYCELTQPSDFVLSDEGKKVQERVGNELMKKLETIQPGITENF"
     gene            <173924..>175897
                     /locus_tag="FOA43_002728"
                     /db_xref="GeneID:62196129"
     mRNA            <173924..>175897
                     /locus_tag="FOA43_002728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923012.1"
                     /db_xref="GeneID:62196129"
     CDS             173924..175897
                     /locus_tag="FOA43_002728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778940.1"
                     /db_xref="GeneID:62196129"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR033695"
                     /db_xref="InterPro:IPR033701"
                     /db_xref="InterPro:IPR036947"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00659"
                     /db_xref="PFAM:PF07714"
                     /translation="MSGKPLQALNSVQINAKSNGIIHTPAKAAVSKPEIHHHRRKQKL
                     SSLCKTPPSVVRTRNGRGYHRGMFLGEGGFARCFQMKDESGKIYAAKTVAKASIKNEK
                     TKTKLLSEIKIHKSMSHPNIVKFVDCFEDDVNVYILLEICPNHSLMDLLKSRKFVSEP
                     EVRFFMTQIIGAVRYLHGRMVVHRDLKLGNVFFDPEMNLKIGDFGLATVLNPPYNKRY
                     TICGTPNYIAPEVLGGKKTGHSYEVDIWAIGIMMYAMLFGKPPFQAKDVQVIYERIKR
                     NEYRFPSDSSVSEQAVDLINMLLKHNPKSRPSLDDILQHPWFTSGPFPSRITTDSLKG
                     TPSNFSMLTREESLINFENTKNHAGIGHDPTVPVEILTSDLHSERPKTLLPHSLSPDN
                     NKSKYREIISPMGGNGNVNVKPYKSKLSSELNRVTYESKMVQLLNESLSRTLTNLKQI
                     EDGTTANNVHNIDQVETPVLVSKWVDYSNKHGFAYQLTTGSIGVLFNSGYTVLKNPEY
                     TKVCIIEPVVERGWDVHSMQPNDVPPFMERNVEIVDFFQKYMNAHLSDVANGADEDAP
                     EAVFLRRYTRDDNYIMFEMSNGSYQFNFKDHHKYVLSQYGEYITHVSPAKKIETLPLE
                     YVISQGNFLQYKDEYFDVKYEFLKHALREKIAM"
     gene            complement(<176071..>176445)
                     /gene="RPB11"
                     /locus_tag="FOA43_002729"
                     /db_xref="GeneID:62196130"
     mRNA            complement(<176071..>176445)
                     /gene="RPB11"
                     /locus_tag="FOA43_002729"
                     /product="DNA-directed RNA polymerase II core subunit"
                     /transcript_id="XM_038923013.1"
                     /db_xref="GeneID:62196130"
     CDS             complement(176071..176445)
                     /gene="RPB11"
                     /locus_tag="FOA43_002729"
                     /note="BUSCO:EOG09344EYE"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II core subunit"
                     /protein_id="XP_038778941.1"
                     /db_xref="GeneID:62196130"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR036603"
                     /db_xref="InterPro:IPR037685"
                     /db_xref="PFAM:PF01193"
                     /db_xref="PFAM:PF13656"
                     /translation="MNAPDRFELFILPDGVSKIRITPDSRVPNCIIVKFEREDHTLGN
                     LLRQELINDPKVIFAAYKVQHPLFANFLMRIQTEEDYKPRTALRNACTRLIFKLGVLN
                     EKFKREWELKSLLTATENEEVL"
     gene            <177024..>180707
                     /locus_tag="FOA43_002730"
                     /db_xref="GeneID:62196131"
     mRNA            <177024..>180707
                     /locus_tag="FOA43_002730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923014.1"
                     /db_xref="GeneID:62196131"
     CDS             177024..180707
                     /locus_tag="FOA43_002730"
                     /note="BUSCO:EOG09340H7F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778942.1"
                     /db_xref="GeneID:62196131"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="InterPro:IPR031693"
                     /db_xref="InterPro:IPR036600"
                     /db_xref="PFAM:PF02671"
                     /db_xref="PFAM:PF08295"
                     /db_xref="PFAM:PF16879"
                     /translation="MPILPGINNLTRYSMDAHDSNVNNATSATVSATASATKALFQPP
                     QPGQTYRPLNVKDALSYLDEVKIQFRNQNEVYNNFLDIMKDFKSQNIDTPGVIDRVSA
                     LFRGHPKLIDGFNTFLPEGFSIECSPTDPNTIVVTTPLGKSIRQGTTHYDLPPPPPAA
                     PNASTAYPGYAQYPAAAYYTSAQPGQPGQALGPYSMAQIPQGVGSMGQQQPLQSLPPG
                     VSPGIPRVPVTDARQGSPAEFDQAINYVNKIKQRYASQPDTYKRFLENLQMYQKGVKP
                     IEDVYREISGLFRDAPDLLEDFKLFMPDTPPKVAEYGYMQLPPVGSFAPPTFADQQQL
                     SEIESASHSRKRRGSSRSTTGNNGAGVTTGGQIQPFDEQPVSNLRATPLPAFSHGHLD
                     SPSLLPGVPEPAYATGIVDTDISDEISFFDKVKKAIGNKQTYNEFLKFLRLYTSDVID
                     KDTLVEKVQGFIANSPELFAKFKAIVGWEAKPLRIENIAIRKELMDLGMRKAAGPSYR
                     LLPKSQSHKPCSGRDELCWEIFNDEWAGHPVWASEESGFIAHRKNQYEEILFRIEDER
                     HEYDFFMEANLRTIQTLETIANRMANMTTEEKAKFKLPANLGHTSTTIYKKVIRKVYD
                     KDRGWEVIEALRENPVLAVPVVLKRLKQKDEEWKRAHREWNKVWREAEQKIFYKSLDH
                     LGLAFKQMDKKLLTNKQLVNEICTIKREQTHKKIHPLMPRPKSQLLCQYNDFEVMMDV
                     LQLIYVFLDHNQTYSPYDKSRMEVFIRSFLIRFYFLSHEFIDESLRRRGVNISRDRHG
                     EESSEESEASSSATSSLGTLSQTRKRPREYDLLRDVLRKSKRRRNHEDDHESDESDAQ
                     RLADEEVERAQSNWIAETGKPNSADSATKAAEFASASARDEFNVFCNTQIYVFFRYID
                     VLYKRLLGVKNLAPAANREIKSRAETKFAKDLGLIDYSLEDQSINIKGNDSYHEALDL
                     CVKLIQGKVEQNAFEECLRQGFLNKAFKLFTINKVIQGVLKHCHTLVTDSRCGEILML
                     MEKDRNTPVSTAKDQIVYRMQVRSHMHADENMFKISYNRKTSTAEIVFIAVDDLTVRD
                     SSKTKEEKWNYYMTSYSMSYPTEGLDSSKLHVPFLKSSLEQEETGEGESEDEIEGVSD
                     SKLKVKVDMDTYRLVFDEDSYDLFVRNSVYSKSKSEKPLAKLRLDYLRKSLEGEYGLG
                     ATKNAEEVKKATDTFELLLSKSQ"
     gene            complement(<180811..>181992)
                     /locus_tag="FOA43_002731"
                     /db_xref="GeneID:62196132"
     mRNA            complement(join(<180811..181890,181945..>181992))
                     /locus_tag="FOA43_002731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923015.1"
                     /db_xref="GeneID:62196132"
     CDS             complement(join(180811..181890,181945..181992))
                     /locus_tag="FOA43_002731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778943.1"
                     /db_xref="GeneID:62196132"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="PFAM:PF01529"
                     /translation="MAVSFKWPWLGVAVSEIPTVIIAYVHIITSWLIIRDDDSSRALF
                     WMFNFSVFMVWLSYYLAIMTLPGSPPSKYRSNDAEKPITFWYKYCRKCRAEKPERCHH
                     CKTCGRCILKMDHHCPWTMNCVGFRNLPHFTRFLMWLLIACFMTLKYYGSRLWSYYKM
                     RNLPFYLISRTEMVLVIVNFIVVAFVEFTLALLFMRTINGLISNVTTIEDWEQDRMHH
                     VFFRDAFWDKVRKNYNDVHGGKPFPELTSWKINYRELPHNSSVPASFSFEDWVFPYDL
                     GSGYENMVQSLGPLYLWLWPWGGPGDNGLKFEKTWWKKEDQLHLPFPMDGDNYKGEEK
                     VEVDLHGGETIMGNFPNELGETLEDFGVDMATENYEIKKVM"
     gene            182151..182224
                     /locus_tag="FOA43_002732"
                     /db_xref="GeneID:62196133"
     tRNA            182151..182224
                     /locus_tag="FOA43_002732"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:62196133"
     gene            <183607..>186318
                     /gene="PMA1_2"
                     /locus_tag="FOA43_002733"
                     /db_xref="GeneID:62196134"
     mRNA            <183607..>186318
                     /gene="PMA1_2"
                     /locus_tag="FOA43_002733"
                     /product="plasma membrane H+-ATPase"
                     /transcript_id="XM_038923016.1"
                     /db_xref="GeneID:62196134"
     CDS             183607..186318
                     /gene="PMA1_2"
                     /locus_tag="FOA43_002733"
                     /codon_start=1
                     /product="plasma membrane H+-ATPase"
                     /protein_id="XP_038778944.1"
                     /db_xref="GeneID:62196134"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00122"
                     /db_xref="PFAM:PF00690"
                     /db_xref="PFAM:PF00702"
                     /translation="MAKEKVEEKPVKPEKGVSELDAEDEDEDIDQLVMELQSNGGADD
                     EEESEDEADQKSFKAVPESMLQTDLAIGLTASEVAQRRKKFGANQMAEEKVNLFVKFC
                     TYFVGPIQFVMEAAALLALGLEDWVDFGVICALLLLNAGVGFIQEFQAGSIVEELKKT
                     LANTAVVLRDGKFAELPASEVVPGDLLKIDEGNVIPADGKLATKDCFLQVDQSAITGE
                     SLAVDKRTGDPVFSSATVKRGDALMVVSATGDSTFVGRAASLVNKASGGHGHFTEVLN
                     GIGTMLLILVIVTLLLIWVACFYRTSNIVRILRFTLAITIVGVPVGLPAVVTTTMAVG
                     AAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHDPYTVEGVEPDDLMLT
                     ACLAASRKKKALDAIDKAFLKSLINYPKARAAMPEYKVLEFQPFDPVSKKVTAVVESP
                     EGEHIVCVKGAPLFVLKTVQEDHPIPEDVLEAYENKVAEFASRGFRSLGVARKRGEGH
                     WEILGIMPCMDPPRDDTARTVNEAKRLGLRIKMLTGDAVGIAKETCRQLGLGTNIYDA
                     ERLGLGGGGDMAGSEMYDFVENADGFAEVFPQHKYNVVEILQDRGYLVAMTGDGVNDA
                     PSLKKADTGIAVEGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVVYRIA
                     LSLHLEIFYGLWVAILDEMMDINLVVFIAIFADVATLAIAYDNAPYSMKPVKWDLPRL
                     WGMSVVMGIILAFGSWITVTTMFLPKGGIIQNFGSVDGVMFLEISLTENWLIFITRAV
                     GPFWSSCPSWQLAGAVLAVDIIATCFCLFGWWCQNWTDIVTVVRVYVWSFGIFSVLGG
                     AYYLMSESDKFDRVMNGQPMNEKPPQRSLEDFMVAMRRVSTQHEKSS"
     gene            <186761..>188098
                     /locus_tag="FOA43_002734"
                     /db_xref="GeneID:62196135"
     mRNA            <186761..>188098
                     /locus_tag="FOA43_002734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923017.1"
                     /db_xref="GeneID:62196135"
     CDS             186761..188098
                     /locus_tag="FOA43_002734"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778945.1"
                     /db_xref="GeneID:62196135"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PFAM:PF00789"
                     /translation="MSHDSTQPLSGLLFETDANSAIHNSIERHKPLLMLITGQSDECE
                     SWIDGRLTNKNERFESSLRPYLSSEFVLLKIFKDTPDFFMLLQIYPQFGSIDVPAVLI
                     VSGGKIVDLIGHDVSVSEFTERMCSQMQRGKKEEEEEEEKKKKNDGDESNERSDLTSE
                     RPLKAITKKTGKIPKSNNTTGYTTSAVQAAAAAAASAASSAALERERILRRVKLDREE
                     IKHDRMEEKHQISEEPVRENIHNKDLETELNYVLQVRLLDGKAIRSKFQRDEKLGKVR
                     DYILEQYPDYRNVSFYFYRNVDRVTYKEEDEAKSLRELNLNRATLLMRPLERQRHGDI
                     DTPTSSTEIGNAVTGTVSWLKNRVGSYLWGTPPAVESSRNTIVHQSKALYHDEVTTDP
                     SEQTSNFNPYGQSDLIDKSEHTEAKKKGHSTFTKKSEKRPQVSTHESHGTEST"
     gene            complement(<188246..>191875)
                     /locus_tag="FOA43_002735"
                     /db_xref="GeneID:62196136"
     mRNA            complement(<188246..>191875)
                     /locus_tag="FOA43_002735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923018.1"
                     /db_xref="GeneID:62196136"
     CDS             complement(188246..191875)
                     /locus_tag="FOA43_002735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778946.1"
                     /db_xref="GeneID:62196136"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR005600"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF03902"
                     /db_xref="PFAM:PF04082"
                     /translation="MSNTTSTSSSASSSPKSPLSPVLSPKSSNFRGRSSFVHNPHSTG
                     NHPAVHRSLTSFPYSKPSPTIKEEPCTSLKNIPAVAGIGGLVSMTAISGANSAADIAG
                     ANRPTLSSGSVGSSGSSGSSGCTSSTESPSSNSSSGNIPASSLSCPSFASAGKPCIEQ
                     ACDSCRKRKLKCSKEYPKCSKCVTHAWDCVYSPRTIRSPLTRAYLTKVESRVRQLESL
                     LRQVIPDKDADSLITSCQNGTISSVISNSIRSSGHASSSKSSSSQAPSSSVSHISLHN
                     SSSIVATAGVSGTNSSGTSSGASSLPNLSRLMDQYLATNEPRGYDWCESATKNDFPAS
                     ATTIPSASSGAGFVPGFGLSHVPQSALESAIFSGSSSVSGSSSSSPSLMAGKSSIDSM
                     ATAVAVANSNLPLVDSPAKAYGSGFYGSPSFNALLRVLAPDVDLDSSLLSSDETLTLD
                     VATINNSAFLDSRPAREQFLTGYFKYYHASYPFIHKETFIRFYNGDLRPKNSNHWQAL
                     LNTVLAIGCWCLYGDSKNWDLIYYERARQSLGSGALENGNFLLLNAELLLSNYCMKRS
                     KPNSGWMYLGMASRMASSLGLYREFEPSDSKRDALDLEIRRRLYWGLYIFDVDMSLSL
                     GRPLSVAYDSSNVLMMSNINDDELNQLIHDPNLPRLTDKMFNKDYPTIYTATIWQTRL
                     AMLVAPFYSRTLGSNPPSLPETLALNSRISGFVNEDLPAYFHENDTIAKSQFFKVVPK
                     YLYTTDDTRLPQWFNLARYRLIWRYKNVQIALFRPYIFHQLTKQDLSGFRKDDLKQAR
                     RICIKAAQETIQSVERFISEEAIASDSGANSTAATRLSPIAVWYAVYFLVQAVLIPLA
                     CLRTDSTSHQASSLREYAVRARTLLGKMPHYASSVRKYIAVIDTVLSRTGKKSSQSKS
                     RRSTISSQQQQQPGLRDDLPSSTASLFGNYTSPRQQQLRRLKQQQQKIASPTLQSTSV
                     PTSVKTEPLFYDLIQTENTSTCNTTPLTTPAGSELNLAKFIQEEMQYQEQQQPQLPQR
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQKMPQQM
                     QQMQQQQQQKMPQQQQQMQQMQQQQPASQVTAVPQLPSSTRPATYASAQQPVFKPDLL
                     SPEFGPVVPKSPSRRSSGKDEMINDIYSLIFDEFTDPVAFGVDEQSQPPQTQPQQFTD
                     NDLML"
     gene            complement(<193880..>195046)
                     /locus_tag="FOA43_002736"
                     /db_xref="GeneID:62196137"
     mRNA            complement(<193880..>195046)
                     /locus_tag="FOA43_002736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923019.1"
                     /db_xref="GeneID:62196137"
     CDS             complement(193880..195046)
                     /locus_tag="FOA43_002736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778947.1"
                     /db_xref="GeneID:62196137"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01266"
                     /translation="MSRELTTASGVDFSHTIIGAGVVGLAIGAEIVTRFPESKVLIIE
                     KNDAYGQETSSRNSEVIHAGIYYPEDSLKMRLCLEGKRMIYELKDRIPVKQCGKWILA
                     QNERDLEYLEKLHEKSKRIAAPTHFLSIKKAALEEPAVYARAGILCSPTTGITSAHEL
                     MSYLMAKFQEAEGSLALGTKVTGIKYNDADKVYEIETVEQEVDQDTEGNAEPFTISTA
                     TLINCAGLHAPQISNMILPKERHVTAYFAKGNYFTYAGKPLHIKRLVYPCPTPGVASL
                     GTHLTIDLGGQIRFGPDLEWVNSCEDYHVSEGNLAKACTQVVRYLPGMKAENLHGSYC
                     GIRPKIIGPQTKRFQDFIIREERGYPGFVNLLGIESPGLTASMGIAKYVMQRYL"
     gene            <195345..>196712
                     /locus_tag="FOA43_002737"
                     /db_xref="GeneID:62196138"
     mRNA            <195345..>196712
                     /locus_tag="FOA43_002737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923020.1"
                     /db_xref="GeneID:62196138"
     CDS             195345..196712
                     /locus_tag="FOA43_002737"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778948.1"
                     /db_xref="GeneID:62196138"
                     /db_xref="InterPro:IPR036322"
                     /translation="MSSSRKLEGTLRGHKAGISAIQFLYLPTALTYSTSNTRHHFLKP
                     TLITGDESGLIIWWDLTTRRQLTSWQAHGTIDSASPNAVITLQQLGITWMLSQEGTYE
                     FPVIDKRWYGCLLSHGKDGEIKIWRLFSVVTCGDYGLKYQLYTPLHQALPPKVVFQMP
                     VNMLNFSNVEMVDDRLVTPGTEDSNKFDIYTVPIPGTDESGTGLKRLFKAVQFESDNP
                     NFTHRNGFGIVMKFAWIDRDHIAVGYESGHVVTYELAQNTVKAITINSIHTPEPVTAL
                     YYDWSRDIILSASSTDCLAIMSGRKAIETSSLSFPVDTTSAISVHHIKHRGIGDLSVS
                     TDGTVGVVTWDGYTRFFHYTEGNSDLTFVFKVKRQAPSISDNRISSDNDIKQESLLHS
                     QKSSALVYSRTQIPYTFIKESRTLEYNDGMSKNLVRRRLERNFDNHWALIGYKDGRVA
                     VYSEK"
     gene            complement(<197207..>198693)
                     /locus_tag="FOA43_002738"
                     /db_xref="GeneID:62196139"
     mRNA            complement(join(<197207..197219,197342..198627,
                     198691..>198693))
                     /locus_tag="FOA43_002738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923021.1"
                     /db_xref="GeneID:62196139"
     CDS             complement(join(197207..197219,197342..198627,
                     198691..198693))
                     /locus_tag="FOA43_002738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778949.1"
                     /db_xref="GeneID:62196139"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00498"
                     /db_xref="PFAM:PF07714"
                     /translation="MRFGGAFLVSKMSDNARLSRKKRPLSAENEYGTGLDISNNGKTK
                     RLERDLENNNVAAVLYSLDPEKSENRMIPRTRKVLIGRSRHCDIIIGPMDCSSEHCEM
                     GVSKVNNEEVIYLKDLSSNGTFINGTIAGKGNVCLVRNGDKVSFASSCHFILKYSARK
                     TVSFFDSYILSDKVLGTGHYAQVKEAVCRKDGEVCAVKIFNPTKHAVGDEDKVKFNRE
                     LDILTKLDHPNVVGFYHTFLEPVSEDTMTTYLVLEKVNGGELFNRIVKKGKLGQSETK
                     ELTKQLLTGLRYLHSMGIVHRDLKPENILLEIESGEQKLPWDVNEHSVRVKIADFGLA
                     KFIGKLSFTNTLCGTPAYVAPEVLVNQNVRRYNKSVDMWSVGVLMYVCLCGFPPFSEE
                     LGPPSMRQQIIDARYAFYSPYWDSIADEALDLIARLLVDTG"
     gene            <198806..>199312
                     /locus_tag="FOA43_002739"
                     /db_xref="GeneID:62196140"
     mRNA            <198806..>199312
                     /locus_tag="FOA43_002739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923022.1"
                     /db_xref="GeneID:62196140"
     CDS             198806..199312
                     /locus_tag="FOA43_002739"
                     /note="BUSCO:EOG0934437E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778950.1"
                     /db_xref="GeneID:62196140"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="InterPro:IPR034964"
                     /db_xref="InterPro:IPR036467"
                     /db_xref="PFAM:PF00885"
                     /translation="MAVSGRGQNDQNLDGSKLKIAIVHARWNEEVIDSLVIGCINRLK
                     ELGVKEENIIVDTVPGSFELPMGSAAVAVNASIDAVISIGVLIKGSTMHFEYISQSVT
                     NQLMDLQFKMGKPVIFGLLTCLTLEQAKLRAGMVPGAMHNHGVDWAECAVEMASKYGQ
                     DFRTATWK"
     gene            <199450..>200442
                     /locus_tag="FOA43_002740"
                     /db_xref="GeneID:62196141"
     mRNA            <199450..>200442
                     /locus_tag="FOA43_002740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923023.1"
                     /db_xref="GeneID:62196141"
     CDS             199450..200442
                     /locus_tag="FOA43_002740"
                     /note="BUSCO:EOG09343U5C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778951.1"
                     /db_xref="GeneID:62196141"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR034353"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MAIEMNSGKREGTLSEKNHDLLIERPKKEDSAMKLEGLESDNES
                     ESSEEELEDKQEDEFVAKPKTVIRQDTEDEEDEEDDSEGDAANDTEGYDEIEEMEKQL
                     VGDNTFGIDKMKKLSPEQLQKQQRKVKRTGVVYLSSIPPYMKPTKIRQIFSRFGEIGR
                     IFLKPEDLKIHRNRVKSGGNKKRKFDEGWCEFISKKDAKLAAFTLNGNILGGKKHSFY
                     HDDIMNVKYLKGFKWADLTSALNEEKEVRESKMEAELSLQHRMDKAFIDNVETSKMVR
                     GMEKKRKHTDSDTTDVRRVFKQRSVATNRSGAKEEEKLRSEKHGNLENVLNKLL"
     gene            <200593..>203685
                     /locus_tag="FOA43_002741"
                     /db_xref="GeneID:62196142"
     mRNA            <200593..>203685
                     /locus_tag="FOA43_002741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923024.1"
                     /db_xref="GeneID:62196142"
     CDS             200593..203685
                     /locus_tag="FOA43_002741"
                     /note="BUSCO:EOG09340GW2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778952.1"
                     /db_xref="GeneID:62196142"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="PFAM:PF00773"
                     /translation="MFRITQITWRCSRVSASVMRFSTSTSRFRFKSVKHYRQGSPTGV
                     SKRIMTPEDLFKQASNVDVNNLKKEYDERKQVRYAKPNQKWLERIASKQDLPDDFNYR
                     DTESNRSLVESLLVKKFGAARKNTNLKDIYFSEIDIGDVVDLSDTLAKNDLAVVVQLP
                     SSPEDTRYTLINQYGEVEFVSRFRMGMKLPRIFPKEWFEGCVMNESQFLQNLNLAPIG
                     KPKYKIEDDVERSRMFDSVIARASVAANIDVQCFILPSILSGIVSGILTGIINSAWNH
                     LPEINLKLEVLHNVLQCTESPIHLGFYQLFKAVIQTDLSMLVKGLTSRNVEDVNTTYK
                     KLLFKLSRDLSVENQFDCISLGRSVYGKVSLNEPIDINVFYGFVLGLRKNNQIFQFDS
                     FANASSFITVVPLSRIVQFNRMVRWFKQNEENYEVMSLYIMKKIDVTSDLHIDKPEFY
                     DDFVRLLKLYVAASFDDGMLESFVIKIIRGLPVYKDIDITRTVVYELLLKLGEISNSE
                     DPFKWWYNSMIPGSGVSAKADLEESYYDNMNASNLNKFIDVNNDMVKHRKQYEDDIIY
                     CIDSKNPLEIDDGISIKPVNAKEFIVSSFIANPSSYINPRSTIARIAFERGLTLYLPS
                     INRAKSLSMLPKVFGESVQLGTPGKVTRVVKISFKVNVETGEVTYLGNDTINFATASK
                     FVKVDYDSVNEILGNTFQANKILFDLSQATDVDEKSLKNDLTQLYKVSSKLKATAKEQ
                     GRSNVFDYFNVRREIENITTDQDNQIQMKFKELEDVDSQNRISGKSEMLVSEIMVMSN
                     HVAGRYFVKNKIPAIFKIQNKLPKSKQVDTMLTQLVSEDETITFRDVVLLQQYMTKST
                     IAPFSSRHESLSMEEYANVTSPLRRFWDMVNHWQLQSFVENGKPLFTASEINYISLIL
                     MFKDELNGQISKRVIAFYTFKVLKQMQAQRGGESIKFKCIVTKKPSEDGLIEVILLDY
                     GVRSILQTSWYALSDRTAKMEKRTALLKDIEIGDVIEDAEIEDIDLLEGLIVLRSGSY
                     "
     gene            <203859..>204585
                     /locus_tag="FOA43_002742"
                     /db_xref="GeneID:62196143"
     mRNA            join(<203859..204512,204535..>204585)
                     /locus_tag="FOA43_002742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923025.1"
                     /db_xref="GeneID:62196143"
     CDS             join(203859..204512,204535..204585)
                     /locus_tag="FOA43_002742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778953.1"
                     /db_xref="GeneID:62196143"
                     /db_xref="InterPro:IPR010422"
                     /db_xref="PFAM:PF06244"
                     /translation="MGGKKKKSKKQEEIAAPEAEQEIDWEDGAKKISKKQLEKQKKQE
                     EVALRKRERELQLEIEDVTNSSAKRKGMSKSKANKKSGNHGGSDLDNALNQIEGSENK
                     NSGSINAEGLDDAIAALSLLKKDVVSDNDIERHPERRFKAALAEYTGRRMADLRMENP
                     GMRKHQLQSLAAKEFQKSDENPFNKETNVAYNASEEEVQRLKDAIKQKRSKKIRALDN
                     WICISQTRNLFMTFIM"
     gene            complement(<204635..>207988)
                     /locus_tag="FOA43_002743"
                     /db_xref="GeneID:62196144"
     mRNA            complement(<204635..>207988)
                     /locus_tag="FOA43_002743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923026.1"
                     /db_xref="GeneID:62196144"
     CDS             complement(204635..207988)
                     /locus_tag="FOA43_002743"
                     /note="BUSCO:EOG093411BZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778954.1"
                     /db_xref="GeneID:62196144"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13432"
                     /translation="MSLSANYYLSSIADPVLREKYISHNITVPLKEEGEEVVIDAEDD
                     LPEDSSELCTLLTNEECKPEYWLLVAKAYANRNMYDEALNVVKQALESPFISHEDNLI
                     VSSFHNFLSWLYVARAGDGSSSESASFLETANTEIQTSLSLLPGNESSILAQATVMLA
                     SQHQNGKNLNFEKESRLLDSVLKKNHHNCYALLAKAKIFFYRQNYLAALKVFQRVLIL
                     NPLLLPDARIGIGMCYWFLDRKDLAAQAWKNSVLVHRDNNTEAKILTCLSKFDDCFTN
                     SKTDDEFKSNYEQALEFTRATYTEDPSNGVILIVLASFYFFKGEFDTVLRICDHILTT
                     AGYIPSLLKSDALFWKARCEFVNGKDIHKAQKLFSEAMRANDRNFLARAGYGQCLVVR
                     KQFNDAIRTFEKIEDSLPQSLEVILALGMLYAKSSRYRRHAIEYLEKYVKLAVDKQEP
                     ISLTALFTLSKLFEDRDISKALEYLRMAKDQEIAAGKTDKQISYSLLNNIGVLATLCD
                     KDGSREFDSALEVLQTTAFDTEELKKASDVTLRYNVARTRESSGRPEDIKSSMVMYKE
                     ILEDCPHYTSAKIRWLLLACVSEDKHIKEELDNLLSEEPDNMEVRSFYGWYLKNYDKR
                     HHLSTDKEHDLESELHRDTLVKYTSHDMYALISLANVYCSLAREAKDARKKEQYYVRS
                     AQLYQKVLGLDPKDVYAAQGIAIIFAQKKQTGFALEIFRRVRDCLNSKFVYINLGHCL
                     LESKQYAKAIENYQLAMDKFVTDDKDAKLLNFLSRAWLYRGLNEKDSGCFKKSLELIE
                     KAYEINPLSAYKYNITFVQFQMADFLRKQPSVKRRVSDLQFGKEGLNKAIKSLNELAE
                     DKEKKPPYPSDDLKLRAELATGLIKHLDTAIETQIQFQAVQTNRLEEARKKHEEEEKE
                     KMAKQKIFEEEKQREEEKLVAERLELDKQQQEWNKIRLDEAKDRKDEIDADEDGDAGK
                     KTTKRRGRKSKGKAKGKEKEKEKEKEDFIVSDSDSEEKLDLYDDEGDDKDDGDDKDEG
                     DDKDDGDDKDDGDLFGDENDKKRKSDDSSSDNKQKTKKRHVLKKRKKLSKETIEDSSD
                     ELKNESYDESEEKKIDRKKNTIVDDEDEE"
     gene            <208219..>209682
                     /locus_tag="FOA43_002744"
                     /db_xref="GeneID:62196145"
     mRNA            <208219..>209682
                     /locus_tag="FOA43_002744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923027.1"
                     /db_xref="GeneID:62196145"
     CDS             208219..209682
                     /locus_tag="FOA43_002744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778955.1"
                     /db_xref="GeneID:62196145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /translation="MTSIERPKDLRLHVGGLSNSLVEDIDDLEKRFSKFGKIVKQFEV
                     HEKVITGYHYAYITMRLTKYEFKKLQALFNGVQYKGAELTVALANQDFHERWIKDAKR
                     PDIKQRKSKLYAILAMRRQQRINHSEDNPFETYSEIIGQMRKTPRKTDLKKATMRVII
                     NGKLRLPRCQKNKLWGYDKTKNDKDLSWEYVGGKWRDGTGHVVEHHVLDDKLSDPTVV
                     KMDEDTEGNDGEDAEDENEKERNKQLLELLMGNYDFQKPADVEVEKDEEFESGGSDYE
                     LEGAKISEDEEESGEDNRDHSIQSQKSLVEDYQKQHPEYLKKEQIDDDTDSMDEDFIP
                     VSGPERKSNLADGKNETEKLRSLLNPVTEHGFKFSLMDDEEEEEADPNATKIEPAAET
                     VVEPATEPVVEPVIKSVMQPAIKAKRDVGLFFSHSDSPFLLAQTQLSKLKTIKVSESG
                     YEDWFWENRGSLNREFRRKRREVTKRNRRKNKYTAVI"
     gene            <209699..>213252
                     /gene="CDC60"
                     /locus_tag="FOA43_002745"
                     /db_xref="GeneID:62196146"
     mRNA            join(<209699..209702,209936..>213252)
                     /gene="CDC60"
                     /locus_tag="FOA43_002745"
                     /product="cytosolic leucyl tRNA synthetase"
                     /transcript_id="XM_038923028.1"
                     /db_xref="GeneID:62196146"
     CDS             join(209699..209702,209936..213252)
                     /gene="CDC60"
                     /locus_tag="FOA43_002745"
                     /note="BUSCO:EOG093407VV"
                     /codon_start=1
                     /product="cytosolic leucyl tRNA synthetase"
                     /protein_id="XP_038778956.1"
                     /db_xref="GeneID:62196146"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="PFAM:PF08264"
                     /translation="MGSTMNTSKPVALESTTRRDTLVDIEKRYQEIWAGEKHFEIDAP
                     TDKEEPYGTSVEKLHEDYPKWYSSMAYPYMNGVLHAGHAFTYSKADFATGFERLRGKR
                     ALFPLGFHCTGMPILASADKLKREIEMFGDDFSGAPSKEEEEKEMARDAKQKATNAHH
                     EDVTKFTAKKSKVAQKTGRGKFQYEIMEQLGVPRDEIKLFADPKHWLEYFPPLVKTHV
                     TKFGGRVDWRRSMITTDANPYYDSFVGWQMRRLKELGKIKFGKRYTIYSVKDGQPCMD
                     HDRQSGEGVLPQEYTGIKIRVTEFTKEALDFFQKQKFDLSGKKVFLVAATLRPETMYG
                     QTCCFVSRKINYGLFDAGNGEYFVCTKRSFKNMSYQDITPKRGEYQETLSINGGLLVG
                     SKIHAPLTSIDTLRVLPMETILESKGTGVVTCVPSDSPDDFVTTKDLYNKPEYYGIDR
                     DWVVKDPISIVNTSKYGDKCAEYLVNELKIHSPKDANQLTKAKELAYKEGYYNGTLLK
                     GKYVGEKVEVAKPKVKNDLVAANEAVVYSEPESAVMSRSGDECIVSLEDQWYLDYGEK
                     NWKEQALACLEKMNTFNSETNNAFEGVFDWLKNWAVSRTYGLGSRIPWDPKYLVESLS
                     DSTVYQAYYTICHFLHSDTYGQEPGLLNISADQMTDQVWDYVFCRKDEVESDIPKENL
                     QKMRREFEYFYPLDESISGKDLIPNHLTFYIYTNVALFKPRFWPTGIRCNGHLMLNNS
                     KMSKSTGNFRTLAQLVEKFGADASRVAMADAGDSMEDANFDESNANAAILRLYNLKEW
                     CETMNKEKDSLRSGEYNFFDKAFNNEMDLLINETYEHYALTHYKLALKSGFFDYHYAR
                     DYYRDVSVLYGGMHRDVVFKYVETQAIMLSPVTPHFAEYLYREILGHKESIHDARWPT
                     PEKPVSREITAELEYVRNLQRSIREAEIQALKKKKKGKASDVDKSKDVKLTLFVAGNS
                     PEWQEKYVEVVRKLFEQSNLDDMKEVKQHIEERDMKKVMPFVSILKKELETSTPEEVF
                     NRELPFDEVQTVKAGFAVLVKAPAQVKVVEITAVSFKSGDKTGKDVKTGEEVEIPNTK
                     SIQNAVPGQPGVYIKNIK"
     gene            <214546..>216378
                     /locus_tag="FOA43_002746"
                     /db_xref="GeneID:62196147"
     mRNA            <214546..>216378
                     /locus_tag="FOA43_002746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923029.1"
                     /db_xref="GeneID:62196147"
     CDS             214546..216378
                     /locus_tag="FOA43_002746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778957.1"
                     /db_xref="GeneID:62196147"
                     /db_xref="InterPro:IPR019190"
                     /db_xref="PFAM:PF09810"
                     /translation="MLPSPFERLSLRCFSSLQGNLKRVNTCTLRLQIPTEDLPETEPS
                     NQETSSSSDSDSRNDLDSQSPDHSSQGASSQITDSDVEKAIKHFVTRKPSNYKAKANP
                     SSSRDALGSSELINPHKYDSLAQILTANSSATILPLDFIVQNDATPYDQLLRAQGEDL
                     QHPKNHARLSVTKILPFNWCELKSMFNVYSGVFQKTATKPMLRGKVEHSTYEHATHPA
                     EKYSINVNGITKHINIEKTRSFMKDTELPVQPIKEYDLQGLYAMLSELPVEPVLRELA
                     SNWTSTILRLLTLFQFGECREVLVQGLYNKAEQALLQTDEQLSSTSSSDYIIISGVID
                     HLVLESGSAEGAFDGYQEELRDSIPDFLDISELINQIQLKADRWCDQSDSLLYITVKD
                     LKTRRTRSLPHPLQQQSAKYQVGMYRKFLEILSIDPKLTYQMLLINARKRGIDPYSVL
                     PEPLVIELVLGNYYLIKDFDRLKHGKPIGFAPYDNDSHIKGNFNISSAGKYTIGNNLS
                     GDWTNPPTLAYLAARLAQLHHSINPFLSSQNFIEYSCQGKVFRQIKDIYHEEDIDSAI
                     RHGMDLWLGHREPETPFIKSICKNCEFRKQCEWHLRQEGAINNI"
     gene            complement(<216390..>217466)
                     /locus_tag="FOA43_002747"
                     /db_xref="GeneID:62196148"
     mRNA            complement(<216390..>217466)
                     /locus_tag="FOA43_002747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923030.1"
                     /db_xref="GeneID:62196148"
     CDS             complement(216390..217466)
                     /locus_tag="FOA43_002747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778958.1"
                     /db_xref="GeneID:62196148"
                     /translation="MGLCLYQVISEEPNGDRKKRRRISTESYRFVNDRHIEERQNINE
                     AEEEQHEEMSSAARLPIIPLPSEALSSQDEYRLLRQRLRLLTRREQQQENPTAGSSQQ
                     VEPARSRPMRRWRHERTLDDVLESVHNGIEDDELRHNRASGRLMRIPSIPTVSASRSR
                     LRREFLRNRRRPMRNANSQFILHDIGGIEEPDIARVHTDSTDTLSVFSPMNNMEDDSD
                     GSEDDDGDLPRWEDPPYAETFSERIHRRWLIIQNIRREIRETRRSTGSEEGGGGRESS
                     NDYRDAINDIPDHEVFLRLYGSINNKYDYWKPREYKDVGKVGEDCFRMSRSTRNKLLE
                     ASTEKFGRPLPTGVIFTQEDDEST"
     gene            complement(<217810..>219948)
                     /locus_tag="FOA43_002748"
                     /db_xref="GeneID:62196149"
     mRNA            complement(<217810..>219948)
                     /locus_tag="FOA43_002748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923031.1"
                     /db_xref="GeneID:62196149"
     CDS             complement(217810..219948)
                     /locus_tag="FOA43_002748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778959.1"
                     /db_xref="GeneID:62196149"
                     /translation="MLQSFMATLALSSIAAAMPFDAGYFNTSASLGSSTASSSSSCST
                     DVTLTSISSVTIYGSSSVANSTTGTATAIASSTATPFISGEFTNDEPIWSIYIPQSSF
                     SDMTGFSIDSEGSFEGFSLGDSAISLYSGSLDDFSDISSTLDDESTNDTVAVSFNGRT
                     TDEYLKLVISATASESQGSYTAAFDLYIDELNSTKRETLDYYLEYTIDVDGFVTTNTY
                     LSCSGTECVTTSSTGFIATGSAITSSSEPTSLTTITTTTCSDGSCQTLTTTGYESVYT
                     TTDNGEETVVTDFIPITGDQATATATGGEATVYSTVICTETKCSTEIIPVSSEYVYTT
                     STNGEEVAVTSYAAITSGDSVAAATGYTSSVDNCTSILMSGSTYLTTISGQETVVTDL
                     YQLSETLSTVTTTDAYGKTTVYTTVCPNTGASETPESTVVSGASETGSNSVAAATGYT
                     SSVVGNRTSIVMSGSTYLTTISGQETVVTDLYQLSETLSTVTTTDAYGKTTVYTTVCP
                     NTGASETPESTAISPVVETVYLFNSSSPETTTSSTISQASKSLVSSQSYSTVTTVSNG
                     KTTVYLTTCPDTTTTKATTIAPVETTEILQSDATVTQTEICTETKCSETSSLSQQTTV
                     PIFSSSTVSLSVENEVTRSEKVYTSSVSGEIITLTTYYTVSSSKASSTVAPESTNVPA
                     VSEVTANIAAANSALNAGIIGLAVGAMFML"
     gene            complement(<220929..>222323)
                     /locus_tag="FOA43_002749"
                     /db_xref="GeneID:62196150"
     mRNA            complement(<220929..>222323)
                     /locus_tag="FOA43_002749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923032.1"
                     /db_xref="GeneID:62196150"
     CDS             complement(220929..222323)
                     /locus_tag="FOA43_002749"
                     /note="BUSCO:EOG09342N80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778960.1"
                     /db_xref="GeneID:62196150"
                     /db_xref="InterPro:IPR029044"
                     /translation="MEFNAIIFCGKGSNLSPFSGVKDTGTTKALLPIANKPVIRYVLE
                     WCDQAPFKTVTVVCGTDVLADISPVVAKYRDTRGSELNSTSTLSCISSSCSTTGSILS
                     EVLKTQKFLYKENIVLLPCDFITDVPPQVFIEIYRGTSDENLGLAISYNNMFENIDNK
                     ILKTNYTVYANQADGNTVLLDLYSKNYVALTKFLKIRTQLIWRYPETRVSTNLLDAFI
                     FFVNFKIFDIIAGQKDSFFNNRSANKIKRDIARRSWSHSTPKETVGLFVLPKESVFAR
                     CNNLSVYMEVNRFFLKKHARQNANLTSGQKSKDNKNAAIAGADCVIGQDTELGDRTNV
                     KRSVIGNHCRIGKKCRITACILLDGVTLEDDVHLENCIIGKKAKLEVKCRLVNCYVEG
                     SYIVGKDVNLKGETLTNISLEKFEGEEGELEIENASDIDDNEVLYSETDSEPTNDADD
                     TDNGSFDSEFVFAN"
     gene            <222558..>223826
                     /gene="RPT4"
                     /locus_tag="FOA43_002750"
                     /db_xref="GeneID:62196151"
     mRNA            <222558..>223826
                     /gene="RPT4"
                     /locus_tag="FOA43_002750"
                     /product="26S proteasome subunit rpt4"
                     /transcript_id="XM_038923033.1"
                     /db_xref="GeneID:62196151"
     CDS             222558..223826
                     /gene="RPT4"
                     /locus_tag="FOA43_002750"
                     /note="BUSCO:EOG0934264R"
                     /codon_start=1
                     /product="26S proteasome subunit rpt4"
                     /protein_id="XP_038778961.1"
                     /db_xref="GeneID:62196151"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032501"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF07724"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF16450"
                     /db_xref="PFAM:PF17862"
                     /translation="MSEENDPLLTALNEEVGGSSETPAAASAIVAAPVDEERERALTA
                     LKNKLIEHIQWDSRLKELRMSIKGSEKEFQKTEDDIKALQSIGQIIGEVLKELDRDRF
                     IVKASSGPRYIVGCRSTIKRELLVKGVRVALDMTTLTIMRILPREVDPSVYSMTTFEP
                     GDMSFASIGGLSDQIRELREVIELPLKNPELFLRVGIQQPKGVLLYGPPGTGKTLLAK
                     AVAATIGANFIFSPASGIVDKYIGESARLVREMFSYAKEHEPCIIFMDEIDAIGGRRF
                     SEGTSADREIQRTLMELLNQMDGFDSLGQTKVIMATNRPDTLDPALLRAGRLDRKIEV
                     PLPNETGRLEIFKIHLTEVQKKGEIDLETMVKMSDGFNGADIRNVITEAGFFAIREDR
                     DYIIQSDLLKAVRKMVDNKKLEGRLEYEKL"
     gene            complement(<223899..>224981)
                     /locus_tag="FOA43_002751"
                     /db_xref="GeneID:62196152"
     mRNA            complement(<223899..>224981)
                     /locus_tag="FOA43_002751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923034.1"
                     /db_xref="GeneID:62196152"
     CDS             complement(223899..224981)
                     /locus_tag="FOA43_002751"
                     /note="BUSCO:EOG09342F09"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778962.1"
                     /db_xref="GeneID:62196152"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /translation="MSNSLRNLSKRYGANLERFPFFLRKMFDQMSREAQLPALSSEVA
                     EVPMKKRFNKPEQWKVEVGDRVLMTKGKYRGHVTKVLALHRPTNRLFLELAETKKMVV
                     PKQFWQPGQSTHVIDYPRTVHPDDVKVVGTAIERAEDGTEREKDIAADQLVFKGEYWD
                     ADYGKMMPYRRVRFHENIIIPWPRPEPEEECSFSTPIEAAEERTYLPKCLVRTDAPEG
                     IVESLRDPLIKRRYKWDKQYITRSEAKKLRQPEMPFSDVKKAMFAERAQIRANTPTEP
                     STETIELVGKLVADRLNSVTDPNFAAYVNSVAPDARAKKIEAREKAKMIHDEKIREAQ
                     ERNKIRRRTEAKYKSRSQKRNGNVVF"
     gene            <225344..>226132
                     /locus_tag="FOA43_002752"
                     /db_xref="GeneID:62196153"
     mRNA            <225344..>226132
                     /locus_tag="FOA43_002752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923035.1"
                     /db_xref="GeneID:62196153"
     CDS             225344..226132
                     /locus_tag="FOA43_002752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778963.1"
                     /db_xref="GeneID:62196153"
                     /translation="MSEHHQAKADTIKSSSLAHIKGYPLVSDSIKFISSVPLTSLIAH
                     YISLSVHFILSYAITVPYFVAAFSFVDSYVDSGLSKIDSALPAFTKVSASDISRVIRS
                     YLGYYVSTAYHYVEKFADPLIKSINDLYKRGLDFFLPVKLSDSITPTASATPVDQVHR
                     SYALAKETYSRLQPFFKQASAIPNHVSTVYKDEKAQSSSTHEAVAKTTTKLSGEVYTT
                     LKPRIGKIVGAAQATYTNTAAAVDPVILPNNVDTVNSSGIEIRG"
     gene            complement(<226210..>227457)
                     /locus_tag="FOA43_002753"
                     /db_xref="GeneID:62196154"
     mRNA            complement(<226210..>227457)
                     /locus_tag="FOA43_002753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923036.1"
                     /db_xref="GeneID:62196154"
     CDS             complement(226210..227457)
                     /locus_tag="FOA43_002753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778964.1"
                     /db_xref="GeneID:62196154"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00724"
                     /translation="MPQLPNIDTVITKAASHVAYFTPQQPGIPGTFRAARQTGVAVKA
                     PKLFTPLRIRSMQLANRVGVSPMCLYSAEDGVATDYHLVHYGQYALRGPGCVIMESVA
                     ISAPGRITTHCLGIYTEEQRVQLKRIVDFYHSQNKPIGLQLCHAGMRASCLALYYDAF
                     DYPVDNERGGWLDQVYGPSPNSQFPYCKELTTQQVKLIVSLFKEAARASIEDCGYDFI
                     EIHAAHGFLIHQFLSPLGNKRTDQYGGSFENRTRILVEILKAVNEVRDTLKKDFPIFV
                     RISASDNDETNPDSWRIKDSLRLAKILVQYGVDVIDVSSGGMADSKPPQIYQTDMAKS
                     VKTVVGDKCIVAAVGSIRKGKFAEQLLQNNYCDMCLSGRGFLKEPGMVERWAEELDVD
                     IQLNLQDGWCFGKVWDPEKSKLS"
     gene            complement(<227648..>230749)
                     /locus_tag="FOA43_002754"
                     /db_xref="GeneID:62196155"
     mRNA            complement(<227648..>230749)
                     /locus_tag="FOA43_002754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923037.1"
                     /db_xref="GeneID:62196155"
     CDS             complement(227648..230749)
                     /locus_tag="FOA43_002754"
                     /note="BUSCO:EOG09340R6U"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778965.1"
                     /db_xref="GeneID:62196155"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR035983"
                     /db_xref="PFAM:PF00632"
                     /translation="MSFNFTGTTRQRNINLGNRSLVGRNRASFLQTTERERKRREQHR
                     KEVHAATTIQSAVRSYLDLDDCRQNVSRNWAGDLAVFRFFFPFRVAKQSLEITQNQVD
                     LLDANFGDGSSLIDNLERNKLASCLVDSIHRVYTYGNGQSAALISRLLQSLNKFINNI
                     DEVDLAPLFRVLFDLQSQDSALSSTFCLAILRYGSIHPDSTLLSLLSSNQGEQLVNKV
                     VRGYQITVIDPFLRAQMREFPQLNQTFSQLPKISQITYLGNMAGLLFTGGESHYRNLI
                     DDTTIRFWGFLLKHFEEGVVFTSDDDDDDLTTEMDIESANASPHLSGSVSIPPQFNGC
                     VSNLYLTSFPRLVLVHCGESNFELFTSFLYAMLQFIAPQSAKSKNATNTELQNSLVIE
                     LIVASSTNNMLNKLYREVSTKIDIPEDSSSQKFMRTVFQPSYKTWWMSLYIFEEMYSY
                     ILSVSHDADLFGKGRLTKAKYLSFVKFLKRLVVLAVLDFRSYRKQNVDLPLLNYFKQA
                     TMLSLKLLRQIYLRDLRMTLFSEEFWYLDKDFSVRSVLPLLQQVEQAHEMYDDTADAR
                     VTPLFDTSVPALFTTSSLTSSQLDSVMVLTYIPYMVPFQQRAALFHALIEMDRTRIGG
                     WFAPKTQGTVSRDNILFDAFEQFGTLPGEQFKRPLSVEFINKFGEKEAGIDGGGLTKE
                     LLTSLVNSAFIPSVENKSHNGGFEFFDTTSDMQLYPSADYFLQQKYALLHPEQTEYSA
                     ESREFTLQMLRFLGMVVAKCLYENVLIDVSFAPFFLNRWTANQGRTNFMGAPQMVEEG
                     QRYRNSFDDLQSFDNELYQSLVKLLRFSKSQIDELDLTFTVTEKLGESTFITLNLVPN
                     GNRISLTQENKLQYAYSVATYKLDQRINVQTSYFLDGLFQVIRPHWLSLFNPYELQTL
                     ISGGEREIDITDLQKNVVLGGYTTNDETIRYLFDILREFTAEQKTQFIKFVTSSSKQP
                     LLGFKELSPKFGVRNSGSDPERLPTASTCVNLLKLPDYKNKELLRRKLLYSINAGAGF
                     DLS"
     gene            <230977..>234285
                     /gene="POL3"
                     /locus_tag="FOA43_002755"
                     /db_xref="GeneID:62196156"
     mRNA            <230977..>234285
                     /gene="POL3"
                     /locus_tag="FOA43_002755"
                     /product="DNA-directed DNA polymerase delta"
                     /transcript_id="XM_038923038.1"
                     /db_xref="GeneID:62196156"
     CDS             230977..234285
                     /gene="POL3"
                     /locus_tag="FOA43_002755"
                     /codon_start=1
                     /product="DNA-directed DNA polymerase delta"
                     /protein_id="XP_038778966.1"
                     /db_xref="GeneID:62196156"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="PFAM:PF00136"
                     /db_xref="PFAM:PF03104"
                     /db_xref="PFAM:PF14260"
                     /translation="MSDSTHPPPFPEKSPLKRRHIDLSVDSGVGFESAHALPIANQSI
                     EPHGFHMPTKGSFSTLKLHKKLTSSQVDNEPSTFEKELINMSKNKSLDADGNLTTDQV
                     WERPKLPSFDPDSYDIEFQQLDADETIIRGCSAARFFGVTGEGYSVLCNVIGFRHYFY
                     APVPKGFTADDVKEFRRYLSSNYAGIVDIRISKKESIWGFNNNVKLPFFKVVVDNSKH
                     IGRIRSGFERGEVQFKGLFQPGGQMTFDNVQYLLRLMVDCHIVGMGWLTAPKGKYTVM
                     SSSEKVSTSQIEININYKDLISHPSEGKYLNTAPLRIMSFDIECSGRKGIFPEPEHDS
                     VIQIANVVSKVGEKVPFVRNVFTVDTCSRIVGSDIFSFEKEQDMLMAWKEFMVKLDPD
                     VIIGYNICNFDLPYLLNRAITLRLDNFPFFGRLKNSRQEVRDTVFSSRAYGTRESKSV
                     NIEGRMQLDLFQFIQREYKLRSYTLNAVSSHFLGEQKEDVEHSIITDLQNGTTENRRR
                     LAVYCLKDAYLPLRLLEKLMCLVNYTEMARVTGVPFSYLLSRGQQIKVISQLFRKCLA
                     LDVVIPNMKNEGVNEEYEGATVISPIRGYYDVPIATLDFASLYPSIMLAHNICYTTLV
                     NRDTIERLQLKENEDYEISPKGDCFVTSKQRLGILPTILKELLTARKKAKKDMKTETD
                     VFKKQVLNGRQLALKISANSVYGFTGATIGKLPCLSISSSVTAWGRKMIDKTKCTVME
                     KYSIKNGFPYDSQVIYGDTDSVMVKFGYPDMETCMKLGQEAADYVSSKFKNPIKLEFE
                     KVYFPYLLINKKRYAGLWWTKLDKFDKMDTKGIESVRRDNCRLVQNVVTRVLELILED
                     RNVPAAEEFVKKTIADLLQNRVDLSQLVITKQLSRQDYAAKQPHVELANRMRKRDPGS
                     APTVGDRVAYVIIKAAGERNWEKSEDPLFVLENSLPIDTKYYLENQLSKPLIRIFEPI
                     LGERKAHDLLTGSHTRTVHISSGKTGGLMRFTRKSNTCRSCKSAIPEDQMLCANCKGK
                     SAEYYAKELASMNALEVKFDRLWTECQRCQGSLHQEVLCTNKDCPIFYMRKKCQKDVL
                     AQSEELKKWNSITW"
     gene            <234486..>235860
                     /locus_tag="FOA43_002756"
                     /db_xref="GeneID:62196157"
     mRNA            join(<234486..234494,235180..>235860)
                     /locus_tag="FOA43_002756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923039.1"
                     /db_xref="GeneID:62196157"
     CDS             join(234486..234494,235180..235860)
                     /locus_tag="FOA43_002756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778967.1"
                     /db_xref="GeneID:62196157"
                     /translation="MTKMSMSISSTYALASKVKARLTKEAVKNDVNLNRLVCQANMLD
                     SLIENLNEQYKIRKNPRAATISFDSISVNAGNSRPISEDYESDDIEDEYVYGDEEDEE
                     EFTENDSLDSRSRIDKFYGEQKQQQDASFYGKITYYDSESESDSSDSDYSEMSDTESE
                     LDSDSEDEEEEEYEGGAAFDLRRMPSHSEESKKESILSQPEVKTVKYESPSLKIESSI
                     LNNNRRMGAVY"
     gene            complement(<236145..>238001)
                     /locus_tag="FOA43_002757"
                     /db_xref="GeneID:62196158"
     mRNA            complement(join(<236145..237421,237446..>238001))
                     /locus_tag="FOA43_002757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923040.1"
                     /db_xref="GeneID:62196158"
     CDS             complement(join(236145..237421,237446..238001))
                     /locus_tag="FOA43_002757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778968.1"
                     /db_xref="GeneID:62196158"
                     /translation="MHFSSLFSVFREPSLIKASATPGVTLPSRDKFKKVHRIKRALRR
                     IEYWLDKANGVHYTKKDLYYLSDPPPLEFSQFSALDSRQGSLISNAHEEKSYNADISP
                     VSLDVKDILTMHASKISLALPTPDLRHPNGKERTKPSKIFRQSSWSTQSDDDWETPAS
                     VPDAQPLPSSPKESSELITRALAHAVSDVVHGSCEVETAAPANSLTAPSHVPKAATKA
                     EAIDPVRPSSKASTETSSIATSTASREFPGTPGTPDGSFSSSSQARSTQVSANTHSRI
                     IFPLTEVLIKKIQKGIKEYEEKIRQSEASSDKENVNHTEVKSADTNINKLKALRIHGD
                     NTSSKSKLTNKPSVFKHAVLSKEDVQVFSPDVKQITAAPTSSPILPIFRGLPSNHFKL
                     PTTEFPSFSPFFEPEHHLRIESFSESQDNEYSYKSNFQHVDEGKSERIFAEECGDSTV
                     KKIYDSPESAYANWINKAFESGELFDMPMGEFGDSTTSTEDEEPDANRYGVTFKNTIT
                     VNHIDQDGPLEVIQKKETLYERKRRTVKETYDGMKSALKVKINPHWKTDKEFLRYNPL
                     TVKQFERAVKWRVGHTKKGYWRDERAAQLRSYERQQKFILGSKQ"
     gene            <238968..>239750
                     /gene="SDH2"
                     /locus_tag="FOA43_002758"
                     /db_xref="GeneID:62196159"
     mRNA            <238968..>239750
                     /gene="SDH2"
                     /locus_tag="FOA43_002758"
                     /product="succinate dehydrogenase complex, subunit B"
                     /transcript_id="XM_038923041.1"
                     /db_xref="GeneID:62196159"
     CDS             238968..239750
                     /gene="SDH2"
                     /locus_tag="FOA43_002758"
                     /note="BUSCO:EOG09343B73"
                     /codon_start=1
                     /product="succinate dehydrogenase complex, subunit B"
                     /protein_id="XP_038778969.1"
                     /db_xref="GeneID:62196159"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="InterPro:IPR036010"
                     /db_xref="PFAM:PF13085"
                     /db_xref="PFAM:PF13183"
                     /db_xref="PFAM:PF13237"
                     /db_xref="PFAM:PF13534"
                     /translation="MLFRLPLVRNLSTQVNAAAQKVSKTPSMKTFKIYRWSPDHPEEK
                     PHMQSYTLDMDETGPMMLDALLKIKNEVDSTLTFRRSCREGICGSCAMNIDGRNTLAC
                     ISKISKADGKDVKIYPLPHMYVVKDLVPDLTHFYKQYKSIKPYLLTSKPLPEKEILQS
                     VEDRKKLDGLYECILCACCSTSCPSYWWNQQEYLGPAVLMQAYRWMIDSRDDATESRK
                     QMLQNPMSLYRCHTIMNCAKTCPKGLNPGKAIAAIKRSMAFE"
     gene            <240549..>241202
                     /locus_tag="FOA43_002759"
                     /db_xref="GeneID:62196160"
     mRNA            <240549..>241202
                     /locus_tag="FOA43_002759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923042.1"
                     /db_xref="GeneID:62196160"
     CDS             240549..241202
                     /locus_tag="FOA43_002759"
                     /note="BUSCO:EOG093443AB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778970.1"
                     /db_xref="GeneID:62196160"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="PFAM:PF12352"
                     /translation="MSFPQLRNQLLGLQNQLSGKLSQYSSFTTAPGSNPSDDELSTCR
                     SIEQLIGKISENVGGLDRIVNSNSSISTSKLQQLARHKEALNQFRIDYNRIQSTIKEE
                     RDRLNLLSNVRNEIQDGNSRQGPENSEAYLMDERMRVDRQHGVMDNLLNQVFETRDDI
                     LRQRGSLRNVGSRLQKSLATMPGINILMNQINTRRKRNTFIIAAVIVLCTIALWFLS"
     gene            <241304..>242953
                     /locus_tag="FOA43_002760"
                     /db_xref="GeneID:62196161"
     mRNA            <241304..>242953
                     /locus_tag="FOA43_002760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923043.1"
                     /db_xref="GeneID:62196161"
     CDS             241304..242953
                     /locus_tag="FOA43_002760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778971.1"
                     /db_xref="GeneID:62196161"
                     /db_xref="InterPro:IPR021861"
                     /db_xref="PFAM:PF11957"
                     /translation="MTLVEAVSRLLELYPLESLKSTPIFDEPQTLEIFQTVGMRDLTI
                     DADQLVYFNAKLTEVLEQYMEKYLKKDLDNLEYTHRLLIVLDLSILIGNTHSIKACPM
                     QTLNTILLVCCPVDLAVSQFTDSVFANHRRRKALTLDNSLIGKAKPGSTLLQIGNNLL
                     PKLVNQFQENDIFAGELRAFITNAIDINDRLSLASDWKINQLKGFYEGASKSRNWVKI
                     SSLPDGSPASSYVYANYLRLCLWFTTKKDIKDLIDDIVQVASVAAAHTHSRKPSPDDN
                     PLAWLSQVAKQSDKLESSRCYASENIEPDWILDKDEFTEQLKSKKNSVALHIQLAIMI
                     DFISQFNLRNIQAVKAKLQAKNTKYKTLPAVFNSFFTSEIVKRKLSSTAEYIYDENKW
                     YGDLTKHLLIDTESTWKFMKIQQFNHPELTELGAISTPKKRKFDEYMHVCSETPFEKA
                     KPYFHKMGLPRLSRVWKLQTGLDQIKSQVKDPNQILQDFKDDLYMAKGKEEAVKEQLK
                     KEQDPENIKKLKLELDETTSSSDLLTWKTLRLSRTCGEWIK"
     gene            <243204..>246416
                     /locus_tag="FOA43_002761"
                     /db_xref="GeneID:62196162"
     mRNA            <243204..>246416
                     /locus_tag="FOA43_002761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923044.1"
                     /db_xref="GeneID:62196162"
     CDS             243204..246416
                     /locus_tag="FOA43_002761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778972.1"
                     /db_xref="GeneID:62196162"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00667"
                     /translation="MTVSQSDTDQVSTSASSSSLLGLSSATLEAPFGYPLDPHELHGN
                     ILTTAYNVIQSTSYLLSSTIFNYTLPGKDFSGSKGSRTGNLLKLWTDLKRRNLLNKVP
                     SLYDVDVTIGCGNILLGYLSDDHHLTNEDVDVTVFGSPSTLEHMAPALHGNGVETLKG
                     LPISFQIATVDYDWTSGRLISNFSSALNAARSLKLPVLVSSSAVEAQHFTVLSSVLAK
                     LGVANIHLFDGLHSLRVNESISGVLSSSEIQDLELKLLSALNIDITVALASERIPMGF
                     SKLNEILKTEYQPFEQYGSPDASIFYIVSGTDELTAKLFQQVPKFSVNAASIIVKAPF
                     PFDSRRFNNLVSGNNVKKLVVVSESYNGVNLLKLDVQASLFLEGNFSLDIVSATQQPG
                     EPLTPSQFKLLLEQHANVRPYLTSTGSSFKFVFHDNFKHLNVPAKVAFGLSMVPDLAV
                     KYRPVYDNTVDAGLLSVEIQAGMDFTGKYNLVFLEEFSLLNKVDVFSTLKSNGTILVI
                     NPLGMRFDPENVVSKLLSNLTKKILAEKKITLQVLDLNSVGEDDATKGLTTPISMNVA
                     FWSYAYPKFEVTPMVNKIWNSYGPTNELLAGVILNLTNRVKKDGFKKISFDDEWKKLD
                     IEGAPDLVSVKDTSFSPMPRDEFTEEYGSQIKSRFDLAKKLMFKEAYQRHESLRPDEP
                     VQNFVIKVKENKRVTPLDYSRNIFHIEFDISGTGLKYNIGEALGVHGRNSGSAVDSFI
                     KMYGLDGDNLVETISKENSSVLEVRTVRQSLTENLDLFGKPSKKFYESLVGYATEEKE
                     KKALEHLISPAGAPLLKQYQEEECYTYADILALYKSVRPSAEELASLIPPLKRREYSI
                     ASSQKLHPDEVHLLVVVVDWVDKQGRQRYGQCSKYLNDLKVGDSLVVSVKPSLMKLPP
                     VTTQPVIMAGLGTGLAPFKAFVEERQYQKEHGQEVGEIYLYLGSRHKKQEYLYGEYWE
                     AYLSSHLLTYLGAAFSRDQPQKIYIQDRIRENLSELTDLICQKKGHFYLCGPTWPVPD
                     ITACLEDIYRNEAEKRGQEIDAAEEVEKMKDEGRYVLEVY"
     gene            complement(<246428..>248665)
                     /locus_tag="FOA43_002762"
                     /db_xref="GeneID:62196163"
     mRNA            complement(<246428..>248665)
                     /locus_tag="FOA43_002762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923045.1"
                     /db_xref="GeneID:62196163"
     CDS             complement(246428..248665)
                     /locus_tag="FOA43_002762"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778973.1"
                     /db_xref="GeneID:62196163"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /translation="MSHSEKDSDVNSIVTSLKSLKLANSSHRKDHHNSFSPAVTAAYR
                     KPVPILPPSNSNEDYFRPIPVKDKSWGRKKFDVSKLKHTSINKNVETTSFAKYATLNQ
                     KSEQGQTGSGFLDNPELFTTQKAIIAKLLASTGKKSRDKTETKPVDPEDRHVHGLKAS
                     LMDHQVQGLQFFLNQEHHSERHIRGGLLCDDMGLGKTIQMLALILSNKATDLDSLVDI
                     TESWNEDRKLELFKDKSVKHMDFSKTLHKVKSTLIICPASLITQWQQEIETKTNLSCY
                     SYHGPNRIKDLDKLSQFDVIITSYQTCMSEFQRTNSPLYECYWWRIILDEAHMVKNTS
                     TKTAIACFNLKSLRRWCLTGTPIQNDVVELWSLFHFLRINKLWESDTWRKEIGNRISG
                     TDVKEGLKRLLDVLDECMLRRNKKDLEKTQFKLPPKHYHQLTMDLTSFEKAVYKKLED
                     KVINTILNGTLITNSELNLGRLDLKAPLMKGNSDSDSYMVALVFLLRLRQTCCHWKVL
                     FSFKKEDDKVKKEYLANSNPTSCHAMKETDESIDSITNQISSLSIHSKEVEFEGKKFD
                     VDKSSVKMNRVLKILAKDPKRKTIIFSEFTTMLHLLEDALCSQNYKCLHYDGSLDNKE
                     KQKVLNRMRDDPDISVLLCSLKCGSLGLNLTFCTQVILYEPFWNPAVGAQAIDRVYRF
                     GQKHPVDVWEFFVSDSVEIRIKELQDKKRNVAKAVTDKDPEAILSLMGNRLSKDELMS
                     LIGID"
     gene            <249274..>250419
                     /locus_tag="FOA43_002763"
                     /db_xref="GeneID:62196164"
     mRNA            join(<249274..249914,250269..>250419)
                     /locus_tag="FOA43_002763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923046.1"
                     /db_xref="GeneID:62196164"
     CDS             join(249274..249914,250269..250419)
                     /locus_tag="FOA43_002763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778974.1"
                     /db_xref="GeneID:62196164"
                     /translation="MDAQGIVDPSFQCVPFSFQLLELEKAAVMQARVKKERELHPQRF
                     VRPNCGYQRKYQRSKYNDQGNYSNYNNCNSNANVNPNGGSNGYNDYNGYNNYNSYNNN
                     CNNNYNNYNSQNSQFQYQYQPQQPQQSQQPQQPQQPQQPQQSVTSSGQPNLLRYQAPL
                     RNYSQVYNQLPSTQNSSAEEPISFQRQLQSILRAATPTGISATAVSGSSSLSNSNSSS
                     NIWGTGSQLLNYNGGNSLINGSINNLFAKTDSTANNDSTWSAGLY"
     gene            complement(<250550..>251566)
                     /locus_tag="FOA43_002764"
                     /db_xref="GeneID:62196165"
     mRNA            complement(<250550..>251566)
                     /locus_tag="FOA43_002764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923047.1"
                     /db_xref="GeneID:62196165"
     CDS             complement(250550..251566)
                     /locus_tag="FOA43_002764"
                     /note="BUSCO:EOG09343GQW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778975.1"
                     /db_xref="GeneID:62196165"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PFAM:PF04695"
                     /translation="MSQIREDMVGSAVTFLLDGSVADSPLAKKVEFLHDKGLTDVEVQ
                     EAIRRAQLGKGADTGSSITKLTSSPPLLPKDYPNYPLYYNNAPPLSAERDWKDYLIMV
                     TATTGLAYGAYQVIRKYVVPKILPASKTELEKEKESIDQEFQRVQSLLDKFDEDQEEF
                     YKKQNEKGDKIDETMVEIDKIINKNNEKNLQNEETLKFLKLEVDNIKTSLMKTMESQK
                     QTIGSELSNLESQIDQLKLELKSLSTVERTRGTEFFDRSNSSTPAEKKVDDSKEDKEK
                     RAGSVPASFSSLKIPPPSSIPSVNDVFKGETKSHSEIPAWQKAINGEDVSIPAWQMND
                     KTKE"
     gene            <252078..>255905
                     /gene="INO80"
                     /locus_tag="FOA43_002765"
                     /db_xref="GeneID:62196166"
     mRNA            <252078..>255905
                     /gene="INO80"
                     /locus_tag="FOA43_002765"
                     /product="Putative DNA helicase ino80"
                     /transcript_id="XM_038923048.1"
                     /db_xref="GeneID:62196166"
     CDS             252078..255905
                     /gene="INO80"
                     /locus_tag="FOA43_002765"
                     /codon_start=1
                     /product="Putative DNA helicase ino80"
                     /protein_id="XP_038778976.1"
                     /db_xref="GeneID:62196166"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF13892"
                     /translation="MPINSLINIDRGADYDVATVATVSAVSGDVGVDAIQATDADGSL
                     VVDSLASPAELLANFRNKLKATAAIDTVNQTQANGLKLMKNEFQLLATTNGIFIEPRI
                     VDELKNKLVELEPKIFEKISRRSRLVRQEEEPLRRIKNMRLRRLVELQKQKDAQLKLL
                     HKIPSNIGSVSGPSSSYVNIAPKEGGKRRARDSVYYEEEPRKRRRRGGNASTDSENIA
                     SRTFRSHDDGHKLPTIKLTLKPRLTMKEQRAITKQYDNTYISIWKDLSRKDGPKAYRL
                     FQQSLQAKQVNLRKTCQLATRESRRWKVKTTKSVKDQTTKARRSMREMLNFWKKNERE
                     EKMLRMKAEQEAIAKAKKEEDERESKRQARKLNFLINQTELYSHFIGSKIKTQEYEGE
                     MADKKIKSSNGSVTGTAVDAKNVDLSHANKDFHSLNFDEENEEELRKTAAANAKTALL
                     EAKKKADRFNDSAQKDSKQELNNGEMNFQNPSSIGDISIPPPKMLDCTLKEYQKKGLN
                     WLASLYEQGINGILADEMGLGKTVQSISVLAYLAETHNIWGPFLVVTPASTLHNWQQE
                     ITRFLPDFKVLPYWGTAKDRKILRKFWDRKSIVYHREAAFHVVVTSYQLVVADSQYFQ
                     KMRWQYMILDEAQAIKSSQSSRWKSLLTFQCRNRLLLTGTPIQNNMQELWALLHFIMP
                     SLFDSHDEFSEWFSKDIESHAQAHTKLNQLQLERLHAILKPFMLRRVKKNVQSELGEK
                     IEIDVYCELTSRQKKLYKMLRSQINLMDLIENSKKIHHRSHGGTDYDEDGSGDSLMNV
                     VMQFRKVCNHPDLFERADTKSAFICGRFAETASLIREGNQDLLEVDYTTQNTIQMKVP
                     RLIQDELLSPSYDHGEIYDRVVSIPKKFSIWNPENFAKSGDLLCLRLLTDSANDLIRQ
                     AHRTVVENAIDLRSYNVTESSDLLSSLKSVRRKVCEDMYLATNRQCAFESCRAPPIEV
                     RCSNQRFTNRHRDKLFNEKFRAALHPLSLNNQWDLYKKKVPLEMWPKAEMLPEKLSNE
                     ESWSTIRLPSIERFVLDSGKLKKLDQMLPELKKNDHKCLMYFQMTRMMDLMEEYLNYR
                     QYKYIRLDGSSRLSDRRDLVYDFQTRPEIFIFLLSTRAGGLGINLTAADTVIFYDSDW
                     NPTIDSQAMDRAHRLGQTRQVTVYRLLVKNTIEERMRDRAKQKEQVQKVVMGGKIDED
                     EESTEKDGVDENENENETGTETETGNETGTETGTETGMETGTETETGVGVGIGGKKGE
                     KKQIAMWLLQDDD"
     gene            <255978..>257273
                     /locus_tag="FOA43_002766"
                     /db_xref="GeneID:62196167"
     mRNA            join(<255978..255984,256147..>257273)
                     /locus_tag="FOA43_002766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923049.1"
                     /db_xref="GeneID:62196167"
     CDS             join(255978..255984,256147..257273)
                     /locus_tag="FOA43_002766"
                     /note="BUSCO:EOG0934426O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778977.1"
                     /db_xref="GeneID:62196167"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR015399"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /db_xref="PFAM:PF09320"
                     /translation="MTVPLATKMPDYSLEQKQEVERIMSIEATDYYTILKVEKAATET
                     QIKKSYRKLAMKLHPDKNKHPQSSDAFKKIAKAFEVLGDDKKRNFYDQTGADPDSRGG
                     GGGGSAGAGADMANGGFGGGRASPFGNGSQFFYTGTPFGGARGGAGGGMFEEDLFDML
                     FGGNNGFSFGFDGSGLRRTTGFGNGNSFFRTNNGPGMRRRPADASRRRGGRGTGEGGA
                     HGNGTRPADHEAPSLRSVLYQYLPLLLVLVPMLFNVIVDSFNSGSGLFDRTPSFSFET
                     SPAYSVERTSENFGVKYYITADSNREMSKRDDHGKTANRLNSKAEEIYVRDLRTKCRR
                     EQGIKERMIEDSYGFFFPDKEKLEKAKNYETRSCDRLKELQLS"
     gene            <258795..>263651
                     /locus_tag="FOA43_002767"
                     /db_xref="GeneID:62196168"
     mRNA            <258795..>263651
                     /locus_tag="FOA43_002767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923050.1"
                     /db_xref="GeneID:62196168"
     CDS             258795..263651
                     /locus_tag="FOA43_002767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778978.1"
                     /db_xref="GeneID:62196168"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="InterPro:IPR036427"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF00439"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF07529"
                     /db_xref="PFAM:PF14619"
                     /translation="MELASSHQVQGSRTSQRSPQSNQSLAMANMNVGSINMNSFGNNN
                     MAAAASGTPTSANANANANANATASASATPGSATHRKIPLHIMSSLQIQGICKRMQQL
                     KNQYGNAVNRIPEYVQLATLLSQDPNFQKQLHARMQRVHTNPQEQRSQQVFQPSQASQ
                     PPQSQGSQGSPNLPNQRRSTGFSPASSTAGSPASTAGPRGPPSSIFSPQQSQILKFQI
                     AAFKKFIQHQPMVPEIANVINFAYQQLQRQRMVAQQRVRQSGPQQPQLQQQQQQQQQQ
                     QQQQQQQQLLKQQQKQHPPKPKKKSTSRRRKTPKVSTPGSSASGSSNLVPTARQSVIS
                     LSQHPVGPIAASVPMGTPAASSPASASRTPRPLLSGQTVPAISPVISGAAIVPGSVAP
                     VTPVVSVAAVPPVAPVSTTVPQPPAQPVGLPPHPPMSLQRLTERFATIRNVVPIQNTN
                     EMVDSYTLPEVINDIPFEYFNSPKSKVITPSLLPKSLDITQTKEILQMVEALEFDRDI
                     QTAKQEDLGEYALLQLHPFQKAMRGYLLSCVFHQNMLLTNHLPNFSAKTRAINMGDAS
                     VVFALNQEQKAMALQSKREKVAERETNLLNASADYKYILAGRKQRYHRLGRQISAMHV
                     QTEKEEQRRLERNAKRRLQALKANDEEAYVKLLDQTKDTRITHILKQTNAFLQSLTQA
                     VKTQQRDTEDRMVENGHVDASDSDEELGEGENKEDTIDYYHVAHRIKEKVFKQPDMLI
                     GGTLKDYQVQGLEWMVSLFNNHLNGILADEMGLGKTIQTISLLDYIYEKKHIKRPFLI
                     VVPLSTLPNWNMEIEKWSPGLKKISYKGAPPFRKELARQVKAGDFDVLLTTYEYVIKD
                     KSVLSKVNWVHMIIDEGHRMKNSKSKLSSTLTEHYHSDYRLILTGTPLQNNLPELWAL
                     LNFVLPKIFNSVKSFDEWFNTPFASTGSQDKLELSEEETLLVIRRLHKVLRPFLLRRL
                     KKDVEKDLPNKVEKVIKCKMSDLQFRMYHQMLKYNKLFIGDKDSKFPVGIKGMNNKLM
                     QLRKICNHPFVFPAIEDMINPRGETNDLIWRASGKFELLDRILPKFLVSGHRVLIFFQ
                     MTQIMDIMEDFLRLRGMKYMRLDGDTKADDRTLLLSEFNAKDSPYFLFLLSTRAGGLG
                     LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKHEVRILRLITSDSIEEYILERAQQ
                     KLDIDGKVIQAGKFDQKSTSEEQEALLRKLLETEENEKEEGADLDDRELNEILSRNSD
                     EMILFTKIDHERDAQRNNKTRLICEAELPAVYSQEPQQENKLQEVLDYAGTHREHKIC
                     HYDETMTEEQWLKSINGYVTDEDNDDKPRKRRRKRGRKPKSEIMDGDVSSDDFKRQRT
                     VGGKHVQKGRRSRSATAEPGGSVSTTPGSSISGPYPRKRKNRGIQFSSPLSRDPDSVA
                     PELTVQERADLQAQIVEIFDHLISFINDEGRKLSTIFMVKPVRRIYPDYYVIIKHPLA
                     FDGIRRRVYGEVYYSLEEFIHDVHLMFKNARIYNQEGSLIFSDAQHLENETLKMYSDM
                     TGKAIDFTEFDRRFGLTKEEFMKVTKGIQEAASRDTPSDAHKISELPDGLNTGRQLKT
                     ESDYSLLP"
     gene            complement(<263749..>264294)
                     /locus_tag="FOA43_002768"
                     /db_xref="GeneID:62196169"
     mRNA            complement(<263749..>264294)
                     /locus_tag="FOA43_002768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923051.1"
                     /db_xref="GeneID:62196169"
     CDS             complement(263749..264294)
                     /locus_tag="FOA43_002768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778979.1"
                     /db_xref="GeneID:62196169"
                     /translation="MSLSIAIQNLNTGYGIFNTVINMFQMVYVLLLGFIFKNWCLSIK
                     LQSPPKNDIQPTSNDAEVYLQTPSLENNNSSASIRLLKSTSQVYPGDTSNSNVSKLTS
                     SSSRHFEIVNFTRSDPSENESLEELYEQNMAARQNGEQIIELRQQLYEEAEASRYLTT
                     AGGEADDEYDEYEETVTTDDH"
     gene            <265321..>267474
                     /locus_tag="FOA43_002769"
                     /db_xref="GeneID:62196170"
     mRNA            <265321..>267474
                     /locus_tag="FOA43_002769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923052.1"
                     /db_xref="GeneID:62196170"
     CDS             265321..267474
                     /locus_tag="FOA43_002769"
                     /note="BUSCO:EOG09342UMN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778980.1"
                     /db_xref="GeneID:62196170"
                     /db_xref="InterPro:IPR014848"
                     /db_xref="PFAM:PF08737"
                     /translation="MVTYKLYSKQINKQVRIEAVYENYPVIAGTDELSILVRFKYTGK
                     RDVLGDGKYRIPRTGDGSNTMTGSSGADGSNEVAGSIDATGSNEADGASAADGANGAN
                     GASSATSDVSSETGADKNSSTLATSSWGRLSMQLSNATRSLFLAQSNSIDENTKQEEE
                     QEEDFTMYLGYSQVLGYYTVNDKIVDFKIFEQLQKSTIIGGKFAGIDTLNANVEVSRK
                     GGFVGQLSTLLSTDINAFGRNIAADIHMIPFYSTTQSIMFSEMKFQAKSGNPSAESRS
                     FYLNYKLPKDLPPCFQSVAGSICYQLVLGYQVLEDGVFVQKTIMIPLKIQPNVDKFGR
                     QPLFHLEKVRLNVNSEKLVTSISKEVSGMHSRHGSAGRLSFKNMRSYAGSIGTSGHRS
                     SAVSFDMMKREIGLKGRVMSDGLGSSWNRRFLELMQELDKSRLNEVNKVQEKFDAEMN
                     QNKVLNYNARESLIHIMADYKSVQRETFDPLLDEEEGIDYISMVPQSEQTKYLIKQNH
                     LEIGTLEMDKSVFKVGDPINLSIDFQESDIETKGLEIQLIRSQIFYREEYLKRGTYGE
                     VYEGLSSERSLETVIYEKLTSTFDSRMVNDDLLIPLETEPQFKTNYFDVRYFIQVRFV
                     LLDQYGVLKRRKEAKAKSAGADTEDGALLEDLENLSVKPPRKLFDLHEIFMDKTGSML
                     FKAKEDFESGYEFTVRIPIVVLPNYEQDFGSIIEL"
     gene            <267818..>272068
                     /locus_tag="FOA43_002770"
                     /db_xref="GeneID:62196171"
     mRNA            <267818..>272068
                     /locus_tag="FOA43_002770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923053.1"
                     /db_xref="GeneID:62196171"
     CDS             267818..272068
                     /locus_tag="FOA43_002770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778981.1"
                     /db_xref="GeneID:62196171"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="PFAM:PF12231"
                     /translation="MASSNHSKFSVSPTRVLSGKDKAEILDRKVADLKRRTKIKRQRS
                     FEETRARDSQSRLNKIYAKFHRPTKKMLSPSKTKEIQEDIPLADGEDSSQQVPSSLPS
                     SLPPQIPKDQDELIVSSSSNSITSANTSGDSVNTIIVSSTQRVKVKDATKHRSSSRRH
                     AKSSSSKTPQTPKTSKTSKISEVAQPSSHKSVLSTPSHSPRLKLSISAATSSLSSIFS
                     PISSHKLLSSPLKLTPTRKRNSIGSPSLSTGDNSFPDELSTPKRVAFSSDLESSPIRS
                     SPIKGAPEPKSILKNLEEEDDMPRSNTTIEVLRKDLRKEESWPSGFVLQLLPGSLAIS
                     KVVEGSVAALSDPDFSKKYEVFATLNDIIKVNNRELTKSMFEPSQLQTIVKAIDTDLA
                     NTGRELKSGSNAFRIRTSIQALKLLTFIMTYHQIRGASAMLKRVSTMFLSENLSKGLA
                     AALLQLMKDQQNNISPSAVEHVISAILQMKYFMSTTIITEKLMAIRRFIAVHPAVMSK
                     ISYQWMSHILCCIINTEVPSYERIVNACIYVLYEFSRNSESKDVVYQLLNETLNENSS
                     SIKASTLDSVTPDTKIVDALTLTLVYMINRGWSAQALDIWAYMTFMIGYKFTNQVDLE
                     SWSGLRHWIKVFDEALKNESENVKLAALSSWRAIIYNYQISKTFAAASLKRDDLDRKR
                     SIFLYPFTVISDKAPVSDKLIEGYVVLYYRLLRFLRTLCISPGAKKVVDPEWVLNCVF
                     SPFYSVFIKRPEFFSAGLKLLEGVLQFSERPTIKSMETPEICFRKINPVESWTLSCLP
                     KQLILSYYNKYYDIVSFVLLNEQINIDSKVEVFNSLLSTLDECTKNAIVSFEAVNGFL
                     RVSDTYLRQMMIATTENHMAKPDIQYLSNIILQARSIFGLKILTGQTVSMNLLALVGS
                     FVFNWYGPTGIHNLIQALYPALSKKYASIFFGLVLLRDDDVNKTLIDELSEPNLSLPV
                     FLTDLDTWNDVILRLSLNKTHFKVIVEKIVDYEAKQKSNVKYKDIAKVLNSFVSIDEK
                     GLSQDSAAFLLSQYALNLSDDEETSFAPVVGVFETFIKNAQISEVVSLVQDLPPNKCP
                     VDWYMKLSDAFANQQPNQIGIVIEWIKRSEEFLRRKYPKRCEEVLGRFKTSEADGANL
                     LKELKEVIDVEQPENSINPLMNSLPLSAESSPESHMRILQLDDVQKDELQSDKSADDS
                     LPELQHTETVEIIDDDDVIDVLDARESDSPSASTEKTSSPEFQDARLPDIGKEELNMA
                     ITNPSPTPGSHLVFSDDPQTTPTPQKRKAEIQKQSVKKIKITSSESTVASVIPPLPTA
                     AAVVAPATTSTFSGFPGFPTSKDPRSPYPYPCFIPCLIPMPMVPQGDSTDKPEVFQLE
                     TVLSKLLANPAQLGGMDAQRKKVLEDSLLGVLMKMRGM"
     gene            complement(<272149..>272892)
                     /locus_tag="FOA43_002771"
                     /db_xref="GeneID:62196172"
     mRNA            complement(<272149..>272892)
                     /locus_tag="FOA43_002771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923054.1"
                     /db_xref="GeneID:62196172"
     CDS             complement(272149..272892)
                     /locus_tag="FOA43_002771"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778982.1"
                     /db_xref="GeneID:62196172"
                     /db_xref="PFAM:PF01177"
                     /translation="MPRLLILNPNSSETITSTMATLVAHPSPGCELTFMTAPPDAPAS
                     INNPQEGMQSAAACMRLFRSDPRKYLCYDGYLICCFSDHPLVYQLRDYFKNMPNPSEV
                     VGIFQCAMSYALTHVGGASKDKAGIITSGNSWKPLLDKAVYELIYGAQDPSKRIDFTR
                     GLPPYFLATEESGVGVLELADPNNYEILTSKIKSLREKGVKYVILGCAGLSNLDGKFK
                     QDFGDMEFIDSVKCGIETLCGYVRFSSKK"
     gene            complement(<273095..>273997)
                     /locus_tag="FOA43_002772"
                     /db_xref="GeneID:62196173"
     mRNA            complement(<273095..>273997)
                     /locus_tag="FOA43_002772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923055.1"
                     /db_xref="GeneID:62196173"
     CDS             complement(273095..273997)
                     /locus_tag="FOA43_002772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778983.1"
                     /db_xref="GeneID:62196173"
                     /translation="MRQDGISTTRVEEYKDTMTLARYLSYTKLLGARETVKNGMFHTF
                     GFVNGKHHLWRVTDLPQLVNGLAIENPKIDYVTGLKLIEQMHGFHIKEYTQRYSPLLH
                     PDVQMKRIYQTILKKNPSDEEVTRKLDQVSQSLRGNSAAKFGKPEKMTSAYRNRGSVT
                     DKAVFQVLPLNIVLKVISLTTNDLAVSLKLVRTMIKRHQCRINNETLLYLTRVFQKNP
                     EAVEQFGEFFEGFRAEIVLNRQMYRAILEVLMRGHNTNLIYQFMRNYVDDGYPISTVM
                     FEKMTLIFGLQNDERYKEFSPCLY"
     gene            <274727..>276424
                     /locus_tag="FOA43_002773"
                     /db_xref="GeneID:62196174"
     mRNA            join(<274727..274732,275018..>276424)
                     /locus_tag="FOA43_002773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923056.1"
                     /db_xref="GeneID:62196174"
     CDS             join(274727..274732,275018..276424)
                     /locus_tag="FOA43_002773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778984.1"
                     /db_xref="GeneID:62196174"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="PFAM:PF02096"
                     /translation="MSMFSARFVGSRVVPSLLASVVVRKSVLTAPLRASPQLLAGLRF
                     EPKFGANKRYFSLTSWITGGSSSAEVAGNSVSCTASSVGDVVNAASASAADASTASAS
                     TASASTASASTIGAVEAADAALTSESKFSTTLGFDPSDAVTSISDKAVDAANAVAEST
                     LTPDQFGYLHSIGLVDGWWPSDIIQQGLEIVNVFSGMPWWLTITVTTIAFRLILFPFF
                     VKSSDTMAKSQLIMPQTKQLRADINTAISRGDQRMQQIKMFQMKQLNKKYGIKYRNMF
                     LSPVIQMTFTMGSFFGIREMANLPLQGFTTGGAFWFKDLTAADPYIGLQLISACLYAL
                     SFKFGGETAMAQYGPKMKHVFMVLPFVSVLFTWNLSSAVMVYLTANGLCSIAQSRILR
                     SAGFRSWAKMTPLNTNKVEQAAAAEEKSSGMFGKISQQWDDMKNSSTVRGEMQDKADK
                     AIAFQKKKARASRVIIKGRK"
     gene            complement(<276539..>276866)
                     /locus_tag="FOA43_002774"
                     /db_xref="GeneID:62196175"
     mRNA            complement(join(<276539..276719,276781..>276866))
                     /locus_tag="FOA43_002774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923057.1"
                     /db_xref="GeneID:62196175"
     CDS             complement(join(276539..276719,276781..276866))
                     /locus_tag="FOA43_002774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778985.1"
                     /db_xref="GeneID:62196175"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR016464"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF05047"
                     /translation="MPAAAALTKNIRELRFLLSQTGESSKTLKSFLVKSYKPLKKANP
                     DLPILIRECSGVQPTLVMRLEKGVEVKKNLNDLSESEIGELLKA"
     gene            complement(<276977..>278572)
                     /locus_tag="FOA43_002775"
                     /db_xref="GeneID:62196176"
     mRNA            complement(<276977..>278572)
                     /locus_tag="FOA43_002775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923058.1"
                     /db_xref="GeneID:62196176"
     CDS             complement(276977..278572)
                     /locus_tag="FOA43_002775"
                     /note="BUSCO:EOG09340XU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778986.1"
                     /db_xref="GeneID:62196176"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="InterPro:IPR036859"
                     /db_xref="PFAM:PF01302"
                     /db_xref="PFAM:PF13516"
                     /translation="MPAARDQYDELKQAGCHIGRRVCLIGVDGKQHMGTVRYIGPIKP
                     WPRNDALGVEWDDLVRGKNDGSLEYKGQLYRYFNTKGDEKTGSFIKLPQEGIADDLIR
                     LGKDRVLVVKGRSFSSALEYKYDELDQIGRAEEEEQIMIGTKKVEKYGFDELIRRQAN
                     FSSLEVVSLDNMLVNNEFEINLVGRLLKSVTDLDLGHNLISDWMQVVKVCDKLQTLKT
                     LRLAGNRFHIVEIAGDNQIARLIIPSNDLEACNLSTLSICFPNLYYVDFSDNRFVQFP
                     ETSTIESIDLSFNRLGGRIILTGSSLRAINISDNQITGLEGTLTSLRVLDLSHNSIDS
                     DWSFLDTFEEQFPHLEALKLDGNPLFDQTDSQNGYDHCLMQIMGRVRTITKINGTEYS
                     PEERNNYELYFISKVKQGNTTKPKRTIWHYLLNKYGQKETNSAIVTSSIKRPTEISVF
                     NNEKLVLKQYVFAENTTLGKLKGKISKKLGLSVLHFTLFRKQADGIVERLDNDQEYLS
                     HLGLQVVYIHTAPHMILDAPPHN"
     gene            <278685..>279142
                     /locus_tag="FOA43_002776"
                     /db_xref="GeneID:62196177"
     mRNA            join(<278685..279019,279118..>279142)
                     /locus_tag="FOA43_002776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923059.1"
                     /db_xref="GeneID:62196177"
     CDS             join(278685..279019,279118..279142)
                     /locus_tag="FOA43_002776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778987.1"
                     /db_xref="GeneID:62196177"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MNVEKLNEAELQEGTPFSASWHQDYRDSSYIFIGNLPAKMNEMD
                     ILIVFSQYGVPTFLKLVRDRETGESSRFAFLKYEDFQSSVLAIDNLNGYEIIPGSKLK
                     VDHVRYRPFKSQNDCWE"
     gene            complement(<279324..>280721)
                     /locus_tag="FOA43_002777"
                     /db_xref="GeneID:62196178"
     mRNA            complement(<279324..>280721)
                     /locus_tag="FOA43_002777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923060.1"
                     /db_xref="GeneID:62196178"
     CDS             complement(279324..280721)
                     /locus_tag="FOA43_002777"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778988.1"
                     /db_xref="GeneID:62196178"
                     /db_xref="InterPro:IPR027267"
                     /translation="MANSDIKDFPPRRHVPPPAHLSEFYHYVDGPGHSKPQVGAASQV
                     GTAGAVAVTDSIDGVKAVKLSDHSTSSSADGQSPDISTPVLPVSPISDISKHMNSHTI
                     GASSITSSRLLRYTLSHTESYQSSTAPSALDLETLITGKDIKDTIDCYKTLINTSQKY
                     REALAQLNLAASEFGGALETCARLKGSGEASEGLMGCSGLQYMIANQQQILVRNLEVD
                     FQNPVVGIIDEFEQQHLNTDAEFKKLINDKVRQLKKNEKTNIKLSRKKYRNIAAYRSN
                     LQQLTAQLDEIDRLKHDYYMSSYEQVQCASRSILDRTRDIVSLETTIYDSVAKKGETG
                     GGLDNLLEEESDARQETEFNDDEADSTLKTDNDHEETPKDASNEIFASTSTASPSAEQ
                     KHSSLIEDGEMNSDKEIEENESSPHDDPHYTSTGARFTEHLDNQNSNEEPLRDTTNTT
                     GIDRSISPDKSKTSI"
     gene            <280984..>281742
                     /locus_tag="FOA43_002778"
                     /db_xref="GeneID:62196179"
     mRNA            <280984..>281742
                     /locus_tag="FOA43_002778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923061.1"
                     /db_xref="GeneID:62196179"
     CDS             280984..281742
                     /locus_tag="FOA43_002778"
                     /note="BUSCO:EOG093449IA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778989.1"
                     /db_xref="GeneID:62196179"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="PFAM:PF00466"
                     /translation="MFFRSFTSLIRIRPYLTKETVSVRSFSSCCNALSNSQGNKPSKP
                     VKPADSRKTYLMEIYQHFWETNEIVLFAHHNNLLSSDNEQIRKELHKISKDIQFRKLK
                     SSIFRHYLRASNHEDPISKAAMRQVKRKKTRHPLEPLLKGPTALIMIKDLDPKAVKEV
                     WRVLKAQKEKLFLMGGKVGQRYVDLDKIGEFKDLPSLPELRSQLVGLLSMSSGAGIVR
                     ALESAPTNLAMTLESRKNEMEKKEADVKTDEIPE"
     gene            <281974..>282837
                     /gene="TRM8"
                     /locus_tag="FOA43_002779"
                     /db_xref="GeneID:62196180"
     mRNA            <281974..>282837
                     /gene="TRM8"
                     /locus_tag="FOA43_002779"
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     (tRNA(m7G46)-methyltransferase)"
                     /transcript_id="XM_038923062.1"
                     /db_xref="GeneID:62196180"
     CDS             281974..282837
                     /gene="TRM8"
                     /locus_tag="FOA43_002779"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     (tRNA(m7G46)-methyltransferase)"
                     /protein_id="XP_038778990.1"
                     /db_xref="GeneID:62196180"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF02390"
                     /translation="MTSKRKQYREHKEEERQTLQKLEQKHVRIAKVDSQKRKMDAEIK
                     MPRKRFYRQRAHSNPFSDHSLEYPMSPNQMDWAKLYPYYHDEKVMAPGKISREVQITD
                     IGCGFGGLTVALAAEFSDTLILGMEIRVQVTQYVEDRLLALRENSPPGQNVYQNAAVI
                     RGNAMKFLPNFFHKGQLSKMFFCFPDPHFKQRKHKARIVTTTLLSEYAYVLKEGGIIY
                     TITDVLDLHEWMVHHLDGHPLFQRLDKQWEDSDDCVRIMTNATEESKKVSRNNGSKYI
                     ACYKRLPDPEI"
     gene            complement(<282869..>284680)
                     /locus_tag="FOA43_002780"
                     /db_xref="GeneID:62196181"
     mRNA            complement(<282869..>284680)
                     /locus_tag="FOA43_002780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923063.1"
                     /db_xref="GeneID:62196181"
     CDS             complement(282869..284680)
                     /locus_tag="FOA43_002780"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778991.1"
                     /db_xref="GeneID:62196181"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MNPEDIPKAPLVGRPLLVFTSFFVSISVFLMGYDQGYFSSILTN
                     EHFKNYFEDPNAVQIGTVVAVLEIGALITSLTLGYVADRFGRRKTTQLGCVLFCFGGV
                     VQTASTSFHHLGIGRFISGLGVGYLSGTAPTYMSEIASSDMRGLLGSAQFTGNVFGYS
                     TSIWIDYACSYLDSNYSFRIPLGIQVCFGLILFFGTFVLVESPRWLLEHDHDTEGLIV
                     LADLFAEGQVHDTLAVESYKSIKESVLIGRLEGELSYIEAIKRYPKRIFIGCSAQLFA
                     QFNGINVISYYAPLVFEEAGWTGRGAILMTGFNSILYLFSTLIPWRLSETWGRKPLLI
                     MGGLGMGAALIMVAIFTSLKYSVLVVIGVMWFNTSFGTSWGPIGWLIGPEVLPNKARA
                     SGAALATSTNWFCNFVVGEMAPILLELISWRLYLIHAACCFISAITVWKMYPETKGLS
                     LEDMDSIFDDASSYSSSVTSSTSRISHTINDIESLGSRHNRAHMARSQPQTQSGTYNE
                     RSPVLDSRTSSFMTMPLPQGSGVISSSAPFILPQDIEPPDLEAVYKYKTDDSRSIRGS
                     LRRGSEAVSSIFKFGKKKDPPNDGVTTDDDVSERFIS"
     gene            complement(<285651..>288245)
                     /locus_tag="FOA43_002781"
                     /db_xref="GeneID:62196182"
     mRNA            complement(<285651..>288245)
                     /locus_tag="FOA43_002781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923064.1"
                     /db_xref="GeneID:62196182"
     CDS             complement(285651..288245)
                     /locus_tag="FOA43_002781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778992.1"
                     /db_xref="GeneID:62196182"
                     /translation="MPVHSDTAPKANYQPFPVPPRMASSGYPRISLPMAPLVPMITPL
                     IPLTSMAASMASMAASMASMAATMVSMAPLASMAPLFPMAAEISPRSPAAKPKTPQMA
                     SPAKRSLQKCTKPAAHTDVTDCYPSVGYYPLIYYVNNANVNAQQREKVRKSTNKGENN
                     LKTGLNDSKKGIKKIPTSATSPAFNPEIRLISSETNSNPPLLDAVSTEGTHSSNSANT
                     LVEVSSKSPVKNKSLEAPTETVESTIKAPAKRSIKETAEGAAKVPAEVPAEANTLEPI
                     AREQSPKKIARPKIKSPLQVIASSVVEAPASLISRGAGNLPTSKKTPSQIEKTCLNVV
                     ADKETEENLQRLRVKYKNIMLTEEEIIKISELPEQENHATATKGLLNHPPEIHQGTPK
                     VKHRAAPKFKSMPRLKPQLQPNLSLNAEPVPNPELVSLASPKLEPFFNATHNANIIPE
                     IIHRVEHKEASQIESKKTCDPKKKEAMKVEDARKETSKPCRPELQKGIKEKYKEQHLR
                     AEKLIAEKEKSNPRKMTEKEERTSKLKAMKKAKAEAESAIQKDEGVRKKYNVRGKTFE
                     IDPESQRLYNLLVARTVPKGRKATSIEEIEARRQGIENKDLPPLSDIDKFGFEYALKM
                     QDERDELATKNRDVNVKAELLVKIVDGVTKDFVCDPELNKLCSEGYGHQLTKLSTEER
                     IDRKYRAILRALDESGPQSSPREYLTLPKTIHGIPFKEIDEAVWGDKKLSQSKDSFTA
                     TVSSVLNNWFQTIIEGDAYKEDPEMAMIVSTIANTAWLEETINQIFLNEEQRNNAKPT
                     TTKKINHLALEHYKGNLLHQGNEKSSSGEYQPLRSHRLPQRVLGEWFSKFGNAILESF
                     PQNEQPNH"
     gene            complement(<288456..>289328)
                     /locus_tag="FOA43_002782"
                     /db_xref="GeneID:62196183"
     mRNA            complement(<288456..>289328)
                     /locus_tag="FOA43_002782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923065.1"
                     /db_xref="GeneID:62196183"
     CDS             complement(288456..289328)
                     /locus_tag="FOA43_002782"
                     /note="BUSCO:EOG093436ZG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778993.1"
                     /db_xref="GeneID:62196183"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="InterPro:IPR037992"
                     /db_xref="PFAM:PF04051"
                     /translation="MSTIKTPTSPLPKLPDQTAVSESSTPVKVANKTPADSPSRASIN
                     TTTSKNEVSSDSEIFTSEINACCLHYLVNECVPLSMRVQEKLMKNETDLGALMKNLKL
                     KDQNIRGSEEIKEDTKSSKGPSDSHTREFLAGRVDYMNDEKYLDVNSLYRIEGYGFEI
                     GFKITDCLIYDKSVKEGLTVKMVDSLEILKFICRDVWKVFYGKQMDNLRTNHLGTFVL
                     IDNAFKPLTHFYSGKGEEDTLNKVTPFLQFPSGLIRGILWSLSVESVVKAEVINGKVP
                     GISFTVQTNFDTKE"
     gene            complement(<289487..>291549)
                     /locus_tag="FOA43_002783"
                     /db_xref="GeneID:62196184"
     mRNA            complement(join(<289487..291018,291297..>291549))
                     /locus_tag="FOA43_002783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923066.1"
                     /db_xref="GeneID:62196184"
     CDS             complement(join(289487..291018,291297..291549))
                     /locus_tag="FOA43_002783"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG093412BS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778994.1"
                     /db_xref="GeneID:62196184"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="PFAM:PF00149"
                     /translation="MSKPSLNVNEKKDVLQSKQNKETKQAKHDREDREDPFAGMEGLK
                     AKIGDKLIDLDDVRLRKPHSVRPRVKNNAGGLLETGDHRPVDRPIVDRVVTDVRLSTC
                     YSILGKIPRCRLTLDDGSSWTRVPKDILLGSKWYKKVFMDYRTANTQKAAKLDIHVVN
                     EVRVGDKLKDKSWKNVGYGMWIKKDAYIDTESITGMDVLFGRMAVEPRQGWDLIEQSL
                     KVSGKHLENEELTEESRLKKDWHIYDTECYLTVRKGRKKEPVQRTTSLSFVDHKFKIL
                     QIADIHLVAGFGRCRDPWPDIENRQKNKCLGDLKTIQFVERVLDLEKPNFVIFTGDQV
                     FGSESKDFETAIFKAVKPVIDRKIPYAMVMGNHDSEGSLSREQIYQLLDTLPYSISKA
                     GPEEISGVGNYHLTVTSDKDTENKDLILYLLDSHSYTHSKVPGYDYIKEDQKEFVRME
                     YENETKLWGDIPMAMGFFHIPLPEYREYKNEHGQARPMVGQYKEGCTAPIYNSHMFEL
                     FKEIGVSVVSVGHDHCNDYCLDYNGVWLCYGGGGGEGGYAGYGGTTRRLRVFEIDNER
                     YSITSWKRLQTNPEEIFDEQILQERQQE"
     gene            complement(<291764..>294098)
                     /locus_tag="FOA43_002784"
                     /db_xref="GeneID:62196185"
     mRNA            complement(join(<291764..294026,294088..>294098))
                     /locus_tag="FOA43_002784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923067.1"
                     /db_xref="GeneID:62196185"
     CDS             complement(join(291764..294026,294088..294098))
                     /locus_tag="FOA43_002784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778995.1"
                     /db_xref="GeneID:62196185"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029458"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00536"
                     /db_xref="PFAM:PF07647"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF14847"
                     /translation="MNEADKIQLLDLLRSMECDQYYELFEKNDINIELLSSMDRPALK
                     ELGVTKVGDRLRVQILISLLNIEKIRSKVPMHELVEAIKVAYSALTGVDDDIGVKINN
                     NREERRQRKHQKAGQQQQNDSQNNYSLHNEITVITQDGQDYRVDITDCYTSSAIKRNI
                     LQQTTTSGPLIADEWSTYYRDKSNSVHLMFNIELATVCNSPGREEKSRIIFCRTGEAP
                     SQAAIEKSNEIIAKSETSSAEQNQRSSMIMRNMIGQRPPSQLISTNLGEYFPEVGPTE
                     LKKVMRNSYRLSMYGSRVLQQQARQSPVNGEISRRNSRMKRNSIYSNYSMISRPESVA
                     SGLTALSSGVGYAMRINQTVGDVLLSNSNAIEEEEEEEEEEKEEEGEEEEEEKKEEDV
                     AKTLNLGNSTFKSARASVDDTGTIKKEDVRTSSFIKLLDEDEYEAEDLMDAYGDMSLS
                     ENAEDEPRTSSVMSILTSELNHGPSIWHKGSKIGQGSYGSVYLGLDGLTGELMAVKEV
                     DLPTSSEDSKNKMVTALKREMELLRELHHENIVRYLGSASDSSKMYIFLEYIPGGSVS
                     SMLHTYGPFEEPLIRNFLTQVLIGVRYLHNNGIIHRDIKGANILIDINGTVKIGDFGI
                     SKRITPSNKVDPVEEEQIKQSKRASFQGSVYWMAPEVVKQVASTEKSDIWSTGCLAIE
                     MFTAKHPYPEFSQMQAIFRIGTLTLPKYPSGCSDSARDFLDLAFETDYRKRVSATNLL
                     KHPFFKPLFNMREKQRK"
     gene            <296397..>299417
                     /locus_tag="FOA43_002785"
                     /db_xref="GeneID:62196186"
     mRNA            <296397..>299417
                     /locus_tag="FOA43_002785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923068.1"
                     /db_xref="GeneID:62196186"
     CDS             296397..299417
                     /locus_tag="FOA43_002785"
                     /note="BUSCO:EOG09340DQP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778996.1"
                     /db_xref="GeneID:62196186"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016528"
                     /db_xref="InterPro:IPR024763"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00637"
                     /db_xref="PFAM:PF12451"
                     /translation="MSLSSWRKFPFFDCVPIQDPNYGSKEGKALYSDSSVSAICSTPK
                     YLVLASKDALIKFADSSFQLVNSFTAYDPLWTITKMCYIDAGSSNAQMLCSIAETQGQ
                     PLTLKLWNINTLLNSDKTKPIDYNSDYLTLCKVTNGVNNYPMTCFASSADFSVLAFGF
                     ANGTVILVRGDLLHDRGSRQRIVYESEEPVTGVHFRDDTLLYVTTISKIITVPTSGRN
                     KGKPEKVLEEQQGADINCSDLLIKGGFKTLVVARQESLQFYNSRGRTNNFLLEVSKKR
                     LHAFGDRYLLLVTSTDALFDGSSTFSTYSMMVVDTVGKFLAFSRTIASTAIEVFSLWN
                     DLYVFTSDGVLYRLHEKPILEKLDILVQRDLFPTALKLAGEGEIDDTVVMKIQQQYGD
                     YLYARDEYAEAMEHYVQCVNLGKTSEVIQKYKESSKIPYLTKYLCKLIDLGKSTSDHV
                     TLLFSSYCKLKQDDMIRSFVENTDVNEDFEVINPHRSFDMMAVINLCRQSKYYQLAAF
                     IAKKFNLPSVVVDIQLNDLKSPKNTMKYIKGLAIDDLLRVLLSNVKSLLDKLPNDTTQ
                     LLIEVFTGLYKPDPSFDIDQVSIYSAGNSSSKSSESPILNSYRQFVAFMNSGSKEDGS
                     NSTLLSQDKPPTYLPPRPKIIFQHFVNHPNELVIFLEACIESYEKFGGNEKDKKDIMT
                     ALYEMYLTLALDSQSPDEKDQWESKAKGLLKTIQNENGWTLEEKTGLLLLSSVSEFNE
                     GEILIREAADESSEGFGLDLFRSAVMSEHYNQSYNIIERFGEKEPDLYRLGLSIYTSD
                     EVVYKTIGEERIITLIKKLESAKLMTPLELIKQLSLNSNGFVKLGLVKQYLLSYIKRQ
                     KLEINNNAKLIEFYKKDSKKIEKDVDNLIHKNQTVNQTKCASCGQPLSFPIVHFKCSH
                     SFHEHCLLTSNGQQQDGVGDSNYIVCPRCSSELDAMTVLKKQQEEVGNNNDLFKASLE
                     GSSDRFKVMMGFLGRGAMQPTSIVYEGSEPTTTD"
     gene            complement(<299466..>302777)
                     /locus_tag="FOA43_002786"
                     /db_xref="GeneID:62196187"
     mRNA            complement(join(<299466..302692,302771..>302777))
                     /locus_tag="FOA43_002786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923069.1"
                     /db_xref="GeneID:62196187"
     CDS             complement(join(299466..302692,302771..302777))
                     /locus_tag="FOA43_002786"
                     /note="BUSCO:EOG09340ATL;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778997.1"
                     /db_xref="GeneID:62196187"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="PFAM:PF00412"
                     /db_xref="PFAM:PF00620"
                     /translation="MDQVPASNAGTDTDPIKPGVPNTTTKLIQVPLCEYDYFRRIDLI
                     CFTCNKAIRGSYITAVGRKYHPEHFYCEICHKVFETEDYYEHEGQIYCHYHYSRIYAA
                     HCESCKSAILKQYVEMHRGGKEQQWHPECFMIHKFWGVDVTVDCIGLDNLPASLIEIA
                     KADEKVMTPKILFEVEHRLEQMMMFIWMTLSEFEESCAACISDMLHSATIDDKLQGLL
                     AAGKLVLKIDCLFKGINVLNDYANSCHIQIDYDSDRYRSLSALTKEPRSLSSKLMSYL
                     TFLRDTTKTKLATSKYSRELLSLISTMAHYIKLISRNSLMHALEYNRLTKSTLATDKY
                     LREVSVHDLVPKDVFPNLEISAKAKDQCSECGKSIEARCFQFDEMRWHPECLRCSKCG
                     KSLANSSVINELAFNRGKSSILCESCASEDVDAMTGFHEVSKYSQLVYLLKIALVRSK
                     YAMQKRGLIEKHGKDAGLQPNDRYSLQVSDIKRMRSLRQNRKIGNATNEIRKSIILEA
                     PEGFVADQEEADDRNIIPELPEEEEVNKSEEAPGNRTPKNYIPGAASHSIREIRDSDS
                     RTNSIISAHSTMFLKKNRSLGRKGSKRLRIEDVPMNAKPTNVNLDETSNLLKNEKGLT
                     LDDIPRIVSSEQAREYRPNAFRFQKRNYETAASTIPASKSVQKRISDVPSTISIPLNE
                     ARSRDSSIQSSMLTTEAENSTVTVIASDYPKPFVSNVKSDGVAVAATVSAHLSASAVS
                     GSHDKRFSELTPIQHDYMRHVAAFSLHKILGDELTLEDCLSFIDIRKNPSFWGKIFGS
                     SKKNSYNDLHKVFGVPLEAVAVKYGIDSDLGIGPEKLRIPTLVDELINAMHTKDLSAE
                     GVFRLNGNIRRLKKLMTSIDEHPDAVPDLYSENAIQLAALLKKFARGLPNPLLTFKLY
                     DVFILSQKFAEEPKKRDKILKLAYCMLPKVYRDLTEVLLSFLNWVATFSHIDEETGSK
                     MDIHNLATVLTPNILYSRPKITNKMPDSADLIPNGENHFLAIEVVNTMIENHDDLSII
                     PTDLLKLYKKAGLDAIAPSKDGFTTKEIIAKCRAAYDKKPSILEKIV"
     gene            <304005..>307154
                     /locus_tag="FOA43_002787"
                     /db_xref="GeneID:62196188"
     mRNA            <304005..>307154
                     /locus_tag="FOA43_002787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923070.1"
                     /db_xref="GeneID:62196188"
     CDS             304005..307154
                     /locus_tag="FOA43_002787"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038778998.1"
                     /db_xref="GeneID:62196188"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF11951"
                     /translation="MVPSLTTDLGEGKLSGSRDSEIRTDLNATQTVGNTSIISTANSV
                     VSTDTMDSTDTTDTLSAMNSSKQFSPPSVPIPAETTFPMKSSSRKPTKKRKYSRSGCL
                     ECKRRKIKCDEKKPECWNCRRLNKVCTYENLVKFNRARSFTVNRSKLVNFPVSAIEGS
                     LSSASRLNNSSTVPPSTTSSVASSSEPFLERPSILVRDSSRQIPQSNNPSTFQLPDPS
                     QMVFNNPIIPVGEQNQINENLLNGASNVISDLNDMIQHFGFDFGTYSQHFDNNMFPAQ
                     RGSCRNSVPEISPVPASYPSENVVSNSPKSDENYVKRLTKTKVDSPVREESQDECFAA
                     SSASVNSMALLASVADDSTYIIKSPTTPSTSAASTSAASTSTTSSSSLVAYPSPPLFI
                     LMSDSPSRFEYLHVLNNTINISDLVSLAKFFNWKLTSLHINYLKIFVTKIHMNFLPFT
                     TSFLNNAYISCFLSQAKPAPHLLFALLAIAAKYKMYQVARTITDGDSQREKLTYHRKF
                     RSYYLSSCLKSLSTIMHSKPQIFGNIESLLLTILVLASDCSGNKGSEWRAHLKGAKDL
                     LLKYCKFRPMSLALVIVWLWFYSMETLAGLTAYNGGTIHDFDELQDFLEVIKSTNSNV
                     GMALKKFGFLFGGYHVDNLDNPILQKTDIVPVTDKSESDGPKGAPNECDADENYIVVD
                     GHRIKKLVNYDLYIGYNDDVIDIINDIVVAVESLRKFSTKQFDSRINDVLNSCGNVRN
                     EYLVSLVAKISKARSFTIVGNKAPFRILIQSPYHPLNTKGYHYNNPTGVNVVLSGYIH
                     NTNKNTCSNDDNKNWYSWFDLSQQLYVDATLLKVLTGPHFFSEEGLSIKSSLVQGVVE
                     RMMSGLHCLITYRDSVSDENLESLRVYYNEPEGSNDDESNDPENESADDVNDSENSSG
                     LISDFETTNDDAPERLHIKEEYELRNDRDIRGGNKRFKVCLGKQEIQFEKYLYYQFDN
                     RLVMVQWPLFMCGLCCIEPKQKLIIDCCFNALMSLGVGSSKIMLTRLVKVWTLQKRGK
                     FDYSSQHLFDNEDDSVPFT"
     gene            complement(<307177..>308604)
                     /gene="HOS2"
                     /locus_tag="FOA43_002788"
                     /db_xref="GeneID:62196189"
     mRNA            complement(<307177..>308604)
                     /gene="HOS2"
                     /locus_tag="FOA43_002788"
                     /product="histone deacetylase"
                     /transcript_id="XM_038923071.1"
                     /db_xref="GeneID:62196189"
     CDS             complement(307177..308604)
                     /gene="HOS2"
                     /locus_tag="FOA43_002788"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_038778999.1"
                     /db_xref="GeneID:62196189"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="PFAM:PF00850"
                     /translation="MPTPLLSSMPKYDWLDDESTISGDAKTNQYTPFFEPIVHSFQDG
                     GYNPNVSYHYNPAASQYHYGVMHPMKPFRLMLTDHLVLAYKLYEKMDCYMPRRATEKE
                     LLEFHSEDYIKFLQSVTPDNVQKFSEQLSKFNINDDNPVFEGMYDYCSLYAGASLDAS
                     RKLISGMSDIAINWSGGLHHAKKYEPSGFCYVNDIAMAILNLLRVYPRVLYIDIDLHH
                     GDGVQEAFNLTDRVMTVSFHKYDGWFFPATGNYDEIGIGNGKHFALNVPLRDGIDDES
                     YIRLFKSVMEPVITKFRPSAIIQQCGADSLGHDRLGGFNLNIRAHGECVKFIKSFGIP
                     MICVGGGGYTPRNVSRLWCYETSVMTNVELNSRLPDNLPFRSFFKPDYSLHPNLGGGI
                     KNKNTKEYLESMRCHALENLRYLDAAPSVQMQEIPPDIQNIDDEEEKDIVDRLEKESA
                     KSHYMNEQRYWISSKDDVRPGELVD"
     gene            complement(<309340..>309702)
                     /gene="RPS10A"
                     /locus_tag="FOA43_002789"
                     /db_xref="GeneID:62196190"
     mRNA            complement(<309340..>309702)
                     /gene="RPS10A"
                     /locus_tag="FOA43_002789"
                     /product="40S ribosomal protein S10-A"
                     /transcript_id="XM_038923072.1"
                     /db_xref="GeneID:62196190"
     CDS             complement(309340..309702)
                     /gene="RPS10A"
                     /locus_tag="FOA43_002789"
                     /codon_start=1
                     /product="40S ribosomal protein S10-A"
                     /protein_id="XP_038779000.1"
                     /db_xref="GeneID:62196190"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF03501"
                     /translation="MLMPKSDRTKIYQYLFQEGVLVAKKDFEIQHDDIETRNLYVIKS
                     MQSLTSKGYVKTQFSWQYYYYTLTDEGLEYLREWLNVPEGIVPKTLLVDAVPERAQGR
                     RFNPRRGDDEGYRRRNRD"
     gene            <311277..>312932
                     /locus_tag="FOA43_002790"
                     /db_xref="GeneID:62196191"
     mRNA            <311277..>312932
                     /locus_tag="FOA43_002790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923073.1"
                     /db_xref="GeneID:62196191"
     CDS             311277..312932
                     /locus_tag="FOA43_002790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779001.1"
                     /db_xref="GeneID:62196191"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030379"
                     /db_xref="PFAM:PF00735"
                     /db_xref="PFAM:PF01926"
                     /translation="MSSEPIKVVSLASANNPVDRINMSTGIDKPFETQISTSVTAVTA
                     ANTVAATAGTAELVTCDIPDLDKDLDDEAYSQYHYNYASALDGVSEENVGLTCLPIQK
                     KTQTFRKGVNFTIMVVGESGVGKTSFINTLFDSKLIESDITSSAADLSEDELQIHLPA
                     GNSFEKKTTRITPYRMDLIENNFKMRCTVIDTPGFGDYIDNKYCWYPITRYIDEQYRK
                     LVYQETQPNRSTLVHSEVHVCLYFIKPTAVGLTILDIEALKNLASRVNLVPIISKADG
                     FTDNELSSFKQKIRESLKINGIECCQFVRDSKTAEDMISRMPFSIINSTDCYKNEDKG
                     LVRARKYSWGLAEVENPDHCDFLMLRAFLMGSHMGDLILSTENYYEKYRRDFMRFRLG
                     ISVQKVLATPELEALGLEVKEYPTNVNSFNNTTPRSKSSWKSATLREAKAGAVESRIS
                     SQSLDQLTNSQDAVTVLKLMDKFSLTSTEKELVLLNPAYLDLEKYVKQKFTADVRKEN
                     IRFKSWKRALFERQDKFNRDIDQIHDRVHRLQQEIKKLGGEEP"
     gene            <314203..>315327
                     /locus_tag="FOA43_002791"
                     /db_xref="GeneID:62196192"
     mRNA            <314203..>315327
                     /locus_tag="FOA43_002791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923074.1"
                     /db_xref="GeneID:62196192"
     CDS             314203..315327
                     /locus_tag="FOA43_002791"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779002.1"
                     /db_xref="GeneID:62196192"
                     /translation="MGLGTKQTTVTGIKLHNQCLKSGTRHFSMLDDFESGNTNLNDII
                     EIPLGSGDKSLATGSTSAGPKMDGEAMQGFNFNEYLVKFALNRSVVMDYTYGNTIRKY
                     SEVNLDFNNVTKTTVEEDEEEDKDGDDSLDLDTQVRSNHFDNYKDSKEVVEMDFGRDI
                     RKFLDEKDKEKKEYSKEDDIYGFSFTQSYQSRPEIYNDDAYYRNQHQDNAKKSPGRVC
                     SPTHRRKTRPWRSNIKVRKNLLNLIVESSDGSLDDATKYATEINSQNSSGIPLPEKTT
                     ELVTIPTTGQSIGGIRKAAIVRATIAKAGVSVSEGEMRVKKEEEHAGFYTAKEKMKFV
                     KAKESVNVDKENAPVVSTGNKERLLTQSGRGVKWARTLEW"
     gene            complement(<315414..>316781)
                     /locus_tag="FOA43_002792"
                     /db_xref="GeneID:62196193"
     mRNA            complement(<315414..>316781)
                     /locus_tag="FOA43_002792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923075.1"
                     /db_xref="GeneID:62196193"
     CDS             complement(315414..316781)
                     /locus_tag="FOA43_002792"
                     /note="CAZy:GT15;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779003.1"
                     /db_xref="GeneID:62196193"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01793"
                     /translation="MNPLRLRASVLLSTALLILVIWNIRQNSGNPGSPAYQTRDVYQT
                     RDDSRLHLLSAPNSKFSERKETLDDGETIIYHKDYTEDLVRENATLFSLVRNGELYDM
                     LRTIRNFEDRFNQFKHYGWIFANDEKFTESFQNQVKNLCSGSVTFVHLPEQMWNYPEF
                     IDRAKADQARRKMQRQQIKYGGSESYRHMCRFFSGVFYRLEAMKKYRYFWRVEPDVEF
                     KCSIKYDPFEVMRKENKMYGFTLAPLELHTTVPTLWNSALEYMAKYPERIAQDNNFLF
                     LTDDDGKTFNMCHFWSNFEIGDLDFFRSDKYNHFFNFMDHKGGIYYERWGDAPIHSIA
                     VSILLPHNRLKHFTSTGYLHKPNLQCDGSSEMMIENECICSPEDDGSWGDQSCIPKIY
                     DIHKDWQRPWYAPKERYLPIHDNILRMMEEKRIQLREEGITEEVIEVRMNEYLASIHS
                     PEEGE"
     gene            complement(<316915..>319372)
                     /locus_tag="FOA43_002793"
                     /db_xref="GeneID:62196194"
     mRNA            complement(join(<316915..318374,319366..>319372))
                     /locus_tag="FOA43_002793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923076.1"
                     /db_xref="GeneID:62196194"
     CDS             complement(join(316915..318374,319366..319372))
                     /locus_tag="FOA43_002793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779004.1"
                     /db_xref="GeneID:62196194"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="InterPro:IPR036837"
                     /db_xref="PFAM:PF01545"
                     /translation="MVLTAKTSFQIAIRTNTTMSLSRKEVKIISLMTLDTVFFLVEII
                     IGYLVNSLALIADSFHMLNDILSLSVALWAVNVAKNRVADAKYTYGWQRAEILGALVN
                     GVFLFALCFTIFIEAIQRLISPPIITNPQLILYVGALGLASNIVGLFLFHDTSDHSLS
                     SSHTHSHEQADDLEVGESSTSEYGTMVNGHGINGVFKGTPSPLTSSMGPQPDDSDIEN
                     VLPSVVVSELDRSASGEISLSSSSSPNSSPAHLARRRRKKGQKTRSLNMEGVFLHVLG
                     DSLGNVGVMVTAILIWKTDYKFKYYFDPLVSLFITCIIFSTALPLCRSSSRILLQGSP
                     ITIDSDEVKNAILHIPEVISVHDFHIWNLTESYLIATMHVDLNCSPEKFLAVASNLKS
                     HLHDYGIHSATIQPEFSDYYAKVNMLPKRYSSSQNLPGLAGTSSASANSATANESTAL
                     LESSASVRNAGKNDSSSNIHCMVDASAGCTMSDCVNQS"
     gene            319797..319869
                     /locus_tag="FOA43_002794"
                     /db_xref="GeneID:62196195"
     tRNA            319797..319869
                     /locus_tag="FOA43_002794"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:62196195"
     gene            complement(<320202..>321089)
                     /locus_tag="FOA43_002795"
                     /db_xref="GeneID:62196196"
     mRNA            complement(<320202..>321089)
                     /locus_tag="FOA43_002795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923077.1"
                     /db_xref="GeneID:62196196"
     CDS             complement(320202..321089)
                     /locus_tag="FOA43_002795"
                     /note="CAZy:GH132;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779005.1"
                     /db_xref="GeneID:62196196"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="PFAM:PF03856"
                     /translation="MITALTYILCAFALVEAAPVSKQHLHHAHKRDNTCAFPNDDGMV
                     KLGQNGGWAQDGDCKAGDYCQYACKPGYLMGQWNPQVTSYTYPGSTEGGLFCNDNGEL
                     EKPITDNDYCYEGKGTGSVSNLASQDVAFCQTVLPGNEAMLIPTEVSASGSEELAVPG
                     TDYWASTAAHYYINAPGVSTEDGCQWGSTANPIGNWAPYVAGMNMDDSGNTFAKIGWN
                     PVYFEDSSPFKNEKPNFGIRLKCNDPSKCNGNTCEINPSTYGLNAVSVSQQADSDGAA
                     WCMVTATDSSAITIEVFDL"
     gene            <324243..>326639
                     /locus_tag="FOA43_002796"
                     /db_xref="GeneID:62196197"
     mRNA            <324243..>326639
                     /locus_tag="FOA43_002796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923078.1"
                     /db_xref="GeneID:62196197"
     CDS             324243..326639
                     /locus_tag="FOA43_002796"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779006.1"
                     /db_xref="GeneID:62196197"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR033133"
                     /db_xref="InterPro:IPR033712"
                     /db_xref="PFAM:PF00806"
                     /translation="MSDQTTLSSAEESSLNADVTTTTTPPSDLTSKEFKQSTISMSAP
                     SSITKQPRSSHFDPSLDDIGSVLANLSLNSVGVAGPQEDSSFLSDVGPQQQQQSNWSS
                     FSQSILPELTKTPDRRDDRRVISPFASSPFVLPDHNGKNINNNDGSAAASVSSSSLGP
                     PLMGDSGSNAASTANSSTSNDSRRMTFPLQSPRDQNQDTITSVESPFSSAALHPAFTN
                     DMLSIGMNYPSLNGFDAFQSPQTTPTTPSLGPVGPVRPMGAPLNSASSAQSVPSVSPP
                     TGFGMMPPMGYQMSSQTFGQSQQQPFMVPQFRNSGSVPMFGMKRPTSVLSQPKVRGVV
                     QGADSQVASANSNSEVDNATAIGVGSPRSLSGTANVHRKHSSSKRRGEDAARFVNASL
                     NDFTNEIYYLCKDQHGCRFLQRQLEIGGPDAATQIFNEIRLNVIELMIDPFGNYLIQK
                     LLERVTEEQRTTLVRNASSQFVRIALDPHGTRALQKLVECVNTQEEFDIIVNSLSSYV
                     VLLSRDLNGNHVVQKCLQKLPPESCNFIFDAACENCVKIAKHRHGCCVLQRCFDHGTP
                     KQCEKLSLKVGENCVELSTDPYGNYVVQYVLSMEENRLRSQNDPVSVTKTPNTKHSID
                     LIISALKNNLVRLSTHKFGSNVVEKSLRIPTLAPVLIGQLLKEPDSPILLLHDAYGNY
                     VLQTTLDVADDHSFKELSELLKSAISDVRNTPHGRRILSKLISRGGASSSVGYVTTPG
                     STAETGLLASNDNNTPQQRYPGVLEISVSNPGSINNREAPMAGLGTFGNTRSLNGYSF
                     "
     gene            <327735..>329132
                     /gene="ERG4"
                     /locus_tag="FOA43_002797"
                     /db_xref="GeneID:62196198"
     mRNA            <327735..>329132
                     /gene="ERG4"
                     /locus_tag="FOA43_002797"
                     /product="C-24(28) sterol reductase"
                     /transcript_id="XM_038923079.1"
                     /db_xref="GeneID:62196198"
     CDS             327735..329132
                     /gene="ERG4"
                     /locus_tag="FOA43_002797"
                     /codon_start=1
                     /product="C-24(28) sterol reductase"
                     /protein_id="XP_038779007.1"
                     /db_xref="GeneID:62196198"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="PFAM:PF01222"
                     /translation="MSQLKERKIKEHAGDSQDSVKDSTTVCKADEFGGPIGNLGMMIG
                     FPQLMYYMWISERFYGGDLAWPKPDQQWEDFFAQYFGYIRDHAIPSWYVVEIFTVFIL
                     AQVVFYVTLPGTWTKGQPLKHLNNKQLSYFCNAYVTFYVNIIIVFFLHVTGVFRIYDV
                     LDYFGEIMTCAIIAGFSFSILMYLYTLFISKDCHRMTGNPIFDMFMGAPLNPRIGIID
                     LKMFFEVRLPWYSLFLIGWAVVAKQIDVYGKASPQAWLLFTAYYLYANACSKGEDLIV
                     PTWDMAYEKFGFMLIFWNIAGVPYSYCQGALYLYYHDPSEYSWSTSYNGFCFALLFIS
                     YYFFDTANGQKNAFRKQIAGDKNIRKSFPFLPYQVLKNPKYIKCKNGSTLLIDGWVKY
                     ARKTNYTADWLQSCSWGFICGFDSYLPWFYAAFMFVVLIHRAFRDLAKCRKKYGADWD
                     RYEKECPYMFIPYVY"
     gene            complement(<329158..>329984)
                     /gene="SCL1"
                     /locus_tag="FOA43_002798"
                     /db_xref="GeneID:62196199"
     mRNA            complement(join(<329158..329924,329978..>329984))
                     /gene="SCL1"
                     /locus_tag="FOA43_002798"
                     /product="Proteasome subunit YC7alpha/Y8 (protease yscE
                     subunit 7)"
                     /transcript_id="XM_038923080.1"
                     /db_xref="GeneID:62196199"
     CDS             complement(join(329158..329924,329978..329984))
                     /gene="SCL1"
                     /locus_tag="FOA43_002798"
                     /note="MEROPS:MER0000557"
                     /codon_start=1
                     /product="Proteasome subunit YC7alpha/Y8 (protease yscE
                     subunit 7)"
                     /protein_id="XP_038779008.1"
                     /db_xref="GeneID:62196199"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR034642"
                     /db_xref="PFAM:PF00227"
                     /db_xref="PFAM:PF10584"
                     /translation="MSGSAGFDRHITVFSPEGRLYQVEYAFKAINSSNITCLGIVGED
                     SAVFVSQKKIPDKLLDPQSISYIFQISPSVGMLATGSIADGRSLAIRARSESAEFKYK
                     YGYEMPVDALTKRMANLAQVYTQRAYMRPMGVSLMFIGVDDELGPLLLKTDPAGYYSS
                     AQASATGPKQQEVGTALERAYKKKVKNGDRDEDGKRKLLVPGDWTKVLEFAITTLGNT
                     LSTEFRKNDLEVGVATKDGFRVLSSDEIDERLVSIAEQD"
     gene            <330286..>331331
                     /locus_tag="FOA43_002799"
                     /db_xref="GeneID:62196200"
     mRNA            join(<330286..330291,330459..>331331)
                     /locus_tag="FOA43_002799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923081.1"
                     /db_xref="GeneID:62196200"
     CDS             join(330286..330291,330459..331331)
                     /locus_tag="FOA43_002799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779009.1"
                     /db_xref="GeneID:62196200"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /translation="MTRLPPNMSRHPYIPVPPTIINNYYYVQPQQQQQQQQQQQQQQQ
                     RQYQRQRNISHGSPISPPQPIASRMPSMSVYEGHSTDDSYESSDIYTSLSLVSPRLRR
                     GRDEEGFGDYNSSQAKIPEISLNDGIYTSGISGDTVYLDLIGQLCHTDDTAISVHNSQ
                     LFAVFKAFNKDLIDNSDLSELFIDAGTRRKFAESSCRTLAKVFSTRSSPGSLDFRCFI
                     KLCAFVKGCCESFNYYDSNKSHTLEYEELIKALRFNGMSSPSELMARVFKYSDYVTLE
                     GFIMAVIIIRKNERRS"
     gene            complement(<331338..>332993)
                     /locus_tag="FOA43_002800"
                     /db_xref="GeneID:62196201"
     mRNA            complement(<331338..>332993)
                     /locus_tag="FOA43_002800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923082.1"
                     /db_xref="GeneID:62196201"
     CDS             complement(331338..332993)
                     /locus_tag="FOA43_002800"
                     /note="BUSCO:EOG09343MSE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779010.1"
                     /db_xref="GeneID:62196201"
                     /db_xref="InterPro:IPR006751"
                     /db_xref="PFAM:PF04658"
                     /translation="MPTIKLRLSTKGGSSQAASTKKSVSRSSSRPKKIKLEAEDSIHL
                     PKIKVKQLKSKHTKRTRKRHDEVEMAVRKITVKAPKVKVPTIRVKPTMIPGDGYDSED
                     PDREDDPLIEEGIVLRMLADESLDTLRACVESGDTSGIAVKWKDKRRAVLKINNVQYG
                     GKLVNLPTVIEVHKSLDKKNIYKAMDVCQMLLITRKLNSEDEVNDIPLDTEYGETYPD
                     GLTPPMQNSKTRFRRCYEEQVIQNVEDEVERLLKLDEEAETTNYEFMDLNMLNNPRAR
                     MALSNLHRKKRRSKESKRAKQRQEKNDKEKQEEKMHTERAEEDLDSELDKLIGEDEDE
                     DEDEEEEDEELDRALAATLDGTSGGILTKARVEDDEGEVEEVVEGAPTEVGIEEDEEE
                     EDDEEEDDEEEDEEEEEEEEDDNGIKPRAAFGKGGEIDESKQHNAILREEIYELSSTI
                     EQKQSDLIKANNPIMKNRINDVINRLKQELDIKKGQIIEPKEKKEDEKEDEKEDEKED
                     EKEDDEAEGGEEEGEDEAEGEREGEREGEGEGEGDDDDLEGLF"
     gene            <333219..>334286
                     /locus_tag="FOA43_002801"
                     /db_xref="GeneID:62196202"
     mRNA            <333219..>334286
                     /locus_tag="FOA43_002801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923083.1"
                     /db_xref="GeneID:62196202"
     CDS             333219..334286
                     /locus_tag="FOA43_002801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779011.1"
                     /db_xref="GeneID:62196202"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR023165"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF00398"
                     /translation="MFKKLESISKKAADFPEAMRMVKQNHICPKLFFEKDIYTEILDK
                     LDLKCQYPQASKTLGIIDYHTGFTPFSYFLETELNPKHHVLFPESVAASKFWKHMISK
                     DPNCKGMIMDDDQANRVLKHSFLNKVLEKGELEPKEETDLSKVNQSALITGNFVDSSG
                     GDSLRILLFFNQMKTSIFQFNNVKLLSWMPSSDALKFIGPLGSRHRRSNALMTNLFCN
                     VNVIAYSNFDNKKSVDGILGKYKKAVKLPQISGQKDVCLMEFQSSYDKYKIQFPDELH
                     LVIHKLLISPSNKIIDNLHTLGPGAEEYLETKIDPEVLQKTAPNITEQEFIDISEAYY
                     YWPFKPNTQLETYLGDPPQDE"
     gene            <334557..>335627
                     /locus_tag="FOA43_002802"
                     /db_xref="GeneID:62196203"
     mRNA            <334557..>335627
                     /locus_tag="FOA43_002802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923084.1"
                     /db_xref="GeneID:62196203"
     CDS             334557..335627
                     /locus_tag="FOA43_002802"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779012.1"
                     /db_xref="GeneID:62196203"
                     /translation="MDAEEDALHFIVDPSALVYGGIGRIKEWVKNDKYYPPIVYYIPH
                     YTLLELDFLKKTFNPLIAKNARESIRFFDSSISGFELPESSEFTEPSDSLVANESSDD
                     DMSSPSSSSSDLLDDISDISDFESYNKRKEDLLTEHSAKEGVIHKPKQPKSQFILEPP
                     EAAGPGWKKTSEYRMRTPLCSEFATGSGSARETVGVFGNRLLFANIKKGGVDNYRSKE
                     SGYADNGEEKAIIPKRLKLLIRSAIQKQFIDRKKNSSVKDINWTVLCEDETTCTWLKC
                     FGLPMMTLNEADSKLNEWKQKTTSPHASTSKSSSSFRYVPPHRVKESLNSTRHLCEDG
                     VYRENFKETKYAPRGRGELWKP"
     gene            complement(<336145..>337437)
                     /locus_tag="FOA43_002803"
                     /db_xref="GeneID:62196204"
     mRNA            complement(<336145..>337437)
                     /locus_tag="FOA43_002803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923085.1"
                     /db_xref="GeneID:62196204"
     CDS             complement(336145..337437)
                     /locus_tag="FOA43_002803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779013.1"
                     /db_xref="GeneID:62196204"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="PFAM:PF08613"
                     /translation="MEEISVKLKPQQPTFEDDKGETNTKEGDGELDEKITKEKGQESE
                     QDGNKEEDLETNREDGKCFKQDTSDSKNGSLNKEDSSLSGTKERSPERIRPPAISSVN
                     MDLFIDNKIDKLGCLNDLKQIEAMAFFKRLVDDLMTLDYVVKEDPEIDLRSLLFDNMH
                     DVLTPGQDLCDEINDDEGSVDSFTDDNRDRFPTLLEKPMSQLKDEKRTDRNSALEKLK
                     SVSNEQLEVPLRKNSRIDANFEDASETAFTDDDFRRKSGSYHQNIDHELCTKIIQKFY
                     LKQAPSLSITQYLERINKFITPSPAVLLSASYFLFNVAFDLKPENNCSLLPLQSPPEE
                     EGPIKMTSVDSLDIFRLVLSALRISLKLIEDKNFKQAYYCKITGLQHIDDLFKLELAF
                     LYLLNFNLFINEFSLTRFLFQFKVFDTNLRRYLKSRTV"
     gene            <340571..>343591
                     /locus_tag="FOA43_002804"
                     /db_xref="GeneID:62196205"
     mRNA            join(<340571..340574,340647..>343591)
                     /locus_tag="FOA43_002804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923086.1"
                     /db_xref="GeneID:62196205"
     CDS             join(340571..340574,340647..343591)
                     /locus_tag="FOA43_002804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779014.1"
                     /db_xref="GeneID:62196205"
                     /db_xref="InterPro:IPR016024"
                     /translation="MPFVLCVTAAGSYAAGVSRNDVKSYDGESEETSKIAPLKLYEAE
                     ANYVISKLPLVDSSPEVPSLAKRDLISDINSALDILLAFVPSRISSVVELIPDLVTAL
                     LEAILNCGGLLDDLLTTIESVITDTLEGASSSVQNVGTILVSLINAVFDSDDVNVLVY
                     VNELANAIITIGLTGTAAELATVNDLLTNVIQAIEDFDQTCTATTATTATTATTATDT
                     TDTGTDTTGTATTDTATSTSTSTNPITEIIDEINTILEPILALLPDNVSSVIEVIPEI
                     VEALLNAVLNCGGVIDDLLTFLGTVIDSAVEGASDVVQNVGTLLSELLTAVVNNDTAS
                     ILSYVTQLANAIVSAAAETTTDDLEVIGTLLNNVLQAITDFDQSCTVPTDTGTATTDT
                     GTDTGTDTGTDTGTGTTDTDTGTGTTGTGTDTGTGTTGTNTDTGTGTDTDTGTGTTGT
                     GTDTGTGTTGTNTDTGTGTDTGTTATGTGTGTGTTGTGTDTGTDTGTGTDTGTGTTGT
                     GTDTGTGTDTGTGTTGTGTDTGTTGTGTDTGTTGTGTTGTGTDTGTGTGTTGTDTDTG
                     TGTDTGTTGTGTTGTGTDTGTTGTGTDTGTDTTGTDTGTDTTGTGTGTGTTGTGTDTG
                     TDTTGTGTGTGTTGTGTDTDTGTGTTGTDTTGTGTGTGTTGTGTDTGTDTGTTGTGTD
                     TGTDTTGTGTGTDTGTDTDTTGTGTGTDTGTDTDTTGTGTGTDTGTGTTGTGTTGTGT
                     DTGTGTGTGTGTGTGTGTGTTGTGTDTGTDTGTGTDTGTTGTGTDIDPDTGKTHNGKT
                     GTGTKGTGFITKSEEPVKTTTLTITSCKDHKCSQSVVTTGVTCYTTNGPQGTTIITTY
                     CPLTDVPSKNVPLTTFVTVTCVEEVCKTSTVTTGLTSYITTTGEQGEVSTVTTFCPTE
                     QLTTPVSVTPVPITSVPGSSIASQTTTLTTSNNIPESVTSSISTFKGAAAVARYGSLM
                     VLPLFVAVIL"
     gene            complement(<344352..>346391)
                     /locus_tag="FOA43_002805"
                     /db_xref="GeneID:62196206"
     mRNA            complement(<344352..>346391)
                     /locus_tag="FOA43_002805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923087.1"
                     /db_xref="GeneID:62196206"
     CDS             complement(344352..346391)
                     /locus_tag="FOA43_002805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779015.1"
                     /db_xref="GeneID:62196206"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="PFAM:PF00012"
                     /db_xref="PFAM:PF06723"
                     /translation="MYKRSTVSITALLLYAVLLVIIPFAAKGSTLVNADKDAEDYGTV
                     IGIDLGTTYSCVGVMKAGRVEILANDQGNRITPSYVAFTEEERLVGDAAKNQASSNTN
                     NTVYDIKRLMGRRFDEKVTQKEIRHMPYKVINQKGRPVVEVTVSNETKQYTPEQISAL
                     ILGKMKRISEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGIIAGLNVLRIVNEPTAAA
                     IAYGLDKGDEEKQIIVYDLGGGTFDVSLMSIAGGAFEVLATAGDTHLGGEDFDYRVTR
                     HFVKLFKKKHQIDITKNARAMSRLKREIEKAKRTLSSQMSTRIEIDSFADGIDFSETL
                     TRAKFEELNMDLFKKTLKPVQQVLKDAKVEESEIDDVVLVGGSTRIPKVQELLETFFK
                     GKKVSKSINPDEAVAYGAAVQAGVLSGEEGVEDIVLIDVNPLTLGIETSGGVMTTLIK
                     RNTPIPTKKSQIFSTAVDNQQTVLIQVFEGERAMAKNNNILGKFELTGIPPAPRGVPQ
                     IEVTFTLDSNGILKVSAIDKGTGKSNSITITNDKNRLSKEEIDKMVEEGEQFAQEDKG
                     LREKIESRNAFENYAHSLKNQISDTNGLGAKLEEEDKETLEDAVNEALEWLDESGEDA
                     SKEDFEEQKEKLSKVAYPITSKLYGGAAGDDGEAYEADEDEEDDEDDDDWDHDEL"
     gene            <346799..>349144
                     /locus_tag="FOA43_002806"
                     /db_xref="GeneID:62196207"
     mRNA            <346799..>349144
                     /locus_tag="FOA43_002806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923088.1"
                     /db_xref="GeneID:62196207"
     CDS             346799..349144
                     /locus_tag="FOA43_002806"
                     /note="BUSCO:EOG09341POR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779016.1"
                     /db_xref="GeneID:62196207"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /translation="MSVTKLAKEISTRFASLEFIPTISDSETEEIPDLDDDNDNEKKT
                     DGEDDEEEEDSEVGKDETAKIAKTDKKKKKKKSKKSKNQEDQEQNEAGDLNPDFTFDL
                     GDDLDTNGFEGWDFDPEEGKEKEEKKDVDLDSIIKRKGGLSGKLSVNEEPKKPEDVLE
                     KEEKDDSDDDELAMDGFGMGAKGQEEKKNEEKMAANDKNNNDDDDDDDDGGFDATINA
                     LYDTADQDEDEEEKQKDSAKAIEKFYDSHEGESAQKTLYKDFQSLNLSRPVLKGLSAL
                     GYSKPTPVQSASIPIALMGKDIVAGAQTGSGKTAAYMIPIVERLLYKPTKVSSTRVVI
                     LAPTRELAIQVADVAKRVSRFVGGITIGMAIGGLNLRRQEQELKTRPDVVIATPGRFI
                     DHVRNSPSFNVDSVEILVLDEADRMLEEGFHSEITEILELVPQKRQTLLFSATMNSSI
                     SDLIQLSLRKPVRIMIDPPKAAAAGLLQEFVRIRKRETLKAALLFSILSKLDSAEQIR
                     IMVFVATKNMAHRLRIIMGLLGLKVSELHGALTQDQRLKSITDFRKLTVPILICTDLA
                     ARGLDIPKIEVVINFDMPKSHEIYLHRVGRTARAGREGISISFVGEAVRERRIVRESI
                     KQVETAHSGKAVGRKVNWDDVEKINDVIEGKREVIKDILEEEKGEKEMIQAEMELKKG
                     ENLLRYKEEIQSRPRRTWFQSEREKKEEKVIGAMGKLKKITSKKRKAEEARESDNGSN
                     GRSYKKTKRDRIEDQSGERRKKEITKKKQKKRAKKARKRMD"
     gene            complement(<349208..>355480)
                     /locus_tag="FOA43_002807"
                     /db_xref="GeneID:62196208"
     mRNA            complement(join(<349208..351053,351573..>355480))
                     /locus_tag="FOA43_002807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923089.1"
                     /db_xref="GeneID:62196208"
     CDS             complement(join(349208..351053,351573..355480))
                     /locus_tag="FOA43_002807"
                     /note="BUSCO:EOG093409VG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779017.1"
                     /db_xref="GeneID:62196208"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012501"
                     /db_xref="PFAM:PF07928"
                     /db_xref="PFAM:PF16457"
                     /translation="MDDSSISLGINKLSEASVSPLGQNSVYELVENTNYRHRATATGL
                     LTIGSSSASVNVKGPSIKDIPATSLTKIKKVKDQQFGPYLNTIADAYKEFHSHKTLTE
                     STLEAFMTQLSNEERKKEKARRKTANASVNTDYGLTEEEEAQMDSNSLEQVSSVYFSD
                     DFRLDDPRVFNEVVGNAIILEDTVDFNEDGQQKPLINNEEVQDKLSSYLDIVEIHLIH
                     EISKSSGSFFSALGDLKNITKQSDSLTNQLHNVDSKLESLDKDRAHVAIQMLKLTQKR
                     NNVEKLEQALLQISTILQQADLAESSYFNANYEKALQLTEAVFSLINGNNPKNQIVDK
                     ITCRWPYPLFDLSAVPALTSLKRLLGNLTTDTGKSLARLFGDFLLEDLRSHYENASRA
                     EVMDRLASNLSKNNRLNRKSLQPPGYQVVTDEFKQQIHKYISEMSRCGELASAYKLYE
                     ERFLAELKTIIKSFLPTDILENIGQPETSISGRSDETRSTTTQRSGMGGLSKNVRAMT
                     PKEFEDMLVGIYTQLSEGFRRLITQKKLLLEMGLDCLAEYDSRYMDEQPDVILQLDIT
                     NAITAAINVTQRRMAKLINVREVQNSCVTLDYFLRLYSVNVMFLMECELISGGRIASP
                     VLQDIINIQFQKFTVQYHRASLKILSGKIEKETWRECLLPSSLQKLTNQIAEAAKDGF
                     DESVWMNPMNLELRPAKPREEAEEENDDKNIDPTQRKTLMIGDKSYIVPEIVSTVLRM
                     VQSYEIIKMQFPKVDNGNIIELFKLANLKIHQSVLGAQATRTAGLRNITSKHLAVTSQ
                     LLGFLSALIPSVIAAFDRLSKVGSFVETEFKKVQQMFSDQQTEIFEKLVSIMVDRVRA
                     QSSEIRSTDWSTPLPRQQVHHYMESLVSKTLTIARILLRYLPESQYTLILSKIFGQYK
                     RVLTDIYSQVKLKDSVDKAVMMRDVDYFREKLADVAGYGNSGQIIWENINALETEEDS
                     RTQQPQQVSLPEEKPLPKKPEAAKPEAATPEAANPGAAEPESAKPEAEKAESAKPEAA
                     IPESEKPESEKPEAAEPEAAKVIVTPSISDQRDREPEKQIGKSSDSGERVEGADKEEM
                     EKSDGEWKRDAKCEANTEEVDKPIEEKDEEVKKGDAVEKVGENIEEKDIKENAEEVEE
                     EATTDVEVEKKVNKEKIEPKESKSMSLEGTTTKTSLQDVSPKDIGREEPYNSTEKSEN
                     GANTPTKEVGLKALKEPENGNGKEEVDNSKKTEYLGAETGEKIYESVRGSSTEKSQEP
                     AKSDKTESTETQILKPVETAAMTTNTSSNQRKTKKDRRRKKLEEGEGIGYVKALKQAI
                     MGPDEMAQFNSIIVLAKMMDYLPKSDHIFSLFDSKLFACLLDASCRPSAANEAIRAVL
                     RICLIFLWGVLPETKPSNMYDPLLWNVCNNHSFFENLSSKLSEQDLRLALASVDFVSQ
                     LLYRTYDLKNPDIILSEIRCLMDSHFFDSISMLPYEFKSRLDSFSALRKSSKLILKYL
                     STAPLRNDPFSGLVNECILVIDRILNECGSGQKFNGRRNSTDYSKVGLLETVDPQHYI
                     QQNFSSAAVIDLIYVLRNPNMTFKKNFSEHTMFATAKTYFPLLKFAVGITNLLNHLDS
                     SRYPNIAYVFTYFNDELYYSFMSSALKFWMASKAEENDFRRIMALLETLVDYCDSLMR
                     SDPFYTVTEQVVGLKYSEIKKYHLEQLKRNKATSWSTAMESFNRTIGQQVLDFVKTQR
                     FVGLSKGSWVYINNPLDKAPVSGKPVYYFLVLSSNNKSLIYKEFTRKHSHAPNIDKDG
                     IIVDFKNVVKIDSKSMTQQVQIQNLINIASRLNVSRIDICTKDEKVFSFYVDSLGLLY
                     AWLDGVKMLLNDNSALSEDTMYQIDALTKIRTNVQLIDLEDSEEKVDNDSVHSRNAET
                     KYDATQLEILASHFYYE"
     gene            complement(<355968..>357863)
                     /locus_tag="FOA43_002808"
                     /db_xref="GeneID:62196209"
     mRNA            complement(<355968..>357863)
                     /locus_tag="FOA43_002808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923090.1"
                     /db_xref="GeneID:62196209"
     CDS             complement(355968..357863)
                     /locus_tag="FOA43_002808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779018.1"
                     /db_xref="GeneID:62196209"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="PFAM:PF01554"
                     /translation="MSRTLSQMPKLMMSSNGLSINSKRRKISMTFLPPSTKSPLFVYN
                     NDYDQRSFLSLGRRSPEENTAMADEEEGSNDTESVSTFRSLPSTLEGTDDDVESMSRW
                     LDEERERRSQKSTYGSVDASQRRRSSSSELLRQADVVFQRRNSYSSSVSSKLDRENAG
                     LLSADEIDNSGVEDEEDFATEKATIASESRRLSRYSAPLVVNFILEQMFSLVCVVFAG
                     HLGKEELAAVSMASMVSTMTFAIYEGLATALDTLCPQAYGAGQPHLVGVHTQRCAALS
                     LFLFIPAAILWWYSGFFFKFILSDEKVVSLAQQFLRVLILGGPPYILFEDGKRFLQAQ
                     GIFDAGTIILFITAPLDVLLNWALVYSDTFGIGYIGSAVAAVINFWLAFILLVLFVIF
                     IDGNECWAGFTVASLHHWYDLSLLAIPGVVMLLAESMAYEILTLLASYFGTNALAAQS
                     ALSSVVSLLYMIPFALSVASSTRIANFVGSGNIPSAKVAVHVGMSSSLYSAALNSVII
                     YIFAKPIARLFTKDLDVQKLIVSLCPLMSLFVIFDGWACIASGLLRALGLQGIGGTIN
                     MVGYYLIAVPLALFLGFNCNMELVGLWLGNGFGLMLIAAAETWVIYTADWNKAVEQAR
                     ERNRACI"
     gene            complement(<372307..>374187)
                     /locus_tag="FOA43_002809"
                     /db_xref="GeneID:62196210"
     mRNA            complement(<372307..>374187)
                     /locus_tag="FOA43_002809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923091.1"
                     /db_xref="GeneID:62196210"
     CDS             complement(372307..374187)
                     /locus_tag="FOA43_002809"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779019.1"
                     /db_xref="GeneID:62196210"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="PFAM:PF08731"
                     /translation="MSRRVKPGKLEGDVFDNHTSSSHPRQGLTQLPTSSSSPSFDQHP
                     TDPALSELTNLHSITDVPSSGDPDHFANDSMDANVTAAAAAATVVVEYPFPQAAQNIH
                     KQNVTGVEEQQTDSLQYPTAQKHQPHVLLLPQQQQRKESQAQLQAQSQAQSQSELQSH
                     SLQAHPGQQVNSPLDQFNPPSSLKFQQLREPQQQQQQQQQQQHQQQQVSHMPQVVPVP
                     ELSQHASSHHQHQNINDKLDSDASAYVLSPSNQSEAYDSTVNGTSESSVDIFPEGMGD
                     PSEYLITPMIEEQMFDNVAVLKEFVKEFGRKNEFGIAIAHSNNKAIYFTCELGGTYRE
                     KKIKKSEIQSNDFQTLNSKKIGSKKIRCPFAMVANFSKKRHYWILKITENKHNHPKLN
                     PLLNFPMLRKRSSQVNETIRHMYTSGDKPSVIQQKLRSLYPSLIIKREDIYNEVRILK
                     KKRLVPTHNQMKKQKVKALIDGSSMENGQPLQQTSHQQQQEPHAFQNELHSQPSKLQQ
                     QQQQQQALQDQDGIAWSSDPYSNLPDPSKKDVDQQAAATAATAAAVAAVEAFKQGSNV
                     HQRQQNHDQHQESSTQSGQSQQNFLQYQNTDPQCQYNYASVSPHVKDQRFNIDERLLG
                     DN"
     gene            <374847..>376091
                     /gene="IDP2"
                     /locus_tag="FOA43_002810"
                     /db_xref="GeneID:62196211"
     mRNA            <374847..>376091
                     /gene="IDP2"
                     /locus_tag="FOA43_002810"
                     /product="NADP-dependent isocitrate dehydrogenase"
                     /transcript_id="XM_038923092.1"
                     /db_xref="GeneID:62196211"
     CDS             374847..376091
                     /gene="IDP2"
                     /locus_tag="FOA43_002810"
                     /codon_start=1
                     /product="NADP-dependent isocitrate dehydrogenase"
                     /protein_id="XP_038779020.1"
                     /db_xref="GeneID:62196211"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="PFAM:PF00180"
                     /translation="MAFEKINVKTPVVDMDGDEMTRIIWKMIKDKLIFPYLDLKLDYY
                     DLGIKSRDDTDDRVTIESALATKKYRVAVKCATITPDEARVKEFGLKKMWLSPNGTIR
                     NILGGTVFREPIVIDNIPRIISHWEKPIVIGRHAFGDQYKCQNIVTPECGGDLKLVFT
                     PADGSADITVPVYHYNGKGCAMAMYNTEESIKGFARASFELALSRKMPLYMATKNTIL
                     KKYDGLFKDTFQNMYESEYKNKFEKLEIWYEHRLIDDMVAQMIKSKGGFIIAMKNYDG
                     DVESDIVAQGFGSLGLMTSVLVSADGKCFEAEAAHGTVTRHYRKHQKGEETSTNSIAS
                     IFAWTRGLIKRGEIDDTPKVVKFARTLEKATIDTVRVDGTMTKDLALARDETDRSAWV
                     TTEEFIDGVAKRLANEIKNAKL"
     gene            <376180..>377260
                     /locus_tag="FOA43_002811"
                     /db_xref="GeneID:62196212"
     mRNA            join(<376180..376187,376252..>377260)
                     /locus_tag="FOA43_002811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923093.1"
                     /db_xref="GeneID:62196212"
     CDS             join(376180..376187,376252..377260)
                     /locus_tag="FOA43_002811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779021.1"
                     /db_xref="GeneID:62196212"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="PFAM:PF00849"
                     /translation="MVIWFGRSCYDVYRSEFRNMPPEHHYAKIMQHKMKLVKNPNSRT
                     NFTVYEGSQLLELIKIGPGDKIVHYEHVHEPPVLNTLPQCIYEDESCYVVDKPAGVPV
                     HPVKNYFYNTVMSLIYNERPDLEPLYPVHRLDKVTSGVLMFCKDQTTVSLFKQMMRNK
                     SVAKTYLARVSGVFPERTQCDDPIVYIYGARKEVKQFEPAKTVFAKLFYDSITDESVI
                     ECHPISGFPHQIRIHLRNLGFPIIQDYLYRDKYTEVFRQRSEVTSEYLDSLYMRSMKQ
                     RQSMESMENCKCPECQTTLYKDPSPQSLAIKLHSLRYSLWNEDTNKQWKFETQIPSWA
                     KPSH"
     gene            complement(<377377..>377688)
                     /gene="HHF1_1"
                     /locus_tag="FOA43_002812"
                     /db_xref="GeneID:62196213"
     mRNA            complement(<377377..>377688)
                     /gene="HHF1_1"
                     /locus_tag="FOA43_002812"
                     /product="Histone H4"
                     /transcript_id="XM_038923094.1"
                     /db_xref="GeneID:62196213"
     CDS             complement(377377..377688)
                     /gene="HHF1_1"
                     /locus_tag="FOA43_002812"
                     /codon_start=1
                     /product="Histone H4"
                     /protein_id="XP_038779022.1"
                     /db_xref="GeneID:62196213"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="InterPro:IPR035425"
                     /db_xref="PFAM:PF00808"
                     /db_xref="PFAM:PF02969"
                     /db_xref="PFAM:PF15511"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISALIYEEVRAVLKSFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <378298..>378708
                     /gene="HHT1"
                     /locus_tag="FOA43_002813"
                     /db_xref="GeneID:62196214"
     mRNA            <378298..>378708
                     /gene="HHT1"
                     /locus_tag="FOA43_002813"
                     /product="histone H3.1"
                     /transcript_id="XM_038923095.1"
                     /db_xref="GeneID:62196214"
     CDS             378298..378708
                     /gene="HHT1"
                     /locus_tag="FOA43_002813"
                     /codon_start=1
                     /product="histone H3.1"
                     /protein_id="XP_038779023.1"
                     /db_xref="GeneID:62196214"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF00125"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
     gene            <378962..>379501
                     /locus_tag="FOA43_002814"
                     /db_xref="GeneID:62196215"
     mRNA            <378962..>379501
                     /locus_tag="FOA43_002814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923096.1"
                     /db_xref="GeneID:62196215"
     CDS             378962..379501
                     /locus_tag="FOA43_002814"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779024.1"
                     /db_xref="GeneID:62196215"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="PFAM:PF10315"
                     /translation="MRDEINKAQLKDTVLTGVGSTVNIPTDSSGVAGAPGGSAASPSS
                     PGNSLISPGVRALLQEWSSSPYPALGFSGALAVIPTIRPVISQVATSFKKKPVLLSPY
                     PSNLSVLFFGGFVGLGGFLIYDHDVENGSALTSAWSLMYVLANGKRSLLTFRLYPKVL
                     ALLALANSGVYGGRFLGLL"
     gene            complement(<379585..>380634)
                     /gene="SIW14"
                     /locus_tag="FOA43_002815"
                     /db_xref="GeneID:62196216"
     mRNA            complement(join(<379585..380285,380631..>380634))
                     /gene="SIW14"
                     /locus_tag="FOA43_002815"
                     /product="tyrosine-protein phosphatase siw14"
                     /transcript_id="XM_038923097.1"
                     /db_xref="GeneID:62196216"
     CDS             complement(join(379585..380285,380631..380634))
                     /gene="SIW14"
                     /locus_tag="FOA43_002815"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase siw14"
                     /protein_id="XP_038779025.1"
                     /db_xref="GeneID:62196216"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="PFAM:PF03162"
                     /translation="MNISHNPAIELDEEDAYDKFEPTDRSKVEEYKKQEQKSHPHRLE
                     EFIITEPKTLQDEETKIRINRPIGVYTPPENFAMVCGSIYRSSFPRVENFEFLQTLNL
                     KSVLCLIPEEYPPENLEFNKVNGIRFFQVGLSGNKEPFVKIKPELVTEALKIITNPAN
                     QPILIHCNRGKHRTGCIVGCVRKLQKWSLSMIFDEYRKFAYPKERPLDQQFIEMYDDT
                     EIELYASERHWLPLHW"
     gene            complement(<380958..>383333)
                     /locus_tag="FOA43_002816"
                     /db_xref="GeneID:62196217"
     mRNA            complement(<380958..>383333)
                     /locus_tag="FOA43_002816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923098.1"
                     /db_xref="GeneID:62196217"
     CDS             complement(380958..383333)
                     /locus_tag="FOA43_002816"
                     /note="BUSCO:EOG09341T2T"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779026.1"
                     /db_xref="GeneID:62196217"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="PFAM:PF06862"
                     /translation="MIDGKMREQRQFDKMNTGKGKKEAGSLEPRRKMQKTKSGRKEPR
                     QINRSMVRHKKANHEEEEKEATENEDESKTVINHGNSDDDFDGSEDDNEEKGDRKMVY
                     GTLVSMLRSDYPDREEKVDDEVEIFSKGVEEEVGEEVSDDNNEDEEEGGPMDEGDMVA
                     DDDVHDKFDALNLHFNDEERISELISRYQNILNNSKPHRILRLVNRSRFEDEKYVKLD
                     YRYSEVTETQSSSTKELDLESRLKHHNVRDRIQQKFAEQKPVTQLEIQFIESLLSYQS
                     IGLQYYQSDVLQSKYQNYYLLHCLNHVMKTRTRVMKDNEKKKKLLKQIEEGTVDASVE
                     EKPEFRDQGYTRPKVLILLPTRNAAWVVVNKLVKLSPIKAVENKKRFKSQYYDSFGSG
                     NNPREQAYKRKPEDFREMFKGNSNDFFCLGIKFTRKTIRLYTKLDESDVIVASPLGLK
                     MLFENAAHDKRKDTEFLSSIEITILDKCESLLMQNWEHVNEILTKRLNAPPKKFEEFK
                     VDFSRIRMWAINDQFKYLTQVLTFGKYASPDLNSVVMSGKVSNNLQSGSAIFKPLIDS
                     SNSIIDQFKVKLVRMGLVDKYTKLKQVFMRFDADSIAEEPDKRFEYFKNVTLPQILSK
                     SSYNYGTLVYVADYIDYIRLTNYLRESTSVPFVAIDEYSSQSKLTRNRAKFAQGRSDA
                     RLMIYTERLHFYKRYDIKGVRNVIFYELPTDPSFYSQVMNFVTDEKIRSEMERKDQVK
                     NDEEEDNDFDLNLCMVRIVFSQLDMMKLEKIVGLKNAGQLCKGESEMNEFI"
     gene            <387336..>390467
                     /locus_tag="FOA43_002817"
                     /db_xref="GeneID:62196218"
     mRNA            <387336..>390467
                     /locus_tag="FOA43_002817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923099.1"
                     /db_xref="GeneID:62196218"
     CDS             387336..390467
                     /locus_tag="FOA43_002817"
                     /note="BUSCO:EOG09340RAD;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779027.1"
                     /db_xref="GeneID:62196218"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF03810"
                     /translation="MELNYENVVLTLTTAADVQRGTQQTVAESQLKQWEICKGYHYIL
                     QRVYDDMSQSLQIRWLAVICLKNGVDKYWRSTRIHAICKEEKQEIRKNLFNQLDESNS
                     QLTIQNAHTIARICRHDFPAAWPTVFDEMADIMESSSQISETLGIMRMNNLLIIMNQI
                     LKVLASVRIGRARSALQAKVPIILPHLVKHYHHYFRLWTTNYDAATMEVGYMCLKNIR
                     RATVDGYEYPHRDNTINEFFETSLLHFQKLLIMHESTQLELLERYLKCYLKLYFNMAN
                     ANSVAFLLFSSSRSIILTLLSMLQQKADTVYNLEDRDGSDFWEQTVVKTILIMKKITS
                     FAYRKGATLLRPSNDKKEVERATKVVEEIFTPQLLENLVNMLMSSYLKLRPCDLEAWQ
                     MEPEEWVTEELQVSWEYQIRPCAENYFEDLVSYFKPFLSELILNKIQTVLSDADTDIL
                     TKDATLSVFQLSSGAISDDCNFDQMFANYFLPEALKVDSDDCKIVKRRVCLIISDWVC
                     IQCSKETRDSIYKLIVTLLQPDQLFNDKVVRLTATQTLQHLINDWEFRKSDFRPYLDT
                     TVEALLKLLSELNWTESKMFILKMISLIIERNNPLIEEAVLRDIMDMVPKMWEESNNS
                     NEMILKNSLLRILRELTNSLNSKSQLIHSMVMPLIPICCTEGSQYYSLLCEDGFELWS
                     AILKQLPLDKPIPSNIFGEWFPLVLKGLCNWTEILPLVLKILRSYSLLDATLFETDFG
                     LEIFKVLGGYLGTMRDDSLFIASQTVEILVLQVSKDQIYNSKLMENLAESGLFNAMII
                     YITRETETPNCEIKVALPVLRMMMLDAKFFVFQLLGSILVKGTSLSMLFHRLFTNLVG
                     YLKMTYDSKARKVFLLALLSLYDPSYFVKKVNLDPNVGGDVDYQLEQMDDNDGIALIL
                     SMNFNKVLSLTSRFLEEVQEAPGGDCKNYHRQSPYDDEVLVMAQTDEEQRDEGEDPEN
                     EYVQEFRIPDSGEKLRYTQLLLAKDSVYNVNLKEFVKFKMSQLVGSVDNYEGLINSVS
                     KETLDDLQLAYSK"
     gene            complement(<390506..>394323)
                     /locus_tag="FOA43_002818"
                     /db_xref="GeneID:62196219"
     mRNA            complement(join(<390506..391472,392774..>394323))
                     /locus_tag="FOA43_002818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923100.1"
                     /db_xref="GeneID:62196219"
     CDS             complement(join(390506..391472,392774..394323))
                     /locus_tag="FOA43_002818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779028.1"
                     /db_xref="GeneID:62196219"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="InterPro:IPR026896"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="InterPro:IPR038192"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF12678"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF14327"
                     /translation="MYNPGNGNVSGIGNASNVNSSNSNTNSTNNNTTTSLNNNNPNNS
                     SNSSCVLYLGAIPYNWDVEVIKSVVCGSGPVVDVRCMMDNASKNKGFCFVEYSSSQAA
                     AEALSLLSKIKIEGRKKLRIELSKEGLRNPVPSQKPELHLNRNFLPSNVIIPQEMLLS
                     NLSRPPIKGSNYNMSSSMGSGLPGSKTGNTASAEISAIMASNSQIQQMVSQMIANGMD
                     MNQISAVVKQLTRSSQSQQAPMMQASINSAASAPNSVNAPVNGSSNAAAVAVSAASPA
                     NAPSSNGMPTSLSMASQFLPLPQQAPQQAIYAKDKVSETLASIPPGILIELLAKLKLV
                     MSGPSPNYAQAATILHDNPKLAAAAAQSLLLMGIIDMDVINETMSGHFAVSGFDSRAS
                     ANSSSSSSNSTPANVASTVANVADVNGAYFSSTHHNPAIANPSSSVAVNNASAPTPVT
                     TTTTSNSAKPINPDWLSFPQHTISKLLGIGEQEANLIVQVLKLSPQQIENLPENERMM
                     ANQIRAQYLQPQGQPQRVPQRVPQSQPASNQVPSTPEPSVSPQNPQNPQNTQNTQNAP
                     RIFTISTNLPINVNNIGGVVPVLNAAGVPFSAVIENVMEFFETTGPAKKKRHFTQEAI
                     QQLKAVHPADLPANETDKRCAICFEPFDDYDSTGVDTVTGTTTSTSLKNYPSLPPMMQ
                     GYDLQDPPISFPVDETASTESHYDVGHEDVIKKQEAAQVKASKKTMVNEHYAVKLPQC
                     DHVFGRSCIVEWLKSNVSCPLCRREVVPEMSEDNDSGRSNLIFYPVALTEIFIPIDWT
                     GPANTGYRMDDPPVNFPAAGDGFSSGRRTGPPPNQPQPHQ"
     gene            complement(<394777..>395649)
                     /locus_tag="FOA43_002819"
                     /db_xref="GeneID:62196220"
     mRNA            complement(<394777..>395649)
                     /locus_tag="FOA43_002819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923101.1"
                     /db_xref="GeneID:62196220"
     CDS             complement(394777..395649)
                     /locus_tag="FOA43_002819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779029.1"
                     /db_xref="GeneID:62196220"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF14327"
                     /translation="MRPSKIIYITGIPYDKTEEQVLDIASSVGPVVSSKLLFDKDTGK
                     SKGTCLVEYQDIETASSAVRNLNNYSISSDNGKGGRYLKCSFGSQDSILRLLQGDAWS
                     GGGGYRSSPEQASKYELEREIPPLPAGMNVGDSSMDGLNATIYQALTRMDRSRLQNLV
                     RDAQLMSQGNSKLMQLLLNRNPQLVYALVQSALLLNITSPDRIKDLLVDQEEAKLNSK
                     LNSKPNSKTTVPVAPMVPVASTDPPNHTLTPQQLEAIRAICSMSDDQITQQIADTQQQ
                     QLYLEIKRKYSGLS"
     gene            <395822..>396709
                     /locus_tag="FOA43_002820"
                     /db_xref="GeneID:62196221"
     mRNA            <395822..>396709
                     /locus_tag="FOA43_002820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923102.1"
                     /db_xref="GeneID:62196221"
     CDS             395822..396709
                     /locus_tag="FOA43_002820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779030.1"
                     /db_xref="GeneID:62196221"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003617"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="InterPro:IPR035100"
                     /db_xref="InterPro:IPR035441"
                     /db_xref="InterPro:IPR036575"
                     /db_xref="PFAM:PF01096"
                     /db_xref="PFAM:PF07500"
                     /db_xref="PFAM:PF08711"
                     /translation="MEVSEAKTLIRNLEKAKDSKTVVQLLKVLKEKVRATEHFLRQTK
                     VGVAVNKLRSNPDPEVSSLVKKIIKHWKEEVSKEKRGKHQSREVKQEKIKQEKKVKQE
                     NDKETATPGGYITTKTRTPANDGVKISFYENPTRNGSISGLYTALAMGSAAQPDTVIK
                     VAKAVEERAFDVNDGKVADKYRNKMRSLIMNLRNKKNPELRLKVLSGELRPENFVVMT
                     NQELAPASLKELIADMHQKNLFDAQGAVQKRAVTDRFVCARCKKREVSYYQMQTRSAD
                     EPLTTFCTCESCGYRWKFC"
     gene            complement(<397418..>397894)
                     /locus_tag="FOA43_002821"
                     /db_xref="GeneID:62196222"
     mRNA            complement(<397418..>397894)
                     /locus_tag="FOA43_002821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923103.1"
                     /db_xref="GeneID:62196222"
     CDS             complement(397418..397894)
                     /locus_tag="FOA43_002821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779031.1"
                     /db_xref="GeneID:62196222"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="InterPro:IPR036416"
                     /db_xref="PFAM:PF01195"
                     /translation="MTRLGRFNYRNSNEGSIPLLFYHNPGYMNVSGDNLVNPWTRVIQ
                     EAEIQGLNAALVVISDELDIDLGKIKIRKQNASARGHNGLKSIQNVIGKGYSSIKIGI
                     GRGSEGGDKSSDLVAKYVLSKFKPSEKEVLNNLVLEQFAKVMKEMTKERYIYDVQR"
     gene            complement(<398623..>399579)
                     /gene="LSP1"
                     /locus_tag="FOA43_002822"
                     /db_xref="GeneID:62196223"
     mRNA            complement(<398623..>399579)
                     /gene="LSP1"
                     /locus_tag="FOA43_002822"
                     /product="lipid-binding protein"
                     /transcript_id="XM_038923104.1"
                     /db_xref="GeneID:62196223"
     CDS             complement(398623..399579)
                     /gene="LSP1"
                     /locus_tag="FOA43_002822"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="lipid-binding protein"
                     /protein_id="XP_038779032.1"
                     /db_xref="GeneID:62196223"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="PFAM:PF13805"
                     /translation="MHRTYSMRDSRAPTASELANPPPPPSTAKKSFFGTGSIASIIRK
                     QTAGSFGPELSRKLAQLIKIEKGLERSMEVVANERRLVAKQLSIWGEDNDDDVSDVTD
                     KLGVLLYELGELQDQFVDKYDLYRITLKSIRDIESSVQPSRNRKQKITDEIAHLKYKD
                     PQSPKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAYLYQLDSLREFSEKEALIAG
                     YGKALLELLDDAPVTPGETRPAYDGYEASKQIVIDCESALGTWTLDNSYVKEPTMSLR
                     HDEIYADPEQPEDHEDAADHEEQADAEAQWAGHEGEPEAEKN"
     gene            complement(<400157..>401368)
                     /locus_tag="FOA43_002823"
                     /db_xref="GeneID:62196224"
     mRNA            complement(<400157..>401368)
                     /locus_tag="FOA43_002823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923105.1"
                     /db_xref="GeneID:62196224"
     CDS             complement(400157..401368)
                     /locus_tag="FOA43_002823"
                     /note="BUSCO:EOG09342W81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779033.1"
                     /db_xref="GeneID:62196224"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="InterPro:IPR037113"
                     /db_xref="PFAM:PF10394"
                     /translation="MFVSLAEPQGAFTFKPKFTYPIFGEAEQIFGYKDLRIDLAFDCK
                     SLKPFLNYKFSDKLSSEAKDINKEILPFLPDKGKDAVLKNELEWLAAIDKEDFQIPGE
                     CVSEYCLPIDTKNVYRIYKFRPFNDINGLWLHRRMQIFVLLFIEAGSYIDETDPVWEV
                     YCIYKCPKDGSKETFVGFTTTYGYWKYPGHKLYDASDDKIQRRYRKKISQFIVLPPFQ
                     GKHHGQNLYKAVVDEWLRDPSVEEITVEDPSEEFDDLRDRCDMERLLFERSFMKDLKK
                     LPISNEWMGEKRKQEKMVPRQFDRCVEMGLVYLKQQKQQKQQIENFSEKEIRLFVKKR
                     LFQKNRDALAELEKADMRDKLQTAYQRIRDDYVRILSRVREVKKENKRRVDEYGDDGL
                     ATKKRVKMENN"
     gene            complement(<401519..>402805)
                     /locus_tag="FOA43_002824"
                     /db_xref="GeneID:62196225"
     mRNA            complement(<401519..>402805)
                     /locus_tag="FOA43_002824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923106.1"
                     /db_xref="GeneID:62196225"
     CDS             complement(401519..402805)
                     /locus_tag="FOA43_002824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779034.1"
                     /db_xref="GeneID:62196225"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="PFAM:PF04825"
                     /translation="MSLPDVCATVISEAEDMSLRRTSSLLYGIVLVFKHKVNDIYRES
                     SSFKSRINQNMSFTKRCRIVVAPNARCLVVRNLISVLTDDPCFDVNIDFLQEASQILQ
                     EQIGPERNPSEINAISGSSIDESLEHPLSAVASSPMAPEWNPDFTFDNSGEAVIQPGN
                     KPGCPIDFIDPGALFGEQPEVTPIPRTALMPAAEQPSPKVRPRKRMHKIQNDMEISFS
                     MPLIKKFHYDCLQRYSTQKKKQNVSSNMSFPKPFVQLLKSMSSERTSNTRRSSSVSSI
                     EQGRRMSMPSSVEQGRRVSEDEQELPFNLNQLEEQKQLPLDFNFEGDDTLMNISFGKD
                     GYNCSESDDMTMSQTTLDARIRDFLNLQGGREVSFEEICPSTRSTRKETTSVFQIILY
                     LATNELVHVELEETVLGKSKWELLSGTDIRMKVIDP"
     gene            <404918..>408046
                     /locus_tag="FOA43_002825"
                     /db_xref="GeneID:62196226"
     mRNA            <404918..>408046
                     /locus_tag="FOA43_002825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923107.1"
                     /db_xref="GeneID:62196226"
     CDS             404918..408046
                     /locus_tag="FOA43_002825"
                     /note="BUSCO:EOG0934088O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779035.1"
                     /db_xref="GeneID:62196226"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="InterPro:IPR033708"
                     /db_xref="PFAM:PF08264"
                     /translation="MLCSTSQRLRALQITRRFSTFLARQNINFEDAAHKYSSTVILPE
                     SSFSNRSNRELVESTLRPQSSSQLYEWNIKRPVKDHLIDNLFILHDGPPYANGNLHIG
                     HAMNKVLKDIICRFELIRGKKIYYKPGWDCHGLPIELKTLEKLGKERRTKLKRMKKQL
                     KMLEPKSKEHALLLEQLNALQHQRLSSLDIIRLSKEHALDTQKMQSASFEEMGIMGDF
                     DHPYLTLQRSFITNQLKIFKQLFDHGLIHRQEKPVYWGCENATALAEGELEYNNRHVS
                     KAAYVKFPIVQLGVELAGKLDRFDRLNVLIWTSTPWTLASNRAICINQRFKYTVLESD
                     RDGQLIVCQDLRDSIETINPELKETGIEFSGKDLLGCEYTNPLLPKGNHFPFLHGSHV
                     TNTAGTGLVHTAPGHGQDDYLVCQNNGIQPYSPVDHRGRYTNELPDTLSDFVGLKVLG
                     EGNDKMLGKLKDNNMCFYEDDNYVHSYPYDWRSKKPIIIRATPQWFIDVSRIKGITTD
                     ALEQRVTFYPEKGSRRLISFIKNRNEWCISRQRCWGVPIPVLYEKETGEPLLNDEIIG
                     QITKVIEEEDTESWFADDTGWMAKWFPEGFQGNPEDYVKGRDTMDVWFDSGSSWKVIE
                     NYLTQEGLIDQARKRGFLADIYLEGSDQHRGWFQSSILIKVGTSESLDNPEAKLVLPY
                     SKVITHGFTLDEKGEKMSKSLGNTVLPADILEGNKQLQIPSLGIDGLRLWVAQSDYSS
                     DVSVGPTVLKHVAENLKKIRFTFKFLLGNLNGFNASNDAVSYEKLDNLDKYALSEAYD
                     LEKACLKSYQSYNYSKIVKDVNHFVNSVLSSIYFDIKKDCLYTDQRESLRRRATQTTL
                     LEVLKTLEIVLAPILPIITQEVWNGFPKEITKGLQSPFMAGWYSLPKNFHREDVEKDF
                     AGLFELRNKIKVLTDTATRRDKNVKNSLETAVYVAVEEKTALYSLLKKYESNLGDYLL
                     VSQFSLNVDLPKRKEGYNYEDGKAVIEGFGECKINVTKSDKLKCPRCWKFTRDEGEEL
                     CTRCEEVTTTNM"
     gene            <408178..>408561
                     /locus_tag="FOA43_002826"
                     /db_xref="GeneID:62196227"
     mRNA            join(<408178..408190,408242..>408561)
                     /locus_tag="FOA43_002826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923108.1"
                     /db_xref="GeneID:62196227"
     CDS             join(408178..408190,408242..408561)
                     /locus_tag="FOA43_002826"
                     /note="BUSCO:EOG09344FLI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779036.1"
                     /db_xref="GeneID:62196227"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="PFAM:PF01920"
                     /translation="MANQDLQSQYSNYQQIIGTLNDKLSQLDSDLGEHKVVLDSLNKL
                     PEDRRCWRMVDSSLIELQCKEARGVLKNRIEGMEKSIKNLSEETHKKQEEFVDWKQKN
                     NVRIVKAN"
     gene            complement(<408617..>409993)
                     /locus_tag="FOA43_002827"
                     /db_xref="GeneID:62196228"
     mRNA            complement(<408617..>409993)
                     /locus_tag="FOA43_002827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923109.1"
                     /db_xref="GeneID:62196228"
     CDS             complement(408617..409993)
                     /locus_tag="FOA43_002827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779037.1"
                     /db_xref="GeneID:62196228"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="PFAM:PF03345"
                     /translation="MIFNLDLFLYVAFALVSSVQAVVVSRSPYAITNKTLVLYDDNLE
                     EQSFSSQYSSFLKLIESNGFEAVVKQADSSADITLFDRFGNRLYDNVLVFPAKARSLS
                     KSINQGILEQFAKKGGNFLFVSSNKGTQTDSSLFLNQLGIYPSPKKYKFIDYHNANTE
                     QSLVDSIQKPIFLNDVIVPIDVEVDQLAYKDGSVSILNNNEFLIPLLKASDSSVTYDI
                     DRGYISSESTWHSGSQGFLMAGSQALNNARTLWIGSESILSNSDINEQLVDSLLKWVF
                     QIDGIIKAEFFNHTKVDREGNELNVTRNDKSLAENGPDYKVKDFCKFEIGISQWNGHQ
                     WVPYNSSDVQLEFSMLDPYYRLTLDFQEVREAAVYGTIFQIPDQHGMFTFRVDYKRPG
                     LSFIDESTVVPVRHLANDEYPRSWEITNSWVYVTSFFAVVAAWLLFVFFYILSANKPV
                     ESQEKKNN"
     gene            <410603..>411499
                     /locus_tag="FOA43_002828"
                     /db_xref="GeneID:62196229"
     mRNA            <410603..>411499
                     /locus_tag="FOA43_002828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923110.1"
                     /db_xref="GeneID:62196229"
     CDS             410603..411499
                     /locus_tag="FOA43_002828"
                     /note="BUSCO:EOG09342R65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779038.1"
                     /db_xref="GeneID:62196229"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="PFAM:PF01263"
                     /translation="MPITNNDDEVIITSPSNGKTQLKVLKYGATVYSWTVNGKEQLWL
                     SDAAKLDGSKPVRGGIPLVFPVFGKSTDASVSKMPQHGFARRSTWEFLGQTTENPPAV
                     QFGLGPELADQEVYSKWDNGDNDFTLVLTLTLENDSIRTRIDISNPDKKPWKFNWLFH
                     SYLKVDDIEDVLVNNLPGEICYDQVIEESYEEREPAVNFAGELDRIYQNVSTKKLLQV
                     IEMGKVVHNVRRKNLPDVVIWNPWTDKSKGMADFEPKNGYLKMICVEPGYVHDFVTLK
                     PGEKWSGEQIIYKGDAVKMQSV"
     gene            complement(<411541..>414609)
                     /locus_tag="FOA43_002829"
                     /db_xref="GeneID:62196230"
     mRNA            complement(<411541..>414609)
                     /locus_tag="FOA43_002829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923111.1"
                     /db_xref="GeneID:62196230"
     CDS             complement(411541..414609)
                     /locus_tag="FOA43_002829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779039.1"
                     /db_xref="GeneID:62196230"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="PFAM:PF02383"
                     /translation="MQVFINRWTRCIIIVSNDFALVLRDSRSEEELSKLKKQRKKDHL
                     PESDPKLLIEFICGSTLPDLEALHFIEIHVGHYTPSPTGTSSINSGLGDVPSLYRPFP
                     LHERNFYGFLGLYFAKGSIYVGFVTEKTEVGSAIVGNKIYRIDNTMFISLTTGECFDY
                     YAEDNSQNQEATVSSSKIRSVEKLLASGTFYYSPHYDMSSFMQERGESSSGYTFDSSL
                     YEYNNRFVWNGNMIQGLVAFRSRLSYSEKKAFDKGKFLLTVIRGFAQSLTINNLSEPA
                     NPFLMTVTSKQDCKKSGPLFGPYGLDDNGNATNFVETEFIISNKDHKFAFLLLRGNVP
                     LFWKLEAQLLRTKVEFPRSDDASKHAFTRHFDNLVAKYGAIHVVDALSTKGSQPEISK
                     KYHEALKASIMGNEPVLYSKVDASQCSRKKNTDAYAWEMMSHLEESIKSNQAYCSLSE
                     DYMLHEIVCMRQLGTFLVNTLDSNDRANFIEMKISEQIVTMIFKTFGMEERVSWDDFW
                     HNHTFLWDANGRSLGKLADSYNNSIRTKNKSGGIMGKMANQSKKYVSSSSSSSSSSGK
                     QAQFDKLLGRLEKQFQVQLVDPIHDYVLTELEKRSNEFSSMKQLKIFTVTFNVNGEQF
                     PGDITRLIFPEPERYNRYDIVVIGLEEVVELTPGKIMNIDPKIRLFWEKKLKSTLIQF
                     NNDNYVLLRGEQLGGLLSLIFVREADNLQYIKEIETASKKTGLKGMAANKGGVAISFN
                     YSKTTKFCFVVSHLAAGYSNTEERHQDFKTIANGLRFRQNRMLRDFDVVIWMGDFNFR
                     IDASNDSVRKALKDASMLSAESADKQKIFNMLFEHDQLNNQMATGQSFPFFDEKEISF
                     MPTYKYDKDTSVYDSSEKQRVPAWTDRIVTLTRDKRLLQQELYNSIQSFQFSDHKPVY
                     GVFSADFDIVDEALRSKIEQRLYEVRKAEVGGVNSIISNDLMQNKGGVLRYGLPAPSN
                     SGSTWWLDKEVKFAQLESGEYEVNSRMPKNPFIGTTEKEFVKIVKPKAGN"
     gene            <415083..>417020
                     /locus_tag="FOA43_002830"
                     /db_xref="GeneID:62196231"
     mRNA            <415083..>417020
                     /locus_tag="FOA43_002830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923112.1"
                     /db_xref="GeneID:62196231"
     CDS             415083..417020
                     /locus_tag="FOA43_002830"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779040.1"
                     /db_xref="GeneID:62196231"
                     /translation="MLRSITTSSIKQGQRVSAKAFQHQPPGPGHHKPQRFFSSMVEQQ
                     QQSQQQQQQPQQSRSSGSAKFFSTVQPSSMASNGYAGVAPNNEAGTSSAVTNLASSDH
                     LDPNYYKLIRDFDQCLGENSTYDLATGRISGGVDKFWTAVRRIIPIYRSLVYSNLLKE
                     KRMAEFVSLLRNGLRIHRLELSKMKKNLDKDANNPIKDIHHLLTCAIREVSYNLLDGL
                     VVMNSHGLTHLFKAYKDLGFTYEAVHIWETGKNSRKLHHLFTSEPVLGSIFPFLVESG
                     DFDFQEVWDMYSRIKASKGPDEKLHNELQVGMIRVCLFKSKTNDALQIFKQLTGDVYS
                     TFNAKGVDPPINVKSYMTMAHLSFIGFCKDIDTADYFFSDAVSESMPYLTPLQLNFIK
                     KYLANTWQVTHDYQRVKKIWLITWKHYESRRTSNSSVSSSLNDSFLSVFFDKYRQFSP
                     EAFVELQQLIQDYNQIRPIDEPFINVLLSKSTGWHNADVFQYILSSANDAPHFSKTNV
                     FYRCCLKATGSVEITSDNILSLFRQLLANNVASGMKYIAHADWVALRDATVNSPQLFS
                     FSNPGERIDLYFKLWKICSPFFISLENFKNYIYKDVKLNYNYSRIYQQMPNIRSDDIE
                     IPEVNLLRRNSAIESYIGYAY"
     gene            complement(<417141..>418487)
                     /locus_tag="FOA43_002831"
                     /db_xref="GeneID:62196232"
     mRNA            complement(<417141..>418487)
                     /locus_tag="FOA43_002831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923113.1"
                     /db_xref="GeneID:62196232"
     CDS             complement(417141..418487)
                     /locus_tag="FOA43_002831"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779041.1"
                     /db_xref="GeneID:62196232"
                     /db_xref="InterPro:IPR005373"
                     /db_xref="PFAM:PF03676"
                     /translation="MPISFELLPSKGLGFIKIFDSLYSVVNQLNAQGIRNDIKFMYRR
                     ASRLFTVQLMSYRINLFFDSELQVLLFIELNLPQPGEPWNYDLKYEGEVAHKFEFRSI
                     YNKIFGPTFPGHLDKVSMDYYLSYSGICFKFKGLAKELRSAVSQLQGDNIVDDDGSLM
                     QILTGSTYDINCSSICIFRGISWRQASKTLVDILPFPRQPQIYAMKNMIQEVEAGTND
                     ILATEEIDRNGSIVIGDAICYVDERKLEISFAGHPTENSFFISIGNTTMITVFKFLGP
                     PDDFLVKQGSCEEGSCRKNSKIHNYFRYGLDIVYNLCRGTDSVVQKIIMHSNLVHSLE
                     FMRYERLPFSLYRKVSSKVIHYSLTGDFTYLREQMFPENSSDHKPILLDRKEYELNPT
                     HFNSNNLFEFVDFVEADGTNGNSDFKKWGISKLYIIGNCIFEVLQEDDSISSVTLF"
     gene            <418894..>419355
                     /locus_tag="FOA43_002832"
                     /db_xref="GeneID:62196233"
     mRNA            <418894..>419355
                     /locus_tag="FOA43_002832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923114.1"
                     /db_xref="GeneID:62196233"
     CDS             418894..419355
                     /locus_tag="FOA43_002832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779042.1"
                     /db_xref="GeneID:62196233"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MQIWDTAGQERFHNLTPLYYRNANLALVVFDLSDQLSFKKAEYW
                     INELKEYMNDEDEGIKMKIILVGNKLDLLERTHDDEFKECDFIDQVDKFLDAHDIVDK
                     WFKTSAKLNIGISELFNYVIDHLDGGLFHSYEEDKKGVIDLKKRSGGKGCC"
     gene            complement(<419389..>421404)
                     /locus_tag="FOA43_002833"
                     /db_xref="GeneID:62196234"
     mRNA            complement(<419389..>421404)
                     /locus_tag="FOA43_002833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923115.1"
                     /db_xref="GeneID:62196234"
     CDS             complement(419389..421404)
                     /locus_tag="FOA43_002833"
                     /note="BUSCO:EOG09341II6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779043.1"
                     /db_xref="GeneID:62196234"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSVVKYNSDSSLINISDGLSVVHKNAQSNSLVVYNSNTNSFQLI
                     SLEGYQEKGDSGSSSNFSKERSDKDSFSFICANCGYENHLGDTGPRKRRHASLIRGKE
                     ENKSGEDPGDSNLNDSGANKRRRNSNSLITNGDTGLGGRYITTSSGDLLREDYFRLLA
                     KIDATTNKSSMDLIKRVKKSGINKGSSSDRDYLPSEIPFELINQGYFQKFFRILKELG
                     NGSNGKVYKVEHELMDLNLGVFALKKIAIGDDVQNLVRILNEVKFLYNLSEKAYNVPV
                     ELGSASILGANNIVRYNHVWLEIDQVSKFGPKVPVVFILYEYCDGGDLDKFVKSLANP
                     GFDLEKEKLFRKLRRLSEHDSKLPDDVAKFRQVDARYLNNYEIYKIFNDAVNGVNYLH
                     ELKIIHRDLKPSNCLFKNRFPADYRPITSIDQLDRIPMLLVSDFGESIMENGQRSSTG
                     TTGTLEFCAPELFQLVKSQDSKNSGRFKEFSHFSDVYSLGMILYFLCFNRLPFKSDLP
                     DDIREEITQFKMFDGMEDIRPLTKDASDQSKLLRDYVVLIRKMINPEMQKRPTASEVV
                     EEMGKVYKKLDNGKHLVESDKLEVVALVNDQSVISIDGNFNILAVTGLTIINIWMLAK
                     WSYLVNIEYLTLGLVIAPRLRPYLMVLQMELFMIGLGITYSVHYTKT"
     gene            complement(<421576..>422265)
                     /locus_tag="FOA43_002834"
                     /db_xref="GeneID:62196235"
     mRNA            complement(<421576..>422265)
                     /locus_tag="FOA43_002834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923116.1"
                     /db_xref="GeneID:62196235"
     CDS             complement(421576..422265)
                     /locus_tag="FOA43_002834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779044.1"
                     /db_xref="GeneID:62196235"
                     /translation="MVSERFKEKAAFRERMSAMKKSAEVLGLRSERDRLNSLGYGLAK
                     KSSIDLGVKDELTFPSLLQEIQKLKKRNKELESKNRKLESRASVSQEAVRSYERKMNK
                     VLSSSEDYKRQARRLKSSNRQLVNEVSELRRQVGKYVADIGSIRARNEVLVSHMSDGS
                     EDEEYEGSNEFDESEQSDNLFTRYETGLSVPLDTTQLLSIDPEELTVGQIGKLGLRQV
                     DDLDTERLLGL"
     gene            <422598..>423809
                     /locus_tag="FOA43_002835"
                     /db_xref="GeneID:62196236"
     mRNA            <422598..>423809
                     /locus_tag="FOA43_002835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923117.1"
                     /db_xref="GeneID:62196236"
     CDS             422598..423809
                     /locus_tag="FOA43_002835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779045.1"
                     /db_xref="GeneID:62196236"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="PFAM:PF12550"
                     /translation="MSTTSPKLYVDEVSNATKSLTKSNDSDANNNDIEGSTDITDVGE
                     AVTTTGNTSSVNDNRVNATATAAAVAVASDDQKEQSSNDFFLAQLKDLTDLIVTSFDS
                     IASNMEDLRIKAGTLSSLSATLIGSSGDSLSKTFSDRDIDSRLMLLEVAQKAQNDFSK
                     SATDADLAVGNGSPTSGSYAAYHQQHVFSNQRRMDSPLDIPEIDLNPRAKSVPDIWDE
                     WMNGYRSQKPLRYLEARYGTKWRRGRIAKSAQRRKKVIDFIVSESKRFSQKSPHDVVA
                     TLEEYRRRKNKGLFWLYGSLPSRLFDDNGNTLLDNDEADEDGSSSTSAAAAAAAAAVS
                     AAQEEEERIELEGPARKKAKKLSDDQTTDSEAEVTAAAAAVVAAQRKAAQPDSTTDPA
                     LASIDNKGKKA"
     gene            complement(<423972..>427298)
                     /locus_tag="FOA43_002836"
                     /db_xref="GeneID:62196237"
     mRNA            complement(<423972..>427298)
                     /locus_tag="FOA43_002836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923118.1"
                     /db_xref="GeneID:62196237"
     CDS             complement(423972..427298)
                     /locus_tag="FOA43_002836"
                     /note="BUSCO:EOG09340Y8V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779046.1"
                     /db_xref="GeneID:62196237"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007131"
                     /db_xref="InterPro:IPR035800"
                     /db_xref="InterPro:IPR035821"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="InterPro:IPR038159"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF03983"
                     /db_xref="PFAM:PF07653"
                     /db_xref="PFAM:PF14604"
                     /translation="MSSGFLGIYVSLYDYEAQNDEELTIQQDDLLYVLEKSKVDDWWK
                     VKKRVVDADVEEPQGLIPCTYIEPAKVKSRATALYDYDKQTEEELSFPEGTTFDVYDT
                     SDSNWTLVGIDNQQFGFIPANYIELNEGNSQSLPQVGSSDYRSKSALAMFPPPPKRIV
                     PPKESEKRDDSQDQSQQAQNTSRTSQSLDSEEEDGPRMLSRPSTSTNDRLPATPALAD
                     EQQNEEEDAPPMPARPKSSKERDSSNPDEFFKDNFFTWKVYEIDGKRKRKAMLEIGDS
                     QIFITPEGSSKPRDWTIRDLTNYNSEKKHVFLEFKNPIASYEFHAGNKDSADAIISVL
                     ADMKGLTSLSALKDIEEASKPSNRPQGKLLYDFDAASPDELTCYEGDVVYIVNDKRSK
                     EWWMVENVATGKKGVVPSNYIKIVGGKDGSSWRNIFKRNSSQVSTGTKKGGKKKSRAE
                     REQDLELQRQREKGEIARRREKEDLAREREELERQRRRQERKERDLRDFEERERVRRA
                     DQKTREKKMKQKQKSSEKDISKPNPHRVRTWIDRSGAFKVEAGFLGVEDGKIHLHKLN
                     GVKIAVAAQKLSVEDLEYVERLTGVSLDNYKLGQTKKTHSKERDSPEGTAQISASSAG
                     AVASNGPLSDTFNEKSYEYWFDFFLGCGADPNMCERYARTFAREQMDETVLEDISASL
                     LRSLGLKEGDVLKVMKYLDNKFRRNKPEEAHPSNGGLFNGADGSLKNNKAAALSVASP
                     PGGSDKFEDDAWAIRPASKAQEDKVKPQFTGSIQDLVDIKPMEPTKKAEPRSTPLPVK
                     PVTPTTTGPMMNSSFAPSQMTGSMSMSNQATGAMMPMPTGFVPISMLPMLTGQTTGYI
                     PLQPTGVTMPLTTFGGQAPMVQPFTSFGQQITGGPTMMLPLSTNAQLMPTTTFSTQST
                     GGLVQLQSTGVRIQKTGPTIPSQLVPAATAVTSFPAMQPTHTGFQPTQQMYTGMQSPP
                     AQQMYTGMPSAQPTQQMYTGAPPSQPMYTGFQAPVQQLYSSNAQPGIQPGIQQTSLPP
                     ITFGTSATAQPLTSFGVPQLTGMMANTSLNGQSQPQQQQTLMSQPTGMGFGNGPDLRS
                     QPTGHQANLANATPDNPFGF"
     gene            <428816..>431032
                     /locus_tag="FOA43_002837"
                     /db_xref="GeneID:62196238"
     mRNA            join(<428816..428818,428882..>431032)
                     /locus_tag="FOA43_002837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923119.1"
                     /db_xref="GeneID:62196238"
     CDS             join(428816..428818,428882..431032)
                     /locus_tag="FOA43_002837"
                     /note="BUSCO:EOG09341C2N;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779047.1"
                     /db_xref="GeneID:62196238"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR033133"
                     /db_xref="InterPro:IPR033712"
                     /db_xref="PFAM:PF00806"
                     /translation="MFDFDSNIAPDETIMVDSEKHGLSSPYSQSERRNLQQYYENQGL
                     FLGVSVASGGPYAGQKPEATGKMETTDVSGTTNLAGSTRTFNVSGSDAYGASAYGSSD
                     ASSGNASSSRFTHLSGLFAPSFPDQFTTDLATGLPYISTPFQYHRHQSSATSLSSSIF
                     GGATPSVSAATIATSATTSTTAPQHTPGPSISASTSLYNGVSGAGLPDAYFINGMSSA
                     FNEPITPPEYCYSKLASIIPATTSDISSNASWNAPQILDKPYAGSRHHSKSRSMASLQ
                     GDNHNRRRMFSYPQSETEQRQGRYPETLNEVGKRHKSVPSVPSIPSTNAVDTFALENS
                     FDQLTLGGKSTSLDSTTDIISMSQDQYGCRYLQKKIDENFAVNFPLIFQSVYQHSTDL
                     MVDPFGNYLIQKLMGSASAEELSLILISIGPSIYKISIDQHGTRACQKMIDCLSTPAH
                     HRLLETYLSPHIVELIQDLNGNHVIQKCIQKFQDVDLQFIIDLICSNMVAISTHKHGC
                     CVMQKLMNKCNSNQLIQLGCEILNNSISLMQDQFGNYVVQYLISLEIPKLNSQLITIV
                     ASYVTELSCQKFSSNVVEKCLKIKVYKQHKNARQVNPLLEEILREPTLSNLIKDQYGN
                     YVVQTSMEVSPFEYKVRFAMALDPLLPTIKFTSFGKRIHNKVIAILEEAKKTKGPIID
                     IPTTVTTAPAKQRSLSNFFTRHGLDSVDNIFPPPR"
     gene            complement(<431208..>432239)
                     /locus_tag="FOA43_002838"
                     /db_xref="GeneID:62196239"
     mRNA            complement(<431208..>432239)
                     /locus_tag="FOA43_002838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923120.1"
                     /db_xref="GeneID:62196239"
     CDS             complement(431208..432239)
                     /locus_tag="FOA43_002838"
                     /note="BUSCO:EOG09342TYQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779048.1"
                     /db_xref="GeneID:62196239"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="PFAM:PF04000"
                     /translation="MTTTPLDSIVDSIISSIETTSKSVDSLIENIDRYGNEYPELVRH
                     LKQSVDNKKLANNPEGMSLLSLKNSSLLGYLNSIMCVIGRRLGSVKQSRDVSIADDKE
                     REKAVQSSVVHRVTLDKGIKPLEKKLSYQLEKLIDAYRRREHEQTAAHEKKSDKINEE
                     SELDDEDEDEALRFRPNASALINRSSKPHEMSVESITTTDKYRPPKISAALPPSTAGN
                     DGEKKREGRQRNLQSMDEYLQDIGDAPEVEESIGATITNSGRDIKTKKQMEKEQNIQR
                     YEEDNFVRLPAGKSKESKRERSKRMRDEFFGEDWSMFDNNRDIGNTTTSKKRRKKQNA
                     WQKAKRSME"
     gene            <432873..>434129
                     /locus_tag="FOA43_002839"
                     /db_xref="GeneID:62196240"
     mRNA            <432873..>434129
                     /locus_tag="FOA43_002839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923121.1"
                     /db_xref="GeneID:62196240"
     CDS             432873..434129
                     /locus_tag="FOA43_002839"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779049.1"
                     /db_xref="GeneID:62196240"
                     /translation="MRALIYILLSFISGYCLADDTDDQTSEIHPKCFKNSYQISTSGD
                     LLEISDCQTISESIYIHGYDAELLDLGSISQIKGDLKISNASQILRIEALGLESIDGS
                     FELNTLTSLTSASFPKLESVNILDWRVLPILSSVNLDKGIKRISSVILSDTSLTGFGG
                     FNVENLKTLRIDNNRFLEMIESSVKEISGDLLIAANARNLKVKLPELKWVKSALIKNT
                     DELDLSALQVIQSSAEFIENRFKELSLPKLKSAGTTLSIIDNNWLENADFSSLVEIGG
                     GLMIINNDKLTQINFFPMLKSVGGALEFEGDIDSNEFRQLKVVKGSAILKSSSNKFNC
                     QSWVDQEVSTVVRGGKIECGSGNSEFTEVIHVDESGERTSRTTGRNNAKTTKGINEAN
                     GSTGPLGVSMILAFAGILAHLSRELI"
     gene            <434396..>436765
                     /locus_tag="FOA43_002840"
                     /db_xref="GeneID:62196241"
     mRNA            join(<434396..434401,434468..>436765)
                     /locus_tag="FOA43_002840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923122.1"
                     /db_xref="GeneID:62196241"
     CDS             join(434396..434401,434468..436765)
                     /locus_tag="FOA43_002840"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779050.1"
                     /db_xref="GeneID:62196241"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /translation="MSNENDSLLCDIFKFGEGPPLLQDELKRTLRNTNRLNLPIPTRS
                     QLDKSNEAEVVDVNDIDAKSRSGSLSEDSSSAQRKSSNGIEKPMQKNKKKKRRVFSCN
                     NCRKLKTKCTYEPNSTCCDRCHRLRLSCSLPEPLAKISGRRVYNSTTSQTGSSSGLET
                     RIDDLELNLKHKFESFDSKMDTMMEMIHRMDSSATVQTNQSSVHYMSTAMQASASSYS
                     SRILPRYNSLSSLNVINQIHSRLFDHSPKNNDAFHESIQEFIKFYYANEELCLALSKE
                     FLNIAHFWIIPGGIGEVDREYVIKHPFSSCVYCIIAMGFDNDYKFVEQKKELYPIARS
                     LMVNTSLTIPLSDHDIEAVLYVCTYGMTKQAYQSEFDGWILSSLAFKHCIISLDLQNI
                     LNRVKMGVFSDDDIFHLRIFNAVCCCHYQFAVGYDRPVMMDLDYVKLHQLILQFPNAT
                     IGDAIKVAELELYQLLSRDLVEMSPGDVYCQVSEDNKLTFAHLIDWLSNWDKIIAKDV
                     THGLIFSYNFAHLLLARKFIQAESQVDHAILPLAYNTACQYSFEIINQLLALPEAYVR
                     GSPLFHLSHIVYSCVTLFDFLDVMKPSERKKSLNLISKVYWHLNKAGEKINVATDSIA
                     QIIRKLVELASKHQYLEYNNKSGFVGSGSITETYVRMKHIKRRDSQQQRRLSVEDLPA
                     LAQDHRRRCSLQSSPKESSETKLMGGLNDMEPMEPIEPKQNDSTKSSVHSGSMVDGAE
                     FQLPDVSNFLNFEDFFYNIFNDSPDYI"
     gene            <436890..>438617
                     /locus_tag="FOA43_002841"
                     /db_xref="GeneID:62196242"
     mRNA            <436890..>438617
                     /locus_tag="FOA43_002841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923123.1"
                     /db_xref="GeneID:62196242"
     CDS             436890..438617
                     /locus_tag="FOA43_002841"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779051.1"
                     /db_xref="GeneID:62196242"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="PFAM:PF03184"
                     /db_xref="PFAM:PF03221"
                     /translation="MSNTEKFNDDEVSIDINMGEIDSRLVYTNDYSNRYKKLPRATLE
                     QKITVLDWHHKSERKCQQYTVGHFQKLNLFSVTKSTMNRWVLNEDELRKQYENLTLNN
                     VKSYKTRPKFKEPLVNRCLEILYEQRCLENSPLSEKQLIAKWEDFYGLIHGNLDDSVA
                     RRSNGWVHHFKKRNEVKRDIIRRYYKEIGGSRESNSMETERLRLRTKLSHYEPEDIFE
                     LDEVSFDCVAECLKQREASRNGKKVIVAILLNSTGTEAPVPLVASTDGEAKYSSCQHG
                     VLTSELLYKYLQDIDSEITPGRRIAVLLNGFRAHMIPRDSFDHIDLVYYSRISRDIQP
                     MNMGIMRSYKLLVKSIYFQKVRQRLIIGGKEGYLKDSLVIDGKELMNDAMRSYRQMQK
                     QKESQIFIRGCFEKSGLIGNFEEGMEKQFTTWKREDFKREEQLKLIFTMLDRKRLLAE
                     SFTENSVRHLNNGEVEIDINKVIFPKSEQVENIDLSDIDIVRLAKLEIEIQSSSNMVK
                     DEVRRQNEDSKANFDAMESVQEYLSKNEGTERLMELAQQYYKNVRKKEKQNGDDPVEK
                     RRSKRTKIS"
     gene            <439424..>441694
                     /locus_tag="FOA43_002842"
                     /db_xref="GeneID:62196243"
     mRNA            <439424..>441694
                     /locus_tag="FOA43_002842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923124.1"
                     /db_xref="GeneID:62196243"
     CDS             439424..441694
                     /locus_tag="FOA43_002842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779052.1"
                     /db_xref="GeneID:62196243"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF02257"
                     /translation="MPSPEDIQAFVMASGSTNASNRAIVTQSAITTSPSVQGVFSSQF
                     LQPAFGSCVKAERLVSLDKVASNRVQIQGQRQRPQSSMTQQHQVQSQFASFQQRLCTQ
                     SNYQDSSVLHNSDNQSPPSNLHEITDYVLPQSAAANADNLCSLSFTSNIDSDASLNGG
                     SLLDDNKADNTTSQSFYSEFPDRRGLYPYSPLASTSSLQSPHTHSLSLDSTVVSSSVS
                     SIQSPVSDDYRRKRPRKINSSASIIDPTERQLVDTARRESGKDLNELSASITLTEQLI
                     SSKIKERASPLFGKAPTGKEIKLLESQKKHQRQVFAMVVLLRSVLPKEAAICPRNRIY
                     NKYVNICRQYGLIPICNASFGKLVKLSFPNIKTRRLGIRGSSRYHYCGLKLIDDSESL
                     DYVTPPSARSTPSDYHSTPLGIYQTPGSSKFSEDSGANGSFSVCFEEHLFRYFNDKVP
                     QFQPSVDKYLMLCGDLEDKAFQEFAQVYTSFTLRVFQNLRYMKVKTLFDELANFNLQD
                     GTLSPEALNCLQIKQEHVSYFVSRCDSDLYSCCIKLLSKTVFQNVPEAVRAQISNLDT
                     RLLSALDKMSAPEYIKKAKREPLKRFVTLVSQLCKVISSAANLADAMIQPETRNTLLQ
                     DYSMLDIETIVNEDLVLPEEFKNRAIFLLENDCMEMFQKLSALSNGEDKPIGSIIIQT
                     ISSYLLRFPSNFRTMSPTDFLLCISSLVGSLLRQLTHQGTLTNFDVWWKANCWVSEFF
                     NLIGGLGAFLKKNSMK"
     gene            <441856..>445758
                     /locus_tag="FOA43_002843"
                     /db_xref="GeneID:62196244"
     mRNA            join(<441856..442153,442890..443603,444394..445666,
                     445749..>445758)
                     /locus_tag="FOA43_002843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923125.1"
                     /db_xref="GeneID:62196244"
     CDS             join(441856..442153,442890..443603,444394..445666,
                     445749..445758)
                     /locus_tag="FOA43_002843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779053.1"
                     /db_xref="GeneID:62196244"
                     /translation="MKIKGFESGINSVSKLLKGHTDDEEFDKLASAKLNGIIELRGSA
                     NRDDSKRGLFSKKDLEEGDTIYEFKPFLQNVDQSCEKSCHHCLKDKEGLSFICNGCVK
                     QDLSKENCENCDSEIPKELIRKKYMLIIGLLLEDNWLHNSVDILYDLTIGTIERCSFI
                     NSPEDVKDWMAAFESTRKYVPLKSWPLQILVNFIKEYYENREQDSFQRVRFTLLSNVQ
                     MDEGGLSRGLQFYELSVSLDAWIQYNKDKNTQQTNRMCVSLACQAYKHLGKYIGFNSL
                     PMVDLDSLIKERGGRKLTVEEMKWSLNEFGTLCQYEKKLGDLLETTTQWKTKLNKEND
                     KAICFKVTPTSTTSTSTSSSSIFSSSTFFAPEDTVVAVSMTSYYSTNYAYSQLFYVTD
                     SGTTFSTAVPLTATTSVPLGASAIDYFSHPEVITTDLADFKSNHYSYLPDELQASSTK
                     KKLSVGAIAGIAIGALIGLAAAVLLLFFLIRRNRRRKTGNVFSGSFNFMKTGGEKSDD
                     NLRDTNSSNSHYGTFDVDRKKEYVPDLGISEKVASIPSMPPPVPPPPRKSRLLETGIE
                     ESFEPIATPEREMNVLYESNEENNRISEMPEYNDRRYRNPTRYETLSSNLSTFREAIS
                     GGKSIKSSHPSAPKPRKNRVVIQARSPRNVTPPPIVADTLSSVTFSQGRIESIDNDHK
                     NGHHHSRSYGHSHSRHHSYNGHYIQSLNHKRHSSTGSLGTRDSSNNSSTTDFDEFDDF
                     DDDEFDDADTEDIYSSSQGSSTYP"
     gene            complement(<445763..>446581)
                     /locus_tag="FOA43_002844"
                     /db_xref="GeneID:62196245"
     mRNA            complement(join(<445763..446551,446573..>446581))
                     /locus_tag="FOA43_002844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923126.1"
                     /db_xref="GeneID:62196245"
     CDS             complement(join(445763..446551,446573..446581))
                     /locus_tag="FOA43_002844"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779054.1"
                     /db_xref="GeneID:62196245"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="InterPro:IPR034751"
                     /db_xref="PFAM:PF03226"
                     /translation="MGLTSDDLLDSHRQLYYGSSTKRFPSIGDSSQNATLGTTLLPAL
                     NPAQMASVLPVARVAPIAPVAPVAFMTTTTIHSAPITNLLSTPPVSQYRSSISSTSTS
                     TASSSNSFSSSSTLTTTPHSSSPSQLPYFSFFIDAQNKSLLTPPTASNHPALNSFSSS
                     SNISAHILRCKQCHNHICTNKLVISTNFYGNYGPALFVSKVLNIKLGDSEEFKKMRTG
                     KYEVKTIYCKQCDVNLGWKYLYSEQEGEKYKEDKFVIERSLLEEADY"
     gene            <447292..>448167
                     /locus_tag="FOA43_002845"
                     /db_xref="GeneID:62196246"
     mRNA            <447292..>448167
                     /locus_tag="FOA43_002845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923127.1"
                     /db_xref="GeneID:62196246"
     CDS             447292..448167
                     /locus_tag="FOA43_002845"
                     /note="BUSCO:EOG093442GM;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779055.1"
                     /db_xref="GeneID:62196246"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR036394"
                     /db_xref="PFAM:PF00237"
                     /translation="MCAWARITPQLSRPLFLFNSRTYATTKTQAASSSSSSLLGSLTP
                     NVSTEKDLLPPRKDAEEASNAAMENEVKYVKPEEDAKLQEYLNPKPYKTVNSLLSPLK
                     RRLYLDNVTKNGFFKNGDLITLPDGISYRLKLSREEIEALEPSIYLRSWRIKSSVKKT
                     NIVLRALKDLPLKKAITQLHFMPKKVARDLFEMLERGLQDAEKMNYDVNSIYVAESWV
                     HTDGHWARRIECKGRGRTGIITHRWISVRFLLKTEQTKKRLAYEAERRSDKRIAKCVL
                     TSEKIRGPCQGYYKW"
     gene            <448436..>449266
                     /locus_tag="FOA43_002846"
                     /db_xref="GeneID:62196247"
     mRNA            join(<448436..448441,448829..>449266)
                     /locus_tag="FOA43_002846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923128.1"
                     /db_xref="GeneID:62196247"
     CDS             join(448436..448441,448829..449266)
                     /locus_tag="FOA43_002846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779056.1"
                     /db_xref="GeneID:62196247"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="PFAM:PF00498"
                     /translation="MLELKGAEDTYYLPPPDQVLPSKSMRYHLFKFDDKVGTENEVPL
                     INGRSFLVVGRDPDLADIVIDIDTEDGGLVSKRHAVFQFRKPSSVEDSSIKLYLLDLG
                     STNGTFLNGNNVELPKRRYIEMKGHDRLKFGDPESDTEFVIVEEE"
     gene            complement(<449269..>450969)
                     /locus_tag="FOA43_002847"
                     /db_xref="GeneID:62196248"
     mRNA            complement(<449269..>450969)
                     /locus_tag="FOA43_002847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923129.1"
                     /db_xref="GeneID:62196248"
     CDS             complement(449269..450969)
                     /locus_tag="FOA43_002847"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779057.1"
                     /db_xref="GeneID:62196248"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PFAM:PF00733"
                     /db_xref="PFAM:PF13537"
                     /translation="MCGILLHFNSEQTFGRAHKESLNSGSLENLGDLENSISELPSSS
                     KTSLSGSISPIFNVLVPEILARGSDYSQYYCQPHLELFSSVLSLRQPLTKQPFIKDDR
                     FIIQFNGELYNDEIPLHSNDLEFIYKRLQDYNGDIIKTIGSLHGGFAYSIIDLTNSKV
                     YFGKDILGKKSLAYSLIEGTGELFISSCFPEEDNQTTFFKECLNAVVYVFDMNKRSIG
                     MLRYEDSADLPDKLAVNNRWLTDDDPSEEFLVSELHKELTEAVRRRVETIFPVHNSKS
                     KFAILFSGGIDCTLLAALCAEILEGPVTIDLLNVSFDNPRTKTDPSQTPDRRLARKSW
                     SHLEERYRNSQIKFHLVEIDVPYESYLKHKQKVVNLIRPNDTAMDLSIAIAFYFAASG
                     MGKDSISECKVLLSGLGADELFAGYTRHERIFTGISNQVRRQLKQKPVKDATVYKMNE
                     LVNKLRQELQYDLSNLYIRNLSRDDKVISCWSKEIRYPYLDYDFMRFVTSKVPLSSKL
                     HYDDQTGEIVRKYLLRLLARKMGLDWVAEEPKRAIQFGARSAKMEEGAGKMKGTDKIY
                     "
     gene            <451187..>452212
                     /locus_tag="FOA43_002848"
                     /db_xref="GeneID:62196249"
     mRNA            <451187..>452212
                     /locus_tag="FOA43_002848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923130.1"
                     /db_xref="GeneID:62196249"
     CDS             451187..452212
                     /locus_tag="FOA43_002848"
                     /note="BUSCO:EOG09342XT8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779058.1"
                     /db_xref="GeneID:62196249"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /translation="MSSGKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEH
                     SNLRFLNNMTLNLWDCGGQDIFMENFLNNDNSNNQSSNTSSNVFHKCEVLIHVFDVES
                     KEVQKDIDTFKRVLSNLKKYSPNVKIFILIHKMDLIQVNKRQELFDLMFDKLKSIALD
                     EYGFHIRGFATSIWDESLYKAWSSIVCSLIPNVSVYERYLSKLNEILNAREIILFEKT
                     TFLVISSTKRIVDSAKRDDLDPKRFEKISNIIKTYKQSVNKIRTNFSNLILHGNNSSI
                     YLEILTSNIYIMIIMNNDNAQTAEATKQEDAASPKIIHYQLNDENLVLQDIKIARDLF
                     EKIEREK"
     gene            complement(<452249..>453139)
                     /gene="RPF1"
                     /locus_tag="FOA43_002849"
                     /db_xref="GeneID:62196250"
     mRNA            complement(<452249..>453139)
                     /gene="RPF1"
                     /locus_tag="FOA43_002849"
                     /product="Ribosome production factor 1"
                     /transcript_id="XM_038923131.1"
                     /db_xref="GeneID:62196250"
     CDS             complement(452249..453139)
                     /gene="RPF1"
                     /locus_tag="FOA43_002849"
                     /codon_start=1
                     /product="Ribosome production factor 1"
                     /protein_id="XP_038779059.1"
                     /db_xref="GeneID:62196250"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="PFAM:PF04427"
                     /translation="MPKSESDILKKIRNKELRRKIYAQIQNDKTKERLTLRKERAKEE
                     QAHPELKTKRLEENVPDTIESKRVYDETVNAEIEGEDDFDEYFKDLEKEPKILITTSA
                     HAHKEAYEFAAMLIEIFPNCTFVKRKRQYSMKEMAGYCSNREFTHLIVINEDKKVVNG
                     MTIMHLPKGPTFYFSIGSLVQRKQISGHGRPTDHIPELILNNFTTRLGKTVSRLFQSL
                     LPHKPEFKGRQVITLHNQRDFIFFRMHRYVFKDNERVGLQELGPEFTLRLRRIQNGIK
                     EEVDWEFRPDMDRDKKKFYL"
     gene            <453330..>454412
                     /locus_tag="FOA43_002850"
                     /db_xref="GeneID:62196251"
     mRNA            <453330..>454412
                     /locus_tag="FOA43_002850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923132.1"
                     /db_xref="GeneID:62196251"
     CDS             453330..454412
                     /locus_tag="FOA43_002850"
                     /note="BUSCO:EOG09342TBW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779060.1"
                     /db_xref="GeneID:62196251"
                     /translation="MSSYDENTTPAVCERCLGDNPYVEMTRERNGAQCKICTRPFTVF
                     RWSIQKGGEFKKTAICLTCARTKNCCQCCMLDLSLGIDLNTRDQLLKMAGVKDGEYSK
                     DVVHNAKNEISRIYNADQLDRKFSREEIKDNSEKAKDVLGKITKLVESGSGKGETTKK
                     SKNKVRGADDEKITKEMLVKLLKTLPFNGNLSHLPKNERIKSFFLFGVGDETPNYLIE
                     EFFKDLVKDSTDRSERRMVNAVFVNSKGRFGFIEFSSRSIAEMAASKLNESKSEKIDN
                     KPKLVVIDRTSVRVCWAGKVITSGSDYSNSELHRIAQVVRKQMIKLAGGGGESTKRIN
                     EESAAITRKKAKVVHDYKALQADYEL"
     gene            <455272..>455913
                     /locus_tag="FOA43_002851"
                     /db_xref="GeneID:62196252"
     mRNA            <455272..>455913
                     /locus_tag="FOA43_002851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923133.1"
                     /db_xref="GeneID:62196252"
     CDS             455272..455913
                     /locus_tag="FOA43_002851"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779061.1"
                     /db_xref="GeneID:62196252"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF12861"
                     /db_xref="PFAM:PF13639"
                     /translation="MSSYAAEHNIRDDEESEDSEDQTTQVSTGQRIHPTLNQALAQFH
                     EEDHHQVHREEGRQVVDSMMSYVVPGNGDNQLFSTMMNFLLSSPATITVLGRGEATDK
                     GGVDNKFLDTLDRVSLKELPKDARCPICTNEFQNDEYPLVVRLPCDSRHCFDLECISP
                     WLKMNKTCPLCREDITIVRKKRLEKLVDEARKENDENDKEEEEEGEGEWEMYG"
     gene            complement(<455968..>456831)
                     /locus_tag="FOA43_002852"
                     /db_xref="GeneID:62196253"
     mRNA            complement(<455968..>456831)
                     /locus_tag="FOA43_002852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923134.1"
                     /db_xref="GeneID:62196253"
     CDS             complement(455968..456831)
                     /locus_tag="FOA43_002852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779062.1"
                     /db_xref="GeneID:62196253"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="InterPro:IPR036838"
                     /db_xref="PFAM:PF00338"
                     /translation="MSSLTLFSKSMRLTAVQFRQFSSSIHPLKPAADLDRELDKLAEL
                     AFESKKQQLPKLEKDKVDRFELLKTFKKYDPKVQTERVVVPGVNRPIPINVELNYYSP
                     LKHAVKYGDLKAEVVFKCFDTRNLEFFCDFALRAAYYLGMPATGPKPVPVKRERWTVI
                     RAPFVHAKSKENFERRTYGRVIRIWDSTEKVVDTWLAYLKQNSVWGVGVKASMYVNEP
                     LDISEKMVQLPESEKVLTDLSSTLRSLSKDSENPVAAKVLELLQDPMFTKHMSSEEVE
                     DVRQAESDKKM"
     gene            <456942..>459145
                     /locus_tag="FOA43_002853"
                     /db_xref="GeneID:62196254"
     mRNA            join(<456942..457037,457152..458130,458354..458376,
                     458438..>459145)
                     /locus_tag="FOA43_002853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923135.1"
                     /db_xref="GeneID:62196254"
     CDS             join(456942..457037,457152..458130,458354..458376,
                     458438..459145)
                     /locus_tag="FOA43_002853"
                     /note="BUSCO:EOG09342AQC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779063.1"
                     /db_xref="GeneID:62196254"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF00485"
                     /db_xref="PFAM:PF01728"
                     /translation="MADMRGNEREEGRKFGETKGIWKRFMYGLIPLSRKNFKEQKIEK
                     SRSSKLLIRLFLLKKLVIDMGKSSKDKRDVYYRKAKEEGWRARSAFKLLQLNEQFDLF
                     KGVTRVVDLCAAPGSWSQALSREIFGKPHSEDARIVAVDLQPMSPIDHVTTLQADITH
                     PKTLERILEIFGGKKADFVCSDGAPDVTGLHDLDEYIQAQLILSALQLATCVLKEGGT
                     FVAKIFRGRDIDLLYSQLGYLFDKVICAKPRASRSSSLESFIVCIGYKSRPGWKPELK
                     PELSTEQFFQEMGIGRAELRKNLSLDQEERKVAPFVACGDLNSSYDSDATYSLDTGVE
                     KSSLDPVQMPTAPPYKKALELKRKAGGHAAGKKHATQLLENGLRDRFDNINIKKVDMT
                     HFLFPSKVIDGSRDPSCFDFEAIDSYVRKLENDSTVDIIVVYGLYALYDQNLLESGTV
                     RIFIDTDSDVRLGRWIKRDVLLPAQKDPLLKAQQSQRLKELLSVYLKKSRVEMKNYVI
                     QTKEKADVVLPNAAEMGGIMLIVDGLDPILRRKSADKFGITRELTRRESIIPEGSSLR
                     KSIQHVFEEAQAGPTVSSIGEDNFRNQNTHFYDLN"
     gene            <459272..>460762
                     /locus_tag="FOA43_002854"
                     /db_xref="GeneID:62196255"
     mRNA            <459272..>460762
                     /locus_tag="FOA43_002854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923136.1"
                     /db_xref="GeneID:62196255"
     CDS             459272..460762
                     /locus_tag="FOA43_002854"
                     /note="CAZy:GH18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779064.1"
                     /db_xref="GeneID:62196255"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="PFAM:PF00704"
                     /translation="MNIIFRLISVTLLLSFFASAREISETPSLDEQPGYVTGVYYTEW
                     SYFLNHTPSDLPLSFITNIYYAFLKIDEETLDLHFADNDLAVKNPLPFHTDKIGAFVS
                     DQYFHSSISDDWVSKYMQNVSQLIQKSTISPINSIGLLGQLSQIKNLNPNVKISLSIG
                     GAETAQVFKKVIKHRQNMVRFVDNIVSYTQKYGFDGIDIDWEYPDAASTDRLTDLMRL
                     FREKLDSLPSTSTCGKYILTLALPSHLEMLNNYDMEDLPQYVTYFNLMGYDMSGIWSK
                     KAEFQSQLFRDPNIDSDSCINDTIQYLLNEKHVNPRKIVLGMPAYGRTFNTGKIYGNA
                     DACAELDGITQDEEECIVPYNKLPPLGYTEIFDKRTGAAYASNGKDGVIVYDNMDSAK
                     LKAQYVRGNKLAGGVWWDSSGDTTTSNGSKSLLLSFLEELGGLINLKRSLCMVNSNLY
                     YGKFENQTFDSSARSPSSSVSYATINEFKLWLLVLEFIVISGVVFL"
     gene            complement(<460857..>463506)
                     /locus_tag="FOA43_002855"
                     /db_xref="GeneID:62196256"
     mRNA            complement(join(<460857..462895,463500..>463506))
                     /locus_tag="FOA43_002855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923137.1"
                     /db_xref="GeneID:62196256"
     CDS             complement(join(460857..462895,463500..463506))
                     /locus_tag="FOA43_002855"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779065.1"
                     /db_xref="GeneID:62196256"
                     /db_xref="InterPro:IPR029033"
                     /translation="MLDKSKRERVHTPGFVFPDIEDSSLSSPSPTWLANFDPPLDIPL
                     AVQEMDSAIRKISTHVTPNQPVKHLKIIIHCSPYNRCIQTAELLLNHILKLPQFNPTN
                     CKVTRRLRIDQALSEWLSENFNLNYLPPNDDGYSMINNINTYLNTPVPADSDPHSPLD
                     GTTKQQMLKIKDPVWSYNQLGHCGDYGEPPLDFKSRCFDYLTSLLQYYYRSQSYEADK
                     ETVVFVISHGSVISTLLQMLLNRPVFNEIPLCTPVYFKQSDRKRTVFSLMDYNFNLNK
                     ILTFSSDVELFRLLRTPIDMSMINFEDSSNELAIGTMDYTTIIQSPPQHGRSRSRSSS
                     RSKSSERKRRSNTISLGQPINSGDQLNESEKASLRQTRSSKQLHLMNRSEDSRLIDMD
                     KLASYFENFSDSSGSGSEDDFEDVDNEAWDNHSSEVSSIAPAPTPRIPSLSSLNTLMH
                     TNSAANSIKDMLIDPSASSKKRSSLASAFLQELFGKESNNDANSEDSGSIKSIGMSTS
                     CSSHHHHTYHQNDNNSVTDTLRSFNSSFFLGDEGITDSEGESDSEETKFEEGVLSFNA
                     RKFASDDTHSDKVPMIDGTFSKVPFNSNGDEDEESNEKKLSVFPGTITPNKSQITLIP
                     SLASPNDNDESGKPDDILVISKQVDANDSLKEILFGTESSNEEDNGWFGFNTGSPET"
     gene            complement(<463859..>465187)
                     /locus_tag="FOA43_002856"
                     /db_xref="GeneID:62196257"
     mRNA            complement(join(<463859..464624,465183..>465187))
                     /locus_tag="FOA43_002856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923138.1"
                     /db_xref="GeneID:62196257"
     CDS             complement(join(463859..464624,465183..465187))
                     /locus_tag="FOA43_002856"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779066.1"
                     /db_xref="GeneID:62196257"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="PFAM:PF10237"
                     /translation="MRVLSAQALAALQEFQDEEKIRLEKFASMYKSAEDNFSERNKDK
                     KAADPIVSPGDNGCSTGLTIDDFKEDWQLSQFWYSDKTANILADALLDGADEDTVICI
                     VSAPSVYAIIRARDPKTLPTHNIYLFEFDRRFELLAGKDHFGFYDYKEPLQFRDDLKG
                     KVNRLLIDPPFLEPECQQKSSETAFALLSKDKTGKTETGDIKYKLISCTGERMKDNVK
                     KNYPETHITSFYPEHKNGLSNEFRCFASFECKQWKFEN"
     gene            complement(<465191..>466276)
                     /gene="GTR2"
                     /locus_tag="FOA43_002857"
                     /db_xref="GeneID:62196258"
     mRNA            complement(join(<465191..466157,466215..>466276))
                     /gene="GTR2"
                     /locus_tag="FOA43_002857"
                     /product="GTP-binding protein gtr2"
                     /transcript_id="XM_038923139.1"
                     /db_xref="GeneID:62196258"
     CDS             complement(join(465191..466157,466215..466276))
                     /gene="GTR2"
                     /locus_tag="FOA43_002857"
                     /note="BUSCO:EOG0934309W"
                     /codon_start=1
                     /product="GTP-binding protein gtr2"
                     /protein_id="XP_038779067.1"
                     /db_xref="GeneID:62196258"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR039400"
                     /db_xref="PFAM:PF04670"
                     /translation="MDYIDSPAQSRATILLMGLRRSGKSSICKVVFHNVRPLDTLYLE
                     STTKPTTESFKSLIDLAVVELPGQLNLFEPSLYDSEKLFSSIGALVYVIDSQDEYLSA
                     LQNLAVIIKYAVSINPRIHIEVLIHKIDGLSEDFRLDTQRDIMQRVGDDLLDYGLEGV
                     QISFYLTSIFDHSIYEAFSRIVQKLIYELPALENMLDLLMQYSNFDKVFLFDINSKIY
                     VATDSSPVDIQTYEVCAEFIDVTIDLDGLYQISHKQKSNQIMASETSGSNTNMDLFSA
                     TEPTKCISKLQNGVTLYLHQMIRGLALVGVNRLEDGDDATSISVIDHNVAIFKKSLEK
                     MWERSKLS"
     gene            <466717..>468126
                     /locus_tag="FOA43_002858"
                     /db_xref="GeneID:62196259"
     mRNA            <466717..>468126
                     /locus_tag="FOA43_002858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923140.1"
                     /db_xref="GeneID:62196259"
     CDS             466717..468126
                     /locus_tag="FOA43_002858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779068.1"
                     /db_xref="GeneID:62196259"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00202"
                     /translation="MGVSEDYFPDEPKRPDMKTKCPGPATIAKLEELSKVFDTKAAFF
                     VTDFYNSLGNYICDADGNKMLDAYCQISSIALGYNNPELLKATRTREMAVALTNRPAL
                     ACFPSTDYYEILKDGLLSVAPEGLDRVCTAHTGSDANEMAFKAAFLYQATKKRAGKPF
                     TEEDKTSVMNNQTPGASDMVILSFTEGFHGRLFGSLSATHSKPIHKLDIPAFQWPVAP
                     FPTLKYPLEGFEKENRAEEERCLKDLESILTTFPHQIAAAIIEPVQSEGGDNHASPFF
                     FQGVRSLTKKYGVLLIVDEVQCGGGGSGKMWLHQHYGISPDIMTFSKKMQNAGFFYHD
                     PLLAGDRPYRQFNTWCGDPSKALIAKAIIHEIKDKHLLNEVNKTAAYLYAKMENVRQK
                     HLKLMLNLRGKDRGFFVAFDLPTVELRDKFLYTCRQKGVNMGGCGDKGVRLRPTLVFQ
                     PKHVDILVKTIDEAFDQLD"
     gene            <468336..>469340
                     /locus_tag="FOA43_002859"
                     /db_xref="GeneID:62196260"
     mRNA            <468336..>469340
                     /locus_tag="FOA43_002859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923141.1"
                     /db_xref="GeneID:62196260"
     CDS             468336..469340
                     /locus_tag="FOA43_002859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779069.1"
                     /db_xref="GeneID:62196260"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01073"
                     /db_xref="PFAM:PF01370"
                     /db_xref="PFAM:PF04321"
                     /db_xref="PFAM:PF07993"
                     /db_xref="PFAM:PF16363"
                     /translation="MILEQQFSRSVLVTGGAGFIGSNFLRAVCTSQDYQDVKFTCIDK
                     LSYVSDNTTKFIDDLLKEDNFEFIKADISEEYDLLYRLIVEQELFTDVIHFAAESSVD
                     RSFEDPLFFTKNNVLAAQNLLECVRLIGNKRGDPHHVKFIHISTDEVYGEQRTNESAA
                     ENTLLSPSNPYSASKGAIDLIINAYIKSFQLFAVLIRSNNVYGYHQYPEKIIPMTLYS
                     LCHRQPIRIHGDGHNKRRYLFIDDFVSAVLTVWNKSEPYEIYNVGSDDEVTNIDMVNL
                     IIRQYKQWKPYSTIPPITYVTDRKFNDDRYDVDFTKIRRLGWKPQTTLQQGLDKVIRS
                     "
     gene            complement(<469398..>471437)
                     /gene="GAL10"
                     /locus_tag="FOA43_002860"
                     /db_xref="GeneID:62196261"
     mRNA            complement(<469398..>471437)
                     /gene="GAL10"
                     /locus_tag="FOA43_002860"
                     /product="UDP-glucose-4-epimerase"
                     /transcript_id="XM_038923142.1"
                     /db_xref="GeneID:62196261"
     CDS             complement(469398..471437)
                     /gene="GAL10"
                     /locus_tag="FOA43_002860"
                     /note="BUSCO:EOG09340W9W"
                     /codon_start=1
                     /product="UDP-glucose-4-epimerase"
                     /protein_id="XP_038779070.1"
                     /db_xref="GeneID:62196261"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01073"
                     /db_xref="PFAM:PF01263"
                     /db_xref="PFAM:PF01370"
                     /db_xref="PFAM:PF04321"
                     /db_xref="PFAM:PF16363"
                     /translation="MSYILVTGGAGYIGSHTVIELINHGYKVVIVDNLVNSSYDSVSR
                     VEYIVKQKIPFYKIDLRDSDGLSKVFDDYPISAVIHFAALKAVGESTTIPLKYFENNV
                     GCTISLLNVMKYHNVKTVVFSSSATVYGDATRFENMIPIPEECPTGPTNPYGHTKLTI
                     ETILKDLHASDPQWRAAILRYFNPIGAHPSGLIGEDPLGIPNNLLPFLAQVAVGRRAK
                     LSIFGDDYESHDGTPIRDYIHVVDLAKGHIAALNYLSSLKPSQGLYREWNLGTGKGST
                     VFDVYHAFCRAVGHDLPYEVVGRRDGDVLNLTSKPNRANKELQWMAHLTIDDACRDLW
                     NWTTKNPLGFHVKNYSVNEDAYGEDRVHTVEYPGFKVSIANYGATIIDIEVNGKPVVC
                     KFDNLRDYHLPSNPCFGATIGRYANRIGGAQFTIGGKQYDVEKNEGANCLHGGSHGFN
                     TQYFYGPIATHSEEDDSTTLKFVSFDKDGHAGFPGDLITTVAFKVQPKSLEFEFESSL
                     SPKSSVDATVVNLTNHSYFNLCGEGTINETELLLASNNFLEVDSALLPTRSIKKWTRP
                     DVSKPFTVGTAVFDNCFVLSDYSSKLDTRKERMVDVVHASHPGSKVKLTVSTTEPSFQ
                     LYTGDGVDTKGFFHRAGFAVEPCRFVNAARVDDWKKQVVLKKGEVYGSRIRYTFE"
     gene            <472627..>474204
                     /locus_tag="FOA43_002861"
                     /db_xref="GeneID:62196262"
     mRNA            <472627..>474204
                     /locus_tag="FOA43_002861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923143.1"
                     /db_xref="GeneID:62196262"
     CDS             472627..474204
                     /locus_tag="FOA43_002861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779071.1"
                     /db_xref="GeneID:62196262"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR036554"
                     /db_xref="PFAM:PF00288"
                     /db_xref="PFAM:PF08544"
                     /db_xref="PFAM:PF10509"
                     /translation="MSYIPIFKDLEFYSAPESQIERYQNLVKSYVSEFGGKPNFISRA
                     PGRVNLIGDHIDYCYFSVLPMAIEYDAIEAIGVEPTSTEETSRHIVVSNTNSRFATES
                     IELPADGSVVTIDNSKNLWTNYYKCSLIVAHKFIIERYPHLLTGKTLKSINVVVDGNV
                     PTGGGLSSSAALCVASTLGILRANGIKKVTKQDLTRITVVCEHYVGLNNGGMDQCASV
                     CGEKNKVLFIEFTPKLQATPFSIPEVKLPFKPLSFLITNTLVTANKTESAPVNYNLRV
                     VEVAVAAEFLAHINGLELTPDSNLQTGTLRGFMDSYFTEKLSKPQWDGRNIQVGIARL
                     TELSNKLETWFDASEKIGLTTEHAASKLGLTVEQFTKKYLTQFPVRYTKLKIYQRAKH
                     VFNESLRVLEVLQLFTDPESSQDSGKFLSEFGAIMNASQDSLRDLFNNSCDACDELNA
                     VARSNGSIGSRITGAGFGGSLVHITTEDKLPGLITAVTEQYYKKRFPQITKEELSQAI
                     VVTKPAVGGCIIDKVDF"
     gene            complement(<474290..>475384)
                     /gene="GAL7"
                     /locus_tag="FOA43_002862"
                     /db_xref="GeneID:62196263"
     mRNA            complement(<474290..>475384)
                     /gene="GAL7"
                     /locus_tag="FOA43_002862"
                     /product="galactose-1-phosphate uridyl transferase"
                     /transcript_id="XM_038923144.1"
                     /db_xref="GeneID:62196263"
     CDS             complement(474290..475384)
                     /gene="GAL7"
                     /locus_tag="FOA43_002862"
                     /note="BUSCO:EOG093427I6"
                     /codon_start=1
                     /product="galactose-1-phosphate uridyl transferase"
                     /protein_id="XP_038779072.1"
                     /db_xref="GeneID:62196263"
                     /db_xref="InterPro:IPR001937"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="InterPro:IPR019779"
                     /db_xref="InterPro:IPR036265"
                     /db_xref="PFAM:PF01087"
                     /db_xref="PFAM:PF02744"
                     /translation="MANFDFTDHSHRRFNPLTRSYVLCSPHRAKRPWLGAREASNVKL
                     LESYDPKCFLCPGNTRATGAQNPKYVSTYVFPNDYSAVKLDQPDYNENEDGPKDPLAK
                     RLLVTQGVKGKCFVVCFSPNHAVTLPLMSVPEIVKVVDTWTKLYTDLKAEHSAGKAPY
                     KYLQIFENKGAAMGCSNPHPHSQAWALDTIPTEVDTELKNLTKYKETYHSDLLGDYVK
                     LEMQEKKRIVLENDSFIVVVPYWALWPFETMVISKEHLHSLQEFNDNQKNDLASILKK
                     LTIKYDNLFDTFFPYSAGIHQAPYFGTEDEVENSWFHMHFYPPLLRSATVKKFCVGFE
                     MLGEAQRDLTSEQAADRLQKLDGDVHFLNK"
     gene            <476944..>478575
                     /gene="HGT1"
                     /locus_tag="FOA43_002863"
                     /db_xref="GeneID:62196264"
     mRNA            <476944..>478575
                     /gene="HGT1"
                     /locus_tag="FOA43_002863"
                     /product="high affinity glucose transporter"
                     /transcript_id="XM_038923145.1"
                     /db_xref="GeneID:62196264"
     CDS             476944..478575
                     /gene="HGT1"
                     /locus_tag="FOA43_002863"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="high affinity glucose transporter"
                     /protein_id="XP_038779073.1"
                     /db_xref="GeneID:62196264"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MGYEKHLVGLSIKVKNFFDKFPEIYNVYVVVMISTTAGMMFGFD
                     ISSMSAFIGTTQYKNYFNSPGSAIQGFITSAMALGSFFGSLACTFVSEPLGRRASLFL
                     CSFFWMVGAAIQSSSQNRAQLIIGRIISGLGVGFGSTVAPVYGSELAPRKIRGFIGGL
                     FQYSVTLGILVMFYISYGLHFIDGVASFRIAWGLQIIVGLFLFFGVFILPESPRWLAE
                     HDFWDEAEEIVAKIQAHGDKTDADVMIEISEIKEQILIDEAAKDVTYATLFNKKYCMR
                     TITAIFAQIWQQLTGMNVMMYYIVYIFEMAGYTGNTNLVASSIQYVLNMVMTIPALFL
                     LDRVGRRPVLLTGAVLMMIFQFAVAGILATYSKPVSSVDGDTTVRIRIPDSNKTAARA
                     VIAMCYLFVCSFACTWGVGIWLYCSEIWGENAIRQRGAALSTAANWILNFAIAMYTPS
                     SFENITWKTYCIYATFCGCMFFHVLFFFPETKGKRLEEIAQIWDEHIPAWKTSKWVPS
                     IPIVSEEGLAKKLEVQHVENPSSSNDNDSETAAQV"
     gene            complement(<478782..>480758)
                     /gene="SSA2"
                     /locus_tag="FOA43_002864"
                     /db_xref="GeneID:62196265"
     mRNA            complement(<478782..>480758)
                     /gene="SSA2"
                     /locus_tag="FOA43_002864"
                     /product="Hsp70 chaperone"
                     /transcript_id="XM_038923146.1"
                     /db_xref="GeneID:62196265"
     CDS             complement(478782..480758)
                     /gene="SSA2"
                     /locus_tag="FOA43_002864"
                     /codon_start=1
                     /product="Hsp70 chaperone"
                     /protein_id="XP_038779074.1"
                     /db_xref="GeneID:62196265"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="PFAM:PF00012"
                     /db_xref="PFAM:PF06723"
                     /translation="MANAIGIDLGTTYSCVGHFANDRVDIIANDQGNRTTPSYVAFTD
                     TERLIGEAAQNQAAMNPTNTVFDAKRLIGRKFTDPEVQSDMKHWPFKVIDDAGKPKIQ
                     VQYKGESKVLTPEEVSSMVLNKMRETAEAFLGSKITDAVVTVPAYFNDSQRQATKDAG
                     AIAGMNVMRIINEPTAAAIAYGLDKKAEGEKNVLIFDLGGGTFDVSLLSIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVTHFSNEFKRKYHKDMTTNQRALRRLRTACERAKRTLSSSA
                     QTSVEIDSLFEGIDFYTSITRARFEELCSDMFRSTLDPVEKVLQDSKMDKAQIDEIVL
                     VGGSTRIPKVQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSSKTQDLLLL
                     DVTPLSLGIETAGGVMTKLIPRNSTIPCKKSEIFSTYSDNQPGVLIQVYEGERTRTKD
                     NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSQKITITNDKGRL
                     SKEEIDKMVSEAEKFKADDDKEAERIQAKNQLESYAYSVKSTADDKKFTEKVSEEEKK
                     QLVEACEKTISWLDANQTATKEEFEGQQKSLEQIVNPIMTKFYQAGGAPAGGVPGAAP
                     GGAAPGAAPGGFPGAAPGGAAPGADSGPTVEEVD"
     gene            <481082..>482308
                     /locus_tag="FOA43_002865"
                     /db_xref="GeneID:62196266"
     mRNA            <481082..>482308
                     /locus_tag="FOA43_002865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923147.1"
                     /db_xref="GeneID:62196266"
     CDS             481082..482308
                     /locus_tag="FOA43_002865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779075.1"
                     /db_xref="GeneID:62196266"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00266"
                     /translation="MFGKSFRDRFLFPSEVVPLNHGSFGAVPRRVYQSYQQAIYDDLK
                     FPDQFMFSKQAPEMEKSVKLVARVLNTDFTNLALIPNASTGINIVFRDFPFVKGDTVI
                     LTSIIYGACGNTVDYVVNRYGLNLKVIDIKLPSTEQAILGQFKEVFEETRAPGKAICI
                     YDAICSMPGIRMPFELITRMCKQYGITSCVDGAHSIGMLNIDLSAIDCDFYTSNMHKW
                     MYLPRGCAVLFVNPRWHDYIMPFPISHTYKNEPFYKRFIFYGSNNYNSFYCIKDALDF
                     IQEDCGGFEKIREYCKGLSDGLIAHFGQDRIVKVDGATGDDLNFMVTVKVPLDQNQHE
                     YFANAFKDKEHETKLIKFVENESLQKYKTFIQFGWHNNFMYVRFSCQIYNDLHEYFWG
                     YERFEEVMKNAISECN"
     gene            <482398..>482985
                     /locus_tag="FOA43_002866"
                     /db_xref="GeneID:62196267"
     mRNA            <482398..>482985
                     /locus_tag="FOA43_002866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923148.1"
                     /db_xref="GeneID:62196267"
     CDS             482398..482985
                     /locus_tag="FOA43_002866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779076.1"
                     /db_xref="GeneID:62196267"
                     /db_xref="PFAM:PF10341"
                     /translation="MPKINRPPKTIDTNAFLTNWLTPYLVIPETTRTFKPSDHTDQGR
                     VLKILSVERRAQKDGLYRVQNGLKVIVCDANVKVFAVLTPDAICQYENTERCRVTKSL
                     INSEILVYDLGVKFIEESDALRDYGFRVTGDREHEGELRRYATIYIERFELFSRDRCM
                     PRDEGMIPFLYGCIKYRNRYFLEYLGETYDDLNSV"
     gene            <483183..>483764
                     /gene="UBC2"
                     /locus_tag="FOA43_002867"
                     /db_xref="GeneID:62196268"
     mRNA            <483183..>483764
                     /gene="UBC2"
                     /locus_tag="FOA43_002867"
                     /product="Ubiquitin-conjugating enzyme E2 2"
                     /transcript_id="XM_038923149.1"
                     /db_xref="GeneID:62196268"
     CDS             483183..483764
                     /gene="UBC2"
                     /locus_tag="FOA43_002867"
                     /note="BUSCO:EOG0934460W"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme E2 2"
                     /protein_id="XP_038779077.1"
                     /db_xref="GeneID:62196268"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PFAM:PF00179"
                     /translation="MSTPARRRLMRDFKRIQQDCSGGISASPLADNVMVWNGIIIGPQ
                     DTPFEDGTFRLRLTFDEQYPNKPPQVKFTSEMFHPNVYASGDLCLDILQNRWSPTYDV
                     ASILTSIQSLLNDPNINSPANVEAANMYKDHRSQYAKRVRATVEKSWTEDLQDMGDDD
                     DDDDEDDDDDEDDEEDDDEEDKQEGDKQEGDNN"
     gene            complement(<483869..>484710)
                     /locus_tag="FOA43_002868"
                     /db_xref="GeneID:62196269"
     mRNA            complement(join(<483869..484666,484705..>484710))
                     /locus_tag="FOA43_002868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923150.1"
                     /db_xref="GeneID:62196269"
     CDS             complement(join(483869..484666,484705..484710))
                     /locus_tag="FOA43_002868"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779078.1"
                     /db_xref="GeneID:62196269"
                     /db_xref="InterPro:IPR036639"
                     /translation="MSIREKMKKSWKFLDADQKRFTYWLAYGSYGPREGFPNVYDYYT
                     SIKGTGSPSGTSVFPPSGTSVFPPSGTPASPVSRILQDDSLGQLIQEINPKKDSQREA
                     FILQNSTSKIVEETKKIDALEMSNRKQDVPPDLPFRYPSVLRAINPSSYTIASRLPAL
                     DPRSFGIKRLQQYQFDRNTNPYNRFIVATLVVLTVLAFKKDRKVNLSGIVPEYGWKQE
                     QEEIQQTQKRQQNEILSLKLKNAMEQQQQQQQQQQHLQEPRRWYYLWLF"
     gene            complement(<485345..>486154)
                     /locus_tag="FOA43_002869"
                     /db_xref="GeneID:62196270"
     mRNA            complement(<485345..>486154)
                     /locus_tag="FOA43_002869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923151.1"
                     /db_xref="GeneID:62196270"
     CDS             complement(485345..486154)
                     /locus_tag="FOA43_002869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779079.1"
                     /db_xref="GeneID:62196270"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="PFAM:PF04900"
                     /translation="MNTCRMTFKFKPPIQVLVDADSILEAEKTKFDINKGIDRTIQME
                     TKCFITQCCINHLYETANQPAIDIAKTMEKRRCHHDETLSSYDCIKSITNVDGQNKFR
                     YVVVTQDEELRKELRRIPAVPLIYLNRSVMIMEPMSPATSRVVELVERKKLTGGLNDA
                     RHAGLMEDEGKKRSIGSNGSEVIAKKHKKGPRGPKEPNPLSVKKKKKVEVIEKVEKRR
                     RRRRHGGGGNDEVSEGRGEEEPEGRGEEEPEGRGEEELQPDDVPEKVPESA"
     gene            <486963..>487241
                     /locus_tag="FOA43_002870"
                     /db_xref="GeneID:62196271"
     mRNA            <486963..>487241
                     /locus_tag="FOA43_002870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923152.1"
                     /db_xref="GeneID:62196271"
     CDS             486963..487241
                     /locus_tag="FOA43_002870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779080.1"
                     /db_xref="GeneID:62196271"
                     /db_xref="InterPro:IPR005344"
                     /translation="MELATFAYITFKALIWSKGYWISFVLHGFFMRLRYEKSIFTRTC
                     FKKLEVRIDGLTSHPALPPVVKKYWIDLKTQLMALSNRFKLLQEKKQE"
     gene            complement(<487258..>488979)
                     /locus_tag="FOA43_002871"
                     /db_xref="GeneID:62196272"
     mRNA            complement(<487258..>488979)
                     /locus_tag="FOA43_002871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923153.1"
                     /db_xref="GeneID:62196272"
     CDS             complement(487258..488979)
                     /locus_tag="FOA43_002871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779081.1"
                     /db_xref="GeneID:62196272"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR036877"
                     /db_xref="InterPro:IPR036974"
                     /db_xref="InterPro:IPR039759"
                     /db_xref="PFAM:PF01253"
                     /db_xref="PFAM:PF17832"
                     /translation="MFQKNPIVKPFANLKNSERRKIIKSTIASYNLPEDVLSLEFVNE
                     HLFPKVIQHAVFKSSPSNFRGSVYVDVQTGKAVWFDTRDSGRLIPTLYTLWKAPFLLP
                     IVYTHMGVVDHLSNGANLMIRGCMPPFDGRAEKGVLVAVSVIERPKVMVAVGYCSMDL
                     SKITEIADNTAGVAVSIVHVYKDKLYKLDGKLEEDVLPKNEDIDMPTSIEELEELRNA
                     GGEKSEQVEDTAELVAESHIDSTFSLSTEEVDDFFVRSVLYSITQDKIDLPIDASIFM
                     SAHILKNLPPVDSDLVNMKKTSWKKAHKFLKAMEKLDLVKLKGKGEDVIVVSVADKSN
                     QRVAKFEPYRVKKHSSRPVKCSSSSVTVQQLYKPKSSTRELFNRLNMEYDRYYEEHEL
                     KELVADYIRQFRLAREQYPKLIRIDPTMSEMGVKGIKQTINSAERSGVFAMIIGKSSN
                     FQQFYRIVKNGDNGEDNGRTSKMKKGSPPKITVLIEQVRGRRKIMTRISGLEKYYIQP
                     EELASVLKVKCSGSATIGEKPVTGLAEVSVQGSHEKAVEEILVKQYGLKSSWIDVTDK
                     LKKQRRK"
     gene            <489132..>491000
                     /locus_tag="FOA43_002872"
                     /db_xref="GeneID:62196273"
     mRNA            <489132..>491000
                     /locus_tag="FOA43_002872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923154.1"
                     /db_xref="GeneID:62196273"
     CDS             489132..491000
                     /locus_tag="FOA43_002872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779082.1"
                     /db_xref="GeneID:62196273"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR024790"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="PFAM:PF12894"
                     /db_xref="PFAM:PF12896"
                     /translation="MSDFSILTSQTLPLALASAQNFQICPSMDLISFQLNSCTIWIYR
                     LNNEKVWDISLELDDEHGEGITKLCWRPDGKFFSIVSNFGRVSLFDADTGKSIIQFNV
                     SSGSKQQHIEACFWSNKAARIVDTSKFAHLLDVKIISSLTKLSSDQQLVNDDESIQLD
                     DSVLDFLIIGSSGSQISLILSGLFTVDGYQLPTRSAKILSVMSNQDLTCHHILLDESG
                     SLNMLKLDTEFVHTFAEKLPLISRTCSRLVSLLKCLIESIDSMSKDYKPFTDYTTRII
                     DLLKGEVDDPIYDLYDLLLTGSLSDATKTWLTDYLGDRGIKRWTKLGRQHFEGSRKTI
                     FYEMIPALQHLLIHLTNLQGLSKWAETRQLLGLDSTKIDNAINTGSSFLKYCYKTMLT
                     LNEEQKDFDSVMEWLEAIVQEVTTDEKPTIQIRTKDIIQFLMSVSKRSGLNQKSSGLH
                     QLYDSLTAELDGIFDQIKQKMKSQMSSSIQTTLLTVDLETCKWETKLYGDYGLLVVSS
                     NDKIDIIKFDTATLSSERMTLSINGDPQSLQASLTENGNLLLVLITYSTESKLALLQL
                     GTNGIDPLVNGSATTLKEFSIPSEDGRIATYMAHNSHRKTCCILDATRKHYTVIEY"
     gene            complement(<491013..>491957)
                     /locus_tag="FOA43_002873"
                     /db_xref="GeneID:62196274"
     mRNA            complement(<491013..>491957)
                     /locus_tag="FOA43_002873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923155.1"
                     /db_xref="GeneID:62196274"
     CDS             complement(491013..491957)
                     /locus_tag="FOA43_002873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779083.1"
                     /db_xref="GeneID:62196274"
                     /translation="MDPMSSHIILTFYRNLQRNIFLVPLDNLAKQRLSNYVHCKFQAP
                     NKDIPLYKRLEAGQELEKLLAGVKTKGDYNCVKKLLNVAFIDSQPIKSRLPNWLYQFV
                     HARSIGRRNRVFLHHKYSDILKTKHLIDKFKSNKPLLSSYYAQLAKNQFESSPDNQSI
                     TQIIDGEMPDFSSNKAGETKTNAEEIKLLLKLRSEYKTKIQTKTKRPSFEVEILPSRF
                     GQPLTRARLFNLVVNRIVKIQTYFKKYSPVSLQDLDYLNRLEKSNFLLQNASVQRGYN
                     EFIRSSFAIAEDATVMLPDLNMRIFPASNRLIQYYNEV"
     gene            <492166..>492993
                     /locus_tag="FOA43_002874"
                     /db_xref="GeneID:62196275"
     mRNA            <492166..>492993
                     /locus_tag="FOA43_002874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923156.1"
                     /db_xref="GeneID:62196275"
     CDS             492166..492993
                     /locus_tag="FOA43_002874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779084.1"
                     /db_xref="GeneID:62196275"
                     /translation="MSSKTSSKETEIFRRVNEEKENTNRKEVNSEGGNKSVYRIKSSL
                     GTLNHRRKTALRTKSSNSILSSRSLLSTARTRPDLFSTYEKASSSETTIKGNYNKVQR
                     VSKSKNTSFEEKENIYVRRLKVVRDSPEMERIIHRNVTQLAEEKGTEQKECDDDDDDD
                     DDDEIEIVPQKPQSNIDENIDGYQEIPEDIMKYVFSHGSGIEKKSLEEFKDPLELDLS
                     NLKEDSNNNDDIGNISELGLEVKLEFPELGEETEEKKLAKIREYYENNREAYKPKRV"
     gene            complement(<493046..>496112)
                     /locus_tag="FOA43_002875"
                     /db_xref="GeneID:62196276"
     mRNA            complement(join(<493046..494457,494744..>496112))
                     /locus_tag="FOA43_002875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923157.1"
                     /db_xref="GeneID:62196276"
     CDS             complement(join(493046..494457,494744..496112))
                     /locus_tag="FOA43_002875"
                     /note="BUSCO:EOG09342OF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779085.1"
                     /db_xref="GeneID:62196276"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030379"
                     /db_xref="InterPro:IPR036410"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /db_xref="PFAM:PF00684"
                     /db_xref="PFAM:PF00735"
                     /db_xref="PFAM:PF01556"
                     /db_xref="PFAM:PF01926"
                     /translation="MAASIKSAAAVNADEKSDLTATNSSATAAADDDGDGVIDGVAAA
                     PAPKKPREVPVIKRKLNGYVGFANLPKQWHRKSIRRGFSFNLMVVGTKGLGKSTLINT
                     LFNKELYKMDESPKVVYPDPEQPVEAKIETVGSEIEENNVKLNLSVIDCPGFGENIDN
                     TQVSWKPIVDEINRRFDQYLEQETKVNRSTTVDNRVHALLYFIEPTGHSLKPLDIEFM
                     KQVHQKVNLIPVIARSDTLTEMEVSQSKQLILDDIKNQGITLFNPPIYDNDDDETASV
                     TQEMVEKIPFAVVGSTNYIQTPDGRTVRGRSYPWGIIEVDNEEDCDLIKLRQLLVRNF
                     MEELKETTSKVLYERYRTEKLAKLGIKQDDSVFREFDPVLKQEEEKQLHEAKLSNMEA
                     QMRSIFKQKVTREEKKLQETEADLFSKHKEMREKLLKQIKLLEEKKKDLEKIKSQQTH
                     SSPQINVTSDLYNVLGVAHDASPEDIRRAYRKLALRYHPDKVGESEREAAEIRFKEIT
                     QAYSIIGDSDKRRDYDIYGERVPGAPPPSGPESYGFGGAAFDGADFDFSPNDFANFFN
                     GMNTGGGMPGMGGAVPGMDGESRGRPTSRGFRGPSRGPPKGKKHEDGIERTEDAHFNV
                     EVIFLDLYNGKVVKLSEERDRICDKCKGKGVKKSAVEISCSSCNSTGYERRYRHIGGL
                     SIVETIACSKCNGQGTYYREKDYCKRCKGTGVVKESKILEFAIPKGSANEGSIVLRGE
                     SDQSPGLTTGDVILEWKLKPTDKESHFERHGDDLYTKVRVPLVDALCGFSRDKFVETL
                     DNRWLSIKMPQGKVLRPGDSIIIPNEGMPVCGNYRNRHGDLYVAIDIEFPKDDWAIEK
                     NDITSLKSILDIKYGTKGQNSDLNDNSDVTNVWFKVKGKSELPVSFNSYNANAVVNSG
                     VDERKGWFGRWF"
     gene            <496509..>497723
                     /locus_tag="FOA43_002876"
                     /db_xref="GeneID:62196277"
     mRNA            <496509..>497723
                     /locus_tag="FOA43_002876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923158.1"
                     /db_xref="GeneID:62196277"
     CDS             496509..497723
                     /locus_tag="FOA43_002876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779086.1"
                     /db_xref="GeneID:62196277"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019544"
                     /db_xref="PFAM:PF10516"
                     /translation="MKKYSEEISKLLDKGGREMAAKQYEQAVEHYSTACELSNLESGE
                     DDPDLLYLYGWSLFENAVANSDVLGQNAAKKTLEEENKEEKEGEKEEEEDGGKMQFNE
                     TLAEEEENGENGEEENGENGENAENGENAENGENAENGESAENGESAENGESAENGES
                     AENGENAENADNEATQSDFEIAWDILDLTRTILRKDIENIDDNSELSHPYLKSDKDSE
                     LKNQTDYVLKRKKLADVYSLLGDISLETENFQQAGADLKSMVDLRKELYPLATGALTE
                     GYYRLSLALEFTDLPGSIEAMKMTMKSIQERAKEGDKIDKDLMQEMEQRLYELEKGNK
                     NIKDEKDRIMKGILGDIAPRGGLHKVKEIKKVTKPVVNDLTFLVKKRKSNSPIDDKCM
                     KKRTGHSSTHTN"
     gene            <497880..>498878
                     /gene="RFC4"
                     /locus_tag="FOA43_002877"
                     /db_xref="GeneID:62196278"
     mRNA            <497880..>498878
                     /gene="RFC4"
                     /locus_tag="FOA43_002877"
                     /product="replication factor C subunit 4"
                     /transcript_id="XM_038923159.1"
                     /db_xref="GeneID:62196278"
     CDS             497880..498878
                     /gene="RFC4"
                     /locus_tag="FOA43_002877"
                     /codon_start=1
                     /product="replication factor C subunit 4"
                     /protein_id="XP_038779087.1"
                     /db_xref="GeneID:62196278"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF08542"
                     /db_xref="PFAM:PF13173"
                     /db_xref="PFAM:PF13177"
                     /translation="MAETKYPLDLELPWVEKYRPKYLKDVVGNKDTIDSLERIAQEGN
                     MPHLIISGLPGIGKTTSILCLARELLNDDPKLMKDAILELNASDDRGIDVVRNQIKQF
                     AQKKVSLPSNREKIIILDEADSMTAGAQQALRRTMEIYSDTTRFAFACNQSSKIIEPI
                     QSRCAILRFNRLQDEEILQALQRIVDREKIECTEDGLAALIFTAEGDMRQAINNLQST
                     FYGFQLVNAENVYKIVDSPHPLLISKMLMLANEGKIEESLNILKELWNKGYSAIDIVT
                     VSFRVMKTMYKLSENRRLELIRIIGFTHMRILEGVSTYLQLACMVGKIAKQINPAK"
     gene            <498882..>502029
                     /gene="SSC1"
                     /locus_tag="FOA43_002878"
                     /db_xref="GeneID:62196279"
     mRNA            join(<498882..498888,498906..498914,498998..499725,
                     500017..>502029)
                     /gene="SSC1"
                     /locus_tag="FOA43_002878"
                     /product="Hsp70 ATPase ssc1"
                     /transcript_id="XM_038923160.1"
                     /db_xref="GeneID:62196279"
     CDS             join(498882..498888,498906..498914,498998..499725,
                     500017..502029)
                     /gene="SSC1"
                     /locus_tag="FOA43_002878"
                     /note="BUSCO:EOG09340Y5U"
                     /codon_start=1
                     /product="Hsp70 ATPase ssc1"
                     /protein_id="XP_038779088.1"
                     /db_xref="GeneID:62196279"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="PFAM:PF00012"
                     /db_xref="PFAM:PF06723"
                     /translation="MYYSKMTVEYQRSLGSHKLRLKEAQGQVPGLTRQSLLAIKSVYP
                     ESYKISRIEGKDDDLIIDLYNIEQLGQLDSRKAEFTRLLNIQLAKNPSTIEDLITYKL
                     PGNGSNNKIPSNHSICFSRPKGSSKILKNSISKFQFHEKTPVGGTKSLLERIRTKEKN
                     NAKFQDQLHLRKEKYIESKMRPVYDVLYTESPKDGSTYSLTMGQLERLLNDSTEIPMA
                     RQDIVETVKKLDQFIDGIDLIIVGKLEVIKIANLFVALPIMFASVSKSFRSIAKRQVR
                     FNSNKVTGTVIGIDLGTTNSAVAVMEGKVPKIIENAEGSRTTPSIVAFTKDGERLVGI
                     PAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPFKIVKHSNGDAWVEARGKQY
                     SPSQIGGFVLNKMKETAESYLGKPVKNAVVTVPAYFNDSQRQATKDAGAIVGLSVARV
                     VNEPTAAALAYGLDRADQSKVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGE
                     DFDNTLVNYILADFKKQSGIDLSGDRMAIQRIKEAAEKAKIELSSTVSTEVNLPFITA
                     DASGPKHINMKITRAQMENLVDPLIKRTIEPCKKALKDAGLATSDISEVILVGGMSRM
                     PKVAATVKSLFGREPSKSVNPDEAVAIGAAIQGAVLSGEVKDVLLLDVTPLSLGIETL
                     GGVFTRLIPRNTTIPTKKSQVFSTAADGQTSVEIRVFQGERELVRDNKLIGNFTLSGI
                     PPAPKGVPQIEVTFDIDADGIINVSAKDKASGKDNSITVAGSSGLTDSEIEKMVNDAE
                     KYKDEDKTRKESIENANKADQLCNDTEKSLNEFGDKLDKAEIEEVKKLITELRELVVK
                     VNGGESVGADTIKQKLDQLQQKSLKLFEQMYKNQQQQQNNNDNNNNNGGSSGDSSNNG
                     TESK"
     gene            <502231..>502659
                     /locus_tag="FOA43_002879"
                     /db_xref="GeneID:62196280"
     mRNA            <502231..>502659
                     /locus_tag="FOA43_002879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923161.1"
                     /db_xref="GeneID:62196280"
     CDS             502231..502659
                     /locus_tag="FOA43_002879"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779089.1"
                     /db_xref="GeneID:62196280"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="PFAM:PF04133"
                     /translation="MSRRSSLTKLIFLSILIAVGFLNIVLSCALYDNWLPLTVVAIFL
                     AAPIPNSLAQCVSTSYDSNFLGDYDDDGSMGNPVVDFCHFLTGFLVLGGTFLPLVLYH
                     CHLIKIGSLALSLTGGFIIYISIALFTMGFKDDDNDGYDF"
     gene            <502824..>504092
                     /locus_tag="FOA43_002880"
                     /db_xref="GeneID:62196281"
     mRNA            <502824..>504092
                     /locus_tag="FOA43_002880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923162.1"
                     /db_xref="GeneID:62196281"
     CDS             502824..504092
                     /locus_tag="FOA43_002880"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779090.1"
                     /db_xref="GeneID:62196281"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="PFAM:PF01399"
                     /translation="MSESYLRFILSLRSYVLSQDPRICQSLSFLDHIKDLSSLPDYNE
                     QGLLEKYPPLQILQQGDQLPNIEEWSAIATAYCLLISDLKHLKFMGTISHSAELVNQI
                     VRCAQRETGWICLPMMTVTSELRKLVFIYVQSSEYKAAKEHKLKQSQFDVYLDEKLAN
                     LLQKPFKVCLSDKCEDKKFAVYFFANELFKTYMKFGKYDAANNMCKVFQHSPNLPDLS
                     TVSKSQVITYRYFMALVECMNFDRLQSATQLLNQALDACKTGDKYHHNQKASILVLLL
                     PLNFLAHRWLPSSMLWKQYPELSLAFKSIFDSIKEGNLKVFDEEVTRMQKMMLERHVY
                     SLFIRIRPFIELRLFTKVHHFYKGEKPHIIPLSQFSSALKYSSSRDYTIEEVESRLAS
                     LIYAGQIKGYISHSNEVIVLSKSDAFPSTM"
     gene            <504256..>505632
                     /locus_tag="FOA43_002881"
                     /db_xref="GeneID:62196282"
     mRNA            <504256..>505632
                     /locus_tag="FOA43_002881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923163.1"
                     /db_xref="GeneID:62196282"
     CDS             504256..505632
                     /locus_tag="FOA43_002881"
                     /note="BUSCO:EOG09342ALB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779091.1"
                     /db_xref="GeneID:62196282"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR038497"
                     /db_xref="PFAM:PF03224"
                     /db_xref="PFAM:PF11698"
                     /translation="MTVEMKFPQFKLEGDIVNDILINSRNRTIAWSACVKANYLKEEE
                     ANCLKRVSDCAEVKDRVNVIMKDADLYAEKMISIVSRPTQDDIARFVLVIIVDTLVTP
                     DRDFSKYILGTSHVNSSLPYAPLTKLLESKDESIRLCASYVLTLLLTSRDAAKSGKEK
                     TLLPLYRFIDKSLLKDESVDMNFVGVQLLKELLQIKIYRDFYWKHQKELFPSLLQILL
                     ERRGELQMKYYTVFSVWLITFNKSAVVDLNEQYPNIIEILYAIGKDAVKEKIVRLAID
                     SLINLLNISDKREKEQVVKHYLLAEGLEITKQLLERKWADEELKADLNDMLETLDDAV
                     TTLTTFDEYANELKTKTFVWSPSHKSEEFWYENIDKFKENNWRLLKEMVALLGEKKTD
                     DEKKLYQNQAIVCFDISQMIKQAPETAKVLEKIGGKSKVMNLMNSQNQNVKYEALRTT
                     QQLVAMTL"
     gene            <505847..>507064
                     /locus_tag="FOA43_002882"
                     /db_xref="GeneID:62196283"
     mRNA            <505847..>507064
                     /locus_tag="FOA43_002882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923164.1"
                     /db_xref="GeneID:62196283"
     CDS             505847..507064
                     /locus_tag="FOA43_002882"
                     /note="BUSCO:EOG093428A1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779092.1"
                     /db_xref="GeneID:62196283"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="PFAM:PF01873"
                     /db_xref="PFAM:PF02020"
                     /translation="MSLINICRDNHDPFYRYKMPPIQAKIEGRGNGIKTNVLNAVEVA
                     RALNRPTAYVIKFFGFELGAQTAMNENQERYLINGVHDANKLQDVLDGFISKFVLCPS
                     CKNPETSLNVTRDGHLKKDCKACGKVTEVDPRLKLVTYILKNPPKSSQKGSKKKQAAT
                     ASANVVGGGKSISDIASEQKSDGSPGASGAGFTAEAVAGSRLANTEAPPSQKVEVKDD
                     EWAVDMSEEAIEARARELNAMTLKDETEKYEEFGEWILSQDELPSDVAIFKKAQDMDI
                     VNDRKTIEVLAQCLLDEEVLEEIDQHKGMFSKVLTTPKHEKSFLGGIERMIGTEHMDL
                     VPQIPRILMQLYQNDLVSEEVIREWGTHVTKKYVPKDVSKKVRKAAKPFLVWLDEADE
                     DEEENEDDGEDEE"
     gene            <507281..>509977
                     /locus_tag="FOA43_002883"
                     /db_xref="GeneID:62196284"
     mRNA            <507281..>509977
                     /locus_tag="FOA43_002883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923165.1"
                     /db_xref="GeneID:62196284"
     CDS             507281..509977
                     /locus_tag="FOA43_002883"
                     /note="MEROPS:MER0018621;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779093.1"
                     /db_xref="GeneID:62196284"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="PFAM:PF00653"
                     /translation="MVPRKTRTKLNARVNLSTIKGRETSFEPFMMNGILMKWPHSETL
                     TPEEMAADGFYYDPTYSHQDGVTCFYCKKKEHDWMGLLDQQLDMDDGIQRKPPIIRHL
                     ESSPNCPNARLLGARFECEHTTDFHWERDDLFQDPMNSAEIRIKTFIGWPYKKKKGFP
                     GAEELAANGFYYLGYDKGDDAVTCLYCGVSLEGWEEGDSVIEEHKARCLGCYVFHYKE
                     KKEASDCRNSSLYRMSLRSKKREIVGPEIDLQDDMPDMDVNNKPSYANDTSRPLKVDE
                     HGLAYEEIPDEGYLDESDDRNILPSEPVNIPASSLNELSDFYIEPSVSGPSTFFHRSR
                     DNTSTLKESKGVEIPKELEEVEESAAPEAIEEPMDDITDYNDYGDANVNEEKQLVLRK
                     PDSTRDLVEAIKEEVRQEVIKQMIAIHGREAESDGDKKKKHKHKRKHKEKKEKEKKHK
                     KRKKGRKGGEKEAAVTIKEIPKEKLDNDTPQEKVLAPLRTPIVLERSSGNLQEQPSKK
                     SIKVKEEKLESPAASPAVAFPPIYIKRETSPAVDDSSSSILPVKRHFENDSMLRMHRQ
                     ARKMNDGSVIPSDDPLSFTSEKINHLKVKKRQLKETDIKMNEEQKTEQPLQDNEPIEE
                     QTTEQPLQDNEQIEEQKTEQALQDNEQMKEALQKVQTLTDVDSDILLENVPPSDEFGD
                     AKLRSSPVATPKAVNTFDDYVSTVVDEVDEHSDNADELLAELTKNQSTPYGKGTKKRS
                     SLSPRTRPSMDLKKKLKMSMGEFEEKKSEGEKPDAASSSVSHSSSPSTAATSTTSSWE
                     PINIKDTPKYCQDLEEAAVCLKQLLSSEYRVLSEDMDGGLTDFIGEMPPEELGMTIKE
                     WLEHRAEQAAIVIRQKTAEMKKQFEADALRALQVLEKMPCDD"
     gene            <510476..>513031
                     /gene="GRR1"
                     /locus_tag="FOA43_002884"
                     /db_xref="GeneID:62196285"
     mRNA            <510476..>513031
                     /gene="GRR1"
                     /locus_tag="FOA43_002884"
                     /product="SCF ubiquitin ligase complex subunit"
                     /transcript_id="XM_038923166.1"
                     /db_xref="GeneID:62196285"
     CDS             510476..513031
                     /gene="GRR1"
                     /locus_tag="FOA43_002884"
                     /note="BUSCO:EOG093419O5"
                     /codon_start=1
                     /product="SCF ubiquitin ligase complex subunit"
                     /protein_id="XP_038779094.1"
                     /db_xref="GeneID:62196285"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="InterPro:IPR036047"
                     /db_xref="PFAM:PF12937"
                     /translation="MSRNYTVRPVASLGRGFEVSGNTEGTMSNTGNIGNTSVTANPAS
                     ASASVSVSVSASASASASASASVSASASASSDDGDYIQETEQDTEQDTEQDTDHERET
                     GRQLLLRAQARIERRFKHTGTINYADASTGLSSTYAHAYGKPIAMLPPEVLCLIFSYM
                     HSKSDSINITLTCKYWAELIVELIWFRPGISNESVLNKLGAVMKLQRDKTYWDYRQYI
                     KRLNLSLVPNLVTDAYLNLFTGCENLERITLVNCTHIGSKAVASLLHGCTRLQSIDLT
                     GVRDIQDDIYEQLATNCKRLQGLYAPGLFKVSKHAVLDVIHCCPLLKRVKLSDCPGVD
                     DEVLHELVINCPNLVEIDLHGCDKITNTAMHEMFASLEYLKEFKISKNENVTGVCFDS
                     VDGSELCLDKLRILDFTQCSNITDSAVEKFVALAPRLRNVVLSKCIAITDRSLRAIAT
                     LGKNLHYVHLGHCSNITDFGARELIKCCYRLQYIDLACCTQLTNATVFELAQLPKLKR
                     IGLVKCSQITDEGILALAENSRAHEDNLERVHLSYCMNLTLYPIYRLLKAFPKLTHIS
                     LTGVAQFLRHDITQFCREPPQEFNPHQKSIFCVFSGEGVNQLRAYLTQLIETPQDPER
                     EINELLDIITSVTEGVQNVDDTVLNADPLQRQRLRVFVDTLDRFINDYHGMRIPRQHL
                     ELFAKCVFTRLPAVHVPRIQRFFQILQNHPLQLQPRRPAQPARQGAPQPQTPGTATPA
                     RGLPVQSTATQLAATAAATAAAAAASAASVTPPPAPEVRIYERQRRQRPSRAQYETRI
                     VGGVQREIAIPRAPMEAELFQQRQSEHRQARPQREHREQGAPHDDPDVAMDDI"
     gene            complement(<513690..>514037)
                     /gene="RPL34A"
                     /locus_tag="FOA43_002885"
                     /db_xref="GeneID:62196286"
     mRNA            complement(<513690..>514037)
                     /gene="RPL34A"
                     /locus_tag="FOA43_002885"
                     /product="60S ribosomal protein L34A"
                     /transcript_id="XM_038923167.1"
                     /db_xref="GeneID:62196286"
     CDS             complement(513690..514037)
                     /gene="RPL34A"
                     /locus_tag="FOA43_002885"
                     /codon_start=1
                     /product="60S ribosomal protein L34A"
                     /protein_id="XP_038779095.1"
                     /db_xref="GeneID:62196286"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="InterPro:IPR018065"
                     /db_xref="InterPro:IPR038562"
                     /db_xref="PFAM:PF01199"
                     /translation="MAQRITLRRRNPYNTKSNQIKVVKTPGGRLIAHHIKKVASRPKC
                     GDCGTPLPGIAQLRPRQYASISKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVK
                     KVLKDQASKDKKN"
     gene            complement(<514423..>514896)
                     /locus_tag="FOA43_002886"
                     /db_xref="GeneID:62196287"
     mRNA            complement(<514423..>514896)
                     /locus_tag="FOA43_002886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923168.1"
                     /db_xref="GeneID:62196287"
     CDS             complement(514423..514896)
                     /locus_tag="FOA43_002886"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779096.1"
                     /db_xref="GeneID:62196287"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="InterPro:IPR035959"
                     /db_xref="PFAM:PF01042"
                     /translation="MSFLRLASRHSLQLNRQLALNSVSIFRMGLSSKVAPVVSTKAPP
                     AAASYSHAIKANGFVYVSGQIPYTPDGKAVKGSFSAQSEQVIKNCIGIVEDANSSLEN
                     IVKCNIFLTDISKFGEFNKVYSKYFNSHKPARSCVAVKDLPLGCPLEMEVIAVEK"
     gene            <515887..>516780
                     /gene="HIS1"
                     /locus_tag="FOA43_002887"
                     /db_xref="GeneID:62196288"
     mRNA            <515887..>516780
                     /gene="HIS1"
                     /locus_tag="FOA43_002887"
                     /product="ATP phosphoribosyltransferase (ATP-PRTase)
                     (ATP-PRT)"
                     /transcript_id="XM_038923169.1"
                     /db_xref="GeneID:62196288"
     CDS             515887..516780
                     /gene="HIS1"
                     /locus_tag="FOA43_002887"
                     /codon_start=1
                     /product="ATP phosphoribosyltransferase (ATP-PRTase)
                     (ATP-PRT)"
                     /protein_id="XP_038779097.1"
                     /db_xref="GeneID:62196288"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /db_xref="PFAM:PF01634"
                     /db_xref="PFAM:PF08029"
                     /translation="MDLVNYLPDRLMFAVPKKGRLYEKCLSLLKGADIQFHRSNRLDI
                     AICLNLPIALIFLPAADIPTFVGEGRCDIGITGYDQVHESNVDVDMGLDLHFGNCKLQ
                     IQVPRNGPYTKPEQLIGKTIVSTFTNLTRQYFERLEKIKPGEVLKTKIKYVGGSVEAS
                     CALGVGDAIVDLVESGETMKAAGLQAIETVLSTSAHLIVSRHPSHPQLVKLIKSRMEG
                     LLAAQKYVLCNYNAPRDKLPVLLKVTPGRRAATVSPLDEDNWVAVSSMIQRKDMANIL
                     DLLKEQGATDILVFEISNCRV"
     gene            <516836..>520551
                     /gene="NEO1"
                     /locus_tag="FOA43_002888"
                     /db_xref="GeneID:62196289"
     mRNA            join(<516836..516842,517004..>520551)
                     /gene="NEO1"
                     /locus_tag="FOA43_002888"
                     /product="Putative aminophospholipid-translocase"
                     /transcript_id="XM_038923170.1"
                     /db_xref="GeneID:62196289"
     CDS             join(516836..516842,517004..520551)
                     /gene="NEO1"
                     /locus_tag="FOA43_002888"
                     /note="BUSCO:EOG093409BT"
                     /codon_start=1
                     /product="Putative aminophospholipid-translocase"
                     /protein_id="XP_038779098.1"
                     /db_xref="GeneID:62196289"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR032630"
                     /db_xref="InterPro:IPR032631"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00122"
                     /db_xref="PFAM:PF00702"
                     /db_xref="PFAM:PF13246"
                     /db_xref="PFAM:PF16209"
                     /db_xref="PFAM:PF16212"
                     /translation="MEHLQSRLHSSNVASTSTSSSTSVNISPNDTTSSSNRFNLDRDF
                     ENTLNVALQNIDANPFLDHSRQSSTVVNSISANHSKFRIDDNDNDIDNETDSDTNEAY
                     SLHGLNYKARNMSSSYRNDQTSSLLGDVEAARDGRRLRSAAGTSGLLFSLKDFLGIPP
                     GSSRSKSSIQISHPHSSRPSSVHLPENCNDLPSPLKDRIINPHMDAELLPTNAISNAK
                     YNALTFLPMTLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTLFKE
                     ASDDIQRRRRDNEQNSELYEVLGSARPVRSKDLRCGDLVKLYKDVRVPADMVLVQSSE
                     SSGESFVKTDQLDGETDWKLRVACPLTQSISEEDLNSIQITAEPPSRHIHDFLGKMIY
                     GINAVGLTVDNTAWANTVLASGSAIGCIVYTGRDTRQAMNTSAPRAKTGLLESEINRI
                     SKILCICVFILSVALVAANGFGKDWYLDIMRFLILFSTIIPVSLRVNLDLGKSVYAHQ
                     IEHDRQIPDTIVRTSTIPEDLGRIEYLLTDKTGTLTQNDMELKKLHLGSISYAGDTMD
                     LVAECVKQMGETAPTKAKKRRDMGARVRDLVVTLAVCHNVTPTYEGGKVEYQASSPDE
                     IAIVNFTKSVGLSLTKRDRHSITLLHAYTGRQYHYDILQMFPFNSDTKRMGIIVHDTA
                     RDEYWFLEKGADTVMSRIVQQNDWLEEETSNMASEGLRTLVVGRKKLTKTVYDEFHEK
                     FESASASMIDRDQQMARVVTQYLEHDLELQGLTGVEDKLQENVKSSIESLRNAGIKIW
                     MLTGDKVETARCVAVSAKLISRGQYVHVVTQLSKITSSTSAAHDVAIQQLEYLKSNPD
                     ACLLIDGESLGIYMRFYRDKFCKVVIRLPAVIACRCTPQQKADVATMIKEATNKRVCC
                     IGDGGNDVSMIQSANVGVGIVGKEGKQASLAADFSVTQFSYLTKLLMWHGRNSYKRSA
                     KLAQFVIHRGLLISVCQAVFSICSSFAPLALYQGWLMVGYATLYTMAPVFSLVLDYDV
                     SEDLVTLYPELYEELTEGKSLSFKTFFVWVAVSFYQGIVMQGLSQLFVGLDEVLFTSM
                     VAISYTALIINELIMVAFEVHTWNKTMVWTELVTLGLYIGSVPFLSDYFDLSYVASAS
                     FVWQSITILAISLVPIWAAKALSRKLRPPNYAKVQQAA"
     gene            complement(<520599..>523760)
                     /locus_tag="FOA43_002889"
                     /db_xref="GeneID:62196290"
     mRNA            complement(<520599..>523760)
                     /locus_tag="FOA43_002889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923171.1"
                     /db_xref="GeneID:62196290"
     CDS             complement(520599..523760)
                     /locus_tag="FOA43_002889"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779099.1"
                     /db_xref="GeneID:62196290"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="PFAM:PF03105"
                     /db_xref="PFAM:PF03124"
                     /translation="MKFAQSLEQHIVPEWRGQYLDYKNGKKKIKKLQKRTSVLQVAKD
                     QIDQSGTSSHHLPTPKFSFRSPRSKTTVSGSPQPIYSSTEPVINTPEQRGISEHRVTF
                     PNASAEPFSLPSPAIYPETLNQSSISTRDSLSTDSETGEGTNVDTSVNINARTPLLSK
                     QSAPIGELNHRKSSVFKLLDTLRRQNSLTQLSQLLSHSSENANMSLTELEEMSLYAKQ
                     QFINWVDSELRKVDEFFREREQDSLERFLVLQDQLIQLNEKKEQAKIQMDRILEGTTI
                     SRQRQRAVSDVSDDYDVCMDDEEEDENDENTAASDVQAIAVSEPSMRSKSLATANSKM
                     RIFIYWAQNELGLFTKFDLPSLPTFDWLKENGKAEKQYYEEGYYDSDDSDDTDNNSLV
                     NDPRYNRKDYMRKKKRVDKVHNVSYFAARRQLKRAVYEFYHSLELLKSFRLMNRTAFR
                     KLIKKYDKTTDDTLLPTYMKTVDSKYFTTSDVLDNLMVKAEEMFTQYFENGNRKIALT
                     KLREIQAEKTYYAPNYLNGWLLGMALPIFAFTVFYALDRTIGGDLPEGKWLMQIWAGF
                     FLLCLMAMLFGINCFVWDEFKVNYKLIFEFNPRDNLNFRQYLVLPTLLFFIGSLLAWF
                     SFEDFWPVEFNGRDWPWIFLIISIAILFCPFDILYLNARTWFLSTVFRLVLSGLYPVE
                     FRDFFLGDIFCSLTYSISNTSMFLCLYRTHWDKCLDGSGLTKCGSSGSRLLGFLSALP
                     NIWRFLQCFRRFADTGDGFPHLANMCKYLISCMYYMSLSMYRIDTIPQNRSLLIVFGG
                     INGLVSAAWDLLMDWSLFQFHSKNFLLRDEITYKRKWVYYSAMITDVILRHQWVCYAL
                     FQKHIQQSAVTGFGVALAEVIRRFIWIFFRMENEHATNVHLFRASRDAPLPFPTSRKR
                     RRRAVKSRVMQQFHVSDEEAQYASTATGITTGFVPAPQPAHTAEGLRTRGQEPSLAPL
                     SEEGSTRNTEATTNYWGTLSKVLKMAHIKDFQRRKPRSVSDIAAEEARAAAGGTSHDP
                     DGDDSDNGGADTDEDIAEDEYRR"
     gene            complement(<523932..>528116)
                     /locus_tag="FOA43_002890"
                     /db_xref="GeneID:62196291"
     mRNA            complement(<523932..>528116)
                     /locus_tag="FOA43_002890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923172.1"
                     /db_xref="GeneID:62196291"
     CDS             complement(523932..528116)
                     /locus_tag="FOA43_002890"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779100.1"
                     /db_xref="GeneID:62196291"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MGSLHITPAQKEGISTDAKAESQQPLIRQKRLFSFLLSKDIPPI
                     PSPDERKVYPEKHTNPLYYVLFWWLTPILEVGYKRTLQAEDMYILDEPQKIEYIYAKF
                     HKYLENEIAKSRKGKGEAEGEQTNSDSDSDSISKIPTKILLVAIMKTFWFDYTLGSLE
                     LLASDIISTLMPLLQKKLTNFVELKAFGVSVDMGKGIGYAIGCCFMVLATGLFVNHFF
                     YQSMCVGAKTKAILTKLLLEKSYHLDAKGRHDFPTGKITSLMSTDLNRIDLALGFMPF
                     VCVAPVPVIIAIALLIVNIGVASLVGIAVFVISSVMLGATISTLMSLRTKANKYTDSR
                     VSLTKEFLKNFKIIKFYSWEESYKKRLGSIREKEMHYVLNLQNLRNIVIAYAISLPTI
                     SSTVAFCVLYAMNSNRSVGDIFSSLTLFQVLASQFSMIPMALAVGTDFFIGLRRIADF
                     ISAGEVPLEGDIPEVLDDPDLALKVVDGNFKWQEFEADSDEEDEDEDKNEGESSKKTK
                     KCLVRRRDTNPASATDTSSSNFEKSNSLDVEREALKFHGLKNVNLEIKKGELVVITGQ
                     IGSGKSSLLNALAGFMHKESGTVFCNGNLLLCGYPWAQNATVRDNITFGRPFDRPWYS
                     EVVHSCCLEDDLKMLPGGDNTEVGERGVTLSGGQKARVNLARAIYAKSDIILLDDVLS
                     AVDAKVGKLIMKRCIMGLLKDKTRILATHQLSLIGAADRMVFLNGDGSLDVGTMDELL
                     NRNENFINLMKFSNDESKEGRNNDGTDGKDDDQLRRIRTQMVNDYEKVSIVRDEERAV
                     NEIHLSVYQSYLKQGSGFFKSAYLPILLTSMILATFCSIFTSNWLSFWAEDKFPGRSS
                     HFYMGLYLMFTFLAVIFLTAEFTMLVYFSNTASRRMNILAMGRMIHAPMSYIDTTPMG
                     RILNRFTKDTDVCDNELVEQYRMFINPFCTIAGTIIMCIIYLPWFAIAVPGLVIIYVA
                     VANFYQASAREVKRLEALQRSLVFNHFGEALGGMDTVKAHKASHRFLSHLNELIDNMN
                     EAYFLTIANQRWLSINLDLVATILSLIITLLCCFRVFDISAASTGLLLTYVLTMSGLL
                     SMMLRSLTQIENEMNSVERLNYFAVDLIQEPPYEIPETDPSPKWPERGRIVFDNVSLR
                     YRPGLPYVLKAISMDIKPQERVGFCGRTGAGKSTIMSCMYRLVEFEGKIYIDDVDIST
                     LGLHKLRSRLSIIPQDPVLFAGTIRENLDPFKEKTDNELWDALRRAGLIEEDEMASVK
                     EQKRGDENLFKFHLQQFVEDDGINFSLGERQLLALARALVRQSKILILDEATSSVDYE
                     TDAKVQKTIATEFSDCTIMCVAHRLRTIISYDRIVVLDHGEIKEFDKPLNLFKNKEGI
                     FRSMCDQSQIAEEDFV"
     gene            complement(<529467..>533219)
                     /locus_tag="FOA43_002891"
                     /db_xref="GeneID:62196292"
     mRNA            complement(<529467..>533219)
                     /locus_tag="FOA43_002891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923173.1"
                     /db_xref="GeneID:62196292"
     CDS             complement(529467..533219)
                     /locus_tag="FOA43_002891"
                     /note="BUSCO:EOG093408US"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779101.1"
                     /db_xref="GeneID:62196292"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF07304"
                     /translation="MVKLCEINETVAFAWSLDALPVIATGTLSGVMDDTFSSDSFLQI
                     YNPFETNVSKRLLFKAASDAKYNSLSWSNSTSSYSRGLLAGGLEDNTIQLYNPDHLLK
                     SSPSKLSILSTYSKHTSPVLQVKFNPIQHHILGSSGSKGEIFVWDTNKGTCFTPGRAM
                     SPVGKVSCLDWNNTVSHIFASAGDTGYASIWDLKAKREVLQLSYSGVNLSVVAWHPSQ
                     STKLVTASGSDLDPVILTWDLRNSSTPEKVLKGHRKAILSLDWCRQDAKLLLSSGKDD
                     TTMLWNPIEGKKLAEYPSLPNWIHQTNFAPRLPDVFASASLDKKMVIQTLQDTSPPVS
                     TKVGGANEDEFWNKISSTDTQQPIFQEKQAPAWLSRPISANFGFGGRIAIARKDTKSG
                     NSIVKIVPVTGVEVVDESASTLVQAIKKHDYEAVCDSRLKIEKAFASGKDWVLLKKLL
                     EKGQKELLGEILDTEKQLDIESSSSEDEKVGKTSPSSSDDDFFRQLGSAKKAEAVAQY
                     SPKGKFTLSNDSSDDYTKKLTSKILEAKFEDALDLCVAENHILEALVLALNGTEEMKT
                     KAKSAYFTKYASQSSLARLLYSASSKDISDVVNNANIGSWKQIARSIVAFGELDNSGS
                     GPSIDANITKLGDRLMDSKETDARDNAITCYIAGNSLDKIAHIWLSELDDIEKFYLEQ
                     SNESDKKKLSESDIRFRALGEVIEKVFVYQSTASVGSDGASSDLEELGDAFKEYAEYL
                     TNAGQFELAFETLSMVSENIPGIKLEKRRLEKVMGRSAHSNTTVQPAAKYSKPTAKYQ
                     NYAPVAAGGYPTTPLPMAPAVNHTSGLRNPYATMASSARAGSMSNGPRNMYGPQGPAG
                     GVPPGSSLPPPPKVESRVSYSSRTPSANRDAGGWNDLPESMNIEPPKRDSVSNTAAAS
                     PYQLQAHQGPYNGPSAIPAQRSPSIPPPPKAGAGATAAVNGNEPLPSSVPSRSRIPSL
                     NPYAPTQPAVYPGIPAPTGANFQASAAPIGGMNSPQALPMSPRAAPRNPYAPAPAQSP
                     RGSFASPLARPGFSPQPNFAQPTFAAPPPRGGAGVVGNGFVDGPSVPPPPPLKKKAAE
                     PPISGTAPPVQTVPALQQPLPQSPLPPNSISGTATSSAVPPESPEEPIPANAQPIYTL
                     LTAEMEKVKPKIPAKFSKQLTDAEKRLNILFDHLSSGDLLSEETVESMVQLSEALSKG
                     DFGTASSLQAQISTNHADECGVWMVGVKRLIGMDKATSSSPAELQQ"
     gene            <533637..>535085
                     /locus_tag="FOA43_002892"
                     /db_xref="GeneID:62196293"
     mRNA            join(<533637..533812,533859..533890,533946..534010,
                     534252..>535085)
                     /locus_tag="FOA43_002892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923174.1"
                     /db_xref="GeneID:62196293"
     CDS             join(533637..533812,533859..533890,533946..534010,
                     534252..535085)
                     /locus_tag="FOA43_002892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779102.1"
                     /db_xref="GeneID:62196293"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="PFAM:PF10384"
                     /translation="MSEREGKEYDKKDEEDDKKEEKKDDKKDEKDEKDEKDEKDDDDD
                     DDDDDDDDDDEPDEWDQRIMKTGCAEENLALQLCHYDKQDWRQCIDEVMCDAQSKRLQ
                     SLVRVKQQWKEIIRKYSELGENEQGDLIDLRTGKILEDFGHLRSMKDSTKEKENVWKS
                     LFIAEVKQKQEAVKAAEDTILFNTLVKKKKPDGMIESIPILTDSEEEAREEEYYDELV
                     LEDPNFFSSMRHYAITTRSKLSQEDNLTVTPCKGQYTEIYYPSESESVTKKTKAKTKP
                     HGALIRRVRRPNKGNVIMDDPLIFKVPLYDNHKTYQLGRSGSLFKSMPRNYSGPLLTP
                     SKVRRLKDALQKCNLHGGNGHLKRLIWKSKGGRV"
     gene            <535242..>536312
                     /locus_tag="FOA43_002893"
                     /db_xref="GeneID:62196294"
     mRNA            join(<535242..535245,535261..>536312)
                     /locus_tag="FOA43_002893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923175.1"
                     /db_xref="GeneID:62196294"
     CDS             join(535242..535245,535261..536312)
                     /locus_tag="FOA43_002893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779103.1"
                     /db_xref="GeneID:62196294"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PFAM:PF00160"
                     /translation="MIYLDITIGDEKAGRIALELFDDIVPRTAENFKELCTEEKGFGY
                     KGCTFHRVIKGFMIQGGDFTNHNGTGGKSIYGEKFEDENFQMKHDKPFLLSMANSGPN
                     TNGSQFFITTAPTPHLNGKHVVFGQVITGKSIVRQIERQETDKGDKPLKACIISDCGI
                     LKEGDPTKFVDETGDPFEESLKDEFSVDEKDSESVFTAVKEIKQFGTDSYKKGNLKLA
                     LKKYVKASAYLEEFLPEDLAEEKVTELWHLKVSCYLNAALMSMKMKDSQETIKFSKKA
                     LECEQLEAKSKAKAYYRRAMGHLLGHNEEDAIGDFLKAKEIEPKDGGVIKGLQDARMK
                     LKERKDKERKAFGKLFN"
     gene            <536777..>542110
                     /gene="RPB1"
                     /locus_tag="FOA43_002894"
                     /db_xref="GeneID:62196295"
     mRNA            join(<536777..536780,536850..>542110)
                     /gene="RPB1"
                     /locus_tag="FOA43_002894"
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /transcript_id="XM_038923176.1"
                     /db_xref="GeneID:62196295"
     CDS             join(536777..536780,536850..542110)
                     /gene="RPB1"
                     /locus_tag="FOA43_002894"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /protein_id="XP_038779104.1"
                     /db_xref="GeneID:62196295"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR038120"
                     /db_xref="InterPro:IPR038593"
                     /db_xref="PFAM:PF00623"
                     /db_xref="PFAM:PF04983"
                     /db_xref="PFAM:PF04990"
                     /db_xref="PFAM:PF04992"
                     /db_xref="PFAM:PF04997"
                     /db_xref="PFAM:PF04998"
                     /db_xref="PFAM:PF05000"
                     /db_xref="PFAM:PF05001"
                     /translation="MKEIRAISVAKIEYPEIMDPVTMKPRIGGLNDPRLGSIDRNFKC
                     QTCGEDMKECPGHFGHIELAKPVFHIGFMPKIKKLCECVCMNCGKLLLDEHTNPHFAA
                     AIKIRDPKKRFQAVWTLCKTKMVCEVDPPADDDDDDDNDINGTGGPKFRRGGCGSMQP
                     SIRKDGMKLWGTWKRTNLEDETEQIERRQVHAEEVLSVFKHISTDDCVKLGFNEEWAR
                     PEWMIMTVLPVPPPPVRPSVAFTDSKRSEDDLTYKLADILKANINVQKFEIDGSPQHV
                     INEFEALLQYHVATYMDNDIAGQPQALQKSGRPIKSIRARLKGKEGRLRGNLMGKRVD
                     FSARSVISGDPNIELDQVGVPMTVAKTLTYPEIVTPYNIQKLTQLVRNGPNQHPGARY
                     VIRDSGERIDLRFNKRAGDIQLQYGWKVERHLMDGDPVLFNRQPSLHKMSMMCHKVRV
                     MPFSTFRINLSVTTPYNADFDGDEMNLHVPQSYETKAELQEIAAVPKQIVSPQSNKPV
                     MGIVQDTLCGVRKMTLRDNFIEYDQVMNMCFWIPNWDGVVPQPAILKPKPLWTGKQIF
                     SLTIPKGIFMQRLDGSLLSPKDSGMLIVNGSVIFGVVNKATVGTSSGGLIHTCMREKG
                     PDVCAQMIGNIQKVVNFWLLHNGFSIGIGDAIADPDTMKTITKTISVAKDQVQEVISD
                     AQKNVLEPEPGMTVRESFEQKVSKILNEARDAAGKSAETSLKDSNNVKQMVTAGSKGS
                     YINISQMSACVGQQIVEGKRINFGFADRSLPHFTKDDYSAESKGFVENSYLRGLTPQE
                     LFFHAMAGREGLIDTAVKTAETGYIQRRLLKALEDIMVQYDGTTRNSLGDVIQFIYGE
                     DGLDGTQVEKQVVDTIQGSTDSFEKKYRIDLMDKSKSLRADLVEYGADIVGDMGLQKL
                     LDEEYKQLLSDREFLRTKVFPTGENNWPLPVNIRRVIQNAQQIFHVDRYKANDLTIPE
                     IINGVKDLCKKFIVVRGKGGCLDEAQDNATYLFQCLVRSRMATKRILQEFRLNKDAFE
                     WVLGMIEQQFAKALVNPGEMVGVLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRL
                     KEILNVAKNIKTPALTVYLQDAVAFDIERAKSIQSAIEHTTLKNVTAVTEIFYDPDPK
                     STVIEEDVDTVEAYFAIPDEKVEENLHKQSPWLLRLELDRAKMLDKQLTMSQVAGKIM
                     ENFGDDLFVIWSEDNAEKLVIRCRIVREEKALDEEEEETEDGLLRALETQMLESITLR
                     GITGISRVFMMKYDKTYVDEAGDFAKKKEWVLETDGINLSEVIAVDGVDPTRTYSNSF
                     VEVLSVFGIEAARTALYKEILNVIAFDGSYVNYRHLALLVDLMTYKGHLIAISRHGFN
                     RNETGALMRCTFEETVEILFEAGASAELDTCDGVSQNVIMGQMAPFGTGAFEMYLDED
                     RLGLLPSEERSTAVAAPSSTPVAASTKNVAGSATPYEDEQLKDDFVHVEDSDKVAFSP
                     MITSTANDDRSGGFTEYGGVSSYQPSSPRFGATSPSYGATSPGYAPTSPGYSPTSPSY
                     SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PSYSPTSPQYSPTSPSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQ
                     YSPTSPQYSPTSPSYSSAADHKEDEEKK"
     gene            complement(<542291..>544303)
                     /locus_tag="FOA43_002895"
                     /db_xref="GeneID:62196296"
     mRNA            complement(<542291..>544303)
                     /locus_tag="FOA43_002895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923177.1"
                     /db_xref="GeneID:62196296"
     CDS             complement(542291..544303)
                     /locus_tag="FOA43_002895"
                     /note="BUSCO:EOG09340HF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779105.1"
                     /db_xref="GeneID:62196296"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PFAM:PF02237"
                     /db_xref="PFAM:PF03099"
                     /db_xref="PFAM:PF09825"
                     /translation="MNVLIYSGQGTTPESVKHCLETFRLILSPYYSVTSASASTLIEQ
                     PWEGKTSLLVIPGGADLPLCRAFNGEPNRKINQFVRHGGKFIGFCSGGYYASHRCEFE
                     VGNPSMEVSGSRELGFFPGICRGCVYRGFSYGSDVGAKAVEMTVNADNLPEYGSTNVL
                     NYYNGGGLFVDAQKYPNTEVLASYTGKVDVEDGPEGTKASVILCTVGKGRVLLTGTHP
                     EFTPDLLHESPEFPTVSRDIRRLRATNTQRLKFLRTCLKRLDLHVNERDTARPSLTPI
                     FLTSVDPSETISLVNRISQNTTHVIDNIIDGGKDKFGLHDSLDRLASFHQKEGYEDPE
                     IAIKEIFPCIHGYPDTKLTPYFNFKHYYEVLNQSYSQLGIEEEFGRMFMYQEVTSSTT
                     TLMDSNIHLMKCLPHGFTIHGTVQVCGRGRSGNYWVNPVGVMAVSTLLKLPLSSANRS
                     PIVFIQYLSSMALVEAVLQYGPGYSEVPLRIKWPNDIYVMPPKFIGQNRNTPIDTDEA
                     TYTKVGGVMVNANVIDNQYYLVVGTGFNVSNAAPTTSVNMVIDSMNKYWGDNGISKSL
                     DRIETERLLAKYLSIFNGMFNTFRAQGFAPFLSKYYQMWLHSNQIVHIVSEGNARARI
                     VGITPDWGMLLAKEVDTNDRPTGQMFELQPDGNSFDMFRGLISKKK"
     gene            <545287..>546012
                     /locus_tag="FOA43_002896"
                     /db_xref="GeneID:62196297"
     mRNA            <545287..>546012
                     /locus_tag="FOA43_002896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923178.1"
                     /db_xref="GeneID:62196297"
     CDS             545287..546012
                     /locus_tag="FOA43_002896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779106.1"
                     /db_xref="GeneID:62196297"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004570"
                     /db_xref="PFAM:PF01066"
                     /translation="MDRSRDLKNKTIQKSIELKDNISKILPPDIHENIYTLPNFLTLT
                     RLICAPVVGYMIIHKMTTGALSLFVYSCITDFFDGLIARHWDLKSVVGSILDPIADKA
                     LMIICTVCLSITSEIPLYLAILILGRDIMLGLAGVVVRYITLPAPKTLLRYFDFSIIS
                     VEVRPSMISKVNTALQMVYLGTIMIKPLAMIYLGQNYGEDATGILLSLIKYFEWIVAT
                     TTTWSGLSYLFGRKAVKILLPKK"
     gene            complement(<546057..>547649)
                     /gene="CCT4"
                     /locus_tag="FOA43_002897"
                     /db_xref="GeneID:62196298"
     mRNA            complement(<546057..>547649)
                     /gene="CCT4"
                     /locus_tag="FOA43_002897"
                     /product="T-complex protein 1 subunit delta"
                     /transcript_id="XM_038923179.1"
                     /db_xref="GeneID:62196298"
     CDS             complement(546057..547649)
                     /gene="CCT4"
                     /locus_tag="FOA43_002897"
                     /note="BUSCO:EOG09341NL6"
                     /codon_start=1
                     /product="T-complex protein 1 subunit delta"
                     /protein_id="XP_038779107.1"
                     /db_xref="GeneID:62196298"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PFAM:PF00118"
                     /translation="MSAVVKPSPSNATFQNKEKPQEVRRANVVAAKAVADAIRTSLGP
                     KGMDKMIKTKDGKVIISNDGHTILKHMAVLHPVAKMFVDLSGAQDVEAGDGTTSVVVI
                     AGALLSAAERLLAKGIHPTIISESFQKAAKRSCEIMLDMSHEISLDDKDALIRAATTS
                     LSSKIVAQHSSLLGPIAVDAVLKVANEEAHNVDLNDVRLVKKVGGTIDDTEMVDGVVL
                     TQNVMKSAGGPTRVEKARIGLVQFCLSPPKPDMENNIVVNDYRQMDKILKEERMYLLN
                     ICKKIKKAKCNVILIQKSILRDAVNELALHFLSKLHILVVKDIERDEIGFLSKSLGCK
                     PIADVESFNEGRLGSADLVEEEESDGSRIIKISGIKKVTHPTVSIVCRGANQQVLDET
                     ERSIHDALCVIRCLVKERALIAGGGAPEIEVSRQLLKEVHSLSGVEQLCFTEFAFALE
                     VIPTTLAENAGLNPIELVTELRNRHENGEKEAGISVRRSGATSTYNEHVIQPVLVNTS
                     AITLASETVKSILRIDDIQFSR"
     gene            <547853..>548959
                     /locus_tag="FOA43_002898"
                     /db_xref="GeneID:62196299"
     mRNA            <547853..>548959
                     /locus_tag="FOA43_002898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923180.1"
                     /db_xref="GeneID:62196299"
     CDS             547853..548959
                     /locus_tag="FOA43_002898"
                     /note="BUSCO:EOG09342SII;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779108.1"
                     /db_xref="GeneID:62196299"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="PFAM:PF07065"
                     /translation="MLVEGPEKKTVSSAVATFADISVSAQDVVNCSYSQWYNKFSSYT
                     YTKAEILRPVPIEFINYLLSDDIILPKDEQGSSLFQKVELNSDNEYSDWEEEEDDDAD
                     ADADEDKDLSNKASPTSTFPSFHQKIKDAIQRLGGKVAPKLNWTSPQDATWMMMNNTM
                     ECHNATELYLLLKSSDYINHDIGHAFECVTEGPQNVPEGFEYELVLRKWFDINPSMEF
                     RCFVRDRQLIAISPRDLNYYTFMKDFENEIVDKIDLFFDSVLLPKFDSNSFAFDVYIP
                     KPLTTVYLVDVNPFARQTDSLLFSWNELATMKSDDDGPLFRKVEQANSGRFASRAHSQ
                     NQVPKEIVDASLDTEALVELAQGWDKMMKKEDGD"
     gene            complement(<549104..>550840)
                     /locus_tag="FOA43_002899"
                     /db_xref="GeneID:62196300"
     mRNA            complement(<549104..>550840)
                     /locus_tag="FOA43_002899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923181.1"
                     /db_xref="GeneID:62196300"
     CDS             complement(549104..550840)
                     /locus_tag="FOA43_002899"
                     /note="BUSCO:EOG09342LTW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779109.1"
                     /db_xref="GeneID:62196300"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="PFAM:PF09368"
                     /translation="MTKNRRSKQSQEPNIEEIGLDEVDEFAQEREKVLLNEAGWDKDQ
                     VDSSESEEEEAVMDIEEEGDDDKDKADIESYRKRLQGPVEDDEEEYFIDKDKEEADNE
                     DDDDGDDDDEAWGNIKGDYYGAEDLEEEDDEDAKEMEKEALRLQKKHLEDLNMDAYML
                     DETVEEWTHETKKEQEAKKGEAEEISITEVAKLDKDSQLQILQRRYPEFIPLTKEFQS
                     LKGVLKELEKQRDGKNEVVQIKYSTLASYLGTVATYFALFVSKLHDGEQFSMKGEPIL
                     EAILNSREIWYEAKGLNETGGEEEKQTIVESSEESLEEPLESLEEPLEIPLEKPLEEP
                     LEESDSELAFGEMTPSFTLEKKSIKHLKRAGIEGIDNVDAEEKRGRRRALGFYTSKID
                     QREKKKMTRFQGDEDIPYKERLYERQQRLLEEARKRGDRNNKKAPGVDLDDDEFNERD
                     TKDAREINLEGEDYYEAIKQKKEKKKATRKNAHELAVRAAKEGKLAELQEGIDGDGKR
                     AINYQMLKNRGLTKKRNKADRNSRVKKRKRYDQAKKKLGSVRAVYKTPEGPYQGEKTG
                     IKKNISRSVKMV"
     gene            <551024..>552208
                     /locus_tag="FOA43_002900"
                     /db_xref="GeneID:62196301"
     mRNA            <551024..>552208
                     /locus_tag="FOA43_002900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923182.1"
                     /db_xref="GeneID:62196301"
     CDS             551024..552208
                     /locus_tag="FOA43_002900"
                     /note="BUSCO:EOG093446S6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779110.1"
                     /db_xref="GeneID:62196301"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="PFAM:PF05132"
                     /translation="MSSNKRLDSISRPSTPKRKLKFKPKLVARKPKEERDAEAHINTP
                     GINRNNLRLQQPHRFMPNRNRMNKRYQNTTLLTSGPLSAGAVPVVPEGIKEKASSLAS
                     RRTVSPVTELVSRLHRTKDKNRPPKVEQGTNGLHVNEINVGSNSDEEDDDLSEAGSDV
                     KINMGKELNFDDEDLKLFPMRAERAQHYEFGEEPHPDSTIKTEFHREASDISSREGSN
                     IPDSGPNVKKENSSLAFIPEDSSDKKQAAIDAINDYQTRQEARILQEDYSSLVKYMEE
                     FKVSQDEEKPSCVLPSEFLFLQLPSILPPFEKPIKAEVSAGAEKIEEEKADLPTGVIG
                     KLRYHESGKLTIKLGNVVFDVTGGGPADFEQEIVAVNRADHQCYHLGSVGEKIIAAPK
                     LV"
     gene            complement(<552220..>553467)
                     /locus_tag="FOA43_002901"
                     /db_xref="GeneID:62196302"
     mRNA            complement(<552220..>553467)
                     /locus_tag="FOA43_002901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923183.1"
                     /db_xref="GeneID:62196302"
     CDS             complement(552220..553467)
                     /locus_tag="FOA43_002901"
                     /note="BUSCO:EOG09342K4Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779111.1"
                     /db_xref="GeneID:62196302"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR031658"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="PFAM:PF00134"
                     /db_xref="PFAM:PF16899"
                     /translation="MTSSEDLTPPPKKPRTVSNDDLYRRSTQYRYWSFTQSKLEDLRV
                     LANKKGRVLTHKRLEDLDPSLDEAKMIKENDVAQFPYVSLDEELKIITYYARKCQDLA
                     NFFHLPSQARSTAIIYLYKFYLTYSVMTYHPQHIMYTCLFLAAKVENSFIGINNFSKA
                     IPKTSPESILQYEYLILQTLRFSLRCHHSYQPLYGFYLDIQQLLPKVDRKRLGQSCDH
                     ARDLVGESLFFDVNFLFTPPQIALACLWRSDDILVERYLAKKLGLKRKQKETDGAEAE
                     AEAEAEAEAGAEAETETETETEAEAETKTEAEAKTDTETKTDTKPPKTEEGEVPPQQR
                     FDKMFQTIKKCSRLIDQASRNPSVEEAKDISSKIRYCLEPLRYGRKLLKQRIAISEIV
                     EEANTKRSVSTESEQTSKRQKTQ"
     gene            <554188..>556242
                     /locus_tag="FOA43_002902"
                     /db_xref="GeneID:62196303"
     mRNA            <554188..>556242
                     /locus_tag="FOA43_002902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923184.1"
                     /db_xref="GeneID:62196303"
     CDS             554188..556242
                     /locus_tag="FOA43_002902"
                     /note="CAZy:GT71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779112.1"
                     /db_xref="GeneID:62196303"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF11051"
                     /translation="MGSGKTWKHFICFGAPRRAKRLAIGAAVVIVILISAQVVDMFRS
                     NRQMASLDEPAERSSHFWPVYGSDADLDNTKEQEMIEHEEIKNHLYEVKQGSEVGDGV
                     EDPDTDQPNENGDDGNSDNSDDNDNSDNNDDNSGGDSDGILIKYKLGLEHKAPEEAEH
                     NAALDKFLQKVLTVLITSKPKTGFELMKRSKKQKSDTSFNLYPRQYGKNGVVNIAAHD
                     NRPGVPVLSEDFLGQCLTMSSQVFQDLQTSHFYVTKWLPDKYPENVYKGDGVVMVGGG
                     RYSWFVLLAVENLRSTGSKLPVEVLIPSEDEYESYLCDKLLPKLDAKCVVLTQRLPFL
                     KKFSSIIGGYQYKSLALLSSSFERVLLLDADNLAVENPDSLFDSEPFDSYGMILWPDY
                     WKRVTHPDFYKLAGFKIGDKRVRNGPDDLSPPELYVSGFENPKTDLPLHDREGTMPDL
                     TTESGQIMVNKRNHMRSLLLSLYYNLYGPHQFYPLFSQGTNGEGDKETFLAAATYYGE
                     SVYRVNKICDSLGYWMDDPHKFVGVGMIQHDPVVDYKNSKDYRKYVEQKLSEFKDENP
                     NWKKLTPQLWKSINEDSENNFNSYMDRNQRPRFYHCNFPKLDPVDMHKYNKLVDDNGK
                     EERLYTSNELDFDFEKKQWVIMRKYFCDGDLELKYFTDAGVRTTDYCQFIDDRITFLE
                     AN"
     gene            <557761..>559466
                     /locus_tag="FOA43_002903"
                     /db_xref="GeneID:62196304"
     mRNA            join(<557761..557768,557819..>559466)
                     /locus_tag="FOA43_002903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923185.1"
                     /db_xref="GeneID:62196304"
     CDS             join(557761..557768,557819..559466)
                     /locus_tag="FOA43_002903"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779113.1"
                     /db_xref="GeneID:62196304"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MTIFTEPTDRTDRTEPSRSLESTGSLGSAGSLGSAGSLGSVGST
                     GSTGSSGAPGTNGTSSISPSVPANAQLPQIWMGELDQRWDELTIRQIWTSLLSPRGIT
                     LHSVKLIRDRQSSQMGLTNAGYCFIRFYNFEDASKVLALFNGKPIPGTNNQRFFRLNW
                     SSANIQAAAAASHTLSESNPEFSIFVGDLPQGATEHILFETFKSRYPSCCGAKVMVDQ
                     NTGHIRGFGFVKFLNDDERCRALVEMQGFALLGRPIRVSPATKSGDAQPQQQQQQQQQ
                     QEQQTYQRPSQNHLSMATSSSNVITNRSSPGPSTTSLQASAPAQAYSDPSNTTIFIGG
                     LNMPVSEVQLRELFAKFGDITYVKIPAGKNCGFIQFFHRASAEAALTEMQGYDIGGGC
                     RLRVSWGARAAQRIWFARQLLVQQQHQQVEQQQQQLLSQQGLTQQQYQLLSQPQLKNT
                     PVSGVVDDSMNGIYNFQQQGLAASTLGLSGGLVADNMPTAFPASAQLNTERIPYSTNN
                     HSNSSNSSAKEELKLNSLLLAARDGNLDHLDINSSVYGSSGHC"
     gene            <560665..>562467
                     /locus_tag="FOA43_002904"
                     /db_xref="GeneID:62196305"
     mRNA            <560665..>562467
                     /locus_tag="FOA43_002904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923186.1"
                     /db_xref="GeneID:62196305"
     CDS             560665..562467
                     /locus_tag="FOA43_002904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779114.1"
                     /db_xref="GeneID:62196305"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MSDTTDNKKGQGTIFEVNPKKAYNTNDEVASTSYDSSSGSISET
                     EESKGGFKGWFHNFIDGFKRYDVGEIDPNLTDIERTAVIAAKAPLKRKLKSIHIQMIA
                     IGGAIGTGLFVGSGTALATGGPASLIICYSLTGAMIFCTVQALGELSVAYPVAGSFLS
                     LCNRFISPGWGFMISWNYAMQWLIVMPLELVAASLTIQFWNSSVNPGAWVAIFYCTIV
                     IINLFGSLGYANVESVLSMIKIVAIVGFCILGVVLNCGGGPNGKYIGGMYFHNPGAFN
                     HGFKGLCSVFVTAAFSFEGTELVGLASAETQNPEKVLPSATKQVVWRVVLFYLVSLTL
                     VGLLVPYNDSRLLQSSSVDVTASPFVISIENAGIKVLPSIFNGVILISVISVANSAVF
                     GCSRTIASLADQSFAPKWFGYIDRTGRPLAGVGLALLFGLLCFLSATPKEAEVFSWLM
                     ALSGLSSICTWGTICLCHIRFRNAMKVQGRTTDELSFTAISGVIGSWFGLILNCLVLV
                     VEFWISLFPIGSKPNAKAFFQSYLNVVVNIGLFIIYLLWKRRKSIVWIHGKDVDLVTG
                     RKKVDVDLVRQEKAEMKAYIRSRPWWYRTYKFWC"
     gene            <563002..>564759
                     /locus_tag="FOA43_002905"
                     /db_xref="GeneID:62196306"
     mRNA            <563002..>564759
                     /locus_tag="FOA43_002905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923187.1"
                     /db_xref="GeneID:62196306"
     CDS             563002..564759
                     /locus_tag="FOA43_002905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779115.1"
                     /db_xref="GeneID:62196306"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MDPKKSLASKEPSTYTASDDLSESLEETPKKNGLKGMLFDFRDG
                     FKERIVEEGDNSSDMSDLEKANVRAAKTPLKRELNSRHIQMIAIGGAIGTGLFVGSGS
                     ALASGGPASLIICYFFTGIMIFCTIQALGELAVEFPVSGSFLILCSRFVSPAWGFAVA
                     WTYTIQWLTLLPLELVAAAITIKFWTSISSAVWVSIVYACIVVINICSIKMFGEIESV
                     LSLIKIFAVVGFCILGIIMDCGVPSGEYIGGMYFHNPGAFNHGFKGLCSVLVTAAFSF
                     GGTELIGLTAAETANPRKTLPKASKQVVWRIVLIYLISLIMIGFLVPYNDSRLMNSSS
                     SSASDSPFVIAIENAGIKVLPSIFNAIILISVVSVANSSVFACSRSVASLANQGFAPK
                     LLGYVDRNGRPLVGIVISLLMGLLCYLSVTPNEAEVFNWLMAISGLSSVLTWGTICLS
                     HIRFRNAMKIQGRSTEELQYTSIVGTLGSWIGLVLNVLVLIAQLWISIVPIGANPSAE
                     VFFQNYLNVVVNLALLIGYCIWKRHGGLKMLWIPAKDIDLSSGRENIDMELLRQERAE
                     ESAMMQTKPWIYRIYKFWC"
     gene            <565019..>565579
                     /locus_tag="FOA43_002906"
                     /db_xref="GeneID:62196307"
     mRNA            <565019..>565579
                     /locus_tag="FOA43_002906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923188.1"
                     /db_xref="GeneID:62196307"
     CDS             565019..565579
                     /locus_tag="FOA43_002906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779116.1"
                     /db_xref="GeneID:62196307"
                     /db_xref="InterPro:IPR000701"
                     /db_xref="InterPro:IPR014314"
                     /db_xref="InterPro:IPR018495"
                     /db_xref="InterPro:IPR034804"
                     /db_xref="PFAM:PF01127"
                     /translation="MLASARNFLRLTASTACRRHSLLRPVVLSSAANVRAIMAHRQIT
                     TVNRSDSQEEAILQAQRRNRPVSPHLDIYEKQLTAVMSALHRITGVMLATGFYGITMA
                     FAAGSLLGHPIDSATLVDLVAGLPSVVDYFLKAVVAFPFVFHFSNGIRHLIWDTSHAT
                     TLKAVYTTGYITIGATAVLGLLLMFA"
     gene            complement(<565602..>567577)
                     /locus_tag="FOA43_002907"
                     /db_xref="GeneID:62196308"
     mRNA            complement(join(<565602..566692,567571..>567577))
                     /locus_tag="FOA43_002907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923189.1"
                     /db_xref="GeneID:62196308"
     CDS             complement(join(565602..566692,567571..567577))
                     /locus_tag="FOA43_002907"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779117.1"
                     /db_xref="GeneID:62196308"
                     /translation="MNSSDDISLSTSKNWALPPRSKPKKGRKERPVTGTSRVKNKGTR
                     VRINRQIHSNINLFTNNQSELQAQLQSVTRENGNLKKALAKLNREIESLKAIANSIEP
                     NTSPFIVDASTNTLPLDPVTMNYIIDCKRLKREETKGPQGSGSLAIPVGLKPIVTGYS
                     LKNTTFLSPKDILINPTALKPQTSIKAPKKHKKKREQENLTRDLKNDSKKDPKDSKKT
                     PEDSKKTPEDSQKRLKSLSRAPENPQDTLPSLRKPVAPKASKSIDTPKQASKLQSASH
                     PADLAAADWFSKNSFLDFDMYNDGMSDSTHPLSESPSSFMLESMKASESLDARKIDDT
                     ANGSTTTNNNNNDDALASPRFDFDNNDDLMY"
     gene            <567879..>568837
                     /locus_tag="FOA43_002908"
                     /db_xref="GeneID:62196309"
     mRNA            join(<567879..567881,567902..567915,567943..>568837)
                     /locus_tag="FOA43_002908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923190.1"
                     /db_xref="GeneID:62196309"
     CDS             join(567879..567881,567902..567915,567943..568837)
                     /locus_tag="FOA43_002908"
                     /note="BUSCO:EOG09343H0T;
                     MEROPS:MER0000549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779118.1"
                     /db_xref="GeneID:62196309"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR035144"
                     /db_xref="PFAM:PF00227"
                     /db_xref="PFAM:PF10584"
                     /translation="MIVFDINNYDNDVTTFSPTGRIFQVEYALEAIKQGSAAVGLVSK
                     THVVLVALKRNAEELGSYQKKVIKIDEHMGVALAGLAPDARVLSNFLRQQAMTSKMVF
                     NRPLNMAKAVYSIADKAQENTQSAGGRPYGVGLLVAGVDETGPHLYEFQPSGSVLEYF
                     GAAIGARSQAARTFLEDKFKEFPDASRDKLIEYGLTALRDTLAQDKELNLHNTTVAVV
                     GKDEPFTVYDDEDVEKYLGMLDSLTNKRHRDEGEGEGEGEGESEGEGGEGAEATGAAE
                     TTDAAETTDAAETTETTQVTTDTMDTD"
     gene            complement(<568846..>569475)
                     /locus_tag="FOA43_002909"
                     /db_xref="GeneID:62196310"
     mRNA            complement(<568846..>569475)
                     /locus_tag="FOA43_002909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923191.1"
                     /db_xref="GeneID:62196310"
     CDS             complement(568846..569475)
                     /locus_tag="FOA43_002909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779119.1"
                     /db_xref="GeneID:62196310"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR024060"
                     /db_xref="PFAM:PF04115"
                     /translation="MVVVDKVKVTVDSARVIEAEMLTPKSFATFGSVFSADEQIQDAE
                     KTSANQGTATKLLKVAPVINNSEQAPSGRMATANWNIFRSYPPNHLMTKDGDTVSYLA
                     RVLERHPYTTQTFIPMGLDAHQIGFLVICAPNDTAHGNLPDYRRARAFLCRGDQSVTY
                     GVGTWHAPMVALGPGYHLDFAVLVHENGVPNEDCEEVLYEPGFHVSYVV"
     gene            complement(<569570..>571360)
                     /locus_tag="FOA43_002910"
                     /db_xref="GeneID:62196311"
     mRNA            complement(<569570..>571360)
                     /locus_tag="FOA43_002910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923192.1"
                     /db_xref="GeneID:62196311"
     CDS             complement(569570..571360)
                     /locus_tag="FOA43_002910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779120.1"
                     /db_xref="GeneID:62196311"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF01053"
                     /translation="MQKSHISQAIGASIPNNTPHAVSVTLPTWEATVGYEQGQDWVVQ
                     KMHSGYPRFFIHSKIQELCDLLEQTYALDDERCFIYPTYNVAKRCRNFIKARTTLPQV
                     NIRILQLSSPAPKTVEEASYRVESDIAVVFFPSSEYPLAKEYWQHSGEGISSRHAEYF
                     LTEMTDKLKNDIRLKKNLQNTPDSRKMSPHPYNSSHSPINGSAGSRSSRSSRSSGRHS
                     TINTPIANNPEFVSFIEERFGRNLDLSFAKDAKKLLRERIADQSEDQYTNSDLVYLFP
                     SGMASIFNAHQVLLNTIQDHKECKSVCFGFPYVDTLNILRKWGAGVHFYGYGDDESMD
                     ELEKRLEGGEQILGLFCECPSNPMLTTPDLKRIHALSEKYNFAVVVDDTVGNPSNIEA
                     LVYADFVVSSLTKVFSGDSNVMAGSMVLNKQSRYYGVFKKYLDENFEDCFWDQDAIFL
                     ERNSRDFVRRSKEMNSNALAVLKLFEESPLIDKIFYPFIAKSRKYYDALKKPDGGYGA
                     LMSIIFNDPTDAVCFFNSVRLSKGPSLGTNFTLVCPYAILAHYQELDEVEKWGVDRNL
                     VRLSIGMEPQKELIEILEEALDIAKEQHEI"
     gene            <572480..>575026
                     /locus_tag="FOA43_002911"
                     /db_xref="GeneID:62196312"
     mRNA            <572480..>575026
                     /locus_tag="FOA43_002911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923193.1"
                     /db_xref="GeneID:62196312"
     CDS             572480..575026
                     /locus_tag="FOA43_002911"
                     /note="CAZy:GH47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779121.1"
                     /db_xref="GeneID:62196312"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR036026"
                     /db_xref="PFAM:PF01532"
                     /translation="MLKPKWSPTKETPLPLYYKDKRIAHKGTIYSNFKAIVTRSKHKK
                     MLFRAFITSLILYGILYFYSIIPCSEESQQPLGLWDRRKNEVRQTFLDSWHDYMRHGW
                     GKDIYRPVSQRGRNMGPVPLGWIIVDSLDTLQLMECKQEFSDARAWVQYELDYEKFDH
                     NINTFETTIRMIGGLLSTYYLTEDDLFLEKATHLANKLSGAFDSDSGIPYASVNLQRG
                     DGIPAPSGSSTAEAASLQLEFKYLAKVTGEKLYWEQVEKVMKVLDDNHPEGGLAPIFV
                     DPDTGKFKGHLIRLGSRGDSYYEYLLKQHLQTGESVYLDMYQESYAGIKKYLVNRSYP
                     NGLTFIGERPNGLDGPLDNKMDHLVCFIGGLFALGATEGETVAEIQKQHRWDASRAEQ
                     MELAREMGKTCYRMYHDIEATGLAPEIVVFNTDPSTDKDYYIKANDRHNLQRPETVET
                     LYYLYKITGDEKYREWGYEIFKNFIKYTKVPAGKGKDDKTRYTSLGDVTVNPPVLRDN
                     MESFWLAETLKYLYLLFDDDSKPKWDIRNVVYNTEAHPLPKFDLIGTGLRTGWRRSEP
                     DQGSMDSLRIKTVENGGLLRNQEVSADDGEELEEGADPKSSRKFIKYTGEHIEDSVDA
                     EKDNKRVADEMKENNEIPKSKQPIAKQLDEQVKEIQGEENNEEFNGENLEHAQELKHE
                     DEQRDESQDEHQDENQDEHPDENQDEHQDENQDEHQDEHQDEHQDENQDEHQDERRDE
                     NQDEHQDENQDEHQDENQDEHQDERRDENQDEHQDENQDEHQDENQDEHQDEHQDEHQ
                     DENQDESADVEANKEFAGNINEVMLEAKHEVAQPLDQQVQQVNEDASNDQ"
     gene            <575804..>577327
                     /locus_tag="FOA43_002912"
                     /db_xref="GeneID:62196313"
     mRNA            <575804..>577327
                     /locus_tag="FOA43_002912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923194.1"
                     /db_xref="GeneID:62196313"
     CDS             575804..577327
                     /locus_tag="FOA43_002912"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779122.1"
                     /db_xref="GeneID:62196313"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSSSIEDFGTPVLKCQATTSSKKKFTGVDGFREKEVELHGDGSE
                     DAPNTGRDQNDGREGHWHDLEPDNSADPSVCFDDPANYPDGGWRAYLVVFGSFLGLTV
                     DFGFINSIGSIQSYLNLHQLQNESTVGSSFIFAIFLLLTYVLCLIGGVAFDELGPRIP
                     LIFATILMFFGLFFTGSCNTVPSFIGVLGILTGLGMGTCSAPLTGVVSHWFYRKRSTA
                     FAMATVGGSVGGIIIPLLLNKLYIVVGFTWALRILAFVCLGLMIICILLVSGRKDKIC
                     PPEASETIKYTGSNPILHKVSILCGKAVNFRALKEPAYLLCTLGIGFSDLSLVCTLTY
                     FPSYVTFVGYSETKANTIITIINCMGILGRYIPGVLADKIGPYNVMIIMMTATCLSVW
                     VLWLAWSMSNSGLSSIYVFSVIYGFFNSSVLSLAPSCIAAISSTKEFGQRYGTAYLVA
                     GFFVFGGMIGGGAIISEESIENYSYFAIYCGSLYVASIAAYAASRFVQVGRRFKVIV"
     gene            complement(<577359..>578444)
                     /locus_tag="FOA43_002913"
                     /db_xref="GeneID:62196314"
     mRNA            complement(<577359..>578444)
                     /locus_tag="FOA43_002913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923195.1"
                     /db_xref="GeneID:62196314"
     CDS             complement(577359..578444)
                     /locus_tag="FOA43_002913"
                     /note="BUSCO:EOG09342TJ3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779123.1"
                     /db_xref="GeneID:62196314"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="InterPro:IPR018246"
                     /db_xref="InterPro:IPR036237"
                     /db_xref="PFAM:PF01261"
                     /translation="MAKKEQVIEKGFAYVRNAKIEYKFGAHVTTSKGIFNSVGHAMDI
                     GANSFAMFLKSPRRWVSPALSDNDAARFKEMCQKYNFNPRTDVLPHGSYFINLANPDI
                     TKNKQSLDCFIDDLQRCEKLDIGLYNFHPGSSLGSDHQESLERLATNINTAIEKTKFV
                     RIVVENMAGHGNLVGSTLDDLAEVLKQVKNKERLGFCIDTCHTFAAGYDIRDEKGWKK
                     FWDEFDEKVGFEHLASLHLNDSKAPLGANRDLHQRIGWGFLGLECFRLLANDDRFKGI
                     PLVLEVPDGGEKVTPYGDDIKLLEWLIGKKKDDSEVVAKTSQLQKLGENERKEQQTKY
                     EKKQKKRRSSGADIASLMTKKRRKKTA"
     gene            complement(<578493..>580007)
                     /locus_tag="FOA43_002914"
                     /db_xref="GeneID:62196315"
     mRNA            complement(<578493..>580007)
                     /locus_tag="FOA43_002914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923196.1"
                     /db_xref="GeneID:62196315"
     CDS             complement(578493..580007)
                     /locus_tag="FOA43_002914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779124.1"
                     /db_xref="GeneID:62196315"
                     /db_xref="InterPro:IPR012340"
                     /translation="MYGTPLISMKQGTKLQTIRVEDLRVDTGYEERKLYSRKLYALVL
                     SYCTLPNPKQSHFANILVTDFTESLDVYKNLTYANRFMIKNGQEQLGSTKIFTIDIRR
                     TDLETFLAQASKAFREQFPEPEVNPYDAIYDQRIIVEASGFVSRYRDIIELKRASVSL
                     LDRSYLVNHTDNVYLTGFLERLNFQLGGKNDPSGLLEKRYDLTSILKGETKHALVGEK
                     GQRDGSVEYIDSTEIVKKLLQKGVGLAGGKRSLSQALEEDRLEEVQKVTPKKLNLGSS
                     GAEITGRTPGTPGTPGSDLGRLDSTPSRIPSTPIPFSVKREESVQPSPLGWQAPTPIV
                     IEDADYYTMASTSPKAVDTDLERIIETSSLKGYYKVSDVKIMGYLPNENESVVIIDAD
                     NRLMINDTLELVLAPNRKGTVVGDKSGNLLCSKYLRVGFADEQTALRFFEINRQHLTE
                     SAIQSKLKLLIGRVCTVSLTNIENTGAVNDHMGINHVIWVLSKPSTIRELLENH"
     gene            <580248..>581792
                     /locus_tag="FOA43_002915"
                     /db_xref="GeneID:62196316"
     mRNA            <580248..>581792
                     /locus_tag="FOA43_002915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923197.1"
                     /db_xref="GeneID:62196316"
     CDS             580248..581792
                     /locus_tag="FOA43_002915"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779125.1"
                     /db_xref="GeneID:62196316"
                     /translation="MKVNGLSETSNESGGGREPKTVNEIFDQATQEEESGDRWLSSDL
                     SKALRFYQRAYSLYMQALNIDVSHLDTRYNASRLLFTVYTEYIKNEGVNLTDLNNCDL
                     ALSRTDASVIQPLQNICQFFQISLELVSQASSRFAWDLYYNAALCYFEYVEEETRNGY
                     ETMAQFSQVMDAMQISQRLLSSALQYQVKELKQFTEKVGKAEPIIHSEVPTARDTIAE
                     IEDTILPSTVLETCLNCYRLVSTSYEDSWSEERLSLVANASDEFINVVDSISSGLLDN
                     YTNSSNEIVPSLTEDEINELKITKISFLASKSLTFAECEAVWQSEPLLDLVDKLLLEA
                     GSYRTLLDKLDESLAVVDDKLKWQVLSVMDTKYKECYKVLKKQLDQLKKRSVEDTGDD
                     KSNIISQICSVFIEQADIEVERSMLESGQKYHDVLVKNSYNLLKNSLVYSKQGGGLRE
                     SVSGKLVREKRRRETLARLCILDGKLSRTELSSIVGANYWPQEMSDLADVSVYSEGAK
                     SALTQA"
     gene            complement(<581797..>582726)
                     /locus_tag="FOA43_002916"
                     /db_xref="GeneID:62196317"
     mRNA            complement(<581797..>582726)
                     /locus_tag="FOA43_002916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923198.1"
                     /db_xref="GeneID:62196317"
     CDS             complement(581797..582726)
                     /locus_tag="FOA43_002916"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779126.1"
                     /db_xref="GeneID:62196317"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MSNYSKQRQANLENFSTDKVLHYESDSLKAILTGCSKCVLQHDL
                     PDRKAVFEAEQLGNYTLPDYGLTDYLPDAEAADNLVSPVFLQDNLKMMDFACGTGLMV
                     QKLAPYFKGANPTVIGIDISAAQIDAFQSKLQTIYRVNPSLNVQAYQYDIIDEQFDRD
                     NSLNRPDELVEDSFDIITTTLSFHHFSELKRIVGQLLKYLKKNGKLIIVDMYDHKDQY
                     IQENVDSDSPVAYHGGLSPSQIKQKLDSFHFSRLEASVKYNYEHWCGVANLENHLPKP
                     TVERALREAPKRLRDGKMEYLVPRELVLAICTK"
     gene            <583181..>583756
                     /gene="HAM1"
                     /locus_tag="FOA43_002917"
                     /db_xref="GeneID:62196318"
     mRNA            <583181..>583756
                     /gene="HAM1"
                     /locus_tag="FOA43_002917"
                     /product="nucleoside triphosphate pyrophosphohydrolase
                     ham1"
                     /transcript_id="XM_038923199.1"
                     /db_xref="GeneID:62196318"
     CDS             583181..583756
                     /gene="HAM1"
                     /locus_tag="FOA43_002917"
                     /codon_start=1
                     /product="nucleoside triphosphate pyrophosphohydrolase
                     ham1"
                     /protein_id="XP_038779127.1"
                     /db_xref="GeneID:62196318"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="PFAM:PF01725"
                     /translation="MSTITFVTGNANKLKEVVAILAGSDGETKVGKFSISNKKLDLDE
                     LQGTIDEVITRKCEQAARIVGGPVMCEDTCLCFKAMHELPGPYIKWFVKYVGLEGINK
                     MLDGFDDRSAQAVTTFGYCEGPGHKVRLFQGRTDGRIVSERGPTDFGWDAIFEPDGFQ
                     TTYAEMTGPEKNKISHRYKALSKLRDFLLAQ"
     gene            complement(<583832..>584469)
                     /locus_tag="FOA43_002918"
                     /db_xref="GeneID:62196319"
     mRNA            complement(join(<583832..583867,583915..>584469))
                     /locus_tag="FOA43_002918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923200.1"
                     /db_xref="GeneID:62196319"
     CDS             complement(join(583832..583867,583915..584469))
                     /locus_tag="FOA43_002918"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779128.1"
                     /db_xref="GeneID:62196319"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="PFAM:PF01126"
                     /translation="MRDPKVYRQGIQMFYHLFRTIEECLYSEIAKDTRYSAMLSSIWK
                     PSLARTDKLYQDLMFFYHEQPEKFSCPILKQQVQSVQHIRDVTAERPYLLLAYMHVLY
                     LALFAGGRIMSSQVARSLNLFPQMEGKSFDEVAAMGTNLYRFEVDDPTELRMIYKRDY
                     ELQTRNFLTEKEKEEVIQESKIAFDITIQIKLPGDN"
     gene            <585035..>585943
                     /locus_tag="FOA43_002919"
                     /db_xref="GeneID:62196320"
     mRNA            join(<585035..585043,585296..>585943)
                     /locus_tag="FOA43_002919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923201.1"
                     /db_xref="GeneID:62196320"
     CDS             join(585035..585043,585296..585943)
                     /locus_tag="FOA43_002919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779129.1"
                     /db_xref="GeneID:62196320"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="PFAM:PF11788"
                     /translation="MITGTVAEREFTKAQKYPIPAHRGVWFPKGMPDIKHGRDRRFKQ
                     EVNLPKEILEGDAEDLENVGRPISANPRITEADKKNDQTSLERELPRTLYLLLKQNGQ
                     WKFPTFQLENDETALNQVAENGLRQLGGDNINTWSVSGTPAAVIKYVNGNILPYGTSV
                     DHEGVSREYLMKSHVVAGQFVPQQGKGVEEYKWLVKEEIQPLVEKPYFDQVRHLLAQI
                     "
     gene            <586089..>589559
                     /locus_tag="FOA43_002920"
                     /db_xref="GeneID:62196321"
     mRNA            <586089..>589559
                     /locus_tag="FOA43_002920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923202.1"
                     /db_xref="GeneID:62196321"
     CDS             586089..589559
                     /locus_tag="FOA43_002920"
                     /note="BUSCO:EOG093409ME;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779130.1"
                     /db_xref="GeneID:62196321"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR031968"
                     /db_xref="PFAM:PF00169"
                     /db_xref="PFAM:PF16746"
                     /translation="MSASHLGPSTASSGPLGDKLIRLVAVGLKEASTDSPSFRASMKY
                     IETAVAEMVHSLRQILAFFQRYSGISADLDDLQDEFNLVFGPIGTAEASNELLNKDIA
                     APCLEQTIGGTNSIFRIMKSLMWFESPIFDEIQKFLDNDIANYWTLQRQFQSIQSKYD
                     GLWVKYMSLPKSHDPAETREDAVQLFEIRKQYVHLALSLWIFVKQLDYRISLLFVNIC
                     NSLWPSAPKFSLLAPTLGLSPVYKSIMSLKASLFLQLASYKTLMGNLTTVRESSERGI
                     VDLFSPSSEMTDYDPAHINDGNLYLKGDAAEQQFEKHGWVFLKSRLIGTGELVWIRRW
                     LFVKADVYGFLSISNNGQYVEESDKFGILLANVTYLPEENRKFCFQIRTLQASLVLQV
                     ETLGDLRSWLTVFRTVKFHAMKEDMGFATSRYQPLVDLLRLVPVVEADYSLVASTQQE
                     DKIRKLVNGQLMHIHPVLDINPPMTTQMTSLAVLSHLYLSSAPIPGASTGNFWGFVNW
                     GLYYVVNRDSKAFLAKMIKARRPKPSLIVRYSESYPHDLKMADVELRSIFEGFIGPKE
                     LVLIRFKASWSPNSSQELFCKIYVTENAFYIYTNNCGLISVSPLPLTDFLYGEVVPKT
                     HCDVIKVYLVSGLSIKMKVFIGSAYVICDQINLLLRSGRSSKPRSMEDLISNFKKLEK
                     QAQKTETEAIGVTPVVKSAVVEATPSNSVITVPEEVFGKGSEGGGLMKFRNGSLPVML
                     CEKSYNLPAKALFHILLGDESFMLQCMQPETPSAISDKGVGHTPWRCNEKQVLSRIVW
                     DASNKNVGTLQQIDKMVNNKYYSFTQTSPKLRILFGVLRRVQLRFVISNLSYHTCGLV
                     IYYHLEKKDHRVAYFVQKMLSKILRYRVEELDIRIRGTQKLISKESRKIASSIKLFGL
                     ITKFDSNEPMSEELTFESQVKYVSAQQLIVCYIERLNFVAGRIMKVVFEWMLLVGTYL
                     MEIFKGNLPWIGLLVLSSIVNLVLVGRTSYSYWEQRSIEQYANELSERPSYMQRQISI
                     SEMNEILQPRTSQVSYNSSRSLCFQEFSKVASLMMIGKAKEDSWGSSMTDSLIGLRLK
                     RNELLAQMNILNSVERSYIYKEWQNWVLKEHKNCELVRKKFSDKYDTEVEEYCDSVSH
                     EMEYLYQVLM"
     gene            complement(<589574..>590692)
                     /locus_tag="FOA43_002921"
                     /db_xref="GeneID:62196322"
     mRNA            complement(<589574..>590692)
                     /locus_tag="FOA43_002921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923203.1"
                     /db_xref="GeneID:62196322"
     CDS             complement(589574..590692)
                     /locus_tag="FOA43_002921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779131.1"
                     /db_xref="GeneID:62196322"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSPFPGINGTPPLSRYTSIHYRLGTSLYNTLYRVEQQRNVSSGK
                     DNLLNCTGLRGHYETPKYPIILCHGFSGFDRLLYIPALKFSIDLSSFRTRTEKRQRKS
                     EVLYKNLVEKDDQELDGKTNVDADSEDAGGLQLFEYWHGIKQSLEKQGCQVLVAKVPP
                     FANIQTRARALDAFIQGKATSWQRKHHSKEKVKFNLVAHSMGGMDCRYLISKLEHNNY
                     EVVSLTTISTPHRGTYAADFVMQRAPKELIDRHFPSIRQLTREYSARFNDKVRDDPTV
                     KYFSFGASANPKFLNMYYLPWSLISVEEGPNDGMVSINSCKWGKYMGCLNGVDHKQLI
                     NWMGGIKRLKTAIGIQDKGFNPPAFYLDIADNLAKNVL"
     gene            <591125..>593078
                     /gene="ATP1"
                     /locus_tag="FOA43_002922"
                     /db_xref="GeneID:62196323"
     mRNA            join(<591125..591345,591656..>593078)
                     /gene="ATP1"
                     /locus_tag="FOA43_002922"
                     /product="Alpha subunit of the F1 sector of mitochondrial
                     F1F0 ATP synthase"
                     /transcript_id="XM_038923204.1"
                     /db_xref="GeneID:62196323"
     CDS             join(591125..591345,591656..593078)
                     /gene="ATP1"
                     /locus_tag="FOA43_002922"
                     /codon_start=1
                     /product="Alpha subunit of the F1 sector of mitochondrial
                     F1F0 ATP synthase"
                     /protein_id="XP_038779132.1"
                     /db_xref="GeneID:62196323"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033732"
                     /db_xref="InterPro:IPR036121"
                     /db_xref="InterPro:IPR038376"
                     /db_xref="PFAM:PF00006"
                     /db_xref="PFAM:PF00306"
                     /db_xref="PFAM:PF02874"
                     /translation="MLSARTIRAVARKALSYNLARAIPKATRFVTPFARSYASAKAAP
                     TEVSSILESKIRGVSEEANLDETGRVLSVGDGIARVYGLRNCQAEELVEFASGVKGMA
                     LNLEPGQVGIVLFGSDREVKQGEIVKRTGKIVDVPVGPGMLGRVVDALGNPIDGKGPI
                     ESVERRRAQVKAPGILPRQSVSEPVQTGLKSVDALVPIGRGQRELIIGDRQTGKTAVA
                     LDAILNQKRWNDGDDESKKLYCVYVAVGQKRSTVAQLVQIFEQHGAMEYTIIVAATAS
                     EAAPLQYLSPFTACAIAEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYP
                     GDVFYLHSRLLERAAKMADSEGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLE
                     AELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLD
                     ASTKKTLVRGERLTQLLKQKQYHPYAVEEEVPVIYAGVNGFLDDFPADRVGEFEAKYL
                     AYLKANHAPILDTIRDKGVLSKEDLAQLKSASQDFVATF"
     gene            593866..593936
                     /locus_tag="FOA43_002923"
                     /db_xref="GeneID:62196324"
     tRNA            593866..593936
                     /locus_tag="FOA43_002923"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:62196324"
     gene            complement(<594008..>596681)
                     /locus_tag="FOA43_002924"
                     /db_xref="GeneID:62196325"
     mRNA            complement(join(<594008..596569,596634..>596681))
                     /locus_tag="FOA43_002924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923205.1"
                     /db_xref="GeneID:62196325"
     CDS             complement(join(594008..596569,596634..596681))
                     /locus_tag="FOA43_002924"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779133.1"
                     /db_xref="GeneID:62196325"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSCKRDLIEERAAYTKRTEDYIQLIKRFAEPEVSEVGNYSILRE
                     IGSGAFGQIYLGYHKFLRVKVCLKRGTRDPNNPQTSDNMMKEFYYLKEFGHHPYISRL
                     YEVILTDKYVYLVLEYYPEGDLFDYLSKRGRIPIDEALKIFTQLVGAVYYMHRNGCCH
                     RDLKLENILLDRKFNVKLSDFGFTREIPLVANGTGRAPLTEICGTEAYMSPELIQKKS
                     YSGIKTDIWALGVILYTMVAGEMPFDDSLPTEQIEAAVLSEEPVFSKPCFAGSLGLVV
                     LLRSLLAKPPENRPASLADVLTLPLLQPYGGQNQIEIVHKLIYGPTDKSLSLHSLSNS
                     DRALLKEMTHLGFDKDCLKRSVRNEMLDPLDGFWMLLKEKKQRKAERKKRKRRSRSML
                     RLSGSKSFIDSAKQYAFGQSSNAENVDSTEPASASATALATAASAATTSCGFPNDTST
                     DGPLMSHHPHHRHELPKPPVQPVASISEEKEVPKPALKEKRLSSIKKKHSVFSLFALF
                     LTSRKNSVALFGTRGSRLSTESSSRESILRKIFPSSSSSNNSTREEKRSYDDSRTHQN
                     SDHGVGVDNRHVGSRRAGSAVNDHNRGHSRAIVSFDSRKRNLRTSVVVIEPEKHAVGP
                     PSSSSTQDNYYKRSVPTRPGSVISSYSIQTTISETSNGSGYITGYSTDNHATGGNSVA
                     AAAQGVPGSPRPARPGISRGISDWSVGSRNVSSQAESPNSSLTGISRTTSMDSSSRSS
                     GGILRSKKKSSSSNSFPLHRRDLGLKSKINAKWSFSMANAGNNLKRYRKHAPKQIIEE
                     EEPEMADSEEMVEDDDLEKEEYNNTENDEELVDEKALRAESTEIEPEIGTPERSANEV
                     LSQHSAPPPLKVQ"
     gene            complement(<596879..>598483)
                     /locus_tag="FOA43_002925"
                     /db_xref="GeneID:62196326"
     mRNA            complement(<596879..>598483)
                     /locus_tag="FOA43_002925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923206.1"
                     /db_xref="GeneID:62196326"
     CDS             complement(596879..598483)
                     /locus_tag="FOA43_002925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779134.1"
                     /db_xref="GeneID:62196326"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="InterPro:IPR036565"
                     /db_xref="InterPro:IPR036615"
                     /translation="MSNSSADTRSSPMIRRTYKDAVNVLNTLQSNFSTIDAVRKSGII
                     RNPMLIPEMVEWTRRIGYKPSDFNRLNIIHVTGTKGKGSVCSFVNSILSQYRTPAKFV
                     PAAAAAAVAADAIDIDPSSRSNSVESSVSPRITKIGLYVSPHLKTVRERIMINGKPIG
                     EELFARYFFEVFDRLDKSSSDPIKFPHMTAGVKPAYFRYLTLLAFHTFISEGVDSAVF
                     EVGIGGEYDSTNIIEHPTACGIASLGLDHTQILGNTLESIAWNKSGIFKPDTPCFSVR
                     QPDQAATNMIEERAVEKKAASLQWVDIRSDLADINLGINGDFQAQNASLAIALCQAHL
                     NKLGFAVDTDTLPDEFIRGLEQARWPGRCQILPDKQRKDLTWFIDGAHTKESIQGASH
                     WFTTVTNPERKRVLLFNQQTRDPQLLLKTLYHEMEKAKLMFSHVVFTTNVTWSSGEYS
                     EDLVSLNTSAKQVDSLEVQTLSAEIWNKLDKKSRKHIFHDLQTSINFICSLEGPLDVF
                     VCGSLHLVGGFLVVLESKEGKMITGL"
     gene            <599023..>600579
                     /locus_tag="FOA43_002926"
                     /db_xref="GeneID:62196327"
     mRNA            <599023..>600579
                     /locus_tag="FOA43_002926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923207.1"
                     /db_xref="GeneID:62196327"
     CDS             599023..600579
                     /locus_tag="FOA43_002926"
                     /note="BUSCO:EOG093428QE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779135.1"
                     /db_xref="GeneID:62196327"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="PFAM:PF03006"
                     /translation="MPLARRVRKRADSTSSIQSFVDSASVQKMNSSLEERLLHKMDSF
                     LADMESKLDHLEEYLMEPSASSSSKDKLLPSPQLLATWKKVKLGMAKNHEKSLHPLVE
                     LLEENEDPVDPVDPVDEESVDSVEDPVEDLSLQRQTSHSSIFSNISVTSEINYTKIMD
                     RLRSLDAKLDDFEGKYNVLLKNPQETLKQLKSSLYNYEKALAAGSYRLLHFYELPFQW
                     RENKFIIFGYRFSESHASAVKSILHWHNETCNIWSHLLGAALIIYLALFHYPSTRVYK
                     LTTMSDHIVTFMFFVAAIKCMLFSVIWHTYASISTLHLRQRFACFDYTGITVLIIASV
                     ITTEHIGLKDYTFLRLGYVIFSFLTGSAGVVFTWSPKFDKPESRIIRIAFFVSLAALG
                     VTSFFTSSFKRSFAYSFDLYSPLFFSFMWYIIGVVFYGCLIPERWRSDVVIDEFNISD
                     ETVMKLDREGKLQEYLDKIPQKTKQYGKFLSLWWVDYVLNSHNIWHVFVLLGILGHYY
                     ATLKMFEKIL"
     gene            complement(<600605..>603067)
                     /locus_tag="FOA43_002927"
                     /db_xref="GeneID:62196328"
     mRNA            complement(<600605..>603067)
                     /locus_tag="FOA43_002927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923208.1"
                     /db_xref="GeneID:62196328"
     CDS             complement(600605..603067)
                     /locus_tag="FOA43_002927"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779136.1"
                     /db_xref="GeneID:62196328"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="InterPro:IPR036378"
                     /db_xref="PFAM:PF02469"
                     /translation="MDVLSANSTYSRFILSLQRSGLVDQVNELENVTLLAPTNDAFKS
                     LGLPYLLMNASTLFKFVVDQPVLSGDVNGVNIYSTLNRHGSPFFNDLSVPILFDRESD
                     GFSIENARVIYPDNLAPASNSVVHGIDSLLVDIKPSVCESFQTIHIHNSFASLFNQDN
                     YCSNFKISNVTFLYPANSLFNRWFTEIELAYLHHQLGSQDREMVLGNFILLGMYGGNM
                     FGRTISTENLLGESVHLSSRYQGNEILVDGNSSQSTSANILLSDGMAHYFEEMELSKL
                     RFPTFTPRKYLIGLNQTDFVDELDFRRLSALIDDLDLEQTIFITLQDSSLSVKSQSKN
                     SLLYKFAKGKIELNGDRMIESKFCTQSSLGHCQKLKMARLSGDDYLLNGHSHILSDRY
                     QIGNTYIYLVDDDIPLPGKLEHSISPVDRCAKTLRFMDDFGQLKFKHNDGRGYTVFLP
                     TSDAWSDIDLTLDYLIAHEDKLELVLGNLVLNGLVYSDFVGSKQLTNINDDPIVLDKM
                     RDSTTVTINNRIQLPLSFGSEALFRDGVAYPVNRVVLPESMTITMDELIETAQAEEFL
                     NILKAVNLTNLPYDPYYSFIVPSSATLLIANITSLTKGLSFLEEFARLHILPGKSLDK
                     ALSCEKEIPTLLDGVHLTCNKLPSGGRMLQILEGNDHEVRVLRSGFTTTDSGLLLIDK
                     PLNPDWLDSHNRPLIRLRLPFVSVLIGIVLGMVILTSILSFCFFFTVGSDSAKQSDLE
                     IADDNPNEQTPNRQDERSRLFAPTAPTVPTAPMAHTGYGSIDSKRPTESRRAVEPLGF
                     SERYSTHSKAKAINCSRVRTEI"
     gene            complement(<604021..>605535)
                     /locus_tag="FOA43_002928"
                     /db_xref="GeneID:62196329"
     mRNA            complement(<604021..>605535)
                     /locus_tag="FOA43_002928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923209.1"
                     /db_xref="GeneID:62196329"
     CDS             complement(604021..605535)
                     /locus_tag="FOA43_002928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779137.1"
                     /db_xref="GeneID:62196329"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01593"
                     /db_xref="PFAM:PF13450"
                     /translation="MNHHTTIIIGAGISGIKAANDLTQNGIDTLILEARDRLGGRLHT
                     IKTESGIPLDIGASWFHDCLVNPLLRKAVDTGNVQFYYDDGRFDIFTKQHGLVNDNMK
                     FKPVADEIKDYLKQICSEQFTSDNDISVRQACYNYFKLKGYTLTEDQIRYAPQLIRYF
                     EMWIGSSWDSLSARLISSDEHWGRNALVTNGYMTFYYDELDELASGFGTGKGTGRGTG
                     KGTDLIGSRILLNKVVYRIRFDQKTRYIMVSARDQTTNEETTYSCDYLLCSVPLSVLK
                     LSSSEATGSIRWEPPLPQSLVEKLGKVSFSGLGKVFLEFKDCFWPQETDRFLCLADPD
                     DELTLSITENRPITFSSSGRITDDPDPFKYTVLFMNLYRAAKVPVLLALISEPLTNFI
                     ESSDDETIWRFFRPLVANISKPVESEPVSIHHTNWTNDPFSRGSYTGVTVGDDLMPCI
                     EALQEAKGIFDGKGRVRFMGEGVIDEGNGCVHGAWLTGQREAGKVVGMINRGRL"
     gene            complement(<605721..>607192)
                     /locus_tag="FOA43_002929"
                     /db_xref="GeneID:62196330"
     mRNA            complement(join(<605721..606991,607034..607042,
                     607189..>607192))
                     /locus_tag="FOA43_002929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923210.1"
                     /db_xref="GeneID:62196330"
     CDS             complement(join(605721..606991,607034..607042,
                     607189..607192))
                     /locus_tag="FOA43_002929"
                     /note="BUSCO:EOG09342TIX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779138.1"
                     /db_xref="GeneID:62196330"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="InterPro:IPR036167"
                     /db_xref="PFAM:PF01974"
                     /translation="MSDLTWNDCERNLIDMKAQLEDNLGSETSVENSPAPMLCYSSSC
                     SDTSVPSSNEEGEGVVEEKEGEEVVEEKEGEEVVEEKERFSESPPLLLPSGTIVDDSL
                     RGHDPESMIPILVIGNRALMFNLDHIKHLRIHHGIVGLLSGSLPLAPQQNTLLGLPLA
                     LSIDEVLYLLYNGVCYLVDGAKAATAFLDDLVCDEDKLDEMATIFSDDVDNQRAERQR
                     EYEERLCKLGLGDKIVQRNDRNKTVFVQTRDNDGLFGALHVHLRMYRDNVGVQKLLLS
                     KLLRMATNEDLDTIYQNFRVFNYLKMNYHHCILPGVRFGGKFVSYPGDPLRYHSHLIV
                     DTRDYYNEDIGMLDISNRGRLATGVKKLWLVCGQRRRGTVPFSDSNEKINELADPEQS
                     SGYRLVSNLFDYQGKGQALKDTETVCFSIEWSGFG"
     gene            complement(<607206..>609068)
                     /locus_tag="FOA43_002930"
                     /db_xref="GeneID:62196331"
     mRNA            complement(<607206..>609068)
                     /locus_tag="FOA43_002930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923211.1"
                     /db_xref="GeneID:62196331"
     CDS             complement(607206..609068)
                     /locus_tag="FOA43_002930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779139.1"
                     /db_xref="GeneID:62196331"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027353"
                     /db_xref="InterPro:IPR036427"
                     /db_xref="InterPro:IPR038336"
                     /db_xref="PFAM:PF00439"
                     /db_xref="PFAM:PF17035"
                     /translation="MVMSLEETISTGIGGGAAEVSKAHLLESKIVESSVQVTRETLIT
                     EMTDDGGAPTEKKTDATTADILPQKHEIEATESVEVKKQKIDHVLPTVDLSNPAPIPT
                     IEPDMDHLPEHPMPPHQKRHALTIMKAIKRLKDAGPFLKPVDIVKLNIPFYYNYIKKP
                     MDLLTMEKKIQVDAYEAPKQLVDDFELMVQNCFIFNGKNSVISQMARNIQASFEKHIL
                     HMPPKDAPAESTRRRRSTYDSDVPKLRRDSASENGRPKREIHPPKSRDMPYDFRPRRR
                     KMTPELRFCQQLLRELMSKKYDAISYPFLEPVDPVALECPNYFNVIKHPMDLGTVAKK
                     MEDGEYTTAEEFEKDVRLVFSNCYAFNPESSAVNMMGHRFETVFNEKWVNKPLPEDEE
                     TRSSSSHGHGSGSSGVRGGEDDEDEGEEMDEDEEFDVDMNSITDPTIEFLLANIDRLQ
                     KDLKKMRQEKYEQMKKEWLKKHHSSKRGKKRRRKRSKANGSTGIYPTHVTYEMKKEIS
                     DAMSTINDKQLKSVIAIIKEGVPDLADDDEIELDMDQMSNTTLLKLYNFVVKGKATKQ
                     RKRKGAQSEEEKINSLKKKLQQFEDAEDEEDSASSSDEDGEGDEGDEDESSEEE"
     gene            <609623..>611755
                     /gene="ATM1"
                     /locus_tag="FOA43_002931"
                     /db_xref="GeneID:62196332"
     mRNA            <609623..>611755
                     /gene="ATM1"
                     /locus_tag="FOA43_002931"
                     /product="Iron-sulfur clusters transporter atm1,
                     mitochondrial"
                     /transcript_id="XM_038923212.1"
                     /db_xref="GeneID:62196332"
     CDS             609623..611755
                     /gene="ATM1"
                     /locus_tag="FOA43_002931"
                     /note="BUSCO:EOG09340PTJ"
                     /codon_start=1
                     /product="Iron-sulfur clusters transporter atm1,
                     mitochondrial"
                     /protein_id="XP_038779140.1"
                     /db_xref="GeneID:62196332"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MFVFRRGLIAEPSLAIRCLTRQFRQPHTKACLAGRIVRPYEFHG
                     GSSFRFLSTESSKAASTKPLKTTFTRPSKGPLKHANLVGNATHTMAPNVEEPEPESER
                     QILKDLLLYIWPKENMSVKVRVVLALSLLIAGKLLNVEVPFFFKRIIDDMNVDWSTTG
                     GMLTTSIIACIFAYGGARFGAMLFDQLRNAIFAKVAQGAIMSVAHNTFKHLLELDLNF
                     HLSRQTGGLTRAIDRGTKGIAYVLSAMVFRILPITFEISVVSGVLTYNYGASFAGVTL
                     LTVLAYSLFTIRTTAWRTKFRKHANKADQRAASVALDSLINYESVKYFNNEAFQSARY
                     DSALENYRESSIKVATSLAYLNSGQNFIFTTALTVMMYMGCQGVAAGTLTVGDLVLIN
                     QLVFQLSVPLNFLGSVYRDLKQSLIDMESLFMLQKYEIKVQSKPNAPPLKLNRGGEVT
                     FDHVTFGYHPDRPILKDCSFTIPAGQKVAIVGPSGSGKSTILRLVFRFYDISAGRILI
                     DGQDIRDVDLDSLRRAIGVVPQDNPLFNETIMENLRYGKLTASDNEVNEVLYKVKLDE
                     LVKDLPDGVNTLVGERGLMISGGEKQRLAMGRLLLKDAPITFFDEATSALDTHTEQAL
                     LKTIHELFREGGKTNVSIAHRLRTIADADKIIVLKDGKVLEEGTHYSLLQDDSSLYKE
                     LWDIQENLDIEEQLNDMNKEDKNKSNKN"
     gene            complement(<612116..>615118)
                     /locus_tag="FOA43_002932"
                     /db_xref="GeneID:62196333"
     mRNA            complement(<612116..>615118)
                     /locus_tag="FOA43_002932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923213.1"
                     /db_xref="GeneID:62196333"
     CDS             complement(612116..615118)
                     /locus_tag="FOA43_002932"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779141.1"
                     /db_xref="GeneID:62196333"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="PFAM:PF00660"
                     /translation="MKFSSIIPASIAALMASSNVLATSSVASEATSVALTSAVSAASS
                     IASLFSSAPSSTAALSSSPVSAVSSSVSTAILPSADVYEIYVLFEDIAANEDEYLNYL
                     LGDTNVTIPDGLMDLFIDVMTYTDSSFTTIFEDVPLSEFEDINAMVTDLPWYSSRLES
                     LLTEVTSIPSTSVVLTSAISAASSVVFSAASETSSVALTSAVSAASSILSLLSSVPSS
                     TAALSSSPVSAVSSSVSTAILPSADVYEIYVLFEDIAANEDEYLNYLLGDTNVTIPDG
                     LMDLFIDVMTYTDSSFTTIFEDVPLSEFEDINAMVTDLPWYSSRLESLLDGATTVPST
                     SVALTSAISAASSVVSSAASETSSVALTSAVSTASSIASLFSSAPSSTAVLSSSPVSA
                     VSSSVSTAILPSADVYEIYVLFEDIAANEDEYLNYLLGDTNVTIPDGLMDLFIDVMTY
                     TDSSFTTIFEDVPLSEFEDINAMVTDLPWYSSRLESLLTEVTSIPSTSVVLTSAISAA
                     SSVVSSTASEATSVALTSAISAASSIVSSAVSTTSPVSSTVSSASSSTSTFSMSDYDV
                     YEVYVLFQDIAANEGEYLTYLSSGADVTIPDGLMNLFIDVMTYTDDSYTTLFETMSGA
                     EYSEINEMVTELPWYSSRLLAELATYDATSSSSVASVSTESSVETTGISETESTVAST
                     GISETGSSNTATGYESTVASTAVSEITGNSNTATSVETGSSSSEEYFTTTIVSGTVTI
                     VSTYCPKCTETETAETFTTTIVSGTVTIVSTYCPKCAATVTAESTGEAAETITTTIVE
                     DNTTIVKTYCPKCTETEAAETTGEAAETITTTIVEDNTTIVKTYCPKCTETEAAETTG
                     EAAETITTTIVEDNTTIVKTYCPKCTETEAAETTGESAETITTTIVLDNTTIVTTYCP
                     ESTETEAVASAASTAVAATAAVTTGASVTTSLSSEATTLASSSQSSVSANGSSVAATV
                     STYKGSGNTLKTPATFLAGMGVILYLLN"
     gene            616741..616814
                     /locus_tag="FOA43_002933"
                     /db_xref="GeneID:62196334"
     tRNA            616741..616814
                     /locus_tag="FOA43_002933"
                     /product="tRNA-Val"
                     /db_xref="GeneID:62196334"
     gene            complement(<616950..>617305)
                     /locus_tag="FOA43_002934"
                     /db_xref="GeneID:62196335"
     mRNA            complement(join(<616950..616988,617057..>617305))
                     /locus_tag="FOA43_002934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923214.1"
                     /db_xref="GeneID:62196335"
     CDS             complement(join(616950..616988,617057..617305))
                     /locus_tag="FOA43_002934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779142.1"
                     /db_xref="GeneID:62196335"
                     /translation="MSVPAEQLRFGSVPAEQMTFESGAVEQLRFGSEAVEQMRFEFGF
                     EVVSPEHAVPGASVGLARQGRPERPDDPDESRKTRQLTKQGNAVPLVPHYL"
     gene            <617395..>617799
                     /locus_tag="FOA43_002935"
                     /db_xref="GeneID:62196336"
     mRNA            <617395..>617799
                     /locus_tag="FOA43_002935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923215.1"
                     /db_xref="GeneID:62196336"
     CDS             617395..617799
                     /locus_tag="FOA43_002935"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779143.1"
                     /db_xref="GeneID:62196336"
                     /db_xref="InterPro:IPR027915"
                     /translation="MFVNASPSVGIPGSTSLPSSASSSGYQSLALSSPQSSLSSLYSS
                     HRTRFMSSKGFELEDDIEFCPQIVNFANHSPVQTHSSNIKNSVFMSPSSPSTHQRSPR
                     VHTPRVRKALDIVNPHTGMRIESSKLSPQTAK"
     gene            <617930..>619495
                     /locus_tag="FOA43_002936"
                     /db_xref="GeneID:62196337"
     mRNA            <617930..>619495
                     /locus_tag="FOA43_002936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923216.1"
                     /db_xref="GeneID:62196337"
     CDS             617930..619495
                     /locus_tag="FOA43_002936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779144.1"
                     /db_xref="GeneID:62196337"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="PFAM:PF00787"
                     /translation="MNFGDYDDFTQDNNPFAGSDHHFSNGIVNSYEDVHSSPLNAPLS
                     LSPQKNQPLSVNDCYTIVGYQVLGAVFYKIHLNGDVNDDLVFRRYSDFVSLRSYLIKF
                     FQTKVIPPVPEKHSISRLLKHPFNYRSDKQIIDRRIRLLNYFLKRLLADEEIRQSEFV
                     ARFLDPREKYWSKILHGPPFTNLSSKSIYLTSPRDPTTPSPYFAFLPIPPRGQIRNYQ
                     SDLNDSVFRPLESRARKLLNIVRRLESTANKTIRDFQSNREALIELGGFFNIFSIIED
                     QHEVIEHFGNKIDLNFLNIEVFVSSLTIYIKEKLMVIRLTLLVILPLLHFRKMKEVQL
                     GYLQDIILRRQARLKDITGRVLGEERLDEVIRKGEIQSPSLSKAIANLKAKRNAVERL
                     DEADNETIEDSLSNISLPQSWNRAISASEDPDTTTTTNNTMGTRHKAVDKMSVSELQV
                     EMVQLSRELNRKLIPCFDSLTKDVEYISIGVERSVNAEMKCSVKMLQEIIGNWKQQVF
                     GEYIKSCTEVWGR"
     gene            complement(<619499..>622540)
                     /locus_tag="FOA43_002937"
                     /db_xref="GeneID:62196338"
     mRNA            complement(<619499..>622540)
                     /locus_tag="FOA43_002937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923217.1"
                     /db_xref="GeneID:62196338"
     CDS             complement(619499..622540)
                     /locus_tag="FOA43_002937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779145.1"
                     /db_xref="GeneID:62196338"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036925"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF03144"
                     /db_xref="PFAM:PF11987"
                     /translation="MGKKGKKNTNQNDYLDEEDEDVNGSTVESTSSSIGEVNESGQND
                     FMANLKKAKSKKAAKQKEEDEKKKALHKGPVIKSKKEKERERKERERERKKKLAARKK
                     AAHQEKDKDSSPLSNEAAVIGETGDAGETGETGDAGGAGKAGDAGETVKTTETAKTTE
                     TVNIKKKTKKVKKLPAGIAALKRQLELQKQAEEEAERLDKEEESKLKEEEKTREEEVK
                     AQEEGKRLKKEREKLKKEKLKKEGKYLTKKQKHERAVANRRRELLLASSDITVAGVEQ
                     KDEGEEVETHKKVMYGSKKKSQKKSSNESTPVAEEKRKEGSLPEEEVDDWEKLAGGAA
                     DGAEPAGDEVAESWEDMIGDEGVKDDEEEEEEEEEEEVETEETKEIKEKEKNQLEVVQ
                     TDQNKQKSQKSNKGTKENTEKDLRSPICCILGHVDTGKTKLLDKIRETNVQGGEAGGI
                     TQQIGATYFPLDVLRQKTAVMSKYEKLTYDVPGLLVIDTPGHESFTNLRSRGSSLCNI
                     AILVVDIMHGLEQQTLESLRLLRERKAPFVVALNKIDRLYGWESTPDNAFRDSFTRQA
                     STVQAEFENRLNGIKLQLAEQGLNSELYFDNSNIARYVSIVPTSAVTGEGVPDLLWLL
                     LELTQKRMSKQLRYLSDVQATILEVKVIEGLGTTIDVVLSNGILHEGDRIILCGMNGP
                     IATNIRALLTPPPSRELRIKSEYLHHKQVKAALGVKIAANDLEKAVAGSRLLIVGPDD
                     DEEVMKDEVMDDLTGLLDSVDPTGKGVVVQASTLGSLEALLDFLKDMKIPVMSIGLGP
                     VYKRDIMKATMMLDKAPEYAVMLCFDVRIDKEAEQYAEEQHVKVFNANIIYHLFDEFT
                     AYQEHLLEKKRKDNKEKAVFPCILKTIQIINKRNPMIIGVDVVDGVLNIGTPIGTVKM
                     DPLTNQKVKLPLGKVVSMEINHESKIQIRKGESSAGVAIRLEDAASQPIWGRHIDEHD
                     PLYSMITRETINTLKDPAFRSTVPREDWFLIKKLKSVLDIE"
     gene            <622833..>623891
                     /locus_tag="FOA43_002938"
                     /db_xref="GeneID:62196339"
     mRNA            <622833..>623891
                     /locus_tag="FOA43_002938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923218.1"
                     /db_xref="GeneID:62196339"
     CDS             622833..623891
                     /locus_tag="FOA43_002938"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779146.1"
                     /db_xref="GeneID:62196339"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="PFAM:PF03372"
                     /translation="MVLLGIKKYSSSSDNSPVENPVAPIAAHVRFQSWNLRNDAISND
                     ETINDTISNLNSTIPYDTDVRWYSQYKEVAWSTRRIGVANEVSFNRPDLFTVNEALSR
                     QVEDLTQLLSPMKYVGVGRDDGDRAGEFQAIFYDPYRVELLNWDTFWMSQTPFKPSKF
                     PGAGSTRSATVGHFRNIRTGFDFVLINLHLDDQSDDQRRLGAAMARLRGAHEFEKHGC
                     PVFLVGDFNSQSQGGSSGAYSILTGVEKFNESLIDHTFLKRYGLSRYSETFAFDDLLK
                     SCKPERRTGNLATFTNFLQTTDGYSRIDFQFGGNPHIKAIDKMWQVERYRVGENWFDN
                     SYFLSDHRPVVSDVMVWN"
     gene            complement(<623910..>625490)
                     /locus_tag="FOA43_002939"
                     /db_xref="GeneID:62196340"
     mRNA            complement(<623910..>625490)
                     /locus_tag="FOA43_002939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923219.1"
                     /db_xref="GeneID:62196340"
     CDS             complement(623910..625490)
                     /locus_tag="FOA43_002939"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779147.1"
                     /db_xref="GeneID:62196340"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSTLKTTIKSEVPEKTFESPEPPESTSGERALSSLSGVIEDKEQ
                     VSDLALTNEEKDRRIDEMALEMGINHRRFMWKLDFFVVPPFILLYFLAFLDRVNISNA
                     KVYGMEDDLGLHGNQFNTALTIFFVPYVFFEVLSNYLMKIIKPHIWLSAMIFLFGIAG
                     MCQAFVKGFGGLLACRFFLGVFESGSFPALFYLLSAYYCKRESQRRFSFFFSCTCLAG
                     GCAGAIAYRIHSLDGVRGFASWQWIFLIEGAITSFLAIVLFFTIADFPEEARFLSNNE
                     RKFLKRKLEYDAGKSAYEVKLLLKDVGGFYKLPAAYLSALCYFALVIPSYGYAYFAPT
                     IIKFLGYTAWEANKHSIYPWICAWGVTCVLAFISDKIGRRWPFAFFSCCLAIAGFVMV
                     MVSSNYSVQYAGCFLAVTGLYSAMPAVVCLFSLNFAGHRNKSVGTSTIVGFGNIGGII
                     SPWLFPNSDAPGYHMGMAVSVFFVVFAVAMTFSYTAYTVYLNRIKNTEAYREKWALKD
                     KRAQLIAGDLHPDFKYMY"
     gene            <625835..>626431
                     /locus_tag="FOA43_002940"
                     /db_xref="GeneID:62196341"
     mRNA            <625835..>626431
                     /locus_tag="FOA43_002940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923220.1"
                     /db_xref="GeneID:62196341"
     CDS             625835..626431
                     /locus_tag="FOA43_002940"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779148.1"
                     /db_xref="GeneID:62196341"
                     /db_xref="InterPro:IPR007014"
                     /db_xref="PFAM:PF04930"
                     /translation="MFALKNSLKYAPRLGISPLFLKNSFNLSKRVNGKSFSSYGWKSH
                     YDHSSRASKGVVIGLMGISATYLINHNPIRNDSALAYSQGPTTPKGYQYVKIPEKPKY
                     DGAFGGRLNYKQLALGSIFGMLSGLIAGQLSSLFVFFSLGVYLAAQYLHAQGVLTIPM
                     TKIVRIGTEDIDIRQMVFEQPSFSITYVLSFLIAAYNS"
     gene            complement(<626447..>627550)
                     /gene="RBG1"
                     /locus_tag="FOA43_002941"
                     /db_xref="GeneID:62196342"
     mRNA            complement(<626447..>627550)
                     /gene="RBG1"
                     /locus_tag="FOA43_002941"
                     /product="GTP-binding protein rbg1"
                     /transcript_id="XM_038923221.1"
                     /db_xref="GeneID:62196342"
     CDS             complement(626447..627550)
                     /gene="RBG1"
                     /locus_tag="FOA43_002941"
                     /codon_start=1
                     /product="GTP-binding protein rbg1"
                     /protein_id="XP_038779149.1"
                     /db_xref="GeneID:62196342"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031167"
                     /db_xref="InterPro:IPR031662"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF02824"
                     /db_xref="PFAM:PF16897"
                     /translation="MTTVQKIQDIEDEMSRTQKNKATEKHLGLLKARLAKFRADLLKE
                     AQTSSGGGGEGFDVKKSGVASIGFVGFPSVGKSTLLTKLTGVRSEVAAYEFTTLTTVP
                     GFIKYRGAKIQMLDLPGIIEGAKEGKGRGKQVIAVARSCDLIFILLDVNKPLRHKQIL
                     EKELEGFGIRLNQSPPDIVIKRKESGGVNITSTVPLTKIDTDEIKAVLQEYRLNSCDV
                     AFRCDATVDDMLDAIEVQNRRYIPAIYLLNKIDSISVQELELLYRIPNAVPISAGKEW
                     NLDELLEIMWDRMNLVRVYTKPKGKMPDFTDPVILKGVKCTVKDFCAKIHHSLIDEFK
                     TAQVYGSSVKHQPQYVGLGHVLHDEDVITILKK"
     gene            <627773..>630490
                     /locus_tag="FOA43_002942"
                     /db_xref="GeneID:62196343"
     mRNA            join(<627773..627794,627903..>630490)
                     /locus_tag="FOA43_002942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923222.1"
                     /db_xref="GeneID:62196343"
     CDS             join(627773..627794,627903..630490)
                     /locus_tag="FOA43_002942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779150.1"
                     /db_xref="GeneID:62196343"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="PFAM:PF08318"
                     /translation="MPIRSKLETRHEKADEYLAESCLQKKTSHQSQIRSLEMTRMELF
                     STLERSRSLKEKLDNSSGLSTKITEKVRLLDSEKTKIQKIKDYVEHVIVLKTEIQKAD
                     EFIRHEQWKEAATSISIIRSLPGGLIHDSFVQSVVPTSDIPEMPEEIVSGWINKLRGT
                     FLGEFNSSASTRNVERLTYFFQLFPLIGEEQLGMDCYSKFVCSIISEQSRAILRNLPQ
                     APEESNFYASILFQLYQTVASIVNQHSRVIRKYYGDSVMPQILTQIQSECDLQSGLTF
                     DTFWESKRIDEVVSRVQQYAYPVLVNLIYNGGASADDSMDTINDSRPSIDLNALGEDT
                     IQSTPSLAEIGAYTDEISAMMNYWAMYCKFYVVTWNESSSRKDAAQSIYPKPLLLSSF
                     MDKINNHVTTKFDVLSTFAVRRTIEKACQLEQVPSFVPQLAQCAKYLSEMEKNHRNSS
                     NKSLHSLLPEEAPVSSLIDDVTMALNVILSEALSTGQFICIKALISNVKRILENDFMN
                     IMNQKFSRVSLRANSTLLTRRALENVREYIDRENIRAGGGKTMLRRGTGKSKTANDSA
                     IAASRGSLLVKSINAAISMANEEGVGSDSGDDKALVNFIIVLNSVSTFGQYLGKLSEH
                     LIEHLEEENLLILDDQEYKRVFKELEVEGSNSSLIVNLKSSKGTPEKPSVQDRIETIV
                     SSLSSSFTEKADALIDSQIGVLFNQVLRSRLINMINETFQEESYLVSSEMLSANMNDI
                     SEAIIQFIQDWNRLSIPYLTTMTKQNFNILIKKLISFIAAHLESKIWAMDKKCNELGS
                     ANLEKDVSVLISEITKYNYSLRDDFVRVTQIIMLLGLDDDEETEDLKDLDWALSPNER
                     SRARDLRVDRKVL"
     gene            complement(<630530..>631513)
                     /locus_tag="FOA43_002943"
                     /db_xref="GeneID:62196344"
     mRNA            complement(<630530..>631513)
                     /locus_tag="FOA43_002943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923223.1"
                     /db_xref="GeneID:62196344"
     CDS             complement(630530..631513)
                     /locus_tag="FOA43_002943"
                     /note="BUSCO:EOG09344A83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779151.1"
                     /db_xref="GeneID:62196344"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR036855"
                     /db_xref="PFAM:PF14608"
                     /translation="MLGIPAKPPTIVPPVPMGMGVGSMGPMGPMNPMGPMGMGPMGPM
                     GMNPMGPMGPMGMNPVGPMGMNPMGPMGMNPMNPMGNPMGPMVPTMSSIDSTDPTQVA
                     LEQEYRIMLQQMLERSKHRVVFKFEPQLRRQFGFGFDPDRPICPFWQHSGGKSCPYQS
                     DCPFKHPSKIFNNKIVCKYWLRGLCKMGDDCDFLHEYNLSKMPECAYYATNGVCQQAG
                     ECIYLHVDPQSKIPECWNYSNLGFCPEGPKCPRRHVRKVMCPRYLTGVCPDGPSCELA
                     HPKFNPALVMQSKFKIITDEEIIKKRTIEVDATEAEAPAPAPVLAVPIEGR"
     gene            complement(<631669..>632919)
                     /locus_tag="FOA43_002944"
                     /db_xref="GeneID:62196345"
     mRNA            complement(<631669..>632919)
                     /locus_tag="FOA43_002944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923224.1"
                     /db_xref="GeneID:62196345"
     CDS             complement(631669..632919)
                     /locus_tag="FOA43_002944"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09343FR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779152.1"
                     /db_xref="GeneID:62196345"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="PFAM:PF03907"
                     /translation="MSDNESLDHLIFGSGPSSGSLSPPSLSPPSPSPPSPSPPSPSSP
                     SSSPPSSPRLLPRINENNDDFAVASDLDAWSLASDRSEDSSRRRRSSAKSSFSVPDIE
                     LFTVSSDSYFSHHRDAAGSGAGAGAGAGDAGTAAAGDAGTATATAAATATATATATAT
                     ATATGAAPPPPTVTPPASPRYSTKRHRRMSRTRKEEIEISPTAQIYKNLLILEEALRQ
                     QGAQQNRLKTKYMIFVISMLIVFVLTSYVTFMAESPSYWRFFCQVVGSIDLLTLILYF
                     LSGEYNRTITRPRKFLTYTNKGIRRMNIRLVKVRVKRTDKLLDILKICLLLPTVLLKI
                     PCEYTLRMVPSFNAVIKFRNWLVEFEAKLQTSSSRGGVECMKIILNPRVFSTGTREQW
                     ELYRNEFWNKETIRRRHVLQKKQQ"
     gene            <633041..>634315
                     /locus_tag="FOA43_002945"
                     /db_xref="GeneID:62196346"
     mRNA            <633041..>634315
                     /locus_tag="FOA43_002945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923225.1"
                     /db_xref="GeneID:62196346"
     CDS             633041..634315
                     /locus_tag="FOA43_002945"
                     /note="BUSCO:EOG093422AD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779153.1"
                     /db_xref="GeneID:62196346"
                     /db_xref="InterPro:IPR027539"
                     /db_xref="PFAM:PF12519"
                     /translation="MDYVQKCFYDASGWNDDLSYEQILRTSNNLMHFPIPSGFKLSIS
                     SKNTEYSYSSLTLSQLSRLTGSLSYLYSSIDLKNTYLGTASLPLRLILDDYRFVKSPQ
                     QQRLQDAHFTPTGQPRPCILYGKMYFPSQFLEGMLIKRISKNVQLMMKFINTPKLRKL
                     ANNSTIVTLYLQRQKGNSSTDFIFSSNESLLGFRCLYKIGSDLSSSPGGISDSTSLSL
                     GFELWFALMSMSPGLSTALRYSTHLSSSGKPLTMTLALNPLLGTIESTYAIKSGLNST
                     LSSKYTFNIYSYESDLLFGFSLLRSSEPPNRAVPPKSPLPSTLPITSSRHQPFKSLDE
                     ETHHRLLTTFMGINPGKLVTENNARHFMDTFNHLNFSSGLKCCASIAKKDLNVAWEGR
                     FKDLLISSGLRIDCSEAIPKMGKYGIEIQYSS"
     gene            complement(<634328..>637702)
                     /locus_tag="FOA43_002946"
                     /db_xref="GeneID:62196347"
     mRNA            complement(<634328..>637702)
                     /locus_tag="FOA43_002946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923226.1"
                     /db_xref="GeneID:62196347"
     CDS             complement(634328..637702)
                     /locus_tag="FOA43_002946"
                     /note="BUSCO:EOG09340BPN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779154.1"
                     /db_xref="GeneID:62196347"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MVVREIINVSDSSEPEEEETMQVPDSSPMKTPDQKTGGLDPLDP
                     LDSDLSSPIKPVTRLSSLKERFGYNSQMNRGGLSLSMSKDYSILRAKFPGIPSSTVSK
                     MLKQRGSCEEAERALRSMNKIDFKPTLKLKRPSSVFGNMSSPSDKIRLSSLKFDSPLK
                     DHDVVSSKVTLKNNRSIAERYGTTTKRKYGHFQFDLDALDEGKMKKKTKHRRLIRGSE
                     MIQRVEDGEESSVSERLRRGEKKEYIELSSGNEEEAEAEEETNLMEDDFDDFDQDVES
                     ESEEDTSLNFDERVMKFLNTADIRDIVDISGVPTAIAQTLIEGRPYESYEQVENKEFI
                     EVKSEGGGKSNRRNGYRRRPIGEKIIATTMRKLKGYEMVESLVDQCKRYGDDIKRAII
                     KWGVKVNNETGELEILSVNADDGEEENEEDLGDLEIVSSRLKADEKKKDDDENDESLS
                     DNPDDEDYGSSKRKLVSRGQLNPNRSSRFGKIGYFKNKPKLMADDCKLKDYQQVGINW
                     LTLLYKKGLSCILADEMGLGKTIQVIAFLAHLKECGSPSPHLIVVPASTLENWLREFE
                     KFAPSLDVRPYYGSQVAREDLRMQLEDDDGYDVLVTTYSMATGGKLDQAFLRSRKFNV
                     IVYDEGHMLKNSASNRYQKLMRLRGQFRLLLTGTPLQNNLRELISLLSFILPQVFTEK
                     KAELEDLFDQKTSTNASKKVSIEDEKVNPLLSQQAIKRARTMMTPFVLRRKKSQVMKY
                     LPAKHNHILYCDMTTAQRDIYDISISEVRSRIKEQRRRKGMTVEEIAKLPKLEGSNNY
                     IMSLRKACMHPMIFRYLYTDDVLRVMARKIKKSPQYHDAYEQYIYEDMTVMSDFEINQ
                     LCHNFPRQLGEYILPIEFYMHSGKVKTLMDLVQKIVSRKEKVLVFSMFTQLLDVLEKV
                     MSFKNFKFVRLDGSTAVDERQNIIDTFYEDETIPVFLLSTKAGGFGINLVAATNVIIY
                     DMSFNPHDDKQAEDRAHRVGQTKEVNVYRLVCKDSIEQNILQVAYNKLELDTSMMSNG
                     KVVEDMVIKKLDEAIPNSPDATSIQRDTTALPQKTHGLLAQTVADDDDLIKVAEKRVH
                     DPAYSMNFPLTMPPSPVHIPVTVPDNPETPIEMHNI"
     gene            <637946..>639049
                     /locus_tag="FOA43_002947"
                     /db_xref="GeneID:62196348"
     mRNA            <637946..>639049
                     /locus_tag="FOA43_002947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923227.1"
                     /db_xref="GeneID:62196348"
     CDS             637946..639049
                     /locus_tag="FOA43_002947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779155.1"
                     /db_xref="GeneID:62196348"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="PFAM:PF00415"
                     /db_xref="PFAM:PF13540"
                     /translation="MFKLLCCGSNNGYQLGVGDNNDRHVMTVSKLHSHKRIVKMASGA
                     EHTLLILEDGKLMGCGTNGRQQLFLDSLVERSPVFETVHLLSAFKFKTIACGWEYSIA
                     VTRDERIFVSGYGANGELGLGKDIRSSTKGYGEIMVNGENRGGVKQLKSSIHSSIIQF
                     GNDQVWAWGNNKKGQLVDYGKNESLKIIWEPVQLEFDKGLKVIDYAMGRDFTVFIVQD
                     EHDKLKSLFRGRDNFDIERRLASLHLSNDSFECIESMWTSIHLIDDRRRIKSIGNNSY
                     GQTFPGTDDDSPYIHYATGSEHGLCSTHNEAFSWGWGEHGNCGEHTRGDKSVDDVTFD
                     YLNLLYRTNGKKEKIVDVFAGCATSFIQIEETL"
     gene            <639391..>640135
                     /gene="RPB5"
                     /locus_tag="FOA43_002948"
                     /db_xref="GeneID:62196349"
     mRNA            join(<639391..639395,639478..>640135)
                     /gene="RPB5"
                     /locus_tag="FOA43_002948"
                     /product="DNA-directed RNA polymerases II 24 kDa
                     polypeptide (RNA polymerase II subunit 5)"
                     /transcript_id="XM_038923228.1"
                     /db_xref="GeneID:62196349"
     CDS             join(639391..639395,639478..640135)
                     /gene="RPB5"
                     /locus_tag="FOA43_002948"
                     /note="BUSCO:EOG09343L0A"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases II 24 kDa
                     polypeptide (RNA polymerase II subunit 5)"
                     /protein_id="XP_038779156.1"
                     /db_xref="GeneID:62196349"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="InterPro:IPR035913"
                     /db_xref="InterPro:IPR036710"
                     /db_xref="PFAM:PF01191"
                     /db_xref="PFAM:PF03871"
                     /translation="MRGYTKMEDVDRATSRLWRAYKTVKEMVSDRGYYIPQEEIEIPL
                     DQFREKFCDSMGMPQRKLMSFQATPRQEALEKYGDLGPLWVEFCDEPSVGIQTMKNFC
                     AHIADKNFSTGVFIYQQNLTPSATKAIAVAEPATIEIFQESDIIVNITHHELVPKHIR
                     LSNEEKKDLLKRYKLKESQLPRIQSQDPVAMYLGLKRGQVVKIVRRSETAGRYASYRI
                     CL"
     gene            <641464..>643356
                     /locus_tag="FOA43_002949"
                     /db_xref="GeneID:62196350"
     mRNA            <641464..>643356
                     /locus_tag="FOA43_002949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923229.1"
                     /db_xref="GeneID:62196350"
     CDS             641464..643356
                     /locus_tag="FOA43_002949"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779157.1"
                     /db_xref="GeneID:62196350"
                     /translation="MLRNVPKATSFAHSSKMTFQSCLTANNVFKRPSSLHVAENARGM
                     YSGSRARSFHMSQRNNSNNSGSGVNQVFAKIPEIKEYTQNVSNKRQLPYYKQLMAFDD
                     CLTHNSSFDISTGRIIGSSKQFWDSVKRIMPLYEELMSTGEMTERRMDEMVSLLRNGL
                     RVHRWELTKLNKNVDKDLNTPLQQLHELLKKSLLKVSSDIVSADSSVRISARGLTNLF
                     KAFKDMGLADEAAQVWNRGKNNEKLYELFTAESVLGSVFSLFVDNNDFDFDEIWAIYS
                     RIKASKPSYEKIHGELQIAMVRACLLKGHTEEALKIFTEVTSNVLQEFNEKNMDPPSR
                     LRSYMTTAHMSFIGYCQDFETSNVFFKGALKGDLPYLTPLQMNFVKRFMHNTWNNTRN
                     FDHVTDIWLSTWKYYESHHRSNSSISSSLNDTFLDIFFTRYPNFDVESSRALKKVLAD
                     YSEIRQMDEPFFNCLLTKSMAWKNTNFFKSIMRAAEMYHFPKTNVFYRCSLKASGAVD
                     LPSDQIFNVFYKLLDSNVEMGSRQITNADWFALRDATVRSHHINAEKIDLYFKLWKLS
                     SLFFVSLQNLKLYVGLDMKLNRAYGRVFREIEYVDASDIHLPQLRFFSRNRAIGNYYM
                     SQNINL"
     gene            <643478..>643861
                     /locus_tag="FOA43_002950"
                     /db_xref="GeneID:62196351"
     mRNA            <643478..>643861
                     /locus_tag="FOA43_002950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923230.1"
                     /db_xref="GeneID:62196351"
     CDS             643478..643861
                     /locus_tag="FOA43_002950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779158.1"
                     /db_xref="GeneID:62196351"
                     /translation="MGLCSSTEREEREQPKTGDRPGNKQSNRPGNRPSRLGNRLGDRP
                     GKMSAVKGQKLGSQGAPNTADSDATLTAKELAAKAANQRLQETKKKNEKGVLGKKLAE
                     ERKKTAKDVVLEAYEKKKNDQLTYE"
     gene            <644030..>644968
                     /locus_tag="FOA43_002951"
                     /db_xref="GeneID:62196352"
     mRNA            <644030..>644968
                     /locus_tag="FOA43_002951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923231.1"
                     /db_xref="GeneID:62196352"
     CDS             644030..644968
                     /locus_tag="FOA43_002951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779159.1"
                     /db_xref="GeneID:62196352"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR036938"
                     /db_xref="PFAM:PF01569"
                     /translation="MFYIDRQNLGLSNRRLLRSLYKWKVIDATYAIVLAILDGTIVHW
                     VHPYQRQFTINDITISHPFTEHERIPVPLLLELVVFVSPVVMTITNRLFTPPGKRIYV
                     FYISFLGLIVSVTTCDFMVDTLKNWIGRCRPDFLARCIPAKDALPDTLYYAKEICTTT
                     DKPLLLDGFRTTPSGHASISFACFGYLTMWMMGQLLGCSCNYVGAWRFLVSCLPSLFA
                     SYVAFSRTQDYRHHFVDVVLGSLMGWLVAWWSYRRYFPSVFLRYSYVPSIILDTAEKG
                     PDDYKTHDFYMEQDWTDSWPGRSDLESQTGLRRDAI"
     gene            <645366..>646702
                     /locus_tag="FOA43_002952"
                     /db_xref="GeneID:62196353"
     mRNA            join(<645366..645369,645432..>646702)
                     /locus_tag="FOA43_002952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923232.1"
                     /db_xref="GeneID:62196353"
     CDS             join(645366..645369,645432..646702)
                     /locus_tag="FOA43_002952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779160.1"
                     /db_xref="GeneID:62196353"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF01633"
                     /translation="MHGEGSSPSPPLVSQLLEKYCAHAIYLPDRFIEPSNSHKQKTQM
                     LEMLLDIFPHWRVYKDLIQLDELTGGITNMLLECKFPGGPEDAPKEVLVRTYGRGTGM
                     IIDRDREFVSHLVLNSYNLAPPIHARFGNGLVYGFIEGRALKFDEMSNPYIYPFIASH
                     LGKWHRLVVVDVIEDSIRKLRRKFRRRSTSSLTDKKPRPVDIWQLVKNWTDILPEIPE
                     MVKVCQANKDIQQLQSSPSSLKNILSQELLWLENEIGHSSPRVATHSDLLSGNIIIPT
                     ELSDCLHDSHLGDLVVSNYKSKKINPISFIDYEYMMPGPRAFDISNHFQEWQGFDCDK
                     ALIPKPIKTNQLLRNWCSSYLEVDRDIQDSSKIIDDLILEISLYYGMPGFYWGIWAGI
                     QSTISLIDFDYGKYSGQRLVEYWTWKRQYLNR"
     gene            <651376..>653997
                     /locus_tag="FOA43_002953"
                     /db_xref="GeneID:62196354"
     mRNA            <651376..>653997
                     /locus_tag="FOA43_002953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923233.1"
                     /db_xref="GeneID:62196354"
     CDS             651376..653997
                     /locus_tag="FOA43_002953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779161.1"
                     /db_xref="GeneID:62196354"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="PFAM:PF00018"
                     /translation="MPAIPYTAVAKYSYTPEAENASDDLAFAEGESITVTEEVDSDWL
                     FGSYKDKKGEILSGYFPRSFVVDKAEVSVSKGGRFASRETTGGSKGSKGSKGSPLASR
                     ETTGETSKTPREIPVASETSEIPVASPKMSSPGMSSPTSSAFRNRIKTFNFDSAPPPV
                     PRDIPEQSFVKRQFTAEHSSYVPEPIGEDRVVRKEQKKPSGSIINESTREEGEGAPKI
                     TLKERMRLLEQRHNEEQEALEAAVKRREEKKGRETEEVENGDADDEEADETHEDEEDE
                     LKDEDEDELKNESLEADEIDESQESSESEESGESEDSEELRRRHLRERMAKLSGGMGM
                     VGMLGFGGVPTTEKKKGKKAKTKKKKVEGEDISSAVPVMPFANPAVISAFSKRGAAPP
                     APAPTASSPTAPPPTASSPTAPSPTAFPPTASSPTSTSPTSPPLPTSPPLPTSPPLTT
                     SPPLPTLPAERPPMPVDASSTSTSSAESDEEEPHTTSTLAPTPTTLAPTRTASIPIPI
                     PGSRPAPPPQPKTPQSPPPPQPVGRPAPPPIPTSVPVKAPAVPPPPAPGSRPVPPPVP
                     TGIPQHRARAPVIEDSSSDDETAMELETMPMEPETMPKTAFSRSELAPTTSIRSSIDY
                     TTNTSIREALKSSQDAWWVDRKLPPQFLTKEVYYETDIHVIAKRCHRSVTYVDYYIVN
                     PDLSSSMWELSYETSKPGKLLTCSELSFSKPKADIAKLAVSSQKFGSMAYRAAANSLN
                     SSCNLVNQVFSQLPSEVLPPIAGKTFGSVIYRNNNNVDIRKIEEIRPGDVLVVLKGHF
                     EGRSSHLIKNKKVHDLGFSGKPYVAFVTSFDEQKQKIKVIEEDKEVIKVGSYKLGDLK
                     SGKVRVFRIVGRDYIGW"
     gene            complement(<654599..>655927)
                     /locus_tag="FOA43_002954"
                     /db_xref="GeneID:62196355"
     mRNA            complement(<654599..>655927)
                     /locus_tag="FOA43_002954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923234.1"
                     /db_xref="GeneID:62196355"
     CDS             complement(654599..655927)
                     /locus_tag="FOA43_002954"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779162.1"
                     /db_xref="GeneID:62196355"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="PFAM:PF10287"
                     /db_xref="PFAM:PF10290"
                     /translation="MVFSYSVLYYIVGCLCVTSKVSADCSYVDGNYYCSQAEAIDYEG
                     IGFSGSYSDVTNMDETSCECSQSSVSFSGTMSPLDEELSVHFRGPLKLAQFGVYYPAS
                     STSAKVKRDAEGCASYEHVHHKHKRAAAVQIVEETTTVYADASGNIINPSTSAVAVAS
                     GVAAVASAVVSAAASSAASSVASSAASSSSSSSSAVAGDWVRSSYYTPGTGDNVTFLN
                     HQGGVTDSGTWSTCFGNSLSYCASDGVSGSSSSEVLSDVTIKSDVEYLIMSGSECGDS
                     SASGDCGYYRTDTPAYHGFSGADKIFVFEFEMPSDTGSGDEQDMPAIWLLNAKIPRTL
                     QYGEATCSCWTTGCGELDLFEILSAGSDKLISHLHDAQGSTDGTVYGGSGSQDYFARP
                     TDSTMKAAAVFTDGNVYIVELDDSTDFSSTLTSDTVSSWTSTDATVVQIS"
     gene            complement(<656444..>657766)
                     /locus_tag="FOA43_002955"
                     /db_xref="GeneID:62196356"
     mRNA            complement(<656444..>657766)
                     /locus_tag="FOA43_002955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923235.1"
                     /db_xref="GeneID:62196356"
     CDS             complement(656444..657766)
                     /locus_tag="FOA43_002955"
                     /note="CAZy:GT32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779163.1"
                     /db_xref="GeneID:62196356"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF04488"
                     /translation="MFTLFFQFNVVRMVRTHGIKHVAIVSVCVLVVFAFVLRMGSMSP
                     SIEQVLRDVPNLYTKEGEEQEGENKEGGVTNEETTVKKDGRYDGLAALGFSYKKSNEQ
                     LDLARKLNEMTQKLVDEQEKRINKLEKERFNLEKQLNTLRRPSESLSLREKLAYLYPY
                     DANKRFPGYIWQSWRYGLNDDRFGPEFKMGEEAWARSNPGFVHEIFNDDTSNAFVHCL
                     FINVPEVIEAYEALPDIVLKVDFFRYLILFSKGGIWADIDTFPVKPVPNWIPENVEPS
                     ELGMIIGADHDMEGDGNNEDWQNKRARKFQFSNAVIQAKSGHPVLRDIIAEITETTLD
                     KKRREDLNLPEDGREIAIMNWTGEGIWTDVVLKFFNDYVLSGVFTKVTWKNFHELDVP
                     KLVSDVLVMPKKVFGSPFKYKKGKESDNGDDSDPLVFVRHQRSKVYQG"
     gene            <658352..>659818
                     /locus_tag="FOA43_002956"
                     /db_xref="GeneID:62196357"
     mRNA            <658352..>659818
                     /locus_tag="FOA43_002956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923236.1"
                     /db_xref="GeneID:62196357"
     CDS             658352..659818
                     /locus_tag="FOA43_002956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779164.1"
                     /db_xref="GeneID:62196357"
                     /db_xref="InterPro:IPR012571"
                     /translation="MGNFIWIFIGTTTFVGLIIFLGNLVMGGEINKKFVRKLITLDNN
                     LNIDVSDPGFKATWKDGMIKFHNVKVRSNKDNNVEYVFDVNTINLTLSLNKWLDGHGL
                     IKDMNISGLTGEIQFPDDQHFIDMSFDDSYILNGFKLNDSHIMMKGKMFKKPFELNIF
                     TCEMEKLRRPWFLYDFLNADALSGSFNGSLFTLHKRQNRYAHFVGMDSDEHENNPWKK
                     ITRVRINQMDLKDVFTDESKLNWITSGKAELTVDVMLPNEEMSEVKKGSLWERVVAGS
                     KRVVEGSESVVAGSQSVVEKAGRTTPKYVVMDFKVSLYDLRASSPKKIPRSSLTNAPY
                     ISEDDLQSLITFINDKKFGLASGSSNDEADTDRIEGDTDVSPFVGDNTIPPLKFRVVQ
                     NLQTFNYIDFPSMISLCSKPVENRSELGEKQLVSFVHTNQFIDSLMSEALSLLLLYKE
                     ETRLNLIRKYSQRSGVQIFFNNSAVGNLLLVGLGSFVI"
     gene            <660178..>662049
                     /locus_tag="FOA43_002957"
                     /db_xref="GeneID:62196358"
     mRNA            <660178..>662049
                     /locus_tag="FOA43_002957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923237.1"
                     /db_xref="GeneID:62196358"
     CDS             660178..662049
                     /locus_tag="FOA43_002957"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779165.1"
                     /db_xref="GeneID:62196358"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="PFAM:PF04468"
                     /translation="MSTIPAIPRNYHPVKNKSNSANSADSANSANSANSANLANSANS
                     ARSSSSTSDYSSLPKGTLFSSSPENVNYSYYQSLGPNNTNLFTSSLLQNSLFDMGPGT
                     GASGASGASGAGATGATGAGDGGTTAPVPSAVSMTPITSVDEIDPFASPFKVNSKLWG
                     AHRRNSVPASFSLPQTDAVGAGAGTVGSVGSVGAVSAVGAVGRPSLHLGVNTAASCPR
                     TPGRTSFPESLQQQESIDLALRRTSYTSNASNGSNGSNGSNVNGSNGSNGAPVGSIWG
                     GHRSSAGSITSPILGISALAASPPMQQRNSLPEYSSLRRGSYDPGLMGFTFQQPVGSS
                     VQENTQHAGIPPNAPPTDYVKSFENPTQQKKDEEQLLDRFNSLNLANYQDQYTQAFEE
                     ANRYFQSPPVETLNLSKVLAHLNSQQLPNFPGGGLPGVSLVLICFKNSRLDVFYIPNE
                     AQQMTNGLKVGDLIIVEADRGRDLGKIVQLDVTLQDARLLKLKQFRDQQAALNQENSS
                     NISTNNNSSEKRPALHFPKPVVRFAYPNEVAQLMQKQTDEDKARNVCQLKVKSHNLVM
                     SITDAEYQWDRRKLTFYYNSNCRIDFRDLVKELFKIYKTRIWMCKQPEPITFKAQDN"
     gene            <662614..>664668
                     /locus_tag="FOA43_002958"
                     /db_xref="GeneID:62196359"
     mRNA            <662614..>664668
                     /locus_tag="FOA43_002958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923238.1"
                     /db_xref="GeneID:62196359"
     CDS             662614..664668
                     /locus_tag="FOA43_002958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779166.1"
                     /db_xref="GeneID:62196359"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="PFAM:PF01226"
                     /translation="MVDDTLYITPHEAALAVVATSMKKARLRLDTLFVDSVMGGVLFS
                     TGGLLYVMCQSMDQGLIDNGCTGIVSLFQGAVYALGLFFVIQTGMELFNSNVLFFTVG
                     VLRGAVSIVDLLISWTITFWVNYATTLFVVYVICYLSGIFQESDYVKGTIQIAQHKIE
                     ASFMQTFLRAVAGNFCVCLATYLQIMVKPPHVKFLLIFMPIFTFVAMGFTHVVADMFL
                     VPSGIFNDCGFGFGRYTWKIMLPGALGNIVGGVFFSVTIPWYLHLVVIEQDMKRLNLP
                     AYEEKDEQPMLNMDSRVVRILPTGQVEVTSGSTAVTVEEKQDDGGGRQLYQPETVGTV
                     GTVDTVGTLETTGTAGTTGTAGTISSLATRSTVSRLRYRRKIRSPKGVFPVVDMGPPL
                     RKEKTIASAYTGAGTTSGTDVTIEEEAEDEAEESDEDKDAFIEENPYDAENDKMSTNL
                     MRAITRAKTRAQRDLESVVEGDTEESALQRLKMKFQQANGKRRHFSFSFRSDQNSMDL
                     PGRLARARIPSVAARHADHTAGIHQDSVDAKVHSMIASRRMDSNNTSSSYNNSSSVRT
                     LTPAMYGSPSHSYISRKKLSRQIGRVDREEPRGLRDSEKAEKSEEPEKPAEAEEAEEA
                     EEAEELGGSPGSEEPPGPGGSPNRRPSGDSFAYSENPISIFSDSSFEGYRSNEREKTD
                     DI"
     gene            <664752..>667214
                     /locus_tag="FOA43_002959"
                     /db_xref="GeneID:62196360"
     mRNA            join(<664752..664760,664872..>667214)
                     /locus_tag="FOA43_002959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923239.1"
                     /db_xref="GeneID:62196360"
     CDS             join(664752..664760,664872..667214)
                     /locus_tag="FOA43_002959"
                     /note="CAZy:GT39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779167.1"
                     /db_xref="GeneID:62196360"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR032421"
                     /db_xref="InterPro:IPR036300"
                     /db_xref="PFAM:PF02366"
                     /db_xref="PFAM:PF02815"
                     /db_xref="PFAM:PF16192"
                     /translation="MSPSKKEPLKQDFEVDTSSPSPDSSPSLLDEPSSTDQQVKAKLI
                     ELALKDTSKSSSVPDELSAKSFMNSFLTLEKYLTPIFLTLLSFFVRMYKIGINNHVVW
                     DEAHFGKFGSYYLRHSFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPDYIDYV
                     KMRLFNASFGALIVPVAYFTAKEIGFNRKACLLYGLMVCLETSYTTLARFILLDSMLL
                     FFTATTFYAMNRFHNKNRFEALAFSRKWWKWLLLTGISIGCVCSVKLVGLFVTAVVGI
                     YTIFDLWIKFGRLRTSMSVSRYTAHWMARILALIVIPLCVFMTCFKVHFDLLSGTGPG
                     DATMSSLFQANLLGSSLTTGPRDVMTINSTVTIKSQGLGGGLLHSHIQSYPEGSNQQQ
                     VTTYTHKDANNDWRFELVRSDPRMEFREPYFVVDGMHVRLIHEGTGRNLHSHPVPAPI
                     SANIAYEVAGYGDLDIGDDKDNWVVEIAYQYGTEDKLRLHPLTTSFRLRHEILGCYLA
                     SMDIPLPQWGFRQGEVTCLRDPFQRDKRTWWNIEDHTNPTLPTPPEGFKLPRTNFFKD
                     FIQLNIAMLATNNGLIPDSEKFDQLASSFWQWPSLNVGIRLCSWADDSIKYFLIGSPA
                     TTWTSSIALIVFIAMIVAYVLRWQRQYDDFPEEKTTTTTVDSNLLIQRTVNDEWNLFV
                     MGGFFPFLGWFFHYLPFGIMGRVTYVHHYMPALYFAMLVMCYVVHWVDARVSRRWFTV
                     SLYISLYALIIGVYIRLSPVSFGMDGPSADWKYLNVLKTWSIG"
     gene            complement(<667258..>669006)
                     /locus_tag="FOA43_002960"
                     /db_xref="GeneID:62196361"
     mRNA            complement(<667258..>669006)
                     /locus_tag="FOA43_002960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923240.1"
                     /db_xref="GeneID:62196361"
     CDS             complement(667258..669006)
                     /locus_tag="FOA43_002960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779168.1"
                     /db_xref="GeneID:62196361"
                     /translation="MTASLIPLNWHHFVRFNSSSPSSLIDLLETTKTYFKRSSTRSKI
                     DSLLHIVPRSVPRSVPRSVPRSVPRSVPRSVPRSVPQSVLKSVSQSAPNLVPRSVAQF
                     VPQKITIGLVHSQSVPRGLLLDCLIDDPLSGDKQWSHIFDTYRKTHPSNNIRVTYANE
                     FSQISYDTFGVKSPFLNKDLRLVEGSPDSSDLLNRELFNDIDLIDINDGFDPSDCQMY
                     VYVKTRPSEAFEPSGHYPFLEVINGEREDGAHFIVENHAIEVDLHKIKHANRLLSEST
                     ENIDQYLELLTNSNARSLLYTLSNETSGYKPVILLLRSLLVDLRADLRRETDTSTQNS
                     GDELSKQIADWSQMSHLELQTKVRPYMDEIMMGKFTKLGRILWNSDDLASIMAKYLFD
                     DHLEVRTSLFGVKNRCHGSLIDSSGNLNYLEGKIDGIFPQDLHNPQNPQNPSRDPLKQ
                     LRVHIIQDKLPELQGVLNSVLLKESMEIPLPVFCITTLGYIVDFIDLNTAGAIFAFSI
                     ALAAYRASHKIFKEMTSFRDWYLDSLRVSIDRNLVHLNNKLTHNMDQYSNHVDSKAEL
                     IDQLDSHLQHLENIKH"
     gene            <669178..>670104
                     /locus_tag="FOA43_002961"
                     /db_xref="GeneID:62196362"
     mRNA            <669178..>670104
                     /locus_tag="FOA43_002961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923241.1"
                     /db_xref="GeneID:62196362"
     CDS             669178..670104
                     /locus_tag="FOA43_002961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779169.1"
                     /db_xref="GeneID:62196362"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033756"
                     /db_xref="PFAM:PF01656"
                     /db_xref="PFAM:PF10609"
                     /translation="MSMIGLLQRARLGINGRGSARCNIHITSHTLSHSNPLGLPNFKP
                     VDTRLPVKHTLPGVKDIILVSSCKGGVGKSTVSTNLAVALRNLDLNVGLLDADIFGPS
                     IPKLMNLHGEPRLSDRGKLIPLQNYGIQTMSMGYLIPNEDSPIVWRGLMLQKALQQLI
                     FDVDWNHLDVLVVDLPPGTGDIQITIGQMLKVSGAVIVSTSQDLALTDVKKGISMFNK
                     VQIPIYGLVENMSVFVCPNCQHEERLFGDRGVLKEAKRLNIDYLGSIPLNPRICTSSD
                     EGFPVAVDPNESLAKPYYEIAKSLIGKIKERA"
     gene            <670215..>671024
                     /locus_tag="FOA43_002962"
                     /db_xref="GeneID:62196363"
     mRNA            <670215..>671024
                     /locus_tag="FOA43_002962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923242.1"
                     /db_xref="GeneID:62196363"
     CDS             670215..671024
                     /locus_tag="FOA43_002962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779170.1"
                     /db_xref="GeneID:62196363"
                     /translation="MKFFSLSLIALLMATKTFGKNIHVSKKGFIDEIKQHRGIYSNGE
                     TNFETWRSPEGNGYLIPNKKATDPVGYDYQLGYALQLKDEGLTESLIPVYETNVTALG
                     FPKFWNKFEEPCEAEPRTITIILDSIEEETKASVKNSKEFIFFGLEDQDEIVTETVVK
                     LVTVHSTTTVTRKGTGEAAKPTAKPAVKAGTESKPSITTAPQTITLGFGIDNETNSGY
                     TNTSEWNTLETSISNYSTISNNTMMNEGFLERAVSNSILGAAILLGIGLMM"
     gene            complement(<671181..>671774)
                     /locus_tag="FOA43_002963"
                     /db_xref="GeneID:62196364"
     mRNA            complement(<671181..>671774)
                     /locus_tag="FOA43_002963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923243.1"
                     /db_xref="GeneID:62196364"
     CDS             complement(671181..671774)
                     /locus_tag="FOA43_002963"
                     /note="BUSCO:EOG093442HZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779171.1"
                     /db_xref="GeneID:62196364"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PFAM:PF03357"
                     /translation="MIRRNKRQMDRQIQDLSKLENKTKSLIKGAVKKGDMKSAKMYAR
                     EYRNVGKTVKRMSISRATLDSIGMKLGEQQQLIKIKGSMQKSTAIMKDMNTLVKLPQM
                     SRTVQQLSRELTKSGVIDEMVDDMIDENSYEEEDEDEEKEIDQILDQVLSEQESKSPI
                     NSLPEAQKVEREEAEEPEEPVEDEILENMRERLSALE"
     gene            <672116..>672949
                     /locus_tag="FOA43_002964"
                     /db_xref="GeneID:62196365"
     mRNA            join(<672116..672157,672212..>672949)
                     /locus_tag="FOA43_002964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923244.1"
                     /db_xref="GeneID:62196365"
     CDS             join(672116..672157,672212..672949)
                     /locus_tag="FOA43_002964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779172.1"
                     /db_xref="GeneID:62196365"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="PFAM:PF00705"
                     /db_xref="PFAM:PF02747"
                     /translation="MLEGKFEQASTMKKVIEAIKDSVKLCNFNCSQSDGITVQAIDDS
                     RVLLIALKLDPSCFQEFRCDKDSVLGLDLESLGVILKQGSSNDIMTLIAEDNPDVLLL
                     VFEDHEKDRISEFSLKLIDIDSDVLTIDDMDHDCSISMPSADFAKVVRDMRTLSESLQ
                     ILVTKDSIKFKADGSIGTGSVILKAHTDLDDTKKSVRIDMNKPVNLSFGAKYLNDIVK
                     ASSLADTVNIKLTDKAPALIEYKLQGGYLRYYLAPKFEDEE"
     gene            complement(<673421..>673978)
                     /locus_tag="FOA43_002965"
                     /db_xref="GeneID:62196366"
     mRNA            complement(<673421..>673978)
                     /locus_tag="FOA43_002965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923245.1"
                     /db_xref="GeneID:62196366"
     CDS             complement(673421..673978)
                     /locus_tag="FOA43_002965"
                     /note="BUSCO:EOG09343XXA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779173.1"
                     /db_xref="GeneID:62196366"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF08445"
                     /db_xref="PFAM:PF13508"
                     /db_xref="PFAM:PF13527"
                     /db_xref="PFAM:PF13673"
                     /translation="MTITYSALSLDTSEKSRGQIDGEIEAIRKLVNEHLSEPYSVYVY
                     RFFLNNWPELCLLAKSEGNIIGCIISKVETHRNTRLRGYIGMLTVTEQYRGQGIAKKL
                     IDKSLDIMVDKKCDEIILETEVVNKKALRLYENFGFVRVKRLYRYYLNKHDAYRLILP
                     ITDKACLRSTFLEKLPEEKCIEARY"
     gene            <674252..>677722
                     /locus_tag="FOA43_002966"
                     /db_xref="GeneID:62196367"
     mRNA            <674252..>677722
                     /locus_tag="FOA43_002966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923246.1"
                     /db_xref="GeneID:62196367"
     CDS             674252..677722
                     /locus_tag="FOA43_002966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779174.1"
                     /db_xref="GeneID:62196367"
                     /db_xref="InterPro:IPR019460"
                     /db_xref="PFAM:PF10377"
                     /translation="MSSLRADMGGFHEDADILDTVSIYNALTGGRLYTNGFNFTNLDS
                     LKLFIAKSFSMSVDNLFLLTPFGIKFKFSMLVHDEINEIFVFDRKFFNPNLVNSDLSE
                     TMTSDLLHDLGHDELINMIRPLSAPIDLPKMDDVIDGLLQVVKSTDIDFGSLRLLLNS
                     LKRTYAWASALLSDFKSTLFDEKMIDGNEQVENMLTSLNVLIQYVNLMFKGVEKRFNG
                     LIDEFIVVRAHSLHENWKLQYDKLGQIKFYLQQNPNQLMLIDLVDGKTASDSAFQAEL
                     LIKQINSGLATLRTKLESEIIIPKQELVKEYDYYRLQYVKKTADKDAESKLASLYKAD
                     FKALQQSVTQLMSSSKELPSFEDLITTENGSSTNLSRASLLKIELLVQLYHQQVQDFV
                     PQIEELSKKMYESQIKRFELRRKLQEKLVKSTLVTLVDLQLKTMEANKILNESIGKRM
                     DQLKEHELGLSFIFDLPLVFGIWLIANLGNVKHGLCLNKLVHKSGEVFEMMRYMEQED
                     RKKWLEEFVEGVGIAKGKSKWMDDTVKKKFVDENTVDVKVERIGSKSISIVPETGNYL
                     HSFNKLLQHINGHPSRVGPAEAQVINQDEQGPRDIFIEICTQVQVDDVFRYIISLQNE
                     GVDSEVIDQLIKYLNDLGIVEQKEGDVRGDRFGSFNGEDPCYMKFLKRYLKSFEIGRV
                     KIEIKGEEEGVGEEKIGKIGLTEPTEQTSKSLIKGYENRIRKLENLLHQETFKQFNAQ
                     WSHKPKQMEFNREKEIVENEHKLINLPPSHPDEKLDKLERENKNLKVKLEELERQGLE
                     ELRKEKADIDLELEMAKKENSEKEKNIVEMAKDLKGLKEDKLQLNKKYGDLKSMNDDL
                     LENLTQKESEFNKESQMNQQELNELKLKLEELEETNIELGDKLEEKERRLEGVDRILG
                     ELSGRLCEDLGTFCLILESMGLLVVKEEGKMTIKRVKGLRGRKKEIATRGGDETMQIV
                     AEDVVEEAKKRLEEVDEDMNIKYMEFRSLAYLDSKMVVEKVFRRFNDVETLARRLQKE
                     KSQQKGDMKALSEEMSQRLAIRDFKVGDLVLFLKTLSNTAGNPEQPWAVFNIGSPNHY
                     LKNEKDDSNYIDLNEREWFVGRIEKITSKTVTERSYNDVRENPFKLSVGFTWHYVSAK
                     ASTTDREGLT"
     gene            <677904..>679685
                     /locus_tag="FOA43_002967"
                     /db_xref="GeneID:62196368"
     mRNA            <677904..>679685
                     /locus_tag="FOA43_002967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923247.1"
                     /db_xref="GeneID:62196368"
     CDS             677904..679685
                     /locus_tag="FOA43_002967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779175.1"
                     /db_xref="GeneID:62196368"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="PFAM:PF00205"
                     /db_xref="PFAM:PF02775"
                     /db_xref="PFAM:PF02776"
                     /translation="MAPIRLDALSMSTDNTSSNVNSARCPEITISEYIFERLYQMGVK
                     SVFGVPGDFNLSLLEHIYDVKSIKWIGTCNELNAAYAADAYAKTSRQMGAVLTTFGVG
                     ELSALNGIAGAYSEFVPVVHIVGTSPLPEKRSNLVKNFHHLITNRKMYQKPDHYVYEK
                     LAQTFSVASASIEDGDIAKTCDSVDNVLESVWRESRPGYIFLPCDLTEMKVPFSRLND
                     KPLKKSYDSGNEQLVDSVVSEILERIYSKQNVSILADAFISKFRMEKPFEKLVKLLND
                     KVNLFDTYMAKGIFSEDTDRFVGTYAGKVGSKQVSEAIEASDLVLYVGSFANEMNCGF
                     FSYKLDESKIIDLNPQYIRIGKKMYTGVTFMDVLPKLIEKLDASRINSSVRYKSIEKQ
                     SLQKVQSNIEAPLTEADLGRSLENLLQPDDILIVETCSFMTGAFQLNMNDARMVSQCY
                     WGSIGYALPATLGACLALRDFQMPGKVITVEGDGSAQMSLQELTSMIRYEVDAIMIML
                     NNSGYTIERAIKGPYSGYNDICGNWQWTKMLKVFGDINEEKSRSLQITSSKQLSNLVN
                     AGLHDEGRFQLIELILPKFDIPWHYGK"
     gene            <679861..>681237
                     /locus_tag="FOA43_002968"
                     /db_xref="GeneID:62196369"
     mRNA            <679861..>681237
                     /locus_tag="FOA43_002968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923248.1"
                     /db_xref="GeneID:62196369"
     CDS             679861..681237
                     /locus_tag="FOA43_002968"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779176.1"
                     /db_xref="GeneID:62196369"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MLVTEKGKRIDELEEHDELEEHDGLEEHDDPEELEEAEEHYGPG
                     ELEEAEEPDYPEGGWTAWMVVAAASVCMAMSFGMTNSFSVYLTYYEHRYLEVSSSSLS
                     MIGSIQAGFTFIFGIPSTMCMYYVGPQLMVAIGGLLCALSFFFLSLTNDPWQLYVIQG
                     VMFGIGSGTMYIHSSGVLFQYFYKRKALVQGIITAGASIAGVYWPIAARELIKRIGFP
                     WANRIIGFIYLPMTVFATIFLKPRHPPPKRRPGQNILRLNFRVLKDRRMLVLCFIWFS
                     FVLSLFPGLFYLDLFCNRANVANPIQEYNIPIVNAITGFSRVITGYIGDSVGIMNMDI
                     GFILLSGILPLALWIPARSTGAVLAYIITWAIATGGPVSLSPAMVGQVFEADDVQSCL
                     SFFFASGGVAALIGSAICGTFIPKGNATGVEGFDKLAIFVGVMAFASAGGVMVLRWMT
                     SRKLWVIL"
     gene            <682018..>684374
                     /locus_tag="FOA43_002969"
                     /db_xref="GeneID:62196370"
     mRNA            join(<682018..682025,682073..>684374)
                     /locus_tag="FOA43_002969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923249.1"
                     /db_xref="GeneID:62196370"
     CDS             join(682018..682025,682073..684374)
                     /locus_tag="FOA43_002969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779177.1"
                     /db_xref="GeneID:62196370"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /translation="MMSSKLKTKSKNRVPIRASKLKDQSMERIALKGSRFMAEAREKK
                     MKQRRELSQDTRSDTRRETLQTPQTPQKPQRPPTNISYGIHSHKSIREQRESLPIYSV
                     RDELMQLVDQNDMLVVVGETGSGKSTQITQYLAENGYGNKGIIGCTQPRRVAAISVAK
                     RVSEEVGCRMGDEVGYQIRFEDCTTKTTTIKYMTDGMLEREALIDPDMTKYSVIMLDE
                     AHERTVATDVLFALLRKAVKRRNGALKLIVTSATLDSKKFSKYFDGCPVFHIRGRTFP
                     VKIYYTKQPEIDYIAATIDTVVDIHVNNPPGDILVFLTGREEIETCCETITSKMTTLY
                     KSDPSLSELLILPIYSAMPSEMQSRIFEPTPSGKRKVVVATNIAETSITIDGIYYVVD
                     PGFVKVNAYDAKLGMDSLIVQPISRAQADQRSGRAGRTGPGICYRLYTKHAFQHEMAA
                     NTVPEIQRQNLSNTVLMLKAMKIEDVLNFGFMDRPEDESIMSALQELYILDALDERGH
                     ITRTGKYMSYFPMEPLLSKTLIQSVGMRCSYEVIVIISMLSVPEVFYRPREQREKADR
                     AKQQFDDYTGDHLTLLNVYEKWKASGYSKTWCKDHYIHEKSLKKTQDVKKQLITILEK
                     LDMKEERISGRIISCQGDRNQVRKAFVSGFFKNCAKRVTNGSHLEDEGTFRTLVENTP
                     VHIHPSSALFRKGAVDYVIYHTLILTNKEYMHCVTKIEGKWLIEYASKFYKEAEKGEM
                     SLAKKREKIEPLWDRFDRDEKWRLSRGRR"
     gene            complement(<685017..>687532)
                     /locus_tag="FOA43_002970"
                     /db_xref="GeneID:62196371"
     mRNA            complement(join(<685017..685241,685316..685488,
                     685548..685609,686313..>687532))
                     /locus_tag="FOA43_002970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923250.1"
                     /db_xref="GeneID:62196371"
     CDS             complement(join(685017..685241,685316..685488,
                     685548..685609,686313..687532))
                     /locus_tag="FOA43_002970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779178.1"
                     /db_xref="GeneID:62196371"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="PFAM:PF00320"
                     /db_xref="PFAM:PF00383"
                     /db_xref="PFAM:PF14437"
                     /translation="MAPSSLPVSVDRRSASTADFNYMEHIKNISGRTNIAAAAADRGG
                     SPNSSASGFMRKEISSVITPQSSKLSQSLRNGGGVAGGIAGGNAGGMVPSFGGGSFGG
                     PPSLVDSAEQSPDFGLDFDPLALGGAGGDNLNDGHNGSLSGPSNGSPFGTAASAVSSS
                     VPPYLNTSTSLTNIASAVPPLGSAPALQFDRSFHPQTVSQSQSAFTYDMLESPSRTSS
                     SVGDSSFNPRFPGPNPAAGQFRIDPDGDMNMFESSFQQMYSDGDLIGSRATSAARAAN
                     DFRPQNPRSSSLRRSSTRSRFKSSGAESHSGTPTPGSSDNTAIPRKSEGEQISCTNCH
                     TKTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSLKTDVIKKRQRGGRLKRTKKTDGD
                     DLHPTPMMIGKKSGDYKMTFDDKLGMKVALEEAKKGFSEGGVPIGACLLSEEGLVVGR
                     GHNMRVQKSSATLHGETSCFENAGRLPASVYKKCTLYTTLSPCSMCSGAALLFKIPRI
                     VLGENETYLGSEEWLSKNGVEVVNVHSKECKNLMDRFIKEKPEVWNEDIGE"
     gene            complement(<688632..>689794)
                     /locus_tag="FOA43_002971"
                     /db_xref="GeneID:62196372"
     mRNA            complement(join(<688632..689655,689790..>689794))
                     /locus_tag="FOA43_002971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923251.1"
                     /db_xref="GeneID:62196372"
     CDS             complement(join(688632..689655,689790..689794))
                     /locus_tag="FOA43_002971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779179.1"
                     /db_xref="GeneID:62196372"
                     /translation="MHLMNTLIVAFNDRLTRLLPLMDDYNVLYRYFQLYKIDVSSEQT
                     LFLRILNRPEISVNVGRESTTRLRPLRLRSLNVGGLGRSTQEAIVPSVNSVPELNQLP
                     PDSLTLFKQLRLIRKMYICCILTLLGTGKVRADDEEEEEVETSASFLNFLKGRFNVSE
                     KYFKHVTRATRLFLCMKMMEHMAELVKILEGEVEEDEVINGVDNLDEVGEDYSIAEES
                     ENEDLSELVQLMDSLSYKLGILEQNSNTISVSKELKGLRSEFQRLYDLYEESSGDNWR
                     EGIKKRRSDEISDFRIGHKSDHRKSSGLSFGLLTVVDKENCNSDEEEIEGGRQEAKNK
                     LYGMRDIH"
     gene            complement(<690740..>692363)
                     /locus_tag="FOA43_002972"
                     /db_xref="GeneID:62196373"
     mRNA            complement(join(<690740..692050,692280..>692363))
                     /locus_tag="FOA43_002972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923252.1"
                     /db_xref="GeneID:62196373"
     CDS             complement(join(690740..692050,692280..692363))
                     /locus_tag="FOA43_002972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779180.1"
                     /db_xref="GeneID:62196373"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR016143"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="InterPro:IPR036969"
                     /db_xref="PFAM:PF00285"
                     /translation="MSFRNIATRSQLATRAFSATRAYSSGSTALKERFAELLPGWQSE
                     VKDLKSKYGETVIGEVTLNQAYGGMRGIKGLVWEGSVLDPYEGIRFRGRTIPEIQKVL
                     PKVEGGEEPLPEALFWLLLTGEVPSFEQTKSLSEDLAARSKLPKHVEDLLDHCPATLH
                     PMAQFSIGINALESESEFAKAYANGVGKKEYWKYTYEDSINLLAKLPTIAAKIYRNVF
                     KDGKVAPVDGSVDYARNFATQLGFGSNKEFIELMRLYLCIHSDHEGGNVSAHTTHLVG
                     SALSSPYLSLAAGMNGLAGPLHGRANQEVLEWLVSMKKELKGDFSKEKIEKYLWKTLN
                     SGRVIPGYGHAVLRKTDPRYMAQRQFALKHMKDYDMFKLVSTIYEVAPKVLKEQGKTK
                     NPWPNVDSHSGILLQYYGLTEQSFYTVLFGVARAFGVLPALIIDRGLGFPLERPKSFS
                     TEKYKELVESLAKK"
     gene            complement(<692766..>693377)
                     /locus_tag="FOA43_002973"
                     /db_xref="GeneID:62196374"
     mRNA            complement(<692766..>693377)
                     /locus_tag="FOA43_002973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923253.1"
                     /db_xref="GeneID:62196374"
     CDS             complement(692766..693377)
                     /locus_tag="FOA43_002973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779181.1"
                     /db_xref="GeneID:62196374"
                     /db_xref="InterPro:IPR008672"
                     /translation="MDEIERLKKLNEKLFEENKELRGENERLTEENPRKRVKVLELKN
                     NPVNELKWKNNSMNEKLVKENEWLISNRAVGNTTVERLEMEKHQDKLEIERLHKQLER
                     LKDRYKKNIRRFMEIVYKILGYKIEFITEERLRITPKQKKESSIVIDIGDLKEMRLNR
                     GKFKDLNSELVDNLVKFWILDKKEMSCFFNALSLELYEQERKE"
     gene            <693590..>694060
                     /gene="MMS2"
                     /locus_tag="FOA43_002974"
                     /db_xref="GeneID:62196375"
     mRNA            join(<693590..693600,693655..>694060)
                     /gene="MMS2"
                     /locus_tag="FOA43_002974"
                     /product="E2 ubiquitin-conjugating protein mms2"
                     /transcript_id="XM_038923254.1"
                     /db_xref="GeneID:62196375"
     CDS             join(693590..693600,693655..694060)
                     /gene="MMS2"
                     /locus_tag="FOA43_002974"
                     /note="BUSCO:EOG0934425P"
                     /codon_start=1
                     /product="E2 ubiquitin-conjugating protein mms2"
                     /protein_id="XP_038779182.1"
                     /db_xref="GeneID:62196375"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="PFAM:PF00179"
                     /translation="MFKVPRNFKLLEELEKGEKGLGAESCSYGLSDPDDMTLTHWNAT
                     ILGPPNSTHENRIYSLTIECGPTYPDTPPLVKFISKINLPCVDQSCGRVKPDNFPILR
                     NWKRSYSMEILLLELRKEMASSLNRKLSQPEEGETF"
     gene            complement(<694182..>694558)
                     /locus_tag="FOA43_002975"
                     /db_xref="GeneID:62196376"
     mRNA            complement(join(<694182..694508,694553..>694558))
                     /locus_tag="FOA43_002975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923255.1"
                     /db_xref="GeneID:62196376"
     CDS             complement(join(694182..694508,694553..694558))
                     /locus_tag="FOA43_002975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779183.1"
                     /db_xref="GeneID:62196376"
                     /db_xref="InterPro:IPR024645"
                     /db_xref="PFAM:PF11093"
                     /translation="MGNQCTYDGNKCVCVPFRRLFARCLDKEFGSRREVIGYKLTPAH
                     GSRMVGQNLKNRREVYRNIEITEKGDNEYVKILNGDKKGDKELLEEFLRADRVFQRKV
                     KEYYEKMK"
     gene            <694856..>696445
                     /locus_tag="FOA43_002976"
                     /db_xref="GeneID:62196377"
     mRNA            <694856..>696445
                     /locus_tag="FOA43_002976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923256.1"
                     /db_xref="GeneID:62196377"
     CDS             694856..696445
                     /locus_tag="FOA43_002976"
                     /note="BUSCO:EOG09342GDN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779184.1"
                     /db_xref="GeneID:62196377"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="InterPro:IPR036900"
                     /db_xref="PFAM:PF00408"
                     /translation="MSLHSAFNKYPAPSGINYAYGTAGFRYFGDQLDSVAFKVGVIAT
                     LRSICLGGKTIGIVITASHNPPDQNGVKVVDPMGEMLPQSWEPFANQLANTKDWHQFN
                     QLVQERLPENYLKSRDIVPMVVIARDTRQSGPRLVSAVIDGVNALNGHITDFGMLTTP
                     QLHYITRCSNDGSFGVASEQGYYNKLIKTVTKILQINNYDCLDAVTVDTANGIGGDKL
                     QKINALNHVMSFHVINGDTAHPLRLNVDCGADYVKTNQRLPHGVGNPIPDQLYASFDG
                     DADRLVCYFMDKGGKFRLLDGDRIATLFASLIGGLLCHVKGIHVTTAIIQTAYSNGSS
                     TEFIREKLGLPVYFTSTGVKHLHEKAIEFDVGIYFEANGHGTVVFSKKYLEELKKYEA
                     KNSSEQVAVDTLILLVDLINQAVGDSISDLITVLVALKLMKKSVEKWGDDYSELANKL
                     FKLKVADRFVFKTTDAERRLIEPVGVQEKIDEVVKRYSKGRSFVRASGTEDAVRVYSE
                     AANEDDCTELGEKVCEIVKGI"
     gene            <696775..>702389
                     /locus_tag="FOA43_002977"
                     /db_xref="GeneID:62196378"
     mRNA            join(<696775..696779,696848..>702389)
                     /locus_tag="FOA43_002977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923257.1"
                     /db_xref="GeneID:62196378"
     CDS             join(696775..696779,696848..702389)
                     /locus_tag="FOA43_002977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779185.1"
                     /db_xref="GeneID:62196378"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="InterPro:IPR036964"
                     /db_xref="PFAM:PF00617"
                     /db_xref="PFAM:PF00618"
                     /translation="MPNFKKAQMAKEATKRALTKNIDSFEPDSTTITSKLISISTSNS
                     DSSRNSSPNLNSTMKQPNLDNSRLDPSNPTPNLDPNLNSHTSAQLAKQVTVNKLGKNL
                     DNLLPKIQDKDESQDQPQPSKSAELDSTPRENGNITGPESRDPKNHVTQDDFNYLSQR
                     LTKMPGSWIGQRGAAQFEDEDAQFNDPNGSRYHEIVDSLNNSPSVDLQREMTFESLEG
                     ELESTSDTVSGAADGAGSRHSSLGAPIRKSVVMSKVPDLPKEAESGETFKRALESMLS
                     AGGGGGIAGAEGTAAAAAAAAVSTSSPRSSSSSSSSLSFSIPATATAAVSGSPTQLNF
                     DSERRTSSSAFTIVDTPDVDADADVDADDDKRFTNPLFKHQSGASSIYSEAVNKSRVS
                     VPLASIPEGNADGGKVVRSKEMPPIGDAAQSFNSGPASHPKTHVISVSSSIYSALPRG
                     SRIANTGVAANSDMSESSGQLASVSAGFAASASATAAAAAAAASPGSVQRIMASFSSA
                     PNASSIASKSAIDSLLSADAGSVLMSDTDTTDTLTPDMFDPDDASALFVAATYPFNAS
                     TLDSDNDAAICLSFGQNDIAFTYNLDESGWGEVILVDSLQRGWVPMNYFKSAVEDSLA
                     ESEGRTHNEKLASSRLPLRVLFRNAGKFLLNPQSKPFYLSGHLRGYVFDVECFNGITD
                     GVRKLLIDTDCISRSNTIVQRKPIVRRRRKKLLRSWSDLMAKAKKYMHTMDPSKIEYL
                     QLLTFDVLKRAAAFLEVWGAETADLDLDNTEEQRHRQELSTFTFDLIYLERPPLVGYR
                     ANEIYDQLVSGLSMISGRIDLVEHNVQGCRVLETVVGQINLMVNEEVFVMKWIKAKLT
                     DAADADANGATADGASADGATADADTTDITAAFTSALTSSETPIGASLQGRFAGVVAR
                     LRALDSNASKLEQVVDELNSFVRVMIDVATRRKIQNNLPERANSNISRGGSITQASAR
                     ASARASAKGASAIALSKGLYFYSREGGAIVINACKMIGIASTSHRILKSLLSTMATAE
                     LHLPAFRKYPNYVKMGISPADFVQRCSVGLMGDKGVRRQVSEYRKRSTATPRVSKRFS
                     VFRAGNSGDMQISDDGLDFLAGISSKENTPFINEGGEFEELVGVGGKSGAGGESGVEV
                     GVVDSADADSDLSYNSEADILRAEDGKLLGASFRALVALLTDESHPPSYFFTSTFFLT
                     FRIFANGSMLLEELIRRFDVRDMWQSAAKENSASAGFSSQASRIKARRRLVCKAFQLW
                     LESYWKPRSDYALLAPLINFFNEGVKPKMPVEGYQLLVVASRLVGQPPVETMRDKLNY
                     SNNIDSDSQLLPRKISPKLHKKQILRISQLHDLNGGALMSELDAYNSFMDDIDSYGLK
                     EVKEAEAEEGESGVTVPAGGATADGATADGATAAAAAPKSGGVSFRKSLNLGMHLELS
                     DGTSSSVLLTSQQMELMKTVVISYRRMLGDHWTGDAEESGKSPDTFSFTPLDTSSLIE
                     SWWRTSQESWKCLNQSLILLNFNGLELAKQLTLIESKMFCCVKVSELLNQNFTTKKLH
                     LNLSPNIQRSVLFTNLLSEYVIESVLQPDIEMKRRAHYFKCWLKVAISCLYLRNFNSL
                     ASIMTSLQSFLITRVQSIWEGLSDKYRDLFHYLASIIHPEKNYNVYRDKLRDFLQSNL
                     EDDLEIPIVPYLSLFLQDLTFVVDGNGNFRNNSKSFLNEKLINIDKFFKITQIIADIQ
                     TLQVPYTDTGELGAIYNSVDTEQMRSQAIRNLEKEIPMDDDVNFADMFDISGVPCLQE
                     MIFLEIWKVKQNNAREEDRAWKLSCTVQPRDQGSDKGSIGTVTDETLTSVANIAQERS
                     SANVVS"
     gene            complement(<703334..>705736)
                     /gene="ACO2"
                     /locus_tag="FOA43_002978"
                     /db_xref="GeneID:62196379"
     mRNA            complement(<703334..>705736)
                     /gene="ACO2"
                     /locus_tag="FOA43_002978"
                     /product="aconitate hydratase"
                     /transcript_id="XM_038923258.1"
                     /db_xref="GeneID:62196379"
     CDS             complement(703334..705736)
                     /gene="ACO2"
                     /locus_tag="FOA43_002978"
                     /codon_start=1
                     /product="aconitate hydratase"
                     /protein_id="XP_038779186.1"
                     /db_xref="GeneID:62196379"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="InterPro:IPR036008"
                     /db_xref="PFAM:PF00330"
                     /db_xref="PFAM:PF00694"
                     /translation="MLAIRLNAKARISGLRGMATAASTSTSPYTAPRGFETRTPPYGR
                     LLKNLGRIRQVLRPDTKLTLAEKILYSHLSNPEDMVAAAVNGDISNVRGKQYLKLRPD
                     RVAMQDASAQMAMLQFITCGMKSTAVPASIHCDHLIVGRDGAANDLRRSIATNEEVFN
                     FLQSCGEKFGIQFWGPGSGIIHQIVLENFSVPGLMMLGTDSHTPNAGGLGAIAIGVGG
                     ADAVDALTGTPWELKAPKILGVELRGKMSGWTSPKDMITKLTGDLTVRGGTGYIVEYF
                     GKGIEQLGCTGMATICNMGAEIGATTSTFPMQKSHLDYLTATGRGPVADLAAKVNAET
                     GFLKADEGAEYDKVLGIDLSELEPSVNGPFTPDLRTPISALKKTTTREKWPQKITAGL
                     IGSCTNSSYQDMSRAASLVLQAERAGIKPKIPFFVTPGSERIRATIARDGLIDIFERN
                     GAIVLANACGPCIGQWDRGADAPKGANVIFTSFNRNFKARNDGNRQTMNFLTSPDIVT
                     AMIYSGRMDFNPLTDTIDRVAAKPFKFSPPVGENLPERGFVAGRAEFYPEASPQPQST
                     VEIAVDPESERLEILKPFPDWTGLELSTTVILKVKGKCTTDHISAAGPWLKYKGHLGN
                     IAHNTLIGAVNEESGEVNKAYDFDGKAYGIPELMQKWKDERRPWVVVAEHNYGEGSAR
                     EHAALQPRYLGGEIILTKSFARIHETNLKKQGVLPLTFADESDYDRLSSGDVLRTVDL
                     KEMMAKGGDNGGIIKLEVIKKSGETFVIKAKHTMSEDQVEWFKAGSAINYIRRENIKR
                     QH"
     gene            complement(<705952..>707697)
                     /locus_tag="FOA43_002979"
                     /db_xref="GeneID:62196380"
     mRNA            complement(<705952..>707697)
                     /locus_tag="FOA43_002979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923259.1"
                     /db_xref="GeneID:62196380"
     CDS             complement(705952..707697)
                     /locus_tag="FOA43_002979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779187.1"
                     /db_xref="GeneID:62196380"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /translation="MPVKTPRKQLKVSFKVDPNLMSHVLRHQPKSATVLFFKEISDRF
                     ELLEHDPSRKRIKKHMALPKLNCHFFLLQDETDKRQLSQLYNRETLKSLMKKPESRDY
                     EHVIFSFQDHISFFRDYERSRTNIKEERYKQFYYLDEEDVVIKRSEGPLARFSGIKTV
                     KKYKEDKRSQWCDLFEPKTHRDILQRRRIREQMDKWIIEAFEKLKKVDKVKKMGILSK
                     KRHKKIRYTDHDDLDDFIVDDEYDEVVEKAISGKFIPSLIISGPAGCGKTSSVYAIVK
                     GELGGEVFEFNSSQPRGKKDINFYLKQMGTTQTVNRGIAMSRDQTAILFDDVDLIDDE
                     DADKEFWNGVTDLLSYTYRPVIFTTNELNKIPENIVDQSTILNFENPSRDVLTRYLNR
                     VAACRGFRFTDHVLRQMERGGLRGSLMQLQMLSYRFEMLEVGTVIVEAEKDVVKEKPL
                     AQLDLEYDLRWCGLNEMSHDQKSSDRASPYQLSRDSKWCKEYSEITLDFYSSKLFDSG
                     SRNRKARYSSGDDYLTLNIGSSFERLSNRIFATELSPFIRSMAQQEASRIKSGLNLTE
                     RRFEMEPSEKLEVLT"
     gene            <708865..>710850
                     /locus_tag="FOA43_002980"
                     /db_xref="GeneID:62196381"
     mRNA            <708865..>710850
                     /locus_tag="FOA43_002980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923260.1"
                     /db_xref="GeneID:62196381"
     CDS             708865..710850
                     /locus_tag="FOA43_002980"
                     /note="CAZy:AA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779188.1"
                     /db_xref="GeneID:62196381"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="InterPro:IPR033138"
                     /db_xref="PFAM:PF00394"
                     /db_xref="PFAM:PF07731"
                     /db_xref="PFAM:PF07732"
                     /translation="MKFTHLLSALVFAGWAFAEQKVHSYNWTAQWGKENPDGLYEREV
                     VTCNGDYPWPGINVKKGDRIIISLTNHLENQNTSLHFHGLFQNGTNEYDGVPLMTQCE
                     IPPNETMVYNFTVPDQAGTYWYHSHSSGQYMDGMRGSFVIEDTEDMPFDYDEEVVVSV
                     SDWYHKTVSELTPAFMSLYNPTGAEPIPQTLLFNETFNGVWNVKPDTTYFLRIVNTGG
                     FLSQYLWMEDHTFTVVAVDGVYVEPNETEIIYITAAQRYDVLIHTKNDTSKNYAFMQK
                     MDEDMLDTLTGVAFINSTDAIVYNKSAPLPEEYISDNYDTDFLNDFYLVPVEPEELYE
                     DYDYQIKIDVVMDNLGNGMNYAFFNNISYVAPKVPTLGTVLSADKYATNSLVYGESTH
                     PIVLQKDEIVEIVLNNNDTGKHPFHLHGHVFQVVERGPSYLDEDEPVPYNESAPYDAP
                     EYPMRRDTFYVNPQSYFVLRFKANNPGVWFFHCHIDWHLIQGLGLTIIEDPESIQAQQ
                     SLSDNWKDVCSAAGTPYIGNAANNTENYLNLKNQNVQVKNLPSGFTARGIVALVFSCI
                     AGILGCVVICVYGMAQIPDMEKKIFDNLTADEQVLFLEEHDDDADDDTEVGGANGASG
                     ASGVNGANVANVTSATTAEKDAEVEENSKEGSSSDKN"
     gene            complement(<711124..>712476)
                     /locus_tag="FOA43_002981"
                     /db_xref="GeneID:62196382"
     mRNA            complement(<711124..>712476)
                     /locus_tag="FOA43_002981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923261.1"
                     /db_xref="GeneID:62196382"
     CDS             complement(711124..712476)
                     /locus_tag="FOA43_002981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779189.1"
                     /db_xref="GeneID:62196382"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="PFAM:PF12430"
                     /db_xref="PFAM:PF12537"
                     /translation="MLGKDSRTENTIKSVNGKLYKLDFPYRIRTSPQSRWKPKSAKLN
                     GSLTSINRLLFNVIISFSFQVTCVFLLDVSGFLDNSMRSLDWKITLTTLIVLLSYVVP
                     SWTFQCYGYIKYDSENQHQIATKRFALSYLMVLTIWIVAIKIYSSIFIGTSSLMRFSQ
                     RAFYGISVLGISCLAALNGTGCISSIFSLTRAQKHVTKEDISKIVESLKSTEGMIDSR
                     RSMETELRLLESSYDDLVRRLEDQLVDYKREMEWQTAYGRMNRLSELGFSIYCMYRVV
                     TILLIQLPTIVLSSWGVIGRQQAETDPLSTTISRLVVRFINDQYDEDQLSVIINMTFA
                     ICLFVCSFKGVVITFSKLSKPSHMAVLGRLYELFVAETTGIYALSTMMILHRGGLPSG
                     LIEGFFGNDQLGADFVNILYTKWFGVSCIVSGIGFGVMKWINRHNSEYLDDWDEEKLV
                     "
     gene            complement(<712727..>713515)
                     /locus_tag="FOA43_002982"
                     /db_xref="GeneID:62196383"
     mRNA            complement(<712727..>713515)
                     /locus_tag="FOA43_002982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923262.1"
                     /db_xref="GeneID:62196383"
     CDS             complement(712727..713515)
                     /locus_tag="FOA43_002982"
                     /note="BUSCO:EOG09344BUT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779190.1"
                     /db_xref="GeneID:62196383"
                     /db_xref="InterPro:IPR019009"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF09439"
                     /translation="MNSIIELLKSMDTTMFVASIVLAILVIVVTSLMVQKTLFKRNSR
                     NFVIVGPPQSGKTNLFQRLTTGKLPVLTVTSIQPNVGPLKVDNSQYGENFSDVIVSDY
                     PASSKMKNLYLYPFLSDNISSCRGMVYIIDASAFDAEYCHYVANDLLTLLPITESIPN
                     GVDLAIFCNKCDYFTSRKPAKIHLMLEQEITKLYGLKLRNLEKVSESAEDMGVELEDS
                     LNTAFNGGQFKFEMLEGNVDFLEGNVFKDKIDSLIDWFCEKTAN"
     gene            complement(<713673..>715319)
                     /locus_tag="FOA43_002983"
                     /db_xref="GeneID:62196384"
     mRNA            complement(<713673..>715319)
                     /locus_tag="FOA43_002983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923263.1"
                     /db_xref="GeneID:62196384"
     CDS             complement(713673..715319)
                     /locus_tag="FOA43_002983"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779191.1"
                     /db_xref="GeneID:62196384"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MKLSKVSIDKDAANLANMGYKQEFSRNYDFLSTFSFALSISGLM
                     GTISITYLYPLWSGGPAAGVWCWFIGSLGCLCIAWSVAEITSCFPTSGGMYYVITHVV
                     PKKYVPLLCWIDGWLYFTGALAGACSTDFGASTLLLQTIAMHTDYSYIPTRGHITAVT
                     ILVIISHALINSLPGEALSKVTKYYCIVNIGTTLALIITLLIKCPQINTAKFTFTTVI
                     NNTGWSSDGWAFLFGFLQVSWVMTCYDATSRMSEEVRDAAYRTPLAIATALTTTAVLG
                     WILCIAITLTMGTNVTEILNGVSGQPIVEIYQYAMGKTGATAFLALAFVINWFTGAVA
                     MCYTSRSLWSFSRDKGLPYSKFWYHLTEKTGVPTRCVWLVCIINSLLTLINLGSTIAM
                     NAVFSACAICTDWSYILVIGAFALNDKKMGVVRGPFHMGRVSPYVMYYGCVWTVFVSI
                     VFVFPNYMPVTKEDMNYTVVILGAVFILAGGWYAFDAKHWYRGPVSNVDAEYTTEIHQ
                     MFSKGEQSSSDTFGNELSREHKKGSVKVDNVSVSSVTASE"
     gene            complement(<718601..>720952)
                     /locus_tag="FOA43_002984"
                     /db_xref="GeneID:62196385"
     mRNA            complement(<718601..>720952)
                     /locus_tag="FOA43_002984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923264.1"
                     /db_xref="GeneID:62196385"
     CDS             complement(718601..720952)
                     /locus_tag="FOA43_002984"
                     /note="BUSCO:EOG09340RLG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779192.1"
                     /db_xref="GeneID:62196385"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="InterPro:IPR036174"
                     /db_xref="InterPro:IPR036175"
                     /db_xref="InterPro:IPR036180"
                     /db_xref="InterPro:IPR036465"
                     /db_xref="PFAM:PF00626"
                     /db_xref="PFAM:PF04810"
                     /db_xref="PFAM:PF04811"
                     /db_xref="PFAM:PF04815"
                     /db_xref="PFAM:PF08033"
                     /translation="MADIYEIEDIDGVRFNWNAFPVTRQEADNMASPVGCLYTPLLAR
                     DDLPSAEYDPVVCRRCRAVLNVFSQIDLGSKTWVCTICNSRNPLPPHYANISAENLPV
                     ELTPAASTMEYVLARAQPPPPPSYIYVVDLCQELEDLQALKEALITSLSLHPPGSLVG
                     LVTFDSVVSVHELGFTSCSKTYVFSGSHECESVAVQKQLGIYGNCSRDWIKQLETGNG
                     TVGRFLVPLGDEDAVARLSKIIQALEPSKWTVKPGHRAVRVTGAALDVASCLVEGSYA
                     QCCAKLCLFAAGACTFGPGKIVGTELKEPIRSHSDIEKGSAKHYKKAVQFFKKLALKG
                     VGASARDSKDKFFDHNASSGFSVDIFAGCYDQTGVYEMKTLANQTGGVLVVTDSFQTS
                     IFRNSFFECFAKDDDGYPFEFSDGYLEVLTSQRLKVAGMIGHGASLKADGENVADIEI
                     GDGMTHRWSLRSLSPRHTYAVFFDMQTVGSAEQRNSSIAEVYIQFQTTYRHTNGSVRM
                     RVTTLSRLTSNSADLASTFDQEAAAVLYARLIVHKLEHGGEYSDLLRWIDKSLVKLCT
                     VFGDYSKGDSNSFRLSNKFSLLPQFIYHLRRSQFLQVFNCSPDETAFYHHTLLRTDVR
                     DSLVMIQPTLVRFLADGSEPEPILLDSASLKPDAILLLDAFFYTVIYYGRVAAEWRDK
                     HYPKDEYPGVYEMMDKAKEEAASLIADRFPLPRYVTCDEGKSQARFLYSKLNPSENDS
                     NQFVGGQMGGYVPDDNETSVVHTEDVSLRTFFQHLAKLVVNTN"
     gene            complement(<721393..>723600)
                     /locus_tag="FOA43_002985"
                     /db_xref="GeneID:62196386"
     mRNA            complement(join(<721393..722680,722882..>723600))
                     /locus_tag="FOA43_002985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923265.1"
                     /db_xref="GeneID:62196386"
     CDS             complement(join(721393..722680,722882..723600))
                     /locus_tag="FOA43_002985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779193.1"
                     /db_xref="GeneID:62196386"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="InterPro:IPR035984"
                     /db_xref="PFAM:PF00170"
                     /db_xref="PFAM:PF00887"
                     /translation="MDQVDRAFNKAVSAIQTLSTWSQNDSLPKPPLTNRVKLYALYKQ
                     ATEGDQGRSAHPPPPEDETSRRKWIAWKKEEGLTKTEAKKRYVACLIDTMKTYAGDST
                     ESRDLLFELEFLWETIRDLKPIPLRSKSPAVSLYRVASGGFNTNIVRPPSRTTNVVAI
                     ESSARSDSPKKDLDLIRWQSEINRAVNRISLELEVLAEPQEEPGSDTTRSWLARALGV
                     VYAYIKQGLQHAVADSLVILVVPGRKPLTTEPKNKRTAQNRAAQRAFRERKERKMKEL
                     ESKVKLLEDEKLQITNETELLRSQVYTLLQELSKYRPVDQEEETRQSEGQKARSIDAS
                     DSAKSSPVSADSTTYSTLETPVSSISSSNVKDISGSSASSSSSFQFPSQWGNSSASPG
                     LTQSELNQSSFKGDFDEGVSDFCAELGQVCGSKDCPIPKAKQQVQEKYASTSSSSLSI
                     PELSPKVCESVSSATTAEDIEYSSSPFYNLLQSTTSGTTKPSDEMNFLLDSFTTPNPT
                     AFNTDDLILGNDLEDYSGMLKKDTDDDTLGGLVTEVSKYDPLDELLGSQSQLNLITPA
                     TLPIFDGGDEKKVEGDDDSNETVPNTSGKMMKCSQIWERITSHPRFSEIDIDGLCSEL
                     KQKAKCSEHGVVVNGGDVGKLITNALDKKGSEVKENRFLKGLAC"
     gene            complement(<723837..>724863)
                     /gene="RPL12A"
                     /locus_tag="FOA43_002986"
                     /db_xref="GeneID:62196387"
     mRNA            complement(join(<723837..724638,724859..>724863))
                     /gene="RPL12A"
                     /locus_tag="FOA43_002986"
                     /product="60S ribosomal protein L12A"
                     /transcript_id="XM_038923266.1"
                     /db_xref="GeneID:62196387"
     CDS             complement(join(723837..724638,724859..724863))
                     /gene="RPL12A"
                     /locus_tag="FOA43_002986"
                     /codon_start=1
                     /product="60S ribosomal protein L12A"
                     /protein_id="XP_038779194.1"
                     /db_xref="GeneID:62196387"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="InterPro:IPR036769"
                     /db_xref="InterPro:IPR036796"
                     /db_xref="PFAM:PF00298"
                     /db_xref="PFAM:PF03946"
                     /translation="MSNNKMPPKFDPSEVKYLYMRAVGGEVGASSALAPKIGPLGLSP
                     KKIGEDIAKATKDFKGIKVTVQLKIQNRQAQVSVVPAASSLIIEALKEPPRDRKKDKN
                     IQHSGNLALDAVFEVARTMREKSFGKTLASVSKEILGTCQSIGCTVDGKPAHDVIEAI
                     DAGEVDGKLSSNLFSFIFHFTNIFQSLKTEFFESIYRSKGNIQFIINLQVCYTLVPSS
                     FIFGSYLCANKIDFPAYYSPFLLSIGLFMSEFFQNSCKDTSRWLDWGVSG"
     gene            complement(<725011..>727537)
                     /locus_tag="FOA43_002987"
                     /db_xref="GeneID:62196388"
     mRNA            complement(join(<725011..727228,727533..>727537))
                     /locus_tag="FOA43_002987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923267.1"
                     /db_xref="GeneID:62196388"
     CDS             complement(join(725011..727228,727533..727537))
                     /locus_tag="FOA43_002987"
                     /note="BUSCO:EOG09340HNG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779195.1"
                     /db_xref="GeneID:62196388"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="PFAM:PF04112"
                     /translation="MSIVSKIPYGVVIKSNQFKLLHGTHALEVLNPKLDSSLLKIQPF
                     DLIHSCTTIDDLNGITCGLYRALSAWLDNNSLSVSVLSCAYIEELLMDYRDNGLVSSS
                     DTSDSLKDHVLVPFSLGILQFVKFVLKLGLAGVVCEEEDINTQTMDLDMIQNVPLQSV
                     IDQIECALKWVSDKSDVSNKSDVSDKSYSFLYDSVRLLTLLLQLPSLLEINLEPFSDH
                     QTPQVSEKLQKIVSDLTKALELLDKLGKSSDYATKINPPLNCFSTNVQKRRNNRSPPK
                     PVVLLSFKDSIENFRRLVQDSLTILHITETRDSIQLVEFLKCCMNKREATNDEDDVLG
                     LHVVPRSLLQLFLIRDDETILGSRKGFNIGSLLYDFMLRICVQDARILSCSDSTIQTK
                     LQLLLGDMKVPFFHFLSCVSQNPARQRQFIGKEVIYWDKFQVESENLESSVNSSIPDN
                     FDGGASFPIMPVASFVYFSKLISMIDLMLKSIELNLFKDLRELNVGYWLTSYLIDYLL
                     QHLNRLLDVVKLRRKQLVVSYGKRVKGDKKKAKQLHAEQLVRSESYLNYQVSRYSIYR
                     TMIELKLVELQVLNYFGYLKLPKLCKVSETLLFNLQLKPFQSIGVPELPSFADYNDAM
                     AKFNDAFGQVVKNGDYIYFRKLIKSKSIDLNAFFRTIQIQLDALEWPSFLSDSIKEDL
                     MELKRSSIYTELSLGQVVKILEKDVDNARHLDVYIERKKHHLYFPDIKVVKKEKKMIT
                     "
     gene            complement(<727557..>728174)
                     /gene="ATP5"
                     /locus_tag="FOA43_002988"
                     /db_xref="GeneID:62196389"
     mRNA            complement(<727557..>728174)
                     /gene="ATP5"
                     /locus_tag="FOA43_002988"
                     /product="ATP synthase F0 subcomplex subunit OSCP atp5"
                     /transcript_id="XM_038923268.1"
                     /db_xref="GeneID:62196389"
     CDS             complement(727557..728174)
                     /gene="ATP5"
                     /locus_tag="FOA43_002988"
                     /note="BUSCO:EOG0934389C"
                     /codon_start=1
                     /product="ATP synthase F0 subcomplex subunit OSCP atp5"
                     /protein_id="XP_038779196.1"
                     /db_xref="GeneID:62196389"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR020781"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="PFAM:PF00213"
                     /translation="MVSRQFVRFLATAVKSVKPPVQLYGLDGTYASALYTAAAKSNSL
                     EKSFESVAKLSDTIQKDPKVMQILGNPSLSQGSRKKVVDILSKQLTLDPIVVNLLSVL
                     AENNRLQLFSDVAKQFSVLNDAHHGVVEAHIVSAKPLDERILSRLNTAISGSNLVGRG
                     QHLKITNDIDVSILGGLIVEVGEKSVDLSVLNKVSKMNKVLGESV"
     gene            <728591..>729550
                     /gene="RML2"
                     /locus_tag="FOA43_002989"
                     /db_xref="GeneID:62196390"
     mRNA            <728591..>729550
                     /gene="RML2"
                     /locus_tag="FOA43_002989"
                     /product="mitochondrial 54S ribosomal protein rml2"
                     /transcript_id="XM_038923269.1"
                     /db_xref="GeneID:62196390"
     CDS             728591..729550
                     /gene="RML2"
                     /locus_tag="FOA43_002989"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG093422F3"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein rml2"
                     /protein_id="XP_038779197.1"
                     /db_xref="GeneID:62196390"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="PFAM:PF00181"
                     /db_xref="PFAM:PF03947"
                     /translation="MLTRRQLELSKEKVAMKKMKPTSPGLRWWRKPIYPYLWKGKPYR
                     ELTATRVSQSGRNNTGRITVRHRGGGHQRRLRLIDYKRIESGPQTVVRIEYDPNRTAH
                     IALVKHNETGKLSYIVACEGLRAGDEVESFRAGIPARLIKEMGGKIDPAILSVRISRK
                     GNCLPISMVPIGTIIHNIGERKNGAAKYCRAAGAYGRVVTKIPEKDKAVVQLQSGEQR
                     YISLEACATLGVTSNSAHHNESYGKAGRSRHRGIRPTVRGVAMNNCDHPMGGGRGKSK
                     SNKLSMSPWGVLAKGGYKTRRGKNVNRNKVKDRPRGKEARSGR"
     gene            <729779..>730396
                     /locus_tag="FOA43_002990"
                     /db_xref="GeneID:62196391"
     mRNA            <729779..>730396
                     /locus_tag="FOA43_002990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923270.1"
                     /db_xref="GeneID:62196391"
     CDS             729779..730396
                     /locus_tag="FOA43_002990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779198.1"
                     /db_xref="GeneID:62196391"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13417"
                     /translation="MTESTTPIGTIYLLINSPRSAIYPALIKYLGLNIAITDNRQPHF
                     SEAFPLHKCPAFESKDGWKLHETLAIMEYFISLKPQCKYNFWGNSPRQKAKVWQWLSF
                     TNTDCVASVARLVYGSSTPESITANQAVVERNLLEFDAQLCKTAYLTGSECTLADVFA
                     AFLFAPFIDKSFMKTFLLAHPITKKWLQNLFDNEKIVSPFLKDKI"
     gene            <730629..>733619
                     /gene="MIS1"
                     /locus_tag="FOA43_002991"
                     /db_xref="GeneID:62196392"
     mRNA            <730629..>733619
                     /gene="MIS1"
                     /locus_tag="FOA43_002991"
                     /product="mitochondrial C1- tetrahydrofolate synthase
                     precursor"
                     /transcript_id="XM_038923271.1"
                     /db_xref="GeneID:62196392"
     CDS             730629..733619
                     /gene="MIS1"
                     /locus_tag="FOA43_002991"
                     /codon_start=1
                     /product="mitochondrial C1- tetrahydrofolate synthase
                     precursor"
                     /protein_id="XP_038779199.1"
                     /db_xref="GeneID:62196392"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00763"
                     /db_xref="PFAM:PF01268"
                     /db_xref="PFAM:PF02882"
                     /translation="MLSAIKCIARQKKVLKIAKAISAVSLASLRPENCRSTHFTTLTH
                     SFSTSRCLNVAQVLSGKDVAKKIRVETQRQIVSFQKKFPGFSPVLAIIQVGSRPDSSA
                     YVRMKKKASANSGIECRIIKLSEDTDEATLLNLVDRLNNEESVHGILVQLPLPPQIDD
                     SKVTNSVVPEKDVDGFDRYNVGELAKRHGKPFMYPCTPYGCMRLLEETGVELAGKTAV
                     VVGRSDIVGSPVAALLQKADCTVTVCHSHTKNLPEIVSRADILVVAIGQTQLVQGSWI
                     KEGAIVIDVGMNYVPDSTKKSGHRAVGDVDYESAKQKASWITPVPGGVGPMTVAMLMN
                     NVYRAAKEQYESSIAPAICRPMKLNRILPVPSDIAISRAQQPKPITVIAEELGVKSGE
                     VEPYGSYKAKVSLKTLDRLQALRKNGYYVLVAGITPTPFGEGKSTTTIGLVQALGAHL
                     GIPAIANVRQPSQGPTFGVKGGAAGGGYSQVIPMDEFNMHLTGDIHAVGAANNLLAAA
                     IDARAFHESTQSDKSFYRRLVPKQKDGHREFTPSMLRRLTKLGINKTDPDDLTSEEVQ
                     RFARLDIDPDTITIKRVVDVNDRMLREITIGQSPTEKGFTRKTGFDITVASEIMAILA
                     LSRDLKDLRRRVGDIVVASSHQGEPITAEDIGAAGAITALLKDAIKPNLMQTLEGTPV
                     FVHAGPFANISIGASSVIADRMALKLVGAPKVTTERGGFVVTEAGFDFTMGGERFLNI
                     KCRASGLRPDVIVIVATVRALKLHGGAPNVKAGQPIPAEYNTENVELVRKGAATNLAK
                     QISNAKTYGSPVVVAINKFTTDTEAEIEAVRAEATLAGAFTTAVSNHWEQGGEGAIEL
                     AQSVIRATREKPVSHGQPVSYLYHLDSSLEEKIRAIATKMYGAKDIELSELARKQIER
                     YEKQGFGHLPVCIAKTQYSLSHDANLKGAPKGFTFPIREINISAGAGYLYALAGKIMT
                     IPGLPTHSGFMNVEVEDGKIEGLF"
     gene            <733760..>735274
                     /locus_tag="FOA43_002992"
                     /db_xref="GeneID:62196393"
     mRNA            <733760..>735274
                     /locus_tag="FOA43_002992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923272.1"
                     /db_xref="GeneID:62196393"
     CDS             733760..735274
                     /locus_tag="FOA43_002992"
                     /note="BUSCO:EOG09343WTE;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779200.1"
                     /db_xref="GeneID:62196393"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR036859"
                     /db_xref="PFAM:PF01302"
                     /translation="MESLMIGSLVRVQGGHEALLKYIGPVKNKQGTFAGVELQGELQD
                     RGKNSGDANGIRYFDTAVPMSGLFIPFWKLLQMNGVRESPERMNMSAPRSLRSPTPMR
                     MERDEEIEHLRDEIESLKVQNGEITNNMRLYEQKLAERSKILQELEATVSSFDPMLAE
                     YDRQLDIEEERFVKYKESTDNQIKELLDAIELMEQQEMYMRKMGGGGGAAAKAEAEEG
                     GRRGAEENIKDEKDEQIEQLKEKVQEKDKQINELRKIEMNNYKLEMKIEELEAEVKVK
                     GDDNEIIKELEEERSKKDEEIEKIKKNGQETIKKLENKVKKLEETVKLKSDQVESNEL
                     GVNETDERINELEKELTAKERMLSQRDEVLQQRGTMLLEKVRQIEDKDKLIRELETYK
                     EGLERQVDTGQRQTGETRQTGQRQTGQRQTGETRQTSRTRQTAQTPQTPQTPPTAQTR
                     QTRRLTTLVNTDGKLEVYRPESKADPTAGREKWCGLCERPGHESIDCPYDDGVF"
     gene            complement(<735310..>735735)
                     /locus_tag="FOA43_002993"
                     /db_xref="GeneID:62196394"
     mRNA            complement(<735310..>735735)
                     /locus_tag="FOA43_002993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923273.1"
                     /db_xref="GeneID:62196394"
     CDS             complement(735310..735735)
                     /locus_tag="FOA43_002993"
                     /note="BUSCO:EOG0934492Z"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779201.1"
                     /db_xref="GeneID:62196394"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF05047"
                     /translation="MAGINIIKQVSKARNGLGLFILPCKQITITYCNFGGSSQGMRDF
                     LRLKLTKFASQYPEVAFQVLDKPGFHPVIKGFYSNNQTKQICCRKLNADMIENKLKLI
                     INSSGRKLTKPKQKVISLNKSVRGIWSPFHVDPSERYKI"
     gene            <736416..>737678
                     /locus_tag="FOA43_002994"
                     /db_xref="GeneID:62196395"
     mRNA            <736416..>737678
                     /locus_tag="FOA43_002994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923274.1"
                     /db_xref="GeneID:62196395"
     CDS             736416..737678
                     /locus_tag="FOA43_002994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779202.1"
                     /db_xref="GeneID:62196395"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF16912"
                     /translation="MLTAAIRSTFLQAQPQLFPTLAICGKIASRQFSTTALRPMRGLL
                     YYGRKDVRYSEDAPEPMVKNDSDVKIKIAYCGICGTDLHEYLDGPIFFPKNGAKDKIS
                     GMKLPLVEGHELSGTVVEVGNGVKNVKVGDRVVVEASGHCSDKARYKGSVKQVKEYCN
                     SCKKGMPNICRDMNFLGLGVAPGGFGEYIVYGADHVLKVPSSIPIDVAALVEPISVAW
                     HAVENSNFKPGQTALVLGGGPIGLAAILALKGHKAGKIVCSEPAKLRRDFAEKLGAEV
                     FNPMEHKNINADLKALVPENEGFHASFDCSGVPATFATSIEALSSGGTAVNVAIWADK
                     PIQYRPMALSFEEKHATGSMGYLVKDFEDVLDAMDKGLIPIESARMLITGKVPLANTI
                     DVAYKNLIEHKESNVKILVSLTDEPTDI"
     gene            <737832..>738404
                     /locus_tag="FOA43_002995"
                     /db_xref="GeneID:62196396"
     mRNA            <737832..>738404
                     /locus_tag="FOA43_002995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923275.1"
                     /db_xref="GeneID:62196396"
     CDS             737832..738404
                     /locus_tag="FOA43_002995"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779203.1"
                     /db_xref="GeneID:62196396"
                     /db_xref="InterPro:IPR007523"
                     /db_xref="InterPro:IPR036748"
                     /db_xref="PFAM:PF04430"
                     /translation="MFAKLATERIFSRNVINRFSTSTSVYGVRVGNQFKGADVGHHLN
                     DYDLFATLDKPENNIEMISKDAVIFSNMKVIKSPNKKREPIGALLINNQILEVNLKKC
                     HFTNNDVVFHMDAELGELFRIIYPKPELLVLGLGKKTRLVSKETRQCFNKLGIRLETS
                     DTRYSALNYDMLATERTPMLVAALILPPNY"
     gene            complement(<739193..>740256)
                     /locus_tag="FOA43_002996"
                     /db_xref="GeneID:62196397"
     mRNA            complement(join(<739193..740046,740253..>740256))
                     /locus_tag="FOA43_002996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923276.1"
                     /db_xref="GeneID:62196397"
     CDS             complement(join(739193..740046,740253..740256))
                     /locus_tag="FOA43_002996"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779204.1"
                     /db_xref="GeneID:62196397"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="PFAM:PF06687"
                     /translation="MLGGFFYTIITELVLAAALVTLLLANLGSITTHKGITSIYLLEL
                     NLSELSIDTVFPSLSDIDSISDLGLDDAYVLGMYGYCQGTGGTTNSTTSDEVVYDTNF
                     TASSCTHAKPMYVFDPVTFLLDQVNDVAGTELTTSDVNLPSSIENYVKIAQNLSKATY
                     ITSCIAIGLNFIVLVLTLFIYCCNLGLVSSLGLVEVVAFLAAIIASGCSTGMYVFIET
                     HFNDKLSKYGIHAALSKNYLILTWVGTVLSAAAAVLLLANSCFRCCCGGRRRDNFEEE
                     EQFMPIEKL"
     gene            complement(<740343..>742931)
                     /locus_tag="FOA43_002997"
                     /db_xref="GeneID:62196398"
     mRNA            complement(<740343..>742931)
                     /locus_tag="FOA43_002997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923277.1"
                     /db_xref="GeneID:62196398"
     CDS             complement(740343..742931)
                     /locus_tag="FOA43_002997"
                     /note="BUSCO:EOG09340FK4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779205.1"
                     /db_xref="GeneID:62196398"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016298"
                     /db_xref="InterPro:IPR021130"
                     /db_xref="InterPro:IPR038019"
                     /db_xref="PFAM:PF00815"
                     /db_xref="PFAM:PF01502"
                     /db_xref="PFAM:PF01503"
                     /translation="MTFPILPYFSVDTAVCQKISLVGQVLIPFTPGTTKSEDITRYST
                     TAYYDVNLDYTAEIIDDKTIDQLLELFNKGVVKVFAPADVASQIQSKIPNARLVYKVK
                     SVSEAVSLTNDCANAVAITSPPATPEALRPLSGKQVFVYFLKSTLPEAVVPAWIKSGA
                     TIIVNSSSVTINYSAPATGKTPLIDYVIPALSTDRVDGLYTTVVTNTSDQVLGLVYSS
                     KKSIAEALRTKAGVYQSRKRGLWIKGATSGNTQELLRIERDCDGDCLKFIVRQVGEGF
                     CHVGTSSCFGNIKGFTSLESVLQDRLANAPVGSYTKRLFDDETLLDSKIREEADELID
                     AKSKQEIAFEAADVIYFVMARCAKNGVTLNDIQKNLDTKSLRVTRRRGDAKPKYLAET
                     QRKAAENARKAAAASAAAANIRVIGPNDRIILDRINTETASPERVTACLQRPIHTSKD
                     IMSLVVPIVERVKSEGDKALLDLTAKFDHVKLDSPIMRAPFPESAMKVTEDVKKAIDL
                     SFNNVRKFHEAQMKGTLNVETCPGVVCSRFARPIERVGCYVPGGTAVLPSTSLMLSVP
                     ALVAGCKDIIFASPPGKDGKLTPEVVYVAHKVGAKCIVLAGGAQAVASMAYGTESVPK
                     CDKIMGPGNQFVTAAKMYVSNDSGALCAIDMPAGPSEVLVIADKYADVDFVASDLLSQ
                     AEHGVDSQVLCIAVDMSKEQLDKLDDAVDEQAKKLPRVEIVRKCIAHSTTLQVKSYTK
                     ALDLANRYAPEHLILQIKDAQKWVDKVDNAGSVFVGAYSPESCGDYSSGTNHTLPTYG
                     YARMYSGVNTATFQKFITSQTLTPEGLKSIGKAVMDLAAVEGLDAHRNAVKIRMQKLG
                     YLPRHR"
     gene            complement(<743097..>745583)
                     /gene="RAD16"
                     /locus_tag="FOA43_002998"
                     /db_xref="GeneID:62196399"
     mRNA            complement(<743097..>745583)
                     /gene="RAD16"
                     /locus_tag="FOA43_002998"
                     /product="DNA repair protein rad16"
                     /transcript_id="XM_038923278.1"
                     /db_xref="GeneID:62196399"
     CDS             complement(743097..745583)
                     /gene="RAD16"
                     /locus_tag="FOA43_002998"
                     /note="BUSCO:EOG09340K9K"
                     /codon_start=1
                     /product="DNA repair protein rad16"
                     /protein_id="XP_038779206.1"
                     /db_xref="GeneID:62196399"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR038718"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MTQALADLSTGMISDSDSDSDIVLGGGGGGGFIKDDPDLKRRKR
                     RKKSKGSFRRRTRASTGNLKKVSYKEDENEVEVEVDGEDSDYTEDNEVIKEDSEIEYD
                     DDVVTEGQSESEPIILGDDIPLTRSKRAKKTEGGKPQKAKGAKQPQKAKRKPRKAKKK
                     AEPKKKVTFFERRTNRFYESHPELKDVFQVLEDTPPRRPERAVQSSGLTITMLPFQLE
                     GLHWMIAQEESTKYHGGILADEMGMGKTIEMISLMMHDRTKTPNLVVAPTVALLQWKS
                     EIENHAGGALKVYLFHGANRAKTLKELEGYDVIMTSYAVVESSYRKERYGFNRHGRKV
                     REKSLLHQKKFYRVVLDEAHNIKDRSSSTAHAADCLRCVKRWCLTGTPLQNRIGELYS
                     LIRFLDLEPFCYYFCTKCPCASKEWTFPDYRACAVCGHSPMSHMNFFNHFMLKNIQKY
                     GLEFEGKQAFHRLQLLLRQIMLRRTKVERAEDLGLPPKIVEIRRDFFNPEEKDLYQSL
                     YSNSKRQFDDYVAEGVVLNNYANIFTLITRMRQLADHPDLVLKRMKPGKLDSSVSEEL
                     IAGVVVCQLCDDEAEEPIESKCHHKFCRICISEYVDSFEGDQSQLKCPVCHIPLSIDL
                     EQPAIEMEPASTRKKSSIVNRINMLGQWKSSTKIEALMEELYKSRSDRETTKSIVFSQ
                     FTSMLDLVEWRLKRAGFQTVKLQGSMTPIQRQESIKYFLENPSVEVFLVSLKAGGVAL
                     NLVEANQVFIMDSWWNPAVDTGQAADRIHRIGQFRPIRIVKLVIEDSIESRIIELQEK
                     KANMVKATLDKDQAAASRLTPADMQFLFNN"
     gene            complement(<745835..>749437)
                     /locus_tag="FOA43_002999"
                     /db_xref="GeneID:62196400"
     mRNA            complement(<745835..>749437)
                     /locus_tag="FOA43_002999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923279.1"
                     /db_xref="GeneID:62196400"
     CDS             complement(745835..749437)
                     /locus_tag="FOA43_002999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779207.1"
                     /db_xref="GeneID:62196400"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="InterPro:IPR036546"
                     /db_xref="PFAM:PF05397"
                     /db_xref="PFAM:PF16987"
                     /translation="MNGNNFIPGSMDQTPLLFNQNIQLDQPVGQVSGTTGPNGANGGS
                     GGSGGSGNGVNGTNGGSGNGANGANGANGANGTNGANGANDEVNGNGIAVQDRHQFIN
                     IIVASIAKIQGTNFSEQKTRPVAQEYEKFAYTHSANKAQYVNFVKTKIASITQARKNA
                     LQRQQYGMVQGQGQGQVPGRGSGQATGQVTGQVTGQVTEQGQGQGQIPGQIPGQIPDQ
                     IPGQGQAFRQTAQRLKIEMQNMPIPAPLVQRLPQVFPKNISTWGQIMPYFRHRNLTTK
                     DLSTIKEVYALHLQLIKSKQRQVLQTQDQQGPQVPGQQNHQSQQVQQSQQSQQMQQMQ
                     QPQQPQPPQAQQTNPPSPQHILMMMQQQQQQPVQMAPQGQPNTQHAGMRPQITNQQLQ
                     AYKQQAFQVIKNLQAAGKLPSNLSREQESLYARKYLFHVLSAKQRAQNAHAQAPMAQN
                     QSGPQGPQVPQASQVPQVLQGSPQAQQGVPGVPGVPGVPGAQDQPGASQRLAQFRQQQ
                     QQRKRRQQQQDALQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     HLQQLQQPPQPPQQLQQPAQPPQPQQLPTNQNQRFAQNRIPYGQATVGQPVQAKNILT
                     PRLFNGVHATEEDWRHLKAIYQETIAAPINLKDVTGSLVDSEKQQIIRLMRQLQQLMV
                     ITETVIIPNFYMLTKSYDGTKKLIYSELMIKQVLEKLKTSGRFYANLDLLTKIQNQIT
                     RFLSYVKEQNSKILKMQQQQQTLQPQQQPQQQPQQQQQQQQQKQQAPQVLSQRQPVQP
                     GHIPQQQPGHPVVQQAALPMASRMGNRGLQQPQRLPIQAQGQGQARAQAQMSVQRPLG
                     EAQAGFQRMNPAAVSQQFQKLAEQRQQPQQRMVQSIVPPSTGTLPGTIQPQFSINGGS
                     SPLNVPTPPVMTPSLGISMTTPVTPATTTPRRGGRRKQSRSNPRGRGMVSPGQSVAPL
                     KTPTASNMSPILSSEAQALLKENSEHIATETASIARADKSRMARRKLAVADPAKYFLA
                     TLADTLNLFEEEQKVIQSVRGVSSTTNEKATTTRASNTMNGGNPTGKVLTPSAVLATP
                     LPFNVKTPISNKMYVTETSNGTPTNDKNSRWTGKVRSTCIAESFDGLIPSIPRETYRK
                     RLAGAELANLIYPTPPDDAPNKRRKATKTDKTEPMTTTASISDSLDQFWDFDQV"
     gene            complement(<749696..>750382)
                     /locus_tag="FOA43_003000"
                     /db_xref="GeneID:62196401"
     mRNA            complement(<749696..>750382)
                     /locus_tag="FOA43_003000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923280.1"
                     /db_xref="GeneID:62196401"
     CDS             complement(749696..750382)
                     /locus_tag="FOA43_003000"
                     /note="BUSCO:EOG093444RX;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779208.1"
                     /db_xref="GeneID:62196401"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="PFAM:PF01086"
                     /translation="MADKFPEINDVSVDGDEQMSGGDFLSREKEVLGDEFATAEDVTA
                     QDASATADKDDEFEEFKTQYPELGAGANGSDNEEDFKDSKDSNGSNGSNGYLNVTTRM
                     AKLNMESSEAVKQWKQQREESISKTDSINEKKVDEIKKEAQKATDEFYENYSNKKEEL
                     IESTKKEEEEFLKKRDSFLENGTVWERVVEVLKLSKNSNSIDEAHNRDKSRFKELLMM
                     LKDKEDSPGA"
     gene            <750561..>751727
                     /locus_tag="FOA43_003001"
                     /db_xref="GeneID:62196402"
     mRNA            <750561..>751727
                     /locus_tag="FOA43_003001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923281.1"
                     /db_xref="GeneID:62196402"
     CDS             750561..751727
                     /locus_tag="FOA43_003001"
                     /note="BUSCO:EOG09342P1M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779209.1"
                     /db_xref="GeneID:62196402"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="PFAM:PF04818"
                     /translation="MSFSVEKASEKLSNLDQTQQSIQSTSQWCLFHYRHHREIVALWL
                     KNLEELSKTKPERSLVCFYLCNDLVQFSKKNEHKFRGFLEEFVKVLPKSMKIMRSCIK
                     QEAKGDEVNEANLLKRYMRVLKVWEERSVFDRRFIERMMKVLSDDNRLINANEKVEKD
                     RRLDEIVGAGTSSSTTVPEEISALVKKYTSLEEFNEKNLNEFTKVNTIYNELVKNFEN
                     LPEPGKLIERLNGLNRMIKSLLGTIEESEKLRQEIIEEFHRLINVQGDWVELDKGKLD
                     KLREMREDVSKQKVEMEKLVEGGDKEEVSPMYEDEDMPGYRGEDGDPVDSGDPVDSVD
                     LVDSENPVVSENPVVSVDPVDPVDPRITKKVKFQETPSEQPLGGDLLSILNQLT"
     gene            <751805..>754467
                     /locus_tag="FOA43_003002"
                     /db_xref="GeneID:62196403"
     mRNA            join(<751805..751809,752010..>754467)
                     /locus_tag="FOA43_003002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923282.1"
                     /db_xref="GeneID:62196403"
     CDS             join(751805..751809,752010..754467)
                     /locus_tag="FOA43_003002"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779210.1"
                     /db_xref="GeneID:62196403"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="PFAM:PF08550"
                     /translation="MLAPPFLELSHSTIAMLQHQQNTNTTNNLDKTPVIDLDNVLTLW
                     TTLANSAEFIRNGRRLENISWRVVNRSLLLDQSFNYNEFSTLLNISTSDSTGNGQPLT
                     QRNLQRMERRRNQRQPTKNGIFYIKDSPSPDACSVEPSQLVNQKIKMNGQQRIQEMTD
                     RPSDLVHPSQRTSLFSRVHPPEEPLVANHTLKPKQGPSDDLQMRHLYQQQLKYNGGNP
                     HSPKSDTQQSQISLFATAKRPQAEKIMFSPSDDSSDGSDWSSMSDDSDFDVDNDEEGI
                     TDGRSRHHDGSLLFQKKEVGPSHLDSTPSTESLSSPQNGLRKSLLSGLFLNGKRANAP
                     ALSTPINQRQQRQIQQQRQQQPREQQQPQHLSSPKLLYSNGSPDSNHPTVRHVNSSDL
                     SNVPKRATASKITVTTIVSKFSPPNNPRDLLRRHASSSSVVPVAPVATVTSVASVAPV
                     APVAPISSVSPVTPAAHTKSAVSLAAFFFNNRRPHVPAHGDVSSHVAPNSAADLNLDS
                     GHYDRFHQSNAPPTATTLLPTALATHMFLPTMSLRQQARAKYGEPNWIRHRQERQRLL
                     HDREYSFDGNEDSEYSSSVRTNTSSIDIPGSVLRTHLRVPSEKHSLNDQSLPSQRRQP
                     RQASPHSERPMLGKCSSSSASRMSPKSTRIEMLSKELPLRLMDSINNENKLLFSKTSK
                     EEGRLLTRLKRVNNGNETVYDSDLDGRENAPVDKKTSNSDEKDERNKGEDNDDDCNAE
                     NESNIIADGIMGNKLKLFHVRERNRQNRVGSPLLFNEDGFVNDQLVTSVLEHTDGNHD
                     NNNNKMKNEWDDDNLNYHARGW"
     gene            complement(<754520..>755424)
                     /locus_tag="FOA43_003003"
                     /db_xref="GeneID:62196404"
     mRNA            complement(join(<754520..755293,755416..>755424))
                     /locus_tag="FOA43_003003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923283.1"
                     /db_xref="GeneID:62196404"
     CDS             complement(join(754520..755293,755416..755424))
                     /locus_tag="FOA43_003003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779211.1"
                     /db_xref="GeneID:62196404"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="InterPro:IPR030878"
                     /db_xref="InterPro:IPR036227"
                     /db_xref="PFAM:PF00828"
                     /translation="MTGPAPNSQVNDKRVGRGAGSGYGKTSGRGQKGQKARGSIPNWF
                     EGGQTPIYKIYPKRGFYRHQKLDLNEISLARIQSFYDSGRLLLDQGEILNMKKMKDCG
                     LITGTMKDGVTIIGTGSQNYHLDIQMEATKASKSAIKIIESQGGKFQSKFYSRYLGFR
                     AHHSPQWFIRNRGYLPLQAKPIARRDIKFYSDADRNGYLVDSDYVKQIHFGKAKQTKH
                     DTVATKSNLDKELEELSHSESKNCGRPGFSANRIISFKDLAL"
     gene            complement(<755475..>756185)
                     /locus_tag="FOA43_003004"
                     /db_xref="GeneID:62196405"
     mRNA            complement(<755475..>756185)
                     /locus_tag="FOA43_003004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923284.1"
                     /db_xref="GeneID:62196405"
     CDS             complement(755475..756185)
                     /locus_tag="FOA43_003004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779212.1"
                     /db_xref="GeneID:62196405"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MTLENNPLFQALNGKRGKKDDKNPLELALRVKRVSKASKTNNIG
                     RVSKANKTNKIGRVSKVKVSKVAKKVNPLALALGIETSKGRNKLPQEAEKDVKRIIGK
                     TRNGLVHQKQQKKPVNFIGASQTSFLRLRNLSPGVTESDIVEIMSKYGTVLKVMTVEG
                     FTREFGKSVTAELFFMSEDSMYSAQKALDGRMADSHRLRVEISHTPIVVIDPEIWKKV
                     VKEIKLIREERETLINVI"
     gene            <756436..>757095
                     /gene="RHO3"
                     /locus_tag="FOA43_003005"
                     /db_xref="GeneID:62196406"
     mRNA            <756436..>757095
                     /gene="RHO3"
                     /locus_tag="FOA43_003005"
                     /product="Rho GTPase"
                     /transcript_id="XM_038923285.1"
                     /db_xref="GeneID:62196406"
     CDS             756436..757095
                     /gene="RHO3"
                     /locus_tag="FOA43_003005"
                     /note="BUSCO:EOG09344974"
                     /codon_start=1
                     /product="Rho GTPase"
                     /protein_id="XP_038779213.1"
                     /db_xref="GeneID:62196406"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MVLCGGPPKSVQRKIVILGDGACGKTSLLNVFTRGYFPHVYEPT
                     VFENYIHDIFIDGQQVQLSLWDTAGQEEFDKLRSLSYNDTDCVILCFSVDTRDSLENV
                     KNKWVGEVLEHCEGVKMVLVALKADLRQSEEEESANSQVQQFGTSAYNSDGQLKKLVT
                     YEQGLAVAKQIGAVRYLECSAMKKRGVNEVFTEAARIAIASKPKNAAQEESSSHDCII
                     L"
     gene            complement(<757161..>757982)
                     /locus_tag="FOA43_003006"
                     /db_xref="GeneID:62196407"
     mRNA            complement(<757161..>757982)
                     /locus_tag="FOA43_003006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923286.1"
                     /db_xref="GeneID:62196407"
     CDS             complement(757161..757982)
                     /locus_tag="FOA43_003006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779214.1"
                     /db_xref="GeneID:62196407"
                     /translation="MLSQLEETHVAYTNATPTDIPNQTRDNPFIQQSKYRQGTLYLIT
                     LPTIAVIFIIFLLCTAYMKYRAKHQARQAPPFEDMCEAKSETSGIFDLEQATRATTLV
                     SKGTFETVEKIGLARSSMEIDGLQGEGSDGTKGSGTGSTTFYSLEEPNHAATQSTVSI
                     PNNKKHFHKKTLSSVILDEFISTGELPAEDPNDTSIQYDPDDTDINITNHSMFEQNCD
                     TSYNADLIRNHKPSSPVRKSRTRLYRSANNSVVFGSPGRLYTQESPTRSSGRYRQ"
     gene            <758376..>759341
                     /locus_tag="FOA43_003007"
                     /db_xref="GeneID:62196408"
     mRNA            <758376..>759341
                     /locus_tag="FOA43_003007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923287.1"
                     /db_xref="GeneID:62196408"
     CDS             758376..759341
                     /locus_tag="FOA43_003007"
                     /note="BUSCO:EOG09343D5O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779215.1"
                     /db_xref="GeneID:62196408"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="PFAM:PF06644"
                     /translation="MRYNYRSTLQLIKPFFSRRYAFPVNNRFIQSKADQQNEILAKYK
                     VKLEAKAKQEGLKNVEQLREKMRDKIENKKKQFSKVDPLRELENLERAEKLKAAIEGK
                     KGSKQDLGAMNPESSSKPFKTLDSFVKVENLKKLPANQISLIWRARFQMKDRSLCAAV
                     PADSFGRMYEHARKNPRFVLPLPRDDAQVEKGEQDEAHVPVEMHFVQWSFVGPNTAHV
                     MITSLTEYKLHNEYARPHTTVAFHSELKDSKHLVLMNGQVDKDAAVSLQDARLLLMNL
                     QRFYGGLGEESEISKERLNMVKLFNRGSGEFDVKRFIELAEMIEN"
     gene            <759639..>760508
                     /locus_tag="FOA43_003008"
                     /db_xref="GeneID:62196409"
     mRNA            <759639..>760508
                     /locus_tag="FOA43_003008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923288.1"
                     /db_xref="GeneID:62196409"
     CDS             759639..760508
                     /locus_tag="FOA43_003008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779216.1"
                     /db_xref="GeneID:62196409"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR008242"
                     /db_xref="PFAM:PF00800"
                     /translation="MPQPSISSCFKAISKHECDYSLIPFENSSNGPVVLSYDLFRDFF
                     VQHSHRDWQQFKGPDFEVIAEQFVSIHHNFISFGRDLGHVQRIYSHPQVWSQCNRFLE
                     QLEEQCDHKIEKIDVSSTSKAVSVLSMIKSRDQQGKSAAIASATASEIHGVPIQRTNI
                     EDVHDNTTRFLVLGNRGSGGMIHFTPRTDKKLSEKKMTLLTFIIKDNDNFGSLCNILQ
                     VFKQHNLNLQTISTRPSRISAWRYVFFVEVWYEEKPLSAALVELDTMVLDLAVIGTFY
                     RPNKFFDMVGKRG"
     gene            <761046..>761768
                     /locus_tag="FOA43_003009"
                     /db_xref="GeneID:62196410"
     mRNA            <761046..>761768
                     /locus_tag="FOA43_003009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923289.1"
                     /db_xref="GeneID:62196410"
     CDS             761046..761768
                     /locus_tag="FOA43_003009"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779217.1"
                     /db_xref="GeneID:62196410"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="InterPro:IPR034120"
                     /db_xref="InterPro:IPR035940"
                     /db_xref="PFAM:PF00188"
                     /translation="MKFSLVVLSSILTQLAIAAPVYVTDYVTHIVTVTVQPGQTQVLG
                     SAASVATSAASAASAASVAASVAAPAASTASGNAETTAYSATSVATSAASSATSSASS
                     SDSSFASEILAEHNAKRALHGVSDLTWDDTLASYAQDYADNYDCSGTLTHSGGSYGEN
                     LALGYSTTGSVDAWYSEGDDFDYTSCNVYDHFTQVIWKSSTKLGCGQKKCNDYWGTYI
                     ICSYDPAGNMVGDCPSNVLPLV"
     gene            <762241..>763314
                     /locus_tag="FOA43_003010"
                     /db_xref="GeneID:62196411"
     mRNA            <762241..>763314
                     /locus_tag="FOA43_003010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923290.1"
                     /db_xref="GeneID:62196411"
     CDS             762241..763314
                     /locus_tag="FOA43_003010"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779218.1"
                     /db_xref="GeneID:62196411"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR032098"
                     /db_xref="PFAM:PF01553"
                     /db_xref="PFAM:PF16076"
                     /translation="MAIIASQLIISALFYNYPARKEAMLQFTKLNFVTLLIHITNKVS
                     PTELIFTFNGDSSLLKDVVLKDKVSKKYSLHLDPHAIIIANHQIYSDWLFVWYLAYLN
                     NCADQIFIVMKKSLQRIPAIGFGMRNFSFIFLTRNWAADRDYMWLQFNKICHLGSKCW
                     VLIFPEGTNMSSGTIVTSNNFAKKIGSKPTKYVLLPRARGLYLSCKSLAKTTSTLYDL
                     TLGYSGHTSEQMAQDIYSLRNIYLLGKAPQTVSIHISAYNLQNDIPRVDFTGTATSPL
                     STEQEEHEIEQFNDWLAKLWYKKDQWMKHYYETGKFPDTDGREYRVQLKLRNRLEIFN
                     VYIIPALSVMFAYLIFSAVRLML"
     gene            complement(<763318..>765249)
                     /locus_tag="FOA43_003011"
                     /db_xref="GeneID:62196412"
     mRNA            complement(<763318..>765249)
                     /locus_tag="FOA43_003011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923291.1"
                     /db_xref="GeneID:62196412"
     CDS             complement(763318..765249)
                     /locus_tag="FOA43_003011"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779219.1"
                     /db_xref="GeneID:62196412"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR037191"
                     /db_xref="PFAM:PF02204"
                     /translation="MFHTPPTKQTWPVETAINNSYNSEGTEVVVDSANKTESEPSSIT
                     AANTQPTSPSILEDAFEMPEESSLPLELLKEYEAFLKYLKEPRFARPLATCEIADLFH
                     RFYRKFSAKAHSFVYDSGVKQPVELPEYDTPRDYACYIYNVLAERMVCDKFYSSIMFP
                     SKGISIDDYVRKLNDSLAVKLACLHSLNIKFSHLDIDLPEDEEKFFVDDIHKIILPIF
                     ELFSSERSPTLKAKYLYKIHITISTIIQHMETGKNPNFAMNTDIYLPVLIYTIIQLED
                     LRTHSLVSQLNFMKQFTDEYIYQLDDETYRDERGKLLYVLTNFEACISYLASVTLDDL
                     HIEPPGDETDQQVLDILTKPMVIENIEEETRKYKQAHSVPRSRSSSYFPSSFQQSTPL
                     SESIYHADQGLRNISRSVDASLKSIMGKVPWIAINSSSPKDGDTLDNALRQQLEENLA
                     FQESQKTLIEDHHISPISSSSISTGSNSLKHHSNLSLSSIGSKTGIPAITTAPSLPPE
                     RLLSRLTNSVGSAVKNFLPASASSSNISLGVQSESQQRSKVRSRAASLMSGSFFSGSP
                     QRISRSSSLQQIGNEGDKQGGGIFNTLENALETVKNRSRGNSVVEPPKQFNKTFEQMS
                     IEELKEMFEGYQSLTNKTI"
     gene            complement(<765361..>766500)
                     /locus_tag="FOA43_003012"
                     /db_xref="GeneID:62196413"
     mRNA            complement(<765361..>766500)
                     /locus_tag="FOA43_003012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923292.1"
                     /db_xref="GeneID:62196413"
     CDS             complement(765361..766500)
                     /locus_tag="FOA43_003012"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779220.1"
                     /db_xref="GeneID:62196413"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00155"
                     /translation="MVKQDTFTLEQFVDKYETVVDYNLGETCCYSMSLDEIEEISGEK
                     FDFGKLAETRLSYSYIKGSPELRRQISELYQGVTDDDIVITNGGIGGNFLTFYSLVGP
                     GDHVVVMSPIYQQLSSIPAMFGADVDILRLNFEDGFQPDLSKLRSLVKPNTKMIVLNN
                     PNNPTGCIMSNKVLKQIVDIAKINDSYVLCDEVYRPLFHSLNADETAPNSIVGLYDKG
                     ISTGSMSKTFSAAGTRLGWIVSKNKELIEACWIRRDYNMISVSMVDDMIARYVLRNKA
                     AVLKRNFKLCQDNLELMEQAVAKSNGKIEFVRPKAGTTAFVKINTTDGTSTMQLAVDL
                     ATSYRTLVVPGETFSYPGFLRIGFVNRPEDIVQGMKNLNSYLNNH"
     gene            complement(<766609..>767208)
                     /gene="MET14"
                     /locus_tag="FOA43_003013"
                     /db_xref="GeneID:62196414"
     mRNA            complement(<766609..>767208)
                     /gene="MET14"
                     /locus_tag="FOA43_003013"
                     /product="Adenylyl-sulfate kinase"
                     /transcript_id="XM_038923293.1"
                     /db_xref="GeneID:62196414"
     CDS             complement(766609..767208)
                     /gene="MET14"
                     /locus_tag="FOA43_003013"
                     /codon_start=1
                     /product="Adenylyl-sulfate kinase"
                     /protein_id="XP_038779221.1"
                     /db_xref="GeneID:62196414"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF01583"
                     /db_xref="PFAM:PF13671"
                     /translation="MATNITWHGNVTHEERVQITQKKGATIWLTGLSASGKSTVACAL
                     ETYLLKLGFPAYRLDGDNVRFGLNKDLGFSEKDRNENIRRISEVAKLFADGCIIALTS
                     FISPYKKDRDAARKLHQDAELPFVEVFVDVPIEVAEKRDPKGLYKKARQGIIKNFTGI
                     DDPYESPEHPEIHLHTDKQSVEECVETILDYLKNRKIIG"
     gene            complement(<767384..>769024)
                     /locus_tag="FOA43_003014"
                     /db_xref="GeneID:62196415"
     mRNA            complement(<767384..>769024)
                     /locus_tag="FOA43_003014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923294.1"
                     /db_xref="GeneID:62196415"
     CDS             complement(767384..769024)
                     /locus_tag="FOA43_003014"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779222.1"
                     /db_xref="GeneID:62196415"
                     /translation="MIRFNRYSRIVSTNLFGCKAAGWTIFQHRFNSQSSYKSIEETLE
                     KLPNLKKSESYFKVINDQLKRINALEHQKQKEEGDKLYDLSRNLISAMKENEQLDQDR
                     ELLLLSEIIEKFARYSFASASIAFKRLNEIDSEFSLKPESIGELIKYNPGRVKSSWEL
                     FNELVKNKPSDFLGSIVLEKLIHGDQIDIKEGATQINLDKAIKIYRILHNLEDRSLIR
                     EESKKKLAEDLISLNVAKALIPLGLSAEAVESIISSKKDTLKNSDYFYLYLSTRDCCT
                     DNHLPSKLLLELFLPISKLQLADDEAFGKDSSNLQQLQKLAPLEVKVQLTAAEITEQF
                     RDLIQEKGLDKPIRVKLDLIKSAGFHSKDLKKAIQYFEEFQTKVPATAPGTDYLKCIT
                     SLVFVYSAIDKNKDEFLNLAEALVPQSPKPMANNLASFVLHHSWFGDSEKAVAIYNKS
                     LDLYMRPKEETTNAKARGMLVQSLIIGALLGDQIGLARLIKLKSVENKLLEDEYDTRI
                     NQVLKNYGDLKERIKSDDSAIRAELKKIVLGAIEEMSP"
     gene            complement(769290..769362)
                     /locus_tag="FOA43_003015"
                     /db_xref="GeneID:62196416"
     tRNA            complement(769290..769362)
                     /locus_tag="FOA43_003015"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:62196416"
     gene            complement(<770025..>771161)
                     /locus_tag="FOA43_003016"
                     /db_xref="GeneID:62196417"
     mRNA            complement(join(<770025..771080,771135..>771161))
                     /locus_tag="FOA43_003016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923295.1"
                     /db_xref="GeneID:62196417"
     CDS             complement(join(770025..771080,771135..771161))
                     /locus_tag="FOA43_003016"
                     /note="BUSCO:EOG09343EUR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779223.1"
                     /db_xref="GeneID:62196417"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR022652"
                     /db_xref="InterPro:IPR022656"
                     /db_xref="InterPro:IPR037129"
                     /db_xref="PFAM:PF01286"
                     /db_xref="PFAM:PF05181"
                     /translation="MNFDRQKKIAENRAKALERIRDRQRRIKDAGRQVTSATTAENVV
                     ANPLTAAQRAIIERNTLNAQERRNKNNKKGPVMESGGDKPDILDEVRFSHHQQAKHIE
                     ALPRKPGQYIRPSIRKSDYIEYDFSTMKDTFGGFLSDDKGNSSIEAEEKTLEDWKKQQ
                     EEKDALNPLGPAPPPLDIANAPTCFECGSIDVDKKLLEVFKCRVCRKCEEKFPEKYSL
                     LTKTECKEDYFLTEPELADTDLFRRIVKENPHSGTFSRMQLFLRYQIEEYAFKKWGGV
                     DNLDKEWLKREGMRKNRREKKFNTKLNQMRRKLRAQEITRKIRGDKGVRHQHDWSAPV
                     KVGGDDPHLYKRRCMECGMEVEEIIM"
     gene            <771340..>772950
                     /locus_tag="FOA43_003017"
                     /db_xref="GeneID:62196418"
     mRNA            <771340..>772950
                     /locus_tag="FOA43_003017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923296.1"
                     /db_xref="GeneID:62196418"
     CDS             771340..772950
                     /locus_tag="FOA43_003017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779224.1"
                     /db_xref="GeneID:62196418"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF12894"
                     /translation="MDRPSTPTGSASQSNPLLTSPTSSRRTKKKVIYSDRYIPSRTGV
                     DLQAAFTLNHDSPSSNLAAHTSMMMSSSSYAADLEVADSELDSLKIQEANRNFDAVLK
                     SELFGDRPQSIPSQQATPPGSMGSIGSMNSAASIVSMTPDSVTNSSPSRDTASSIPVP
                     RTPRQNRNMFTYQSPSKSRPSSSSLTVNNELYSLSPVGASSERILLSPQRKPRAIPKV
                     PYRVLDAPELADDFYLNLVDWGSQDILAVGLGSSVYLWDASTGSVNRLCDLGPSDSVT
                     SLSWIGAGTHLAVGTNSGIVEIWDASACKCTRTMTGHASRASSLAWNRHILTSGSRDR
                     TILHRDVREPAHYMKRLEYHKQEVCGLRWNVEENKLASGGNDNKLFVWDGVEDRPLYK
                     FTEHQAAVKAIAWSPHQRGILASGGGTADRRIKIWNTVTGLKVHDVDTGSQVCNLAWS
                     KTSNELVSTHGYSRNQIVIWKYSTMQQIASLTGHTYRVLYLAMSPDGQTIVTGAGDET
                     LRFWNVFEKNKNEHNTSSVLLDSFMQLR"
     gene            <773069..>775438
                     /locus_tag="FOA43_003018"
                     /db_xref="GeneID:62196419"
     mRNA            <773069..>775438
                     /locus_tag="FOA43_003018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923297.1"
                     /db_xref="GeneID:62196419"
     CDS             773069..775438
                     /locus_tag="FOA43_003018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779225.1"
                     /db_xref="GeneID:62196419"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="PFAM:PF12862"
                     /translation="MSRKPIFTPILASSKVPILVLITGYCHKKFPSRSIPPILSTLVE
                     LIEGGKEANSTTDEDIVSVFFPSLNKILDKIERAIVEFVSSDESREQNEAHKDTLQVQ
                     NYVLRKLWSIEDIDSFYSFLKESQNLLVGKVPKKSSTKRLYSSSFLGKFVSNISVAAN
                     ILGFEETIKLWTAFCDYRQESYERWTIQARCEHIHFKSKQSEHDLLVEEQITENLDIP
                     AADPAPGGVEVYSQVDLAQLLEFQVHKLQIYAGKVPNSLKMILLSMSESQRSIVPSSY
                     YIDYLEYWKSGDYEGSFNALHRYFDYMMSNKQQLFYHYALLSLATLHASFGSDDEALR
                     AIDEAILVARENKDLDCLNYLLTWLFDFLKSRPELSNKLTSQPGREQILQFLKLKTKE
                     NKNQVLQSMAYQYEAIKQMLEGFPLRKVLNNLTRAFYILLNLDSSLNTKLSFARACQL
                     AVTAWSRVGIPSMTRLYINAALESAGSDISIFDEVELSLRRANLMYQSGETEAAFKLL
                     ESYEPQVSGEAALMKSWQTRYMILKVDYWLKKCRYNQASILLDKLRCQTCEIQEHELK
                     CEVNYQLACFQEKVGNATEAIQIISRELSHLKEHEYSYNNFWAIQFQILYAQVVKEHS
                     SSPERALSVLLSSLKTAHKSSLLVLIVRATLLLCELLLKIDPINSAGDVNEILRNGMP
                     NILMIDNLWLSSQAYYLLAKVATMVPVDNHQADQQQMRATLDQTMSYLQISLEGFSKL
                     HDFKWIKKTLQIQQSLSELMRDSELSHSCQMAMSKLDQQIQMEMAYDSC"
     gene            complement(<775474..>780165)
                     /locus_tag="FOA43_003019"
                     /db_xref="GeneID:62196420"
     mRNA            complement(<775474..>780165)
                     /locus_tag="FOA43_003019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923298.1"
                     /db_xref="GeneID:62196420"
     CDS             complement(775474..780165)
                     /locus_tag="FOA43_003019"
                     /note="BUSCO:EOG0934023S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779226.1"
                     /db_xref="GeneID:62196420"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="PFAM:PF00136"
                     /db_xref="PFAM:PF14260"
                     /translation="MSTSFASSSFDISSIDSSQLKIQIIAYDSYQCLPSSLDKTQFSL
                     NGICDKTTTTFPHVPIIRVFGKLPTGHTCLLHIHNVFPYIYIPFTGSSPKNTDDLNKQ
                     LIRFKDEIEWRLSSSYRRDDTEAAEKGQNRQNRPPTASSGCFLADLSIVKGVPFYNYA
                     VGFTPFIKISLLSSRYVARLSRLLSDGVIFSRKIQPFESHIPYTFQFLLDYNCYSCSW
                     LSLSKFYWRYPLIQLKNREDYQTYFDTDFCRFNKAKINGDLIKFISAYMNTLVRPNYV
                     NVLDPEEFPRMGRSLLELDTSASWIINRNELQERVIHDRLIETPSSLTAEKYINSTRA
                     LLSDVKFQRRQRNLPNDPKLKLFDNTQERAFSGEKWVEIDELKDLLQYCSKLSEDSFY
                     GHHGRDKKLDAESVVSQYPWLYDYPTSFKSVDKLQYEPNTLTLDLMKASSSLTAANFL
                     SQDGFVGSRPSQPFQLSQLGENILDSVIVDDLEGDPEGDPEDPADPEDPEDPEASHTH
                     MDAEEGKDISINDMNTSLYQALEEDKLVDAEDTDLHIFEETQTQKGHIDSSFHQMLPP
                     FSQISIGPSQGFNIYSLFNDMEHQENLFVPKTEAPRYNTNDDFMNSFDNDYGMLKINY
                     TGPFFSKRDNYDSTPFYFAGKKFQLDCLDIQGLPPYESVGTITSNEVSFDTRYNIQSI
                     WSYSKHPPQYKDIEHWCLNKSSDVKSQLLDSEIEPVTQKLQAYKYSSAETPVERKNTN
                     YSKLVMLTIEIHVNTRENLEPDPDKDSVAAIFWHFDRDNSLNPLNIEDLGVFVVDDTT
                     NIAWDHLIGIPVSSFEDEESMIAGLVGLVELVDPDILGGYEIHSSSWGYIIERFKKVY
                     DVDLPVRFSRVACKHNNKAADSWGYRHASGIRITGRHMLNFWRTLRGELRLGNYSLEN
                     AVFQVLHRRIPHFSPKVLTKWYCDDKKGLLSCALSYYVERLRLEVRLVEQLEIIEKVI
                     EQSRLLGIDFNSIIYRGSQFKVESLLVRLAKAEDYILVSPSRKQVFNQDPLQCIPLIL
                     EPESALYKSPLVVLDFQSLYPSVLIAYNYCFSTLLGRLRGFNPKRNQKLGVITQKLPE
                     GLLKCLQESVTLSPNGLMFTKPSVRKSLMAKMLTEILDARILVKDTMRQLRDDRELNK
                     LYNNRQLALKMIANVTYGYASATFSGRMPHSALADAIVSSGRETLLRAISEIEGNPKW
                     GAKVVYGDTDSLFIYLPGKTRKDAFKLGKEMAAHITDINPAPIKLKFEKVYHPCILVS
                     KKRYIGWKYEYEEQETPDFDAKGIETVRRDGIPAQQKIVEKAINILFETMDVSKVKSY
                     VLDQFTKIIRNKVNLKDFLFAKEVRVGTYKNEAYIPPGARVSMEKMAKDHRAEPQYKE
                     RVFYVVKKGNNDQPLRERCMSPSDFLNDETAELDTEYYINKVLIPPLERIFNLAGIDV
                     RRWYNEMPKYISYGDVELRNLNVRTTSCICCNDPVNRTNDLLCDQCNKNKAQTMLELK
                     SRLKFQESHLRDICTICDACTRRTVNSNSIRPSEYLACDSKDCSVFFDRQKAFRQVHS
                     SRNQFSQLPDW"
     gene            <780298..>780891
                     /locus_tag="FOA43_003020"
                     /db_xref="GeneID:62196421"
     mRNA            <780298..>780891
                     /locus_tag="FOA43_003020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923299.1"
                     /db_xref="GeneID:62196421"
     CDS             780298..780891
                     /locus_tag="FOA43_003020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779227.1"
                     /db_xref="GeneID:62196421"
                     /translation="MQTQTKATVLIRFKESRKELTEKGVILEEDKDKDETIWTTDKVE
                     EIRQVLAEVEDKEGELKVRFDFTELCERLNIDKTSIYRKLVELYHDRRTIKEENQAAE
                     EDVVVVADPRPLIKPKMQQSFLQRLQGLKLGSSSSVTKIPIVGEEDTDSSEVDDSSTS
                     VINIASASMYLHRSQLLGKAGSKRTTESNESLDPLLE"
     gene            <781028..>781861
                     /locus_tag="FOA43_003021"
                     /db_xref="GeneID:62196422"
     mRNA            <781028..>781861
                     /locus_tag="FOA43_003021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923300.1"
                     /db_xref="GeneID:62196422"
     CDS             781028..781861
                     /locus_tag="FOA43_003021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779228.1"
                     /db_xref="GeneID:62196422"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="PFAM:PF09510"
                     /translation="MSLRKSLYTHYNRNSSSTTSFLNYVDQGTGEKHWVRDWYDPPKV
                     SKETNLLPKQQGGLMTRHTSGLITPMESTPQPQSSVSVSQSQTPQPVETYGFKVKTWV
                     ITDELVDRKDCQDDETDTFIPLSAHKYMAEDTTVKQSTGGESGLTEAEMKSAVGGPGV
                     SNSLFSSSAAQEFKQNGESSVAVAATLDASATPAVAATSDASATPAVPAISDASATAA
                     SATAASATPASVTPASATPASATPASATPASATPASATPAVASSVNVTEKDIDGDVDM
                     H"
     gene            complement(<781917..>783158)
                     /locus_tag="FOA43_003022"
                     /db_xref="GeneID:62196423"
     mRNA            complement(<781917..>783158)
                     /locus_tag="FOA43_003022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923301.1"
                     /db_xref="GeneID:62196423"
     CDS             complement(781917..783158)
                     /locus_tag="FOA43_003022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779229.1"
                     /db_xref="GeneID:62196423"
                     /db_xref="InterPro:IPR028012"
                     /db_xref="PFAM:PF14616"
                     /translation="MQTPETELTSTATDLDFYEPADIFGTNTILIPEIGSVFKQLADM
                     NHSYNLYNTPLQQQHPSENEQEQDSNFESQGSPPPEPIAPPHITEGDMAQIEEAIFAE
                     IQPEPNYIATSGSGQIQGLYENQSSEQFEQSNIIRQMNLISPITPLAAATQVNEMNQM
                     AQIGTMVQSTLSPSDTKQENIQKESYKRRNVSQKKRIQVKESKRSKKSNKDFAATQYT
                     FLGILPEKPVTPYNQLPYYRRANGLEYRNFSLLNGPQSLAIYERNKKFRTNLYEPAVN
                     KKFTALPGQAIKSSNQGNFALCPYCELTTDNVANDCEKMYYKRNDSNYLHHMIQYHGI
                     FSNGELVKDPEIRGWALTPTDKSPVEVVRCPYCEEFVNLKKFKRDNRNEHRLLKYLRH
                     VKEKHKTGKNLEIMQRQRFDK"
     gene            <783825..>784814
                     /gene="RFC3"
                     /locus_tag="FOA43_003023"
                     /db_xref="GeneID:62196424"
     mRNA            <783825..>784814
                     /gene="RFC3"
                     /locus_tag="FOA43_003023"
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C)"
                     /transcript_id="XM_038923302.1"
                     /db_xref="GeneID:62196424"
     CDS             783825..784814
                     /gene="RFC3"
                     /locus_tag="FOA43_003023"
                     /codon_start=1
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C)"
                     /protein_id="XP_038779230.1"
                     /db_xref="GeneID:62196424"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF08542"
                     /db_xref="PFAM:PF13177"
                     /translation="MTNSLHENLPWVEKYRPQNLDQVYGQQEVVQTIRKLAKDGRIPH
                     MLFYGPPGSGKTSTVIALAREIYGKNYKNMVLELNASDDRGIDVVRDRIKSFASTRQI
                     FSSGFKLIILDEADAMTSTAQNALRRIIEKYTKNTRFCILANYAHKMNPALMSRCTRF
                     RFAPLADSAVGKGIHVVVKEEKLNLPEETEKCLIPLSRGDMRKAFNVLQACAAALDEE
                     GDPITIDMIYECVGAAKPKSIETVLDAIMKNDWTDAYGTMDKVRKAEGLALIDLIEGF
                     VEVLDKYQLKPSTRTSILEGLGDIEYGISKGGSDKIQSTAVIGCIKSSLENEQ"
     gene            <784965..>785656
                     /locus_tag="FOA43_003024"
                     /db_xref="GeneID:62196425"
     mRNA            join(<784965..784969,785002..>785656)
                     /locus_tag="FOA43_003024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923303.1"
                     /db_xref="GeneID:62196425"
     CDS             join(784965..784969,785002..785656)
                     /locus_tag="FOA43_003024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779231.1"
                     /db_xref="GeneID:62196425"
                     /translation="MQQVLDLDLNNYLKVKGKLIDLISMARTNELDSISEPELEGIQK
                     ELNFISFRSKLNAKMDALMCVRLVQEYEQFDEVTSTKFMKQIDEQVILGKEIGKNVQR
                     AEELLLRRRELSDIVADYMKKSGVIRLKKKEIEELFGDEVDSNSVIKGGRLLSKKSDE
                     YEFQIEKRASFKQSCKELQESIDEKINRCEMMKNDIEQVKDSWKTLGEKLLRVVEILK
                     N"
     gene            complement(<785698..>786591)
                     /locus_tag="FOA43_003025"
                     /db_xref="GeneID:62196426"
     mRNA            complement(<785698..>786591)
                     /locus_tag="FOA43_003025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923304.1"
                     /db_xref="GeneID:62196426"
     CDS             complement(785698..786591)
                     /locus_tag="FOA43_003025"
                     /note="BUSCO:EOG09343NCK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779232.1"
                     /db_xref="GeneID:62196426"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="InterPro:IPR038340"
                     /db_xref="PFAM:PF06984"
                     /translation="MFKQLAKFSTSARSLARSRKQYRISPHIKLRPPIVPSIDNIEIK
                     EDHALWQFFEDKSFVRTPEQITFTGRAWTVQELRRKSFEDLHSLWYVCLKERNKLYRE
                     SHVYDQIESLRSQEFEGLSEQIRQTMIHIRQVITEREMAVRNAQAEFEVIGDEYLDEF
                     KDNYLKEENVETDEWYNKLERLQYAIFGIPDVLDTSLIVDVKFLEGVRYIGQLKYEKF
                     ASSIGREDIGKLRDIAEIYTVFEESATADGVKEACQKIDEYRESELVIPGSKEIQVVQ
                     GFIDDKIKQAESDLTEEEIKE"
     gene            <786859..>787272
                     /locus_tag="FOA43_003026"
                     /db_xref="GeneID:62196427"
     mRNA            <786859..>787272
                     /locus_tag="FOA43_003026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923305.1"
                     /db_xref="GeneID:62196427"
     CDS             786859..787272
                     /locus_tag="FOA43_003026"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779233.1"
                     /db_xref="GeneID:62196427"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="PFAM:PF00472"
                     /translation="MPPRPKVAESEIHEKFIKGGSGNGGQKINKTNSKVQLTHIPTGM
                     VVTSQATRSRDQNRKIAREILAMKLDEIENGSHSRAQLLLARKQMVKRRAKRKTKAKY
                     KKLDEKKAEENTEKRKQNEPSDRIKDEDEEIIVVK"
     gene            complement(<787309..>789105)
                     /locus_tag="FOA43_003027"
                     /db_xref="GeneID:62196428"
     mRNA            complement(<787309..>789105)
                     /locus_tag="FOA43_003027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923306.1"
                     /db_xref="GeneID:62196428"
     CDS             complement(787309..789105)
                     /locus_tag="FOA43_003027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779234.1"
                     /db_xref="GeneID:62196428"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="PFAM:PF09197"
                     /translation="MSASEVPIRDRLFVGQDDQPYDFYLCPPLDTNNDLIQMVVEHGG
                     SVVDDLSLECIVISSEGYDVPENLKDAHIYSYKAIEDSVANGIQMDFAHYLIHAPPPE
                     PDFQQQEITAAEPQVEPKQNGSNNDNNDDEVNPFLDIDPEYPTEVPNSDPPPIGAESG
                     LSADLPTVQQSKATAVFPKHHGVKYFTPEEDAFLLEEIRKRPWLGFKGHQIYKEICEL
                     SFFQKRERTSASLRERIRTLKYHVGYVYSADKDHKLLVDEDGKYVRSFLIKACVQPFT
                     AADDFGLCKVVYGKLSPKPNSTGFETVYFPTNFFDKYGAMFPQHSPESWRQRFKNYLA
                     IFGVANYLKYFIMEKQQGNDPLPSNSANRDWIKARRSLRKTDGPRLYFPNIPDEDQFI
                     DDNIDTILVPELEGKNLDVFTPMAWTENKEDGNEAPPSKRQRVSNSTEPTAPESITRF
                     VDTPTTYFREATFAKFYEKEGEPIDLDEVIPRKDSFLTDVANALKLEELTASNMLKAL
                     NKVGVKKYYAMFLIYRCGSKEWLVQKSIKRYVETNGQELLCISPGAWSNKAIDWLELK
                     NKHLNDLLKAYHGEEDFNIQVAAFKKSHSINL"
     gene            <789328..>792013
                     /locus_tag="FOA43_003028"
                     /db_xref="GeneID:62196429"
     mRNA            join(<789328..790756,790866..>792013)
                     /locus_tag="FOA43_003028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923307.1"
                     /db_xref="GeneID:62196429"
     CDS             join(789328..790756,790866..792013)
                     /locus_tag="FOA43_003028"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779235.1"
                     /db_xref="GeneID:62196429"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR024528"
                     /db_xref="PFAM:PF06738"
                     /db_xref="PFAM:PF12821"
                     /translation="MVKARSLSPAERNRHNINRINSGSNGIQEKKSRSGSRGRSHDRN
                     QGSSRTEILGDSSSEDNLLMTTHSPSWQRDFIRDKSPRRRGEYSSLIGGSRSRDLTPA
                     RSARSAVISGRPITIAEGEELDQSEPLILPVFSASSTNLRVPDESQANVVPYPAEEID
                     TYALPDGQRQRIHEEIEDDFDKEFDRDISSNLGNRVPHKASIRRKIGVDDNETDDENS
                     ASSQGSLLDATISNNGGDPFTETYQLEDLQPHESSQEDSSHPKPRNFVDLENQKKNSN
                     LADQQPMKEAKDLVDQYIGRGRSRYRDGSHSLLVSEPGDESVPEDGITGLPRKVRSGV
                     TSNLMRLNEPDDDYEDYSGSEFSEPIANKHDKSHSHQLHHPFNKIKPFSSSTSSLQPI
                     FSKKNHRKVKSSFDMPSFSRTPSTFDHNGQRSHSADRMAKMFDLRHRFKRKLGRDTRA
                     RITVHIADILQRQRFLLTLCKAFMGYDPSTKTSDVKVVRVSQGFNLAKLDDAHEIYKS
                     VVHDRMGVEEASQKLDQLLNIKSPFNRFWLIVFYGLSSSFIIIWFDGSFRDMAPSFVM
                     GCIVGFFQLVIAPTSSLYSSVFEVASSILLSFIGRAIGSINHGKLFCFSAIVQSGLAM
                     ILPGYTILSGALEIQSRSIVSGTVRMFYAIIFSMFLGFGMTLGSALYGWMDKNAIDTT
                     TCNAGSVLHPAWNFLFIPAFTVFATLGVEARFSQLPVMVIIACGGYAVDYFSAKHFGI
                     TQFSAALGAFTVGLLSNLYSRFGMPFRRLGYCSSAFTSMYPGIIDLVPGSIASRNVLA
                     AGLNQLKSVQANTTTSILDSSTLTFGITMIEVSIGISVGLFLSAIFVYPFGKERTGIF
                     SL"
     gene            complement(792090..792162)
                     /locus_tag="FOA43_003029"
                     /db_xref="GeneID:62196430"
     tRNA            complement(792090..792162)
                     /locus_tag="FOA43_003029"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:62196430"
     gene            <794422..>795834
                     /locus_tag="FOA43_003030"
                     /db_xref="GeneID:62196431"
     mRNA            <794422..>795834
                     /locus_tag="FOA43_003030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923308.1"
                     /db_xref="GeneID:62196431"
     CDS             794422..795834
                     /locus_tag="FOA43_003030"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779236.1"
                     /db_xref="GeneID:62196431"
                     /translation="MDQSGKLPRKNDSKDKADERNRPSEDLGGSNDYQQIEESPNMNV
                     SYNTSTSKIYPKQTDSNSLHSPIEGHPANENLMNDEYDEAMSILTEGQLGWESEPALD
                     SNLQASVSTVGGIDFSTNSPEFVPYANPRAHDSITYQESSNIKRRRQKQAQGELAYVA
                     SDTSIVYGRNGELSLDKNSSPPTAYSRFPAFTVQSESDLRGLQEERVGNTVKNATIAT
                     HTEQDKNNFAKLPSLVRGASLGRSMKAPLTPHLGPGFKYIRCQIELINAEENCICFPP
                     WTPREQDDMRRIVCIIRKQTKNKVQGIFEIVPPESQQSSEECIEVSCLRCLSSKRYPS
                     YDNEHIICQFEEEESKLDNCYYITSVEVVKIVKFLANLPHHLSKREERKESGRIRSNL
                     TAFWLEKPINSIKLEDGVRSGKTNADFKNELAGRIIGYQTRKPRDFDRYVRILEWRTL
                     SFALRRAMRSYYVEVKEETQ"
     gene            complement(<796423..>797607)
                     /locus_tag="FOA43_003031"
                     /db_xref="GeneID:62196432"
     mRNA            complement(<796423..>797607)
                     /locus_tag="FOA43_003031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923309.1"
                     /db_xref="GeneID:62196432"
     CDS             complement(796423..797607)
                     /locus_tag="FOA43_003031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779237.1"
                     /db_xref="GeneID:62196432"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSRKYISTAIIGDAHKSDILGVSVTKGFTITCSSDGYLKFWEND
                     TSDKKLSLEQFVDKLGLHHVTAFEDTIQSQKVLLVCTVSFSGKCYLYSYERESSQLTS
                     LVEALPEELTNSKISYWACKLTKDELGELNILALTTVTGHTEVFRILFGHDGDDNGEF
                     KTSEVSQDALLPSFQYRGTAYANDANFATCLDVNVGQKRLAVGHQNGGIYLYDLEYLK
                     LLYSFESFGLKSNLSSSQLSTTRCVRFSPGGSLLAVARDSGPYGTVTLYDVKYGETVG
                     SLTMPTHSASVGIGSYAHGKWCLSVSFNDDGTLIATGGLDNQIRVWNVETKESEAVLT
                     INRTDISDEELKNSNELDKATCCSLSFIDKGANVAEGNNDGLVIVGFDRAIRWFREAG
                     GV"
     gene            <797804..>798802
                     /locus_tag="FOA43_003032"
                     /db_xref="GeneID:62196433"
     mRNA            <797804..>798802
                     /locus_tag="FOA43_003032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923310.1"
                     /db_xref="GeneID:62196433"
     CDS             797804..798802
                     /locus_tag="FOA43_003032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779238.1"
                     /db_xref="GeneID:62196433"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="PFAM:PF00787"
                     /translation="MITVNISSATKAEDHYAYNIVVTVTKASGNIFFKASRRYSDFDR
                     LRKSIEEQTKKKLPYNLPSKLSNLFKRTSNAIDRRRIELSEFSRQLLNDSKYQTNISV
                     LEFFNIPKTTFMKLDNEVSEKRQDRVMNLDGNGTIESSGKWIESLKDVKSVLQNVRTK
                     MYTSNANIVDIKSLLKICQHRVVSLETYLKSDTEIGAGEYDRRRDMLRNIRLEYEELD
                     SSATSFISQRPLDETIKEKGSIFRSHRTLGQPRETEVTKSLDNKQLYQGQQIQMVKQD
                     EQLERLHGTIQRQKQLGMAIHEELDVQNEILKDLNHQVDKSSDKMQHARRNIAKII"
     gene            complement(<798853..>800697)
                     /locus_tag="FOA43_003033"
                     /db_xref="GeneID:62196434"
     mRNA            complement(<798853..>800697)
                     /locus_tag="FOA43_003033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923311.1"
                     /db_xref="GeneID:62196434"
     CDS             complement(798853..800697)
                     /locus_tag="FOA43_003033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779239.1"
                     /db_xref="GeneID:62196434"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR010107"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00282"
                     /translation="MPPSQHIDADSLENSIFQNAGKYQPLIGKYLNAGKAFHRLRRQS
                     QPDSKLVARFSGVENKYKLPETSMDASLAYQMVHSDLTLDGNTTLNLASFVNVHVDDY
                     AQKLIDENLTKNLADNDEYPVLIDMQDRCVSTLADMWHAPVEDQAPGRTLSPKTRAIG
                     TACTGSSEAVMLGGLAMKKNWQAHRKAEGKDISNPNILMASCCQVALEKFARYFDVEA
                     RIVPVSSSDYLIDYNKIRSRLDENTIGVFVIMGSTYTGGFENVSLVNQILDDYEEETG
                     NYVPIHVDGASGGMIAAIMYPELEWDFRVPRVMSINTSGHKFGLVTAGLGWVVFRTKE
                     WLPNALKFQLQYLGGLEESFSLNFSRPGFQVIHQYYNFLHLGRQGYNVIFDNCLTNAR
                     ILSCFLEETGYFKCISNLHLPFGQTVHGGNVSPTPINHHEYLSNHKDFNPALPVVSFQ
                     LSEEFVRKYPEIPQIMISQMLRSKKWIVPNYGLPSTKVPPKDGKEQEATADDDDDDDD
                     DDGDDGKNNEILRVVVKFDLEGELLDKLMHDIVDVVEVLSESVEMVRNNVKHMREIKA
                     DSAEIGSGMIYNMLISLANDADRRLVKLRKRIADEHEDHLHTSYRGTC"
     gene            complement(<801176..>802993)
                     /locus_tag="FOA43_003034"
                     /db_xref="GeneID:62196435"
     mRNA            complement(<801176..>802993)
                     /locus_tag="FOA43_003034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923312.1"
                     /db_xref="GeneID:62196435"
     CDS             complement(801176..802993)
                     /locus_tag="FOA43_003034"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779240.1"
                     /db_xref="GeneID:62196435"
                     /db_xref="InterPro:IPR006003"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="PFAM:PF00370"
                     /db_xref="PFAM:PF02782"
                     /translation="MTVPVYYVGVDVGTGSARAALVDQKGAILGLAEKPISLGELKEN
                     YITQSSTEIWDAICYCVKATIAESKVDPSSILGIGIDATCSLVSIKESDDSPMGVGPD
                     FTDNLQNIILWMDHRAEEEVAMINQTGDVSLKYVGGGFSIEMEIVKMTWLKNHMPKGA
                     DGESTFSDCKFYDLGDYLTHKATGEETRSFCSCVCKQGMVPQGISSDRNGWSKEFLSR
                     IGVPELAEDNFRRLGGLPGVTGKYTTTGETVGPLTAAAAKELGLTTKCYVGSGVIDAY
                     AGWIGTVACNTEVPIPSLQLQDQNKEGIAKANGRLAAIAGTSTCHICLDEKAIFVPGV
                     WGPYRDVIGKGFWCAEGGQSCTGALLAHVLTSHPAYNKLVEAAKNAGVSKFDYLNRRL
                     QELKGARGERSIISLGKNLFFYGDFHGNRSPIADPHMKASIIGQSMDVSLDSLAIEYL
                     GACEFIAQQTRQIVERMEESGYKIQAIYMSGGQCRNELLMRLLADCTNMPIVTPKYID
                     ASVVFGAAMLGAVAAEDALIDQGERKKTSESVSDRLWRIMCELSASGKVVFPRSDSEP
                     DRKLLSVKYKIFLDQIRTQQEYRKMVANTEDAISNYLKI"
     gene            complement(<803420..>804061)
                     /locus_tag="FOA43_003035"
                     /db_xref="GeneID:62196436"
     mRNA            complement(join(<803420..803868,804055..>804061))
                     /locus_tag="FOA43_003035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923313.1"
                     /db_xref="GeneID:62196436"
     CDS             complement(join(803420..803868,804055..804061))
                     /locus_tag="FOA43_003035"
                     /note="BUSCO:EOG09344I0I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779241.1"
                     /db_xref="GeneID:62196436"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF00808"
                     /translation="MAVSPGQSESVSPGETASTGEFVSPGESVSLGESASPEKRASPR
                     ESVDPLFHTKFYGSEGYKRIKTHFPSARIKKLMQSDEDIGKVAQATPVALGRALEMFM
                     CTLVERSLETAQQDRMKKVNVQILKKTVETNEQFDFVVGICDKYLSKGK"
     gene            complement(<804248..>805768)
                     /locus_tag="FOA43_003036"
                     /db_xref="GeneID:62196437"
     mRNA            complement(<804248..>805768)
                     /locus_tag="FOA43_003036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923314.1"
                     /db_xref="GeneID:62196437"
     CDS             complement(804248..805768)
                     /locus_tag="FOA43_003036"
                     /note="BUSCO:EOG09341XKX;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779242.1"
                     /db_xref="GeneID:62196437"
                     /db_xref="InterPro:IPR005016"
                     /db_xref="PFAM:PF03348"
                     /translation="MGAIVSLPVTMAGNWLAACLGASCCSCCMNSKMNPLSQTFRSSV
                     ATRVMYAVIFCFNSIFSWLSMSHQFIDIMNKISVGPFKSATAYCREEGCTGFANVQRM
                     NLSLGLLHLILAGVMMGVKSTSNPRSTLQNGYWMAKLMVLATFITVSYLIPDRFFVFW
                     GNYLSIFFGTFFLGIGLILLVDFAHEWAETCLEKIDEGEIYLDAGNDDDDDDSDGVTC
                     FQGARFWRGLLVGGTLSMYAGAILMTVVMYHYFSHNGCGMNTSFISVNLALVLLVTGI
                     SVTPVVQEYNPNAGLAQASMCCVYCTYLVFSACLSEPDDKLCNPLIRSSGTRTLTTIV
                     GALFTFVAIAYTTTRAAGNSTFNHGNINPNYISGGNYDSVMDVITQEPRAHNAMRIDA
                     IRQAVNEGSLPESALTDPIYYEGEDTEAAAGSGTGDNNNSMKYNYVLFHVIFFLATQY
                     IAALLTINVESDSSKGFVPVGRTYFNTWLKVVSSWVCYLLYSWTLIAPVLFPDRFL"
     gene            <805965..>807089
                     /locus_tag="FOA43_003037"
                     /db_xref="GeneID:62196438"
     mRNA            <805965..>807089
                     /locus_tag="FOA43_003037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923315.1"
                     /db_xref="GeneID:62196438"
     CDS             805965..807089
                     /locus_tag="FOA43_003037"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779243.1"
                     /db_xref="GeneID:62196438"
                     /db_xref="InterPro:IPR004000"
                     /translation="MLSDEKKRRLADQTKDKPLILKLGSRSIEFGICGDAKPLVHISS
                     SEFSQLQSFKVDPGQIFWGHSINSKDVEHLNKSGELSPNKSSLELDLESFKFLFYPDL
                     LAYRDSENLLNSLEYRLRNHLFDIFEALFKKITFNAVNAKIFILEDLFHNEWYKKTMS
                     DVLLSQLQARSVVFLPNSVMCIVGAGIQNGLIVDCGWSAISVEPVYENRLLTNYSAFT
                     RRGGMMIHYKTVTKLQENGVKKDFDEVEKLIVECNDSSIPAYDAVNECLFPEIDSADT
                     DMDEQKPASLVVNTIAGLPVDIRKELAGHIIITGGLGRIDWLRQKLIQEISCLVKREG
                     FKFTTGQNHSLGSWQGASLFASTILPRQKSNGIIQELRRD"
     gene            complement(<807091..>808376)
                     /locus_tag="FOA43_003038"
                     /db_xref="GeneID:62196439"
     mRNA            complement(join(<807091..807971,807984..808009,
                     808165..>808376))
                     /locus_tag="FOA43_003038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923316.1"
                     /db_xref="GeneID:62196439"
     CDS             complement(join(807091..807971,807984..808009,
                     808165..808376))
                     /locus_tag="FOA43_003038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779244.1"
                     /db_xref="GeneID:62196439"
                     /translation="METENKNDNAHLENAEVPDSPLESVLKARSEVKALIKAVNRRKR
                     ESKSIESENVYLQSYAGSLVGSGVLEKKRMENSLNIPGSLRFSQGSHNDKKRYPSLSF
                     EQLQALKFRKIGASTTTHRPVLYQRDLNRTNNSRDIGSVKGLLNISSGNSVDGEHKRG
                     ALLNLISVSRNTDSIESISVEKRKMAFAKAAAPRLQKHKIIKEELFVPNSSRHTTQVE
                     LVPFDFPLTAESKSLIIDGCSRRTSINASPFFDATEFDPRCATDEMVLMSILEDEMER
                     IDAPLENRPKATFWKALCNTFYRLLHFGQFTKEDYIARYTWEKFFDPELYYADKANNE
                     NDDEGEINYGMVPGGDLDVKNILENRGKMAYAFVPGLT"
     gene            <808557..>809978
                     /locus_tag="FOA43_003039"
                     /db_xref="GeneID:62196440"
     mRNA            <808557..>809978
                     /locus_tag="FOA43_003039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923317.1"
                     /db_xref="GeneID:62196440"
     CDS             808557..809978
                     /locus_tag="FOA43_003039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779245.1"
                     /db_xref="GeneID:62196440"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="PFAM:PF03372"
                     /translation="MTENTSNKHPEKISKKNKGGHNRPSPEEIGEIRRQRQEKKKLRE
                     KLIAEGRDVDDPSGKPLYIKREMLEVSHEKFLSIEKGLRLRFMTYNLLAQTLIRRSMF
                     PDNGPILKWTNRSKPLFQEVKNYNCDIMCMQEMDYTNYDNFWKPKLSDLGYHSRFNRS
                     GTKSHGVAIFYRDSLFTFIDICRIDYDSERTGAISPRTITQNVGLIVGLSLKSDPDKV
                     ILFGTTHLFWHPFGTYERTRQTYIALAKCREFQNRIRILHPKVNKIWKFFAGDFNSQP
                     YDSPYLSITSKPVQYNSRCKTVISCSTSFQFSSLRGGGVAHEEEKGGNVEKYGENQPK
                     DPVPDTFIPTADQLELVEEMQKLHNSLPVRAISMYSVGYKLVDPVNAGIDNDRNEPFF
                     SNWAHTWRGLLDYIFLVKEWNGNDNCKDIDQLEQFETDNDLVLEKLLKMPHPKDMDKG
                     LPRQHQYPSDHLCMIAQISLKLL"
     gene            complement(<809994..>812978)
                     /locus_tag="FOA43_003040"
                     /db_xref="GeneID:62196441"
     mRNA            complement(<809994..>812978)
                     /locus_tag="FOA43_003040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923318.1"
                     /db_xref="GeneID:62196441"
     CDS             complement(809994..812978)
                     /locus_tag="FOA43_003040"
                     /note="CAZy:GH65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779246.1"
                     /db_xref="GeneID:62196441"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR037018"
                     /db_xref="PFAM:PF03632"
                     /db_xref="PFAM:PF03636"
                     /translation="MKPSNLLLASLPLNFDYHDPQTDTFYYQDERFLSTLKFNSYNHY
                     TNQPYVSNGYIGSRIPNLGFGFAYDQNENSSSSSLGNGWPLFNDRYAGAFVSGFYNAQ
                     PNTTGTNFPELLADGGYESVISAIPQWTQICIKQVVNGTESVLDPQQIIPSGSISNYI
                     QSLNMSNGIVTTSYDWLGLLHLDVTVWAHREISSLGLLKVDISPLKTLDSLVVSDVLD
                     FNSSQRCWLQDLGNDGGSIFMTVTPENVPYKAATLYSIMRSSLQPLSSHINRTDSAVS
                     SELSLPTDRNVSLFKYVGIVSDDLFDTNSSSKVFEIAKTTALKASNSSWSNLQKSHNR
                     SWSDLWDETRISVEDDSYLTLTAEASIYHLLANTRSSSANLTSALGVTGLSSDSYAGM
                     VFWDSDLWMMPGIQTFSPENAAAVSQFRKYIHPQAVINAQDHGYNGSVYSWTSGRFGN
                     CTGTGPCMNYEYHINVAICYSIWKLYVSGSIGDYQLRADGWPILKDSADFFSQYVKYN
                     NTLGKYTTHNLTDPDEYANFKNNAAYTAVGIAQVMKWAMLVGNYLGEKVDSRWQDIRD
                     NMYLAVSKDNVTLEYDTMNSSVSIKQADVVLISYIDDQDGFLPYIYGYDKARAYRDLV
                     YYSDRHASEGPAMTYPVYLAVSQKLNHYGCGYHTYLQQSVRPFIRFPFAQMSEQNNDD
                     YDSNGGTHPAFPFLTGHGGVVQSYYYGLLGLRYTYSLGGNNEINRLLHIDPISLPRFT
                     GNFTIEGFRYMNESIDIQVDSSKCEYGNSDISGCSATFISHGYGNDSVFIYVDSRNSK
                     GGLYELSLGSSLSVPLFVPSMNLPGSFTECVADTAGVTEGVEGDVLDAIVDGDNATSW
                     QVRDKNKPSRIMIDLKNPRTFTRGTIVWGPRPAKRFTVSILPEYNDLSRKDMVRIKKT
                     FEPGPENYYNVTTLVHEQGVDITSPYNVSDVEVRVQDMNYTTFDMKMNYTARYVVLDV
                     HGVVDEDNNEVGAKIAEFGLFK"
     gene            <813788..>815134
                     /gene="TUB1"
                     /locus_tag="FOA43_003041"
                     /db_xref="GeneID:62196442"
     mRNA            <813788..>815134
                     /gene="TUB1"
                     /locus_tag="FOA43_003041"
                     /product="alpha-tubulin"
                     /transcript_id="XM_038923319.1"
                     /db_xref="GeneID:62196442"
     CDS             813788..815134
                     /gene="TUB1"
                     /locus_tag="FOA43_003041"
                     /codon_start=1
                     /product="alpha-tubulin"
                     /protein_id="XP_038779247.1"
                     /db_xref="GeneID:62196442"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="InterPro:IPR036525"
                     /db_xref="InterPro:IPR037103"
                     /db_xref="PFAM:PF00091"
                     /db_xref="PFAM:PF03953"
                     /translation="MREVISVNVGQAGCQIGNSCWELYCLEHGITPDGYLQEGLTKPK
                     GGEEGFSTFFSETGAGKYVPRALYVDLEPNVVDEVRTGKYKNLFHPEQLITGKEDAAN
                     NYARGHYTVGRQILDDVCDRVRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLEQFSN
                     DYGKKSKLEFAVYPAPQLTTSVVEPYNTVLTTHTTLENADCTFMVDNEAIYDMCRKNL
                     GIARPSFENLNSLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPV
                     LSKSRANHESNSVSEITAACFEPGNQMVKCDPRLGKYMATCLLYRGDVVNRDVQNAVS
                     TIKAKKTVQLVDWCPTGFKIGICYQKPTQPPNSDLADVNRAVCMLSNTTAIADAWQKI
                     DRKFDLMYKKRAFVHWYVSEGMEEGEFAEAREDLAALERDYVELGADTFPEEDEEY"
     gene            <815531..>818464
                     /locus_tag="FOA43_003042"
                     /db_xref="GeneID:62196443"
     mRNA            <815531..>818464
                     /locus_tag="FOA43_003042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923320.1"
                     /db_xref="GeneID:62196443"
     CDS             815531..818464
                     /locus_tag="FOA43_003042"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779248.1"
                     /db_xref="GeneID:62196443"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MTEPNSYASGSAVRVKKTRNRVPTSCENCRRRKLKCDRRRPCSN
                     CVRSQNESLCKYAVQPSEASPKTKLTNEIVHLKMKINKLEHILQMNNIDPGEYSDLSL
                     MIGTDKSSSDSSSPDGEADPMVSLANKFDQLVIKGNHFLHSGTTSYMTFVAGDKTLSQ
                     LYEKYMEHHRLAYKEYLRRLQLKPSDFPGNCADSSLALLSDTAFSEMNACGMESLQLP
                     GADKAYSVMKPSFNAAKDTLRILNKINGEIPPLFAVKALIDNFFNRVYYLLPFVDENK
                     FRDELSRVLVETPNGGCRLVLVHIDNTSIISLLLILLRFSYLAVNVGDLTENPKLIDN
                     AELIAMIKSNIDIGPSFIGLAKDLLMSLPLSENIFKKITPRNIQVLLFLRLYQSYSPE
                     LNEENQENAINLAMIIEMGRVMGSNRDPSNFPNVLPDERSNNISRRIYYELLLLDTVN
                     SIEYGCPLIIQDDESAVDLPKLSAEDSQILYNFKKGRPIGVNGGKLKSVVVEKAVNTA
                     TALTYEATRLMREGIKAFQNVGDGTKKSNLTHIVRRMENFMSTKLPSLTALVRNTNFE
                     DFQDMCTMYQIFKIPMIRVYELRLTMLSLLNCFYYLLYMNEDKGFSRVKTDYAVRATE
                     ISLSLFKNAYDYVTYYSESETLNGTSPSHIELRKFSMKLETFLVRITVFSTLKSSLWI
                     CSLFLNCVQDEGLDFLSILSKFGSSTDTLLALDWFNVDLADGTNEQYLFMLFHYMKQF
                     YFKLFSLKDKFFCCWRSSMTLKLFINYFKDSNESQFKKFIDPNFMFNTTASTYEGLAL
                     PTGSSNETNSLSDTGNDTSNASLEDIVNNDLGEFLEGSKNDVNDILFDSMEDTINAIF
                     ADNKAYRSSTEMFSMFGNDLSQMETMFYDSNKSEPPTLTRNKTSSTGKMTDPSTSSLY
                     STRDERKSTTTTSSRSPFDTGHGTGSDIDTAESYIDDAPLMKDKQLNLADLLERLKQE
                     PGFEI"
     gene            <818531..>819152
                     /locus_tag="FOA43_003043"
                     /db_xref="GeneID:62196444"
     mRNA            join(<818531..819027,819125..>819152)
                     /locus_tag="FOA43_003043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923321.1"
                     /db_xref="GeneID:62196444"
     CDS             join(818531..819027,819125..819152)
                     /locus_tag="FOA43_003043"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779249.1"
                     /db_xref="GeneID:62196444"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /translation="MLSEDLIESYRTVFDSAVDHRLVNELCAGKLADKTLLIYLVQDV
                     KYFNLYMKIVLKTAYLCPDEAATIRFGKQVGFISNDENDYFERTIDLLCGRDSSLERY
                     VNDKSFVLDEVKQYLSLLTRLTTRLQDYSYDQMVTYLWTTEVVYLRWAQKALKDPNVP
                     SDLHWRLKGSLGKP"
     gene            complement(<819193..>820137)
                     /locus_tag="FOA43_003044"
                     /db_xref="GeneID:62196445"
     mRNA            complement(<819193..>820137)
                     /locus_tag="FOA43_003044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923322.1"
                     /db_xref="GeneID:62196445"
     CDS             complement(819193..820137)
                     /locus_tag="FOA43_003044"
                     /note="BUSCO:EOG09343VQT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779250.1"
                     /db_xref="GeneID:62196445"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="InterPro:IPR036371"
                     /db_xref="InterPro:IPR036759"
                     /db_xref="PFAM:PF04263"
                     /db_xref="PFAM:PF04265"
                     /translation="MVDESDSNITENPDCMHVVRPVSGDINVISPLSFFSCEKTSSTS
                     NSPVKCLLILNQEIHLPFKFFDRLWKSTSIRICADGGANRLYNYSRQNSVLNEYTPNY
                     IVGDLDSLIDPVRDYYLSQGTRIKKQGSQFYSDLDKSIALIDLLVNFPSVDVSKLDDY
                     SGLEKTEVDRIKGQDRPFFKQIFLLVVGGIGGRFDQTIATISRTIQSLSQRPFIDFIL
                     LNSEHAEFVLLLPKGKNFIDFPTEKGFMDEDRGDNPRNVGLLPLSGPANVTTKGLKWD
                     VQDWRTEMIGDLSLCNYQVGDNGIYLGTSSELFVNIEF"
     gene            complement(<820260..>821027)
                     /locus_tag="FOA43_003045"
                     /db_xref="GeneID:62196446"
     mRNA            complement(<820260..>821027)
                     /locus_tag="FOA43_003045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923323.1"
                     /db_xref="GeneID:62196446"
     CDS             complement(820260..821027)
                     /locus_tag="FOA43_003045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779251.1"
                     /db_xref="GeneID:62196446"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR035991"
                     /db_xref="PFAM:PF01214"
                     /translation="MASREGEYISDSGSDYTEYWIDWFLGSRGNEYFCDVDAEYITDR
                     FNLTGLNQYVDRIGLLVDIITDRTQISETQPEEARARLEDNAKFIYALIHARYIITSR
                     GLSKMLEKYRNGDFGYCPRVNCKLTPLLPVGLSDKPRVASVKLYCPNCEDLYNPKSSR
                     HASIDGAFFGTSFPAMFLQNYPELVPTHNVDVYIPKIFGFQLHSQAQLTRWRLLKREQ
                     LVNRLDQLHIEHANDGPGGFADPVDDDENKKAKRGRR"
     gene            <821302..>824406
                     /locus_tag="FOA43_003046"
                     /db_xref="GeneID:62196447"
     mRNA            <821302..>824406
                     /locus_tag="FOA43_003046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923324.1"
                     /db_xref="GeneID:62196447"
     CDS             821302..824406
                     /locus_tag="FOA43_003046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779252.1"
                     /db_xref="GeneID:62196447"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF07569"
                     /translation="MYFFTASFLNKTSLFVSVNSTNDYVATANNDGNIKIRSMSQFTH
                     LIPNKSLEEEEEEKEKEKENLAKNPDGDDVDRTKEISSIIDLDKESVDNNSPSSSHID
                     KQKLTVPTRKTHKSPTIDQSKLELAQHPVNIIGVRSRSKITSLKYANLKSHSNLLAAV
                     YKNGEVYMVSDPQNSAKCAVRQIFKHVNGLILDFSWSADDQLLAFSSMNDEVIIYDVI
                     YSRIISVLHLHEIKGNGTTNISSSAAFGSNVPVKGISFDNTSGKYLLTLGDDKLVNIL
                     EYSLVPDDLEGRKFEYNITQRFSKLINSSKLNKATIRKVSWSKDDRTISVPNASKSKT
                     SIISVLFNDTPNFGATWDKWHSFTGHGFKSTMTQFSPCTYRKEGSDPVFTYVLATASP
                     DSSIAIWKTSEDRPLFMINEISPQPIQDICWSQNGRLLFLTTSSGHMILVVFDEGELG
                     EVVPESECIKNDINSGASKAAPEILETFDKWMRKEKDTRPQLKLAPKLKTPKTIVKNE
                     GKSKLQSAIPGGTASADATDTSVDNTEKDKPIDQTKNGKKRSHSAVLSENHKSGLNSN
                     NSLKKPSGPTSDFVGPSTSVPKSLAHRISKGNQLDGAPRKKRELESVEFAGSVAINPQ
                     ISFSNIRIAVPKVRAHINYSLLEDSSMCLEVTNGNGHESYPSRIALLKRFPSDSTKEV
                     FVDFIPHRVHIITGSGTYWAISTTNGQIITYTNSGRRVLPTMILGSPLSFLEMKDQFL
                     MAVTSVGEMYAWDLRRHKALFRPTSLYPLLQPIYRAGGPNDSLASGNQGSNNGSNGTG
                     TGGAASGNTQGTTSIDKNGIVFVNGDLLTRSENLTMCSITSTGLPIVTLSNGNGYLYD
                     SDMGTWSLVSDSWWAFGSQYWDSTQTLTSSTSSTTEDSSLLNYLEIHTNEEIVRRGKA
                     KFFSKISKVMLMKEGFENLETVISLNHLENKINLYQFLNDFKNFKTYLIVYVKRLSEL
                     NLKDRLIEIFQELFIDMNGKICGVEKKHLLEELILSCSKQREVQRILVQYGESIGLLE
                     NNLL"
     gene            complement(<824459..>825622)
                     /locus_tag="FOA43_003047"
                     /db_xref="GeneID:62196448"
     mRNA            complement(<824459..>825622)
                     /locus_tag="FOA43_003047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923325.1"
                     /db_xref="GeneID:62196448"
     CDS             complement(824459..825622)
                     /locus_tag="FOA43_003047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779253.1"
                     /db_xref="GeneID:62196448"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF00579"
                     /translation="MLGKRALVKSCYRLRLYSTVNTSAETVETIPSILDPKFEIPNGS
                     VIFSGIQPTGAFHLGNYFGAVRNWRDFQTRIERDHINSRLLFFVADMHSLTVPQNFSR
                     LTNQRLEAFGSLMACGIDPEKATIFFQSEVPEIPKLQWILSCMCGMGQLNRMTQWKSK
                     ANLRNDADIAADFGKVKLGLFTYPVLMAADILTFNATHVPVGRDQAQHLELTRELVDI
                     FNRATKSKFLHQPMTLLAPTMKVLSLKNPEKKMSKSDPDDMSKIFITEDAKSIRNKIS
                     KALTDSVEGKLIYDPVNRPAVTNLITILAAALGRPVLEVSNQVEDFTKKELKDAVSDA
                     VVKELKDPAARFQELMKDPERLDKLSRRGSEKAREIASKNLKEISKLVGMGYW"
     gene            <825839..>827356
                     /locus_tag="FOA43_003048"
                     /db_xref="GeneID:62196449"
     mRNA            <825839..>827356
                     /locus_tag="FOA43_003048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923326.1"
                     /db_xref="GeneID:62196449"
     CDS             825839..827356
                     /locus_tag="FOA43_003048"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779254.1"
                     /db_xref="GeneID:62196449"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PFAM:PF11976"
                     /translation="MSDPSKSSSRAEDDFFAFGGDDEDYDLPPPSKKRKKKGHKKHHH
                     HTKKSQENESTSKSGGRLSKMDVSSPSKNISFKSESKEEPKNDDLMKMLGIQDDDSDE
                     DYITGLIINEKSSIKTTRSEPISVKGKRASEDEQLLEQLDSDIMKVEKYETMAEMEEA
                     LDRVPTDFLAQTVVVNGEKMNVSDTKFKIDVTVELGDRSLTISLTAKGSTHFKKIQEK
                     ICAWLYPKYIEQPVMMPETLVFYIKELDLIVKQFLKIGYLLQLSKKNGKISLPITDDG
                     YHFCTTMSTETKIQATRQLLNLGKQSTSEAASSGNGDPEITINLKDRKTGRSTTIATK
                     RTSVMIDLVSIFLVRLHYPDMLKVTLYGSDGAALPAESSIGDSKIGENETIELDYDQR
                     DFDELQEAAKQHKSDDEYDNDNDIDLRHNLDLTREQDNSYFTINMVGKDKKSYKVQVN
                     PDTEIRLMIDYYRSKAKVEAKVLISLLFDDELLLPSMKVSDTELEEDFIVDVMLQ"
     gene            complement(<827391..>829091)
                     /locus_tag="FOA43_003049"
                     /db_xref="GeneID:62196450"
     mRNA            complement(<827391..>829091)
                     /locus_tag="FOA43_003049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923327.1"
                     /db_xref="GeneID:62196450"
     CDS             complement(827391..829091)
                     /locus_tag="FOA43_003049"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779255.1"
                     /db_xref="GeneID:62196450"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR039261"
                     /translation="MLKLTLLRAQRPVRFPLLATGSWAGLRFNSSTGKGKDPRDSKDC
                     KDCKDSKDSKDPKDSKDYNVPLRDLENFSPDLSSRVSNPSGSLPGMNQEILDLMKHPK
                     VVYNPANNKDETRYEFHAPKTPKEEYKEAIKNKVQGSSKIKKLLPSLLLGAGFLWVIY
                     TYDYFTREKDPYRDTDSSLLREDKFLPYLVSFKYRIDDSHYLIELTRKNRARKLIHNQ
                     RLFNGDKIWSIEIAKPDINITRSYTPLPLFVAGFDPLTQEPHLRLVSKAEQEGKFILI
                     VKRYPDGEFSRWLTGLGLLQEIKVRGPIQDYKFRFHPLDHYQARPQLGNTLERTEPDH
                     EYPGHLPKPENFVFYGAGTGILPFLQVLYSPNPPKGITEAFVSVHSESNLMGQLRTLN
                     YFAEKCGRVKFHYLVEDQNQHLSSNDIPSPTFPHFTGAKDLKISEEVYRYKLLQEKKA
                     EVRRQVEGDPIKKPDDSTSVSPSSVSYGSPGPNDIPNLDFSKIKPDNAYQQFRFLRGK
                     KELPPPSLAFVCGPDGYIDFVSGKPNLNNTEMKDMGPIGGLLKEKGWTENNVKRLVGL
                     "
     gene            <829208..>830201
                     /locus_tag="FOA43_003050"
                     /db_xref="GeneID:62196451"
     mRNA            join(<829208..829933,830127..>830201)
                     /locus_tag="FOA43_003050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923328.1"
                     /db_xref="GeneID:62196451"
     CDS             join(829208..829933,830127..830201)
                     /locus_tag="FOA43_003050"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779256.1"
                     /db_xref="GeneID:62196451"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSISLEYTFNANDDICWAVAVQPQLHLMATVSADKTCKIFDLRT
                     RKLVATLADDTHSKTTRCVSFKPSTEFPTVAVGSFDATVSIWGRDLMEEKNAQRDEDT
                     EKDFNSDSKSEIVGDNGWELLAIIEGHENEVKSVDWSYDGKYLATCSRDKSAWIWETD
                     DTNEEFECINVIQEHEQDIKEVKWHPSLNLLATSSYDETCRIFRQDTYDEDDWICVAK
                     LTDAKGTVWCSDFEKDSKKNVVRLPAADVTEESSFIKKKEIRVGNGQF"
     gene            complement(<830311..>831138)
                     /locus_tag="FOA43_003051"
                     /db_xref="GeneID:62196452"
     mRNA            complement(<830311..>831138)
                     /locus_tag="FOA43_003051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923329.1"
                     /db_xref="GeneID:62196452"
     CDS             complement(830311..831138)
                     /locus_tag="FOA43_003051"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779257.1"
                     /db_xref="GeneID:62196452"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="PFAM:PF05739"
                     /db_xref="PFAM:PF14523"
                     /translation="MNESFNSAIDLEEQPSYQDSPEFDQVNDDISNGLLEINNMLSNL
                     NKNLIVMERKVDVDGRSGGDGSVEKYQSNSVTLVNRLVGLFKDISLYSRKMNGMDTTM
                     LNKSQIFVKSKLNENLKSSLKKFNELQKSLTDLDKQMNEQVQESHKQSETSPPPQQQQ
                     QQQQRLIIEYEPVNAEELEYQRNLVEERERDIEQISHGVSELNEIFHDLSSMVDAQGE
                     FVDNIETNIYSTLHDTRMANKHLRRADRYHRNKRKLCFWLLMIACVVILFVIMIIFA"
     gene            complement(<831358..>832884)
                     /locus_tag="FOA43_003052"
                     /db_xref="GeneID:62196453"
     mRNA            complement(<831358..>832884)
                     /locus_tag="FOA43_003052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923330.1"
                     /db_xref="GeneID:62196453"
     CDS             complement(831358..832884)
                     /locus_tag="FOA43_003052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779258.1"
                     /db_xref="GeneID:62196453"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="PFAM:PF00170"
                     /translation="MSTKAKAIDQQDLQFAGSDYVTSSTMVNANNATKPPQQSGSAAS
                     FDLDLLGAAISDTSHVTQQPNSHSHRHSTRHMASKKNQTLSLENFHLDPQDFQNFLMI
                     NPPIMEYSPYYYMKTPAGIPIEQSQQPQPQQPQSQSQSQQPQQPFGGPENYGYAHYKA
                     NGAKPVPSGVATGPAIGATTGPPGPSGSHFVDNFPDGIDPSIDEQFVENVAPQTIPQG
                     APFVTAPVDSSESGDVSGDSGYVNGPLTAYPPAPRRRVSISNGQIGQISMIVHRTEAE
                     QDQAYMEAQSQAHIQGSGRGQSISPHQMGPGLGHQASTQLQQGPSQQNRQVFYSHHQP
                     PASPQPFNGGEIEVDKDGIPKRQLLYNNQVIFNPDAGPIPGTAAWKRQRILERNRVAA
                     SKCRQKKKNLQRRLQRDVEELSNKNRYLEQVILSMKEKLNDYMSANNIPLDILLGQGD
                     EDFHSHVKSEEATKKNSVRLSKSQKRDLALSVTTDTLRDIMLSDGSDLYYGLKGSVKH
                     "
     gene            complement(<833149..>833835)
                     /gene="REX2"
                     /locus_tag="FOA43_003053"
                     /db_xref="GeneID:62196454"
     mRNA            complement(<833149..>833835)
                     /gene="REX2"
                     /locus_tag="FOA43_003053"
                     /product="RNA exonuclease"
                     /transcript_id="XM_038923331.1"
                     /db_xref="GeneID:62196454"
     CDS             complement(833149..833835)
                     /gene="REX2"
                     /locus_tag="FOA43_003053"
                     /codon_start=1
                     /product="RNA exonuclease"
                     /protein_id="XP_038779259.1"
                     /db_xref="GeneID:62196454"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR022894"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="PFAM:PF00929"
                     /translation="MSTASDIIKSATGVYDHMKPIIWVDCEMTGLDHEKDHIIEICCL
                     ITDKNLKVLDKAGYESVIHYPKSEMDSMNKWCIDHHGSSGLTKKVIESEKTKDLVENQ
                     LLNYIKKFVSPNVGILAGNSIHMDRLFMLKEMPKVINYLMYRIIDVSSIMEFCKRHNP
                     KVEALMPPKIGAHTAKQDIIESINQLKYYRDVYLKDSDEIDEEVIREKWAGKDINGNP
                     LERNTRKRKI"
     gene            complement(<833975..>834379)
                     /locus_tag="FOA43_003054"
                     /db_xref="GeneID:62196455"
     mRNA            complement(<833975..>834379)
                     /locus_tag="FOA43_003054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923332.1"
                     /db_xref="GeneID:62196455"
     CDS             complement(833975..834379)
                     /locus_tag="FOA43_003054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779260.1"
                     /db_xref="GeneID:62196455"
                     /db_xref="InterPro:IPR006806"
                     /db_xref="PFAM:PF04716"
                     /translation="MRYLPYLRQAQEILIKAGKGDATGLTGLYRHPNPRPVLTKLYNA
                     TLKKLAKDFPKESIYRQSVESMTKARLAVVEKNEVLDRIEKEIGCGLIEELVIQANDE
                     YNLAQKMAEWKAWEPLQEKPLEDQWVYFGKKV"
     gene            complement(<834501..>835304)
                     /locus_tag="FOA43_003055"
                     /db_xref="GeneID:62196456"
     mRNA            complement(<834501..>835304)
                     /locus_tag="FOA43_003055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923333.1"
                     /db_xref="GeneID:62196456"
     CDS             complement(834501..835304)
                     /locus_tag="FOA43_003055"
                     /note="BUSCO:EOG09342TWE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779261.1"
                     /db_xref="GeneID:62196456"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="InterPro:IPR016612"
                     /db_xref="InterPro:IPR038566"
                     /db_xref="PFAM:PF04934"
                     /translation="MSIENTPLDELQWKSPEWVNAFGLRTDNVLEYFSQSPFFDRTSN
                     NQVLKMQNQFSDANYISRPYELLLIDLTKMRGTEFIISIVREPDFWVIRKQYRYSETR
                     VKTLADFYIIGSSVYMAPSIHAILSSRLLSTSLNLKNAINLLQELPSFSPSKGHYYEF
                     SKSDNESKDDKTEDSLKLPDSISNAFSNLLNLSLQKNSVRLDDMPDTGINEIALTKQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSKSLLNPAVSSPPK"
     gene            <835445..>835918
                     /locus_tag="FOA43_003056"
                     /db_xref="GeneID:62196457"
     mRNA            join(<835445..835452,835510..>835918)
                     /locus_tag="FOA43_003056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923334.1"
                     /db_xref="GeneID:62196457"
     CDS             join(835445..835452,835510..835918)
                     /locus_tag="FOA43_003056"
                     /note="BUSCO:EOG09343UTV;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779262.1"
                     /db_xref="GeneID:62196457"
                     /db_xref="InterPro:IPR019083"
                     /db_xref="PFAM:PF09597"
                     /translation="MSTINLVLVPEPTKEVPDVDTFLNKIGHQASEASSTFENDWKKF
                     FTMTSKQMKEGGIDTSVRRYILDWQEKYKKSIPLQELRTTQRKHGGERKSRIYAADKK
                     VKDRIKMAQLKKAYRKKSVQEVIQTRRWEKLHREQE"
     gene            complement(<835976..>836527)
                     /locus_tag="FOA43_003057"
                     /db_xref="GeneID:62196458"
     mRNA            complement(<835976..>836527)
                     /locus_tag="FOA43_003057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923335.1"
                     /db_xref="GeneID:62196458"
     CDS             complement(835976..836527)
                     /locus_tag="FOA43_003057"
                     /note="BUSCO:EOG093447R2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779263.1"
                     /db_xref="GeneID:62196458"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="InterPro:IPR036265"
                     /db_xref="InterPro:IPR039383"
                     /db_xref="PFAM:PF01230"
                     /db_xref="PFAM:PF11969"
                     /translation="MTAGKPDMSGTFFYKFPVTRQVFYRSKYCYALVNLKPIVPGHVL
                     VVPFRQVPRLKELSVKESIDLMATVQLIHCFIEKVYKADSLNLSMQDGIGAGQSVPHV
                     HFHIIPRYLKDGYGDHIYDMLEQNEANLNGFFRKVCQERVVAADLERRPRSMEVMEKE
                     AIWLHEELQKFLKDYHPVEEPPK"
     gene            <836643..>838532
                     /locus_tag="FOA43_003058"
                     /db_xref="GeneID:62196459"
     mRNA            <836643..>838532
                     /locus_tag="FOA43_003058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923336.1"
                     /db_xref="GeneID:62196459"
     CDS             836643..838532
                     /locus_tag="FOA43_003058"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779264.1"
                     /db_xref="GeneID:62196459"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /translation="MSSTSIDHYKILDLSVNASAIDIKKAFRKLALKYHPDKNKTREA
                     EDKFKQINDSYKVLCDPHKKADYDRARQFTATTTSMNSGEPFGYGYAYSFGAESFAQA
                     AGREYDRARRQYEEFKRRQDQEQRARVNAERARQSRMEKEAWERVYREKERRQNDGYS
                     PFGNAFHYSQFDDEFSNPFSGFRPRFDTGSKKKEDPKPDLQSTNNGKWSKSSSSYSFK
                     AGEKTYMGPTPKSTVNDVKETENGNEQKSSLPPSPESAFSNINSDSSYLSEDNLPDTS
                     GIQNADANGFSNPFVAPKFEFDPSFAKPNITGDPVDPGDPAGTAGTAGTAGTAGTAGT
                     AGTDGTKDDPIVLDGGTEEDPIILEESNTEGTEKSSPRRVSRSPHRSGLKINGKQRLW
                     NPPRSQNETLSGRAEARNETEMDVEEEEEESDETDDTFHFDVNHLAPFTETSGDFNMD
                     SIERSLNTEELNTDKKEPGKRRRDSGVDEFGNQDYMNEHEQEPAPKVKPSVNVDSSEI
                     PIHEPVNGSLPRRPPAQPLTAQDLGFDFRIIEKIQSAVPILSASASLMEYWPYLESVE
                     KFNLLMADYTRHRSELNRENMDRITREPLSFQTYRKGIELDLKLRKFWNTVSENCKLA
                     CERYS"
     gene            <838695..>839261
                     /locus_tag="FOA43_003059"
                     /db_xref="GeneID:62196460"
     mRNA            <838695..>839261
                     /locus_tag="FOA43_003059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923337.1"
                     /db_xref="GeneID:62196460"
     CDS             838695..839261
                     /locus_tag="FOA43_003059"
                     /note="BUSCO:EOG09344CPW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779265.1"
                     /db_xref="GeneID:62196460"
                     /db_xref="InterPro:IPR003162"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF02291"
                     /translation="MVESRGNDKKSKKGNSNSNMQSVGSKSQQSQEIPRDVRLLRLIF
                     ATQGIQNYQDHVPLQLMDFAYRYTSEILHDAIIYNDHAHANINNAGNAGSHHSQISNE
                     DIRLAIAARTSYQFQPVPPKKMLMKLAAERNEKPLPPVMPMWGIRLPPEKYCLSAKEW
                     KLDDEELTAPEAKRRKAEKRTKKESERQ"
     gene            <839464..>841507
                     /locus_tag="FOA43_003060"
                     /db_xref="GeneID:62196461"
     mRNA            join(<839464..839495,839557..>841507)
                     /locus_tag="FOA43_003060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923338.1"
                     /db_xref="GeneID:62196461"
     CDS             join(839464..839495,839557..841507)
                     /locus_tag="FOA43_003060"
                     /note="BUSCO:EOG09340YB9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779266.1"
                     /db_xref="GeneID:62196461"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="PFAM:PF09295"
                     /translation="MTSVTQGSIPEVVEKVIGESLEQRTSILDNINDLGPPDMVHLAK
                     TMNNSSTKIPCTGTFFYYTGVDSRNSATIAALLHSLVDIMGEKPQLWFGKHKSWKVTE
                     ATYCSYNAFSKLDSRVKVQFPGSVESSMIDSSNNKVMESDRLWLETYVCAMVRALITA
                     DNDSSDFTSVVEIRKINPLLNKEGTDLFLEGFEKLFFEGAKLGCSEDIQVATNGNNCL
                     VDAFLRCIELTGLYEKGLEIIGRLKSIDPFVSSLEAKLCFMGDQEVKAIKVMHDAVQL
                     NTLDGEIMTMQAQFCLDKGRLDMALPIATKAVNSSPSYFKPWSVLVKVYVALGEYEQA
                     LLTLNSCPMVTHKDKYILKRINNPKSEDMHLPLPIDVTLDKVSTLNSVDVAVEHNKID
                     RSLLNLPAANLKSTFAEAYSLLTSIVHKTGWEALLKYRTKVFVMEEEFKMENGSKESV
                     IDGPKKLPEATISEEARARTASLNDDFKKKRLCERWLDNLFMLLYEDLRVYTMYKAEL
                     MHFDAQQMELKKTTLEWELTGLVANRLDHLEEAAKCFEMGLEERFSPRCTLKLLQYYT
                     KQRGTKLGDSSKHNEYNDTILELIVKLLVWNHRWYCGFSPELIEALRDLVNEVGRVKV
                     ENEVRVRFDDGNTGVFDVVLDNLRFLEIYGTIEAEE"
     gene            <841681..>842609
                     /gene="SEC13"
                     /locus_tag="FOA43_003061"
                     /db_xref="GeneID:62196462"
     mRNA            join(<841681..841683,841734..>842609)
                     /gene="SEC13"
                     /locus_tag="FOA43_003061"
                     /product="GTPase-activating protein S13"
                     /transcript_id="XM_038923339.1"
                     /db_xref="GeneID:62196462"
     CDS             join(841681..841683,841734..842609)
                     /gene="SEC13"
                     /locus_tag="FOA43_003061"
                     /codon_start=1
                     /product="GTPase-activating protein S13"
                     /protein_id="XP_038779267.1"
                     /db_xref="GeneID:62196462"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MVTISNAHDGLIHDAVLDYYGKRLATCSSDKTIKIFQVEGDDYK
                     LIETLQGHEGPVWQVSWAHPKFGIILASCSYDGKVLIWKEEGGVWSNIAECSVHQASV
                     NSISWAPSEYGALLLCTSSDGKCSVVEFQEDGSQKTIVWQAHSIGVNAGSWAPPQKEN
                     IQERRLVTGGCDNLVKIWRYDAAQNTYVVEEALTGHTDWVRDVAWSPSLLSKYYIASA
                     SQDRTVIIWTKNVADKMSPWKKQLLRQDKFPDVCWRASWSMSGNVLAISGGDNKVTLW
                     KENLNGQWEQAGEVDQ"
     gene            complement(<842676..>845276)
                     /locus_tag="FOA43_003062"
                     /db_xref="GeneID:62196463"
     mRNA            complement(<842676..>845276)
                     /locus_tag="FOA43_003062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923340.1"
                     /db_xref="GeneID:62196463"
     CDS             complement(842676..845276)
                     /locus_tag="FOA43_003062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779268.1"
                     /db_xref="GeneID:62196463"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PFAM:PF08238"
                     /translation="MQHLSSLLACIALVFVRIVICTGDKSVINNEAPLISDIWDYDHC
                     IDVLRNESEASEQRQADLVSVDYAKRKFVEPSGFELTMALDWYPTFENERRHQQYELL
                     SLSQKHALSSLEYLADFRDDDKSAYLLGEIYLYGNYSIPRSPQKSVGYLEKSVTANST
                     ATNWFSHAHYLLGFCYSTGLFGEAEVNYGKALLHYTFAADMGHIRAAMALGYRYYMGL
                     SVEKNEQLALYYYSRVARHCTDTYKSEGGPAANLNVTINGFEVPLLAPNLESYNVRLS
                     DFNDGLFGHGVSEVKSSIKQEDPLSMDPSLADLEDLDNPTDHYLAQLYKGYLRNYEGR
                     YLMSHNYTRAFILAKGCALEGLKLPSVRYYKKTRRIDRTLEVILTAKCAYAVGHMYLR
                     GEGTPQNFTAARSWLQSSWSLVQSVRTAADLGIIYQYGLGLEKPNPAKAKSLYANFYG
                     FSAINYQSGLLMLSQNDPLGWKLISLASYDKYAPALYSLMQSYSQGNPLGLHKSVALS
                     NAKALAELIEPAVSDLKWAFSQVMKGDNEKALVAYGMAAEAGFESAQSSVAYMLYPPT
                     GYLEEAPHVPLERFQSAVRFYRESARQGNIDSMVFLGDLYWSGMTNETKKSNETSFLV
                     SPDLEAAVGIYRDASNKRSHQASYNLGHAYEAGLGVPLDLHLAKRYYDKALIINPDAY
                     IPVELALIRLKLKRWWFRLIGVECTESSEQDDGFPRRKWRELLNLYDKLRQRQIEGSD
                     INLSPTGDMAAQGGKDGAGEDAGSDFDSDADAASVTGAENNNNGDSFYFEANGDLGVE
                     DLLFTGMFLSFIGFTIYARWRAARRRNANNDNHQNENENDNANGNANANMPRPAAPPP
                     FQFNFMVIPL"
     gene            <846814..>847125
                     /locus_tag="FOA43_003063"
                     /db_xref="GeneID:62196464"
     mRNA            <846814..>847125
                     /locus_tag="FOA43_003063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923341.1"
                     /db_xref="GeneID:62196464"
     CDS             846814..847125
                     /locus_tag="FOA43_003063"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779269.1"
                     /db_xref="GeneID:62196464"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR018552"
                     /db_xref="PFAM:PF09415"
                     /translation="MSEEIKIDPTTIARLFHTVSFSDSENIRITKKTLALVSEYAKLF
                     TDEAIVRSNEYRLEERRRLANSYQTDTNEISTTNEAAPTGGALDAKHLEAIAGLLVLD
                     F"
     gene            complement(<847233..>849005)
                     /locus_tag="FOA43_003064"
                     /db_xref="GeneID:62196465"
     mRNA            complement(join(<847233..848255,848325..>849005))
                     /locus_tag="FOA43_003064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923342.1"
                     /db_xref="GeneID:62196465"
     CDS             complement(join(847233..848255,848325..849005))
                     /locus_tag="FOA43_003064"
                     /note="CAZy:AA4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779270.1"
                     /db_xref="GeneID:62196465"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="PFAM:PF01565"
                     /db_xref="PFAM:PF02913"
                     /translation="MFTRSYKGLLRKSAGALKRATKCDRSGLRFASTSTSRSNGNFTK
                     GAGLLFIGALAGATFVSYRTAENPPSFLFPASSTTKIKELTPPKYGKAEPAIQEIIQA
                     LGKDKVVETKNTLDDHSDTFFQTKHATDDQRPVAVVYPESTEEVSEIMKICHKHRVPA
                     VPFTGGTSLEGHFTPTRKGISVDLSKMDKIVALHKDDLDVVVQPAVGWEDLGDYLSSY
                     NLLFGPDPGPGACIGGMIGTSCSGTNAARWGTMKENVISLQIVLADGTIIKTKRRPRK
                     SSAGYNLNGLFIGSEGTLGIVTEATLKLNVKPKYQNVAVVSFPSIADAARSVSSFVQG
                     GLQLDAMELLDEKMMHFVNDSGETSIKYDEAPTLMLKIGDNSKEGLKAIVKNVKEICK
                     ENHNHHFKFAQDEDEKLELWNARKVALWSTIAYGKKHVGPDAKVWTTDVAVPISKLAE
                     NLEKTKADIESTGLPTSIVGHVGDGNYHCFLLFEEPQRPLAQAAVERMITRAIAADGT
                     VTGEHGIGFGKKVYLEQELGDDTIDVMRKIKMALDPYRILNPDKVFTIDPTESPSLRE
                     G"
     gene            complement(<849231..>850186)
                     /locus_tag="FOA43_003065"
                     /db_xref="GeneID:62196466"
     mRNA            complement(join(<849231..850108,850177..>850186))
                     /locus_tag="FOA43_003065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923343.1"
                     /db_xref="GeneID:62196466"
     CDS             complement(join(849231..850108,850177..850186))
                     /locus_tag="FOA43_003065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779271.1"
                     /db_xref="GeneID:62196466"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="PFAM:PF08597"
                     /translation="MSWDEDFKNPSVNEASVADDWEQEAVEDEDANDQPLLESWDVDI
                     DELEKKKKEEAAKKKAEIEALKKRQQEALANKKNKKGKKPVLLEIDKVDGSTRRKMLK
                     EAQLKADIKNAAELFAGMELSEKKKGEDSNGTSNEEDLDELFEADDDDEQTGSRVALT
                     VDSPLIEHPLFLAEDEQGYEKLRRGLAGEMKRLAKVKPLTYVNSLAIDLISTMCEPMS
                     LEQTRKVVSTLNAQVTKKVKDERKIRLSKTGGTSLGGTGKKKVKGKLNIGGGDSFRTD
                     KINDMLEDDDDDFGDEDFM"
     gene            <850471..>851029
                     /locus_tag="FOA43_003066"
                     /db_xref="GeneID:62196467"
     mRNA            join(<850471..850473,850529..850910,850968..>851029)
                     /locus_tag="FOA43_003066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923344.1"
                     /db_xref="GeneID:62196467"
     CDS             join(850471..850473,850529..850910,850968..851029)
                     /locus_tag="FOA43_003066"
                     /note="BUSCO:EOG093449UV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779272.1"
                     /db_xref="GeneID:62196467"
                     /db_xref="PFAM:PF05348"
                     /translation="MSLRIVPEEKQLTDAKNTQFGPAAPSAPGVVDTLRSGEAPLSIS
                     SKVNNRHPLQSRIEKWDQTQRDLQLETYRRTFGVADPIRREMELNIVKETDFRPTLFG
                     FSAITSPSLDILLNKETTIGWEDIYTGFNDAKPTDFHTEMEKQMGI"
     gene            <851346..>853781
                     /locus_tag="FOA43_003067"
                     /db_xref="GeneID:62196468"
     mRNA            <851346..>853781
                     /locus_tag="FOA43_003067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923345.1"
                     /db_xref="GeneID:62196468"
     CDS             851346..853781
                     /locus_tag="FOA43_003067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779273.1"
                     /db_xref="GeneID:62196468"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="InterPro:IPR035445"
                     /db_xref="PFAM:PF02213"
                     /translation="MSTYQSQPQSTKTWFNSNSDDILSNSQLPVNSEQQPMGVDQSAN
                     AQALSISMQSLFAIYSSMAENHQLIPGHSDANFKSNGITRPLHVDVLIQQQQERQKKL
                     QNADALASKLAGIALRDSDGSRSSGSPASQLSSLSLMPGGSVQQRQQLDNSSSVTEPT
                     SASNGMPAPGLQRQISDASQQRPMTPHMLDPSQIRWYYLDPRGIQQGPFDGNTMQQWY
                     TQKYLALDLCIRREGHSNYKTLGDFVSFIGEYQYPFSVPLPVVHVPVNSGPVVQIETP
                     GTPVNSAATPSAAVEIAGTSSGPVRSSFQAFESTSGFLASSDPSAPSAPSALSALSAP
                     SSSSAWSVGNADFFKNDMYANPSFLHSDAALNVSGKLFGNDDKKLKQLEPEVLLQSQP
                     EPRSEPLSELHSESQVEFSKPKSKKHKLEKIRAEPKSDFLEESEIKTPSKHHIQPHVV
                     KTSESSKPSKKGSKTVIAPWASSTAQSTAPPRSLTDIQREEEEEKKKLEVKARSLLEE
                     QDRLLASKLALEEERGDSISDDLSSYVMQQPDNDSASLPTTSTWGSSSGNNVVKQPVK
                     SLEEIQREETRMAVAKERALAASHHQKSIASAIAAQKQTFASSVSSGSSRSNDSSWTV
                     VTSKKVKSVATNGSALSALHRQHTATSLSPATLRSVSSNAHAAAYGSSNAKVIKAVAT
                     TAPSSSGDYFAAKQFLAWCRVQLQGLYTTVNREDVLSIMLQLPAGSESTEIISDTIYS
                     NSSVMDGRRFAGEFNKRRCKVEEYVVKQGYDFNWQELLQNRTTTSTASASHDDSWDTA
                     FTKVVSKRSRRRN"
     gene            complement(<853913..>854560)
                     /locus_tag="FOA43_003068"
                     /db_xref="GeneID:62196469"
     mRNA            complement(join(<853913..854354,854556..>854560))
                     /locus_tag="FOA43_003068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923346.1"
                     /db_xref="GeneID:62196469"
     CDS             complement(join(853913..854354,854556..854560))
                     /locus_tag="FOA43_003068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779274.1"
                     /db_xref="GeneID:62196469"
                     /db_xref="InterPro:IPR018624"
                     /db_xref="PFAM:PF09802"
                     /translation="MSRRKIDKLQSMKPLFYENRPKEMYIQLKNQTEPKVNSKVLKAA
                     LIRRGSEAIRRMFKLKECEPYFNILYMKGYIGDEDHERLKIQKKLQELELTQLAMEAE
                     SFKKGWAQTFFPVCQETTMNEALRRRIKSIDDRKDQHSKQWSVTDI"
     gene            complement(<854728..>855564)
                     /locus_tag="FOA43_003069"
                     /db_xref="GeneID:62196470"
     mRNA            complement(<854728..>855564)
                     /locus_tag="FOA43_003069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923347.1"
                     /db_xref="GeneID:62196470"
     CDS             complement(854728..855564)
                     /locus_tag="FOA43_003069"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779275.1"
                     /db_xref="GeneID:62196470"
                     /translation="MPIPSTNENLLVTFLVKPLVFIVKIPFLVVSTLGLILLSPIGQL
                     CKPLLYLYLAVFFNLSQTELLVDGVKKSNQSTINSKRPNKGDIIFVNFSSPLDSLVLY
                     ISCRCSSAVFYTINEQGQLAKVGSPLNCFKFALQQTHQSSVSHSLKVTDHSRAIFVLV
                     EGTTTNNRSVMRFPKKFDINKFVETNTNDHRFKALSIKIHPTDLACTPLPESWFTFVY
                     NNVSNFRLDLRYRMKLFEMDRKTEITEQSIRESLSNYGKLKLLGEYLDIAKKKEFVQS
                     YS"
     gene            complement(<855704..>857311)
                     /locus_tag="FOA43_003070"
                     /db_xref="GeneID:62196471"
     mRNA            complement(<855704..>857311)
                     /locus_tag="FOA43_003070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923348.1"
                     /db_xref="GeneID:62196471"
     CDS             complement(855704..857311)
                     /locus_tag="FOA43_003070"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779276.1"
                     /db_xref="GeneID:62196471"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="PFAM:PF04515"
                     /translation="MFSPPPYSSVHLNEDNENEEPPEYEYSFEKPRIPVESDSFDKSF
                     RVDHPKFNDGIFTIIFLTVVLLFIIITTLCFKDLTVNAPFLESVSQAYLTPTSDTSDK
                     NKRDLILLALTTVGTPIICSMVALLLAYLFPMFFVFIGYFIIPLTFFSVATISFANGA
                     ALIGLLFFFLGILSLTFIYQNYSKLSFTALMLKIVIEVMRLHPSIPFVSFLGSISSGL
                     IGLVYMFMTAIIYADRIRIDDRTCPTDDPENQPCVSATSTWIYIYVLFTGYYIFEVLK
                     NLVHVTVSGVYGSWYFFEKSPLKPLHPAWGAFKRAVTYCFGSICFGSLIVSVIRAMRQ
                     ILAVLQQKLAERRTHRGSSSDDFGANAFIYCILACIVSIFDFIFAQAEYWIKWFNQYA
                     YSYMALYGKSYLASARDTFEIMKYKGIFILITDCLIGATLTFYSILTCVLSSGIFYAA
                     IVGFQKNTNVAPEFIVGGFIVQLLLAYFITSVTLNSINSGFITFLVALCIEPEIFEAN
                     YHDYFVKMTNYYPEVSQSLKVPFPEGV"
     gene            <858322..>859296
                     /gene="XYL1"
                     /locus_tag="FOA43_003071"
                     /db_xref="GeneID:62196472"
     mRNA            <858322..>859296
                     /gene="XYL1"
                     /locus_tag="FOA43_003071"
                     /product="NAD(P)H-dependent D-xylose reductase (XR)"
                     /transcript_id="XM_038923349.1"
                     /db_xref="GeneID:62196472"
     CDS             858322..859296
                     /gene="XYL1"
                     /locus_tag="FOA43_003071"
                     /codon_start=1
                     /product="NAD(P)H-dependent D-xylose reductase (XR)"
                     /protein_id="XP_038779277.1"
                     /db_xref="GeneID:62196472"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="PFAM:PF00248"
                     /translation="MPKLITLNNGVKIPQVGFGCWKVPKDICPQQIYDAIKVGYRMFD
                     GATDYGNEKEVGKGLRKAIADGIVKREDLVIVSKLWNSYHSPKNVKLVVNKILSDLGL
                     DYLDVLYMHFPIAQKFVPIEERYPPGFFCGTEGVWEYENVPIAVTWAAMENLVKEGLV
                     KSIGISNSCGAVIQDLLRGCKIRPQLLQIEHHPYLVQKRLVEYVQAQGIVIVAYSSFG
                     PQSFVEMDNPMAVNCPKLFDNPTIKKIAQAHKVSAAQVLLRWSTQNGICVIPKSSKKE
                     RLLSNLQSDKFNLTEAELNEIDGLNRNLRFNDPWDWSDDPKTKIPTFI"
     gene            <859464..>860339
                     /locus_tag="FOA43_003072"
                     /db_xref="GeneID:62196473"
     mRNA            <859464..>860339
                     /locus_tag="FOA43_003072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923350.1"
                     /db_xref="GeneID:62196473"
     CDS             859464..860339
                     /locus_tag="FOA43_003072"
                     /note="BUSCO:EOG09342V25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779278.1"
                     /db_xref="GeneID:62196473"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR036526"
                     /db_xref="PFAM:PF00795"
                     /translation="MSVPIAKSIKVALLQFYAGSDKIANLSKAKEYFLKALKKEPDLD
                     LLVLPECFNSPYAVDQFHNYCERIPGGETTNMLSKFARENSINIIGGSFPELGEDGNV
                     YNTSLTFNKSGEIVAKHRKVHLFDIDIPGKMTFKESASLHSGNKATVFDLEGLGKFGL
                     AICYDIRFPELAMIASRRGAGVMCYPGAFNTVTGPKFWTKFGVARAIDNQNYVILCSP
                     ARNPNGGYQAYGHSMVVDPNGDVLIEAGHGEEIVYAELDPQVEIDARTSIPLSSQRRF
                     DIYKDVSKDAVTSAL"
     gene            <860476..>861353
                     /locus_tag="FOA43_003073"
                     /db_xref="GeneID:62196474"
     mRNA            join(<860476..860483,860534..>861353)
                     /locus_tag="FOA43_003073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923351.1"
                     /db_xref="GeneID:62196474"
     CDS             join(860476..860483,860534..861353)
                     /locus_tag="FOA43_003073"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779279.1"
                     /db_xref="GeneID:62196474"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF06999"
                     /translation="MCLSMLKSFFSAFSSIQVTPLSGAYKFVSCPQPVKDTGCTYCEL
                     PQFPSNRQIDYERQLRNSKVALYKHALILHGLPDHKAWPRRFEMAPDSIISTLNALKR
                     QYTDGYHPSLISMTSLQEPANVDCQLVGLYPDGLVIHVPNSRLKDFTRAFLDGKGGED
                     SKEKAALRETFKTRKLLKDYVLVCGHYKRDIRCGLLGPLVKAEFEKAFQLAQVPKEKV
                     GLGYISHIGGHSFAANVLIFKKNGDVIWYGRVEQRNVQGIVLKTVLGNEIIEELYRG"
     gene            complement(<861383..>865558)
                     /locus_tag="FOA43_003074"
                     /db_xref="GeneID:62196475"
     mRNA            complement(<861383..>865558)
                     /locus_tag="FOA43_003074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923352.1"
                     /db_xref="GeneID:62196475"
     CDS             complement(861383..865558)
                     /locus_tag="FOA43_003074"
                     /note="BUSCO:EOG093402XG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779280.1"
                     /db_xref="GeneID:62196475"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR010080"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR014397"
                     /db_xref="InterPro:IPR020806"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="InterPro:IPR036736"
                     /db_xref="PFAM:PF00501"
                     /db_xref="PFAM:PF00550"
                     /db_xref="PFAM:PF01370"
                     /db_xref="PFAM:PF07993"
                     /translation="MSSLEFWLDFLGSPTLNSLPSDFNRPTNGQIDEQKRIISDLSDG
                     QSSFLTNLTLFVILVYRLSGDEEITIATDNDKFEPFVLKLTLDDPNSSFHDLYEQVTH
                     LYDQLSQKVVPLNQIVSALQDKRSLDTAPALFRVSFQHSRGSEEKLATSVNGSVRDLA
                     LFQQENGQINVFYNALLYREKRLEYFGEQFRQTANSFAEDSSLPISKVSLITSSQKTI
                     LPDPTADLDYSNYRGAIQDIFSDNAAKFPDRTCVIETASFLDPKTYDRTFNYRQIDQA
                     SNIVGNYLVKTHIKRGDIVMIYAYRGVDLMVAVMGVLKAGATFSVIDPAYPPARQNIY
                     LKVADPRGIIVIKKAGTINQLVEDYITNELHVVTRIDALELQDDGCINGGEDNNQQDS
                     ADILQPYEQYKSQRTGVLVGPDSAPTLAFTSGSEGIPKGVLGRHFSLAYYFPWMAKTF
                     HLNEKDKFTMLSGIAHDPIQRDMFTPLFLGATLLVPTQDDIGTPGRLAEWMAEHGATV
                     THLTPAMGQLLSAQATAKIDSLHHAFFVGDILTKRDCLRLQTLAKNCYIVNMYGTTET
                     QRAVSYFEITSRAKDRYFLETQKDIMPAGKGMDNVQLLVVNRHDTLQTCGVGEVGEIY
                     VRAAGLAECYRGLPEKNKEKFVNNWYTTPDEFIARDKALDKGESWRKFWKGPRDRLYR
                     TGDLGCYLPDGNCECCGRADDQVKIRGFRIELGEIDTHISQYPLIRQNVTLVRNDRNG
                     DKTLISFVVPKLNSDLENYYETNEKTEHIADPIVKGLVEFRKLIKSLRAHLKKRLANY
                     AIPTLIIPMTRLPLNPNGKVDKPKLPYPSQAQLSEVAKFSEQDEQNITFSEMESKIRD
                     LWLDVLPNRPASVYPDDSFFDLGGHSILATRMIFQLRKKFRIDVPLGTIFKHPTISSF
                     AAEVERVEKHDSSSVEQTTSVDYYEDAVNLCTTMLKPAYATKYGLDRSGEINVFLTGC
                     TGFLGSFITSELLSRSDKVNIHIYAHVRAKDTEAGMQRLVNAGTTYGLWKDSWRKRIT
                     VVLANLAKPQLGLSDAVYRHLSETIDVIIHNGAMVHWVYPYSQLRNANVISTINVLNL
                     AAQGKPKNFSFVSTTSTLDVEHFNALSDKLVAEGKKGIPESDDLMRSSKGLGNGYGQS
                     KWSAEYIIRRAGERGLRGAIVRPGYIQGSSLSGAANTDDFLLRMLKGCLQVGEYPDIK
                     NGVNTVPVNHVARVVVSSALHPPIFDGKTNLPVVQVTGHPRIPLNKMLASLTQYGYDV
                     SETHYTNWANDLERYVIDEGHSDCALFPLLHFVLGNLPETTKAPELDDSNATETLKED
                     VRWNSDGHDYSDGTGVTLEVMGIYISYLIKIGFLPVPSDKGPLNLPVAEVSEDSLELI
                     RGGAGKRSSAAIK"
     gene            <865898..>867964
                     /locus_tag="FOA43_003075"
                     /db_xref="GeneID:62196476"
     mRNA            <865898..>867964
                     /locus_tag="FOA43_003075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923353.1"
                     /db_xref="GeneID:62196476"
     CDS             865898..867964
                     /locus_tag="FOA43_003075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779281.1"
                     /db_xref="GeneID:62196476"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="InterPro:IPR038635"
                     /db_xref="PFAM:PF04065"
                     /db_xref="PFAM:PF04153"
                     /translation="MSQRKLQQEIDRTFKKVNEGIEEFDYLYDKLQESDSQSQKEKLE
                     GDLKKEIKKLQRSREQIKNWMGGNELKDKKQLGDYRKKIEREMERFKEVEKIMKTKAF
                     SNEALASGTLTLDPRQKEKVKCSQFLEVNIDELQRQSEAIEADIDRVYASMKKHRSDS
                     SKQKEIEEQDVRLKNHKYHISMLESVMRHLMNDKLQVDQINEIRDDIEYYVESNDDPN
                     FIEDNDFYEELGLDETTGEFTVTGVDDESVVDSSQESTPAPTSVLATTPVVSSAMAAS
                     STSSVSASPSSSHRRIKDKDLDKEKDNDKDKDKELKKQTTRLSSVSRVSSQTARPISA
                     LAPSRSSSISEIHPVTVAQTLASQLSHTQHSSPKSKVATLNGGLKPSTPVGTPKLRYS
                     TVASAALYQNHSQSAIMSTAQDQRQMSSSQSQSIMAQKLVDSKDHLQSSSMDVTGSSV
                     SADSSSFSTSSSNSKDTVAEIQKSLSFMNLSSYTNLPGGFDKYVRALETAKERLVDCH
                     EDENSTRKSTNGTCASYPFDLKLPSFESIFPQLESSLLNCPDSYDADTPKNYVPSNQF
                     VTQPCFPQEPAVEVIGSTKLLKKLELDTLAYCFYYHNQRYQSSFSNVHHSVNNGDHDY
                     LQYIAARELHNRNWRYDKQSRSWFHKDDEQDATDWKFFDYKDTWMVRRKENFQFNEDQ
                     EEAAFF"
     gene            complement(<867981..>868518)
                     /locus_tag="FOA43_003076"
                     /db_xref="GeneID:62196477"
     mRNA            complement(join(<867981..868413,868466..>868518))
                     /locus_tag="FOA43_003076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923354.1"
                     /db_xref="GeneID:62196477"
     CDS             complement(join(867981..868413,868466..868518))
                     /locus_tag="FOA43_003076"
                     /note="BUSCO:EOG09343SOB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779282.1"
                     /db_xref="GeneID:62196477"
                     /db_xref="InterPro:IPR002115"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="InterPro:IPR036196"
                     /db_xref="PFAM:PF01451"
                     /translation="MTTQNQPIKVAFVCLGNICRSPMAEAVFKKVVQDNDLSDCFSEI
                     TSFGTAAYHTGETPDHRTVRVCKERNVPINHRAQKISADHFNHFDYIICMDNANLHTL
                     KSRNPGNSKAVVQLFGHWKEDSLVSEEVNDPYYGGVDGFEACYQQCYHFSQVFIKREL
                     D"
     gene            complement(<868639..>869628)
                     /locus_tag="FOA43_003077"
                     /db_xref="GeneID:62196478"
     mRNA            complement(<868639..>869628)
                     /locus_tag="FOA43_003077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923355.1"
                     /db_xref="GeneID:62196478"
     CDS             complement(868639..869628)
                     /locus_tag="FOA43_003077"
                     /note="BUSCO:EOG09342VEG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779283.1"
                     /db_xref="GeneID:62196478"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="PFAM:PF06391"
                     /db_xref="PFAM:PF17121"
                     /translation="MVELDWNNVPKDMCPVCKTDKYLSPEIQFKINPECYHKICDSCV
                     DRIFSLGPSPCPYPNCGKILRKNKFKTQIFDDLEVEKECDIRRRVLSIYNKKEHDFAS
                     TEVYNKYQEEIEDIVYRMLYKIDIEKTEEQLKEYSIANKQSIRLNNARRDQEYEKFIR
                     LQKLEKQYKSERIRLNRLIVQEQTNLKSLEKIKAMDQLQESSEEKDPDAVIKSVKESM
                     KKQSSKYKKQLEDLHKKYKRQKEAIIKNQQSSSKKNQDAALRVPFTPFDGDRLSPKPY
                     HLDPSKYKDPYLEKMVSDVQFKAGGYKLDDYYERSLNEAFTGLNCFIEEEKVN"
     gene            <869793..>870917
                     /locus_tag="FOA43_003078"
                     /db_xref="GeneID:62196479"
     mRNA            <869793..>870917
                     /locus_tag="FOA43_003078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923356.1"
                     /db_xref="GeneID:62196479"
     CDS             869793..870917
                     /locus_tag="FOA43_003078"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779284.1"
                     /db_xref="GeneID:62196479"
                     /db_xref="InterPro:IPR019038"
                     /translation="MISQESIDLINSQIFENKQPLTYKVLSRKLKISNESSRDLLESY
                     YDKYKEQHHQLCPTYILMGTHSHESDQNNVGDYGEDSGSMLIKLCKLSELEESKKQFR
                     RVDSSFIYSLSIGDVSLNNIAAVNETIPPTSESDCGVYGVIRTPTSGIFDKPLVEKKQ
                     VKVEEKNDNRTIAAEIKTVKEETDPFASYRARKSEEKKAEREAKREAKREVKREVKRE
                     VKREAKRNRVVIDEAPSRKRTKIESDKAREQEEELSKMFEDDDKDAMEVTNPEEKGID
                     TTEDKAESHADEINKSLDEEPQADETNAQKSQTDDVKTYVDDDGYMVTVKSSKSRSKP
                     PKAPKGSRKPSSFDHKLETKKKGQGPKKQSSLMSFFGKKR"
     gene            <871048..>871836
                     /locus_tag="FOA43_003079"
                     /db_xref="GeneID:62196480"
     mRNA            <871048..>871836
                     /locus_tag="FOA43_003079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923357.1"
                     /db_xref="GeneID:62196480"
     CDS             871048..871836
                     /locus_tag="FOA43_003079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779285.1"
                     /db_xref="GeneID:62196480"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF13241"
                     /db_xref="PFAM:PF14823"
                     /db_xref="PFAM:PF14824"
                     /translation="MSSIPSIQSGGSLMLSWQVKDRHVLVVGGGSIGLSRVNHLLEAD
                     AKVTVISEKMDPVIEKYGELEMMERNETRKFCFDDLQMYETSNRDELAQLDLTEPENV
                     QLVEDFDRNQRFALVLVCINDHELAKKIYYRCKQLGLNVNLADKPDLCDFFFGSVYRK
                     GSLQIMISTNGRSPRLCNRLKNFKIKPMFDGLDVNTAVENLSYMRNQLRQTIHPGDNP
                     KTIEERMEWNKQVTDFYSIEDWCEMEKNDVDQIVSHYPDLPSLM"
     gene            complement(<872094..>874094)
                     /locus_tag="FOA43_003080"
                     /db_xref="GeneID:62196481"
     mRNA            complement(<872094..>874094)
                     /locus_tag="FOA43_003080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923358.1"
                     /db_xref="GeneID:62196481"
     CDS             complement(872094..874094)
                     /locus_tag="FOA43_003080"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779286.1"
                     /db_xref="GeneID:62196481"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MPSQQQTETSKVHEHSNEPTELTTPAASSPTNTAQSPSANSSLP
                     LPKPPINPGNTVPAKTLWMGDIEAWWDEGYLVQLWAKLGLAVMVKVIKPKRNLILRQL
                     AKSNGQPMLNHSGYCFVEFDTPQQAQEALALNGSPIPDSGNKLFRLNWATAATLNSQI
                     EQTPEYSLFVGDLSPVTTEAHLLSLFQTHFNTVKTVRVMTDPATGLSRCFGFVRFSSE
                     VDRNRALGEMNGKWLGGRLIRVALATPKHQASLGYSGNEAPGGSPLTVGAIGPMGSMG
                     PMGPMGPVGPVGPMGSIGSMTDVEPRDIYMSAPMGYYAATTPQRFGASASPTTAQSSS
                     STGINSITGASSQPGYADPTNTTVFVGGLAASVSEDTLRTLFEPFGPIVHVRVPPGKG
                     CGFVKFEDRGSAQQAVAGMEGFVIGGSRIRLSWGRSSNRNRQHQQQQLEQQQFQPAFQ
                     FQRLQAEPPQGQSQQVQQAQARQMMMAAMTGPPSGGASLAPGRFDFSGPIPPRMAAPS
                     TNGGPDQPTVFTAPQGGPLGPSAGLVEIPPGTQLFYDPYFASNGAPLEPQESGFTTTS
                     LATRQESTVTTSNDAPNSQIAPTELALNGAVAGMTLEDMPQQFYDQSGQYLYMAPPFP
                     NPMMPLMTGKNEIEETRSGAERPGNTLHQNGNHGGPDSKSDR"
     gene            <874900..>876201
                     /locus_tag="FOA43_003081"
                     /db_xref="GeneID:62196482"
     mRNA            <874900..>876201
                     /locus_tag="FOA43_003081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923359.1"
                     /db_xref="GeneID:62196482"
     CDS             874900..876201
                     /locus_tag="FOA43_003081"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779287.1"
                     /db_xref="GeneID:62196482"
                     /translation="MLSREARKELRKRGAARRTVDLDDLVLKTPPIKDSKENLLSSSS
                     RESSSDEGSNEKSSEKSSEKSSEKSNAKSNEKSDEKSNEKSNEKSDEKSSEKSNAKSN
                     EKSDEKSNEKSNEKSDEKSDEKSNEKSNEEKQIRRRTLRSSDYDVIVVGERKSKGISP
                     VAEKTMRRKTTKKRGSLLKKEANVKKRRLTSNPEDEFKEEDVDSSGLELRPVSEEAYQ
                     SSKSRIATSYQQKVESRTVKSHKRGRKKQHNGMVQIKYRRMPANRTKIITIDVIGQIL
                     SDYFSKKSLEKTKFGKFLASYRSILNEYFDLLIDLQLSNNLILYDLSAVNRQKNQCRL
                     EIFNTREERNENSVKINSLRQGYMELKKKYDEKLRMYNNLLELKGDSNANLEKKPHGT
                     SNQLPLVDFALVDLKKVVEPGFNLIDKLKAVNDQIGKLVED"
     gene            complement(<876316..>876735)
                     /gene="ERV14"
                     /locus_tag="FOA43_003082"
                     /db_xref="GeneID:62196483"
     mRNA            complement(<876316..>876735)
                     /gene="ERV14"
                     /locus_tag="FOA43_003082"
                     /product="COPII-coated vesicle protein"
                     /transcript_id="XM_038923360.1"
                     /db_xref="GeneID:62196483"
     CDS             complement(876316..876735)
                     /gene="ERV14"
                     /locus_tag="FOA43_003082"
                     /note="BUSCO:EOG09344DZJ"
                     /codon_start=1
                     /product="COPII-coated vesicle protein"
                     /protein_id="XP_038779288.1"
                     /db_xref="GeneID:62196483"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="InterPro:IPR033466"
                     /db_xref="PFAM:PF03311"
                     /translation="MNGEAWLYILSVIVNAVNLFLQVFFTIMYSDLECDYINPIELCN
                     KLNKYIVPEACVHGVLTLLFLLNGQWFSFLLNLPLLGYNANKIYKKNYLLDATEIFRT
                     LSKHKKESFIKLGFHLLMFFYYLYRMIAALISDETLD"
     gene            complement(877077..877148)
                     /locus_tag="FOA43_003083"
                     /db_xref="GeneID:62196484"
     tRNA            complement(877077..877148)
                     /locus_tag="FOA43_003083"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:62196484"
     gene            <877845..>880361
                     /locus_tag="FOA43_003084"
                     /db_xref="GeneID:62196485"
     mRNA            <877845..>880361
                     /locus_tag="FOA43_003084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923361.1"
                     /db_xref="GeneID:62196485"
     CDS             877845..880361
                     /locus_tag="FOA43_003084"
                     /note="BUSCO:EOG09340YP9;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779289.1"
                     /db_xref="GeneID:62196485"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="PFAM:PF12751"
                     /translation="MIESEPIRPSLAPKGARDNNSKETDSKEESRTTKASFIKFPDNK
                     NKAAASGLMTVVQEQADSYKVIHIMPPSDNNKVKEREQNREASTGDERDVVGSTISAG
                     VQRPISRKSSSLGISNIDTEVENGGRIEEVKALSSRGASNSGITGGGASALLGVPGGL
                     DGSGEFSIVGGVSDESVVANAVSADVNNRPAAPSETGHQVHGNTVDNPDSFLNHLRNK
                     KSTLDAGISSSQKTTPNGSQADIAKQKRSSAATPSILNLRAAIGQSGNLNTVSSTNTV
                     QSKGSTRAEFFAAKLHDAIKDDQKNNSDSEETFVYDTAPENSQEQNQINRDVTLVAER
                     SSAQQQNDNQIDLPPSLNEDVYSKSENSSREMSHSKLPSLLAQRKLSANALGCTGNFI
                     QGSSSVTAHTTDADDALDAYSRTSAASRLHRKTSRMDSLSVIANQPDATNAVTTGEPP
                     HNELREITSRIFDSKGVPPRKYSGIDVGDFSFDEDDEDELNEMYGNRQNNANMNNNQL
                     GTLGTIPSSMDYDSDLDDEYSLADPAKPSHGYGQYGTFNSLNRVYPNVVPTYDSKVDE
                     PQDPLLLDSNHEYLPNKQGASKLLRKKKKNLYFNPHDFTSSRAKRLRQLRNFCYTIGL
                     IFLLLSVGFIGGFILATSKELQSTKVTSIRDILISDEEFVFNIEIESFNPGVMPVSIY
                     DVQLDVFAKTQYVVDAYTYTVKDAKKNKPKEKEKPYSTILLGSMKELDIPLRFQGGCF
                     TRQKDSSLTEMKIMNPCSFDDDDKNGDGDNMRINKPEEPPSGSPPDIREPSRKWLNIS
                     RNPFDLIVRGVLNYQLPVSSSNKTVAISYSYSVEPDKLKI"
     gene            complement(<880492..>883104)
                     /locus_tag="FOA43_003085"
                     /db_xref="GeneID:62196486"
     mRNA            complement(<880492..>883104)
                     /locus_tag="FOA43_003085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923362.1"
                     /db_xref="GeneID:62196486"
     CDS             complement(880492..883104)
                     /locus_tag="FOA43_003085"
                     /note="BUSCO:EOG09340X9G"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779290.1"
                     /db_xref="GeneID:62196486"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="PFAM:PF10291"
                     /translation="MSESPEDQHVTYSSTILVEKPPIEAMEALKVRNSQLKEINHQLA
                     EWLTAYGRLRLKYVDELKKLTYKGDVLFTESTNSKLHNDRIDSLGFVSPMWSSLLQIA
                     HDEGRYFDSTTRMMGRDMIAPLKLYTRRNGSILVEMDEIVELARKIASSEKSGKEDAK
                     SMTQWSERAPSFFEVFERYDYNRLILLKDVFLKYQTEMSDVLTNFKKDSEAGMEHVLS
                     FNPSDEMKRFADAVNEKTLPIHTIKAPKIEEDVSSGIGTTGTAGATGAAAIASGASEA
                     SVRVASGASTVRTVPQSGSKRLSILPGHRRNQDRNRQESIGSFTDNPAARVSNSSGST
                     LHKKKGMRSRFGTIFHRKKKDKESDSLRSSTIAESETESLATHETRSSTRQEKHTKAK
                     ELKQEPKEEPKEEPKEINKEPKEDPKEGPREETNEDPKEEPKEDSSAAEKETKSAVSE
                     DHMESPAFYPAMRPTKRSGSGASGTLSQITPEQQEEGQSANSTTLDPAVPQPASVSTN
                     DPPPPPSSRKHVGSELSSPTIPPARSLRGSVPLPPAQRRISTMESLKPANTGLSSQST
                     GLSGNVTGGGGLVSGQIVHPSLTNPGLNASIVELFNASFKSGKVIRSNAIGEIAFSYI
                     LEEPIKRIPSRINLLLSSKSDALLPAFVVNPLFLQQGTKSPNSFVLSQPSQINLRTVG
                     GLKYMLNDPIPPIVIHSIWKHEPSKSTVIISLKPAMILEKYLKEGKVILSNLLVSVSI
                     QDAHAISAATKPSGSFSREKSRITWNLPDGIVFDTSKKEERLIARFITDGIARESDSG
                     VQMRFTINGEDGASFVGGLSNDLEILAEDEDMIEDPFSSTSSLPDTKPAASGDWLEVP
                     TLKTVVAGGYSGHV"
     gene            complement(<883831..>885315)
                     /locus_tag="FOA43_003086"
                     /db_xref="GeneID:62196487"
     mRNA            complement(<883831..>885315)
                     /locus_tag="FOA43_003086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923363.1"
                     /db_xref="GeneID:62196487"
     CDS             complement(883831..885315)
                     /locus_tag="FOA43_003086"
                     /note="BUSCO:EOG09341DQB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779291.1"
                     /db_xref="GeneID:62196487"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01494"
                     /db_xref="PFAM:PF08491"
                     /translation="MSSQPDNNTVYDIIVIGAGVVGPCIAKNMARQGRKVLIAEREWN
                     LPNRIVGELMQPSGLKALRQLGMIKAINGIEAIEVDGYYIEFNGKEVTIDYPSKNVES
                     KLNNTPVPGAIKTGDEDKVGSDSTISAKKWEECPHVKGCAFRHGEFLTNLRDQCLSEP
                     NVTKLDGNVTGLVKDDDQRVCGIKVADKGVFKGRLIVNCDGIYSKFRKEIGEDYVPTV
                     GSYFVGMELIDAKMPRPNHGHVLLGKHAPVLLYQISPHQSRILCAYRSKTLPKRNDVL
                     QYLRENVLPQLPKSLCPSFKAALEKDGQDIYRAMPNQYLTARLNNTPGFICIGDSLNM
                     RHPLTGGGMTVGLNDAVMFCKMLSDVSNEDLADEEIVLEKMIDFHNERKSLDVIINTL
                     SIALYTLFAADSKYLTILQRGVFGYFLKGGLCIEEPISLLSGLTPSIWTLFVNFFAVA
                     FYACQLNFIARGILGFPVALFENIGVLITAAFVLLPLLLKEILS"
     gene            <887458..>888039
                     /locus_tag="FOA43_003087"
                     /db_xref="GeneID:62196488"
     mRNA            <887458..>888039
                     /locus_tag="FOA43_003087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923364.1"
                     /db_xref="GeneID:62196488"
     CDS             887458..888039
                     /locus_tag="FOA43_003087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779292.1"
                     /db_xref="GeneID:62196488"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF12874"
                     /translation="MQWNSKVTDFNLNGVSEANGDSGSGTNLQSLQSSQSVASAAAAM
                     ASMQPSMISMTSFHTQNSSKVQRPQKFACTYPNCDKTFSRRMNLKSHIQSSHEHKKPF
                     QCSVCLKTFARHSDRRRHENNQHKTASGFVCGGLLKNGQRWGCGKVFKRKDGLIAHWR
                     SQKARKKCLKNLPTDDASMLGLMQDSGKPLEFS"
     gene            <888243..>889034
                     /locus_tag="FOA43_003088"
                     /db_xref="GeneID:62196489"
     mRNA            <888243..>889034
                     /locus_tag="FOA43_003088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923365.1"
                     /db_xref="GeneID:62196489"
     CDS             888243..889034
                     /locus_tag="FOA43_003088"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779293.1"
                     /db_xref="GeneID:62196489"
                     /translation="MNPIYLLLETLGLLTGFVNAGSIQPYPMSDSDISTYASFRKGDM
                     IPLECTKRQIDTGEHFFDEKGNIIYIDFPICRETRKPPLLYFGVDQQFKCTIHFEDKI
                     YHLFQLYLHQDAPFSCRLPVKPDSAMYIPFTVQMRGDVLESHFNLDPNVNLLLFSDNL
                     QDGQIVSGTSFSSSVNTTRVIIGDFVELNFDVRWTTLKQIREGTEEEDEKKGIVTYRL
                     PEDFTAFWYSVIAVSSILLGSIITLVFSYKRLNRKLHASYIDKVE"
     gene            complement(<889044..>890462)
                     /locus_tag="FOA43_003089"
                     /db_xref="GeneID:62196490"
     mRNA            complement(join(<889044..890199,890455..>890462))
                     /locus_tag="FOA43_003089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923366.1"
                     /db_xref="GeneID:62196490"
     CDS             complement(join(889044..890199,890455..890462))
                     /locus_tag="FOA43_003089"
                     /note="BUSCO:EOG093427E2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779294.1"
                     /db_xref="GeneID:62196490"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="PFAM:PF08640"
                     /translation="MLRWTDFEHRIMSMGSKPTDYLNYVKYEKNLDKLRKLRLKRMKS
                     FVDSKPSISDVSGQRRIFFIFERGVRKFPKSMDLWANYLKYAKKNGSVKVVYKIYTML
                     LQHQPRNVNVWLSAAKYEYESNKNVKSARNLLKRCLRFNGDELLPWMEFIKFEMNYLS
                     KLLVRRKLLNLITEKQQQQDLKENEEVHKDGLAEGDEVVSLGKAAADEVNEATEADEL
                     SNLPDLNMSTLGSIEDNPVLRGDLIMTLYDVCVATMIKSLQEENDKFSKTWEICTKVM
                     AIVDKFDTLDRGYLCTHIVNDLMDRYPFNDTVIFLYLTLPLRYVSIDDNEFVSTLQIS
                     VKLYQSWTYRTKAEEGVKNSIKKQYLNFLTERYLSQAQNDTKELLGLLMKKLN"
     gene            complement(<890478..>891794)
                     /locus_tag="FOA43_003090"
                     /db_xref="GeneID:62196491"
     mRNA            complement(<890478..>891794)
                     /locus_tag="FOA43_003090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923367.1"
                     /db_xref="GeneID:62196491"
     CDS             complement(890478..891794)
                     /locus_tag="FOA43_003090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779295.1"
                     /db_xref="GeneID:62196491"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR016827"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="PFAM:PF00249"
                     /db_xref="PFAM:PF00569"
                     /db_xref="PFAM:PF04433"
                     /translation="MAKFHCDVCSSDCTRRIRIKCAECTDYDLCVPCFAKGRATGKHK
                     PWHAYRVIEQHQYPIFDKDWGADEELLLVDGCQTLGLGNWHDIADYIGGRSKEEVGEH
                     YEKVYLNSEYYPIPDLNQSFPQLSTTRFLSRRKERLDARKNLPLPPPTKILTSGPLCS
                     DIQRYMPGRLEFEEEPDDDAEKVIQDMVFDPEDSEQDVELKFMILRIYDEKLTIRAER
                     KRLILKDGLLNYKQNNAVDRKRTKDEKELYNRIKPFARVMSNEDFPVFSQEVMNEFKI
                     RNRIYQLQNWRRNGITTIDQGEHFEKEESNRLARISLPSSGTRHSHSHSHSGRHSRSQ
                     TPESSSKWSRRKGGSMLSSIYSDHPDITAAPDYELLSPEERHLCTTLNILPKPYFAIK
                     EALFRELLSNCGQLNKKAAKEMLNIDSTKISKIYDFFVSQRWCRAN"
     gene            <892284..>892691
                     /gene="RPS17A"
                     /locus_tag="FOA43_003091"
                     /db_xref="GeneID:62196492"
     mRNA            <892284..>892691
                     /gene="RPS17A"
                     /locus_tag="FOA43_003091"
                     /product="ribosomal protein S17A"
                     /transcript_id="XM_038923368.1"
                     /db_xref="GeneID:62196492"
     CDS             892284..892691
                     /gene="RPS17A"
                     /locus_tag="FOA43_003091"
                     /codon_start=1
                     /product="ribosomal protein S17A"
                     /protein_id="XP_038779296.1"
                     /db_xref="GeneID:62196492"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="InterPro:IPR036401"
                     /db_xref="PFAM:PF00833"
                     /translation="MGRVRTKTVKRAAKTLIEKYYPKLTMDFETNKRLCDEIAEIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEDERERKDQYVPEVSALDLSKTKGLLFI
                     DADTDDMIKSLGFKLPTSVNTVSANRVPRRFRK"
     gene            complement(<892842..>893498)
                     /locus_tag="FOA43_003092"
                     /db_xref="GeneID:62196493"
     mRNA            complement(<892842..>893498)
                     /locus_tag="FOA43_003092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923369.1"
                     /db_xref="GeneID:62196493"
     CDS             complement(892842..893498)
                     /locus_tag="FOA43_003092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779297.1"
                     /db_xref="GeneID:62196493"
                     /translation="MKSESTTDSRFPTWITPKVQKVVEGQEDSLFNPLNIPESIQEDK
                     GISPSSSPRTAGSGNTVTTATTGATGATGATAATGATRATTASMLAKNLIKALHEQQL
                     SVEISDYDSEMIRILQEENFSDTDSMMYYSSPCQRSKHLESDNEIESRFDSWLKVTEN
                     NLQQYQSLTKQASLSRLKLVERVQKMLQRLGQSKVGTQQQQLLMLQWCQNLLKEANYM
                     "
     gene            complement(<893680..>896277)
                     /locus_tag="FOA43_003093"
                     /db_xref="GeneID:62196494"
     mRNA            complement(<893680..>896277)
                     /locus_tag="FOA43_003093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923370.1"
                     /db_xref="GeneID:62196494"
     CDS             complement(893680..896277)
                     /locus_tag="FOA43_003093"
                     /note="MEROPS:MER0001009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779298.1"
                     /db_xref="GeneID:62196494"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="InterPro:IPR034016"
                     /db_xref="PFAM:PF01433"
                     /db_xref="PFAM:PF11838"
                     /db_xref="PFAM:PF17900"
                     /translation="MSSDSGRQLLPTNVKPLHYYLTLEPLFDRFKFNGQEVIDLEVQD
                     DSDSITLHTLEIDILDTSLTTGTGDIVKPVGITTNEDDQTTTFKFNETLLKRGQIANL
                     HIKFVGELNDKMAGFYRSTYEENGEVKYLATTQMEPTDCRRAFPCFDEPNLKARFSIS
                     LIGNKKLTFLSNMDVKQEEGIDSTRKKVVFNATPPMSTYLVAFIVGDLSYVESEYKFN
                     DVPVRVYTTPGYEAKGQYAAELGARALEYYEKCFGIKYPLPKMDMVGIHDFSAGAMEN
                     WGVVTYRMVDLLYDEQKSTLDTKLRVSEVVAHELAHQWFGNYCTLDFWDSLWLNESFA
                     TYMSWKCCNEFYPDWKVWENFVGESLQYALSLDGLRSSHPIEVPVKRADEINQIFDAI
                     SYEKGSSVLRMLANWLGEDVFIQGVSKYLKKHAFSNAKTEALWEALSEVSGKDVEGTM
                     KVWTERVGYPLVSIKESGSNVIATQHRFLTTGDVKPEDDGTVYPIFLGLKTDAGLDES
                     VVFDKRSMEVPVKDKSSFFKVNGNSNGVFRVNYEPERWAKLGKAASKLSVEDRIGLVA
                     DAGALAVPGFSKTSNLLSLVSGWKSESSVFVWDEILTRLAAIRGAWLFEDRAVKDAIK
                     SLTLDLVGEKSNTLGWKFGKHESFLDQRLKGLLFGSALSAGDCTVVAAADKMFADYVA
                     GDKEAIHPNLRVSIFNSIASKGGEKEFKQLVSIYEHPQSMDEKIAALRSLGRFEDSAI
                     LSRVLSLLLDGTVRSQDIYIPLQGMRIHKLGVEMLFKWMCEKWDTLCHMLPPGLSMLG
                     SVVQLCTSGFTKEEQYKKVEEFFQTKDTKGFNQGLAQALETIKSKSGWVARDSKDVEA
                     WLKANGYLK"
     gene            complement(<896736..>897242)
                     /locus_tag="FOA43_003094"
                     /db_xref="GeneID:62196495"
     mRNA            complement(<896736..>897242)
                     /locus_tag="FOA43_003094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923371.1"
                     /db_xref="GeneID:62196495"
     CDS             complement(896736..897242)
                     /locus_tag="FOA43_003094"
                     /note="BUSCO:EOG09343XZH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779299.1"
                     /db_xref="GeneID:62196495"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="InterPro:IPR036020"
                     /db_xref="PFAM:PF00397"
                     /db_xref="PFAM:PF00639"
                     /db_xref="PFAM:PF13616"
                     /translation="MTNPYDGLPDQWTIKISRNYDQEYYYNQETEESRWEPPEGTDET
                     KLSSYLAKGLHRPTKVKVSHILVKHKDSRRPASWKEDHITRTKEEAIDILRGYKLEID
                     CGEKTFADVARESSDDNSHVKGGDLGYFGKGEMQPSFERASFALQVGDRSDIVESNSG
                     VHLIERTG"
     gene            <897396..>900158
                     /locus_tag="FOA43_003095"
                     /db_xref="GeneID:62196496"
     mRNA            join(<897396..898065,898663..>900158)
                     /locus_tag="FOA43_003095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923372.1"
                     /db_xref="GeneID:62196496"
     CDS             join(897396..898065,898663..900158)
                     /locus_tag="FOA43_003095"
                     /note="BUSCO:EOG09344CUA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779300.1"
                     /db_xref="GeneID:62196496"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="InterPro:IPR019447"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="InterPro:IPR038254"
                     /db_xref="PFAM:PF00046"
                     /db_xref="PFAM:PF10357"
                     /translation="MGNRDRNTRKRVLKGLQKTKFYCQICERQCLDENGFKCHIQSES
                     HIRKLGTKMSDAGHNSKRLVDEYSEEFLKSFLGLLRRMHGEKMVGANKFYQEYIQDKD
                     HVHMNSTRWNNLTSLVMYLGESGKCKVKVTDEELDDSDLEKFSIAYRDEKGDSIGKRK
                     EREKQQLIKNDKEVSDNLLRDQIERGKKRRIERTESKDEEQKTPNKKKQQQQEQQLQA
                     SGSAFVSRSRSDPSPRPSTRLPSIASIFSTKKASNSAEAKSAEANSADNTVCAVPSSS
                     TPKTTSLGSITLPSIDHLTSSPSYARSHSYPSLPLPSSTPRTESSEDLSSKSFIPVTP
                     VSRNILLPPSHYGSTAAFAYAPQSSTPISYGTLPAPPIFMMPVQPLSFVYRRSDKTSP
                     STPARSAGSNGASTSWLAATPLKTPMKRKRTPSKAEKKYAFISHNQTTFLSCEPSIDN
                     ARLARRKRRRTSPTELAVLLAEFKKGSTPNRARRNEIASKVDMTEKAVQIWFQNRRQA
                     LRKSKIIKTVVVEVPKKDELDENILNNGSYEGSVDDGNVTMSDSARTSPEASPVKSEP
                     SNSSFSISADTSSSSVVVPPPKVTFTSLETRTATSRDGKLPPTGLFVTPSKLKSDTNK
                     RNVLTSPSVSHNENHKHNPLTFRFRTTDFMMMNPSQPGGRRQKPTMKLKLSKSNSNSR
                     IALQDKTNIANNRTRQTLQTAKPARSPVASSNSQTASTN"
     gene            complement(<900261..>900713)
                     /gene="RPS18A"
                     /locus_tag="FOA43_003096"
                     /db_xref="GeneID:62196497"
     mRNA            complement(<900261..>900713)
                     /gene="RPS18A"
                     /locus_tag="FOA43_003096"
                     /product="ribosomal 40S subunit protein S18A"
                     /transcript_id="XM_038923373.1"
                     /db_xref="GeneID:62196497"
     CDS             complement(900261..900713)
                     /gene="RPS18A"
                     /locus_tag="FOA43_003096"
                     /note="BUSCO:EOG09344ALR"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S18A"
                     /protein_id="XP_038779301.1"
                     /db_xref="GeneID:62196497"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="PFAM:PF00416"
                     /translation="MSLVVHEEGTFQHILRLMNTNVDGRINIVYALTTIRGVGRRYAN
                     LVCKKADVDLHKRAGELTQEEMERVVVIMQHPTDYKIPGWFLNRQKDVVDGKDYHVLA
                     NNLESKLREDLERLKKMRAHRGLRHAWHLRVRGQHTKTTGRKGKVSIA"
     gene            complement(<901028..>901912)
                     /locus_tag="FOA43_003097"
                     /db_xref="GeneID:62196498"
     mRNA            complement(<901028..>901912)
                     /locus_tag="FOA43_003097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923374.1"
                     /db_xref="GeneID:62196498"
     CDS             complement(901028..901912)
                     /locus_tag="FOA43_003097"
                     /note="BUSCO:EOG09343WSV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779302.1"
                     /db_xref="GeneID:62196498"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="PFAM:PF00573"
                     /translation="MPTSFLSRSACCFVRGLATATSAATATSAATAATATATATTATA
                     TAAYSVLPNIQQPAKYTLATLRSFPSLEPHEVFPVHTKFLNVPLRRDILWLAVVMELD
                     NKRVGASNPPGRSEHKFSRRKLMAQKGNGRARVGDANSPTRHRGAQALARTAPNDFST
                     TLPKKEYYLAYRIALSDMYRQGKLYIIGENAQKSDELQKGDSYHLEICTDDSHAVQQF
                     VKQHDLRDKLNALFVPNDYLATANLRQAVLRYPSNRLRVMDKQDVQVRDILKAHRIYI
                     EKEAFEYFVGKYSKYLVL"
     gene            <902576..>903817
                     /locus_tag="FOA43_003098"
                     /db_xref="GeneID:62196499"
     mRNA            <902576..>903817
                     /locus_tag="FOA43_003098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923375.1"
                     /db_xref="GeneID:62196499"
     CDS             902576..903817
                     /locus_tag="FOA43_003098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779303.1"
                     /db_xref="GeneID:62196499"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="PFAM:PF08613"
                     /translation="MTDINGQRSDKGSVDSPRRTGKIPSMSPTLHNLLQQRELHLQLQ
                     SQGQSLRQQQQGQVQSQPKPKLEHHTHSMGPTQLPPPPIQPYLPPSIIYRKLPREFIK
                     CQKKDLITIVSRMLSSLIEINDRQSAPNLKYIDHASLTRFHSRSPPQITVFNYLYRLS
                     HFSSLENSILITAVYYIDLLTRCYPVFAINSLTVHRFLLTATTVASKSLCDSFCSNHH
                     YSKVGGVNIMELNLLEAEFLTKVNYRVVPRDFNYDFIGERRSSTGTLDADTNRNVQHG
                     ITCAAEILDLYYRRMVMLVGGMSKDVEDNDLDDSNENGNHVFIGHDDSVVFYLGDDDE
                     QYFQDTEPAPVQYYSNEYIDSSTDNDSSPVSDSLSSSDSAESLQNPTGQSTEHPEHGD
                     PICSRKRGAEDFSHSKRRCGA"
     gene            <903821..>904685
                     /locus_tag="FOA43_003099"
                     /db_xref="GeneID:62196500"
     mRNA            join(<903821..903825,904046..>904685)
                     /locus_tag="FOA43_003099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923376.1"
                     /db_xref="GeneID:62196500"
     CDS             join(903821..903825,904046..904685)
                     /locus_tag="FOA43_003099"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779304.1"
                     /db_xref="GeneID:62196500"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="PFAM:PF03061"
                     /translation="MVVLVVAMTYLSFEDLEKEVAVAGYEHIPTLLNENNQDSLFIGH
                     NNLLQKDRIEEVRIYSKPIYTHTELDKLINQGSGPIQYLVEDKGNWSDTDTEPISNHL
                     IGFFRLGKLLTSHLNVVHGGAIATLIDEFFVKVTLPLTPNSFAVTANLNIKYSKPLKF
                     NDEDRLLEVVLECFIVKMKEHRKFTVYGYLKNIHDGYRYCKGELLVVVPKNSIE"
     gene            complement(<904699..>906324)
                     /locus_tag="FOA43_003100"
                     /db_xref="GeneID:62196501"
     mRNA            complement(<904699..>906324)
                     /locus_tag="FOA43_003100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923377.1"
                     /db_xref="GeneID:62196501"
     CDS             complement(904699..906324)
                     /locus_tag="FOA43_003100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779305.1"
                     /db_xref="GeneID:62196501"
                     /db_xref="InterPro:IPR007251"
                     /db_xref="PFAM:PF04120"
                     /translation="MVSFSTKVKRTFLPKKRTSLTVKSDLIAPSKLGNPSAAENASLS
                     GVSWADDTDQDQDLDEKDGNIDKFKIKDDYNSGYISPVDRMVVKVVHWSGSASAFFLS
                     ATILVLWAIVGIVYKAPDTWQIVMQDGQSIQCYIWDTLLMRQQLDDNNEFLRLYGRLK
                     SRYVTHKRLLQFMQSGKGKVRSKDIMTEVTMEGDSDVEEHNKLESQIKLTGEGWFDRM
                     CSFISHCIGSLPMVIIYWIGVFVWIACGSLNLRTSNTAPFSASNPEYAKWSDEWQMYI
                     NTAVAVVLLTTSVILENVRARNNKFVQEQIGHIGAVDCQVESIGRYTTGDMDDNAIIE
                     VPGCERKHFRKMISWYAEVIGTGVGLMLSAGVFVTWISIGHTLKWNSDWWLIIGTYTG
                     LVGYVDGFTLREVYYSITLYEEDKFMELLADSQELLELAGIDYQLRELHEKKNIGHRI
                     SAFVSKATSSQYAVVASICTVIGLICIATGLGWSVTGQLICNSPTMIIEAFCMLILIQ
                     SHSWADYKRRFVVKQLAVSRNLLLEHVKNIEDA"
     gene            <907442..>909127
                     /locus_tag="FOA43_003101"
                     /db_xref="GeneID:62196502"
     mRNA            <907442..>909127
                     /locus_tag="FOA43_003101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923378.1"
                     /db_xref="GeneID:62196502"
     CDS             907442..909127
                     /locus_tag="FOA43_003101"
                     /note="BUSCO:EOG093415ID"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779306.1"
                     /db_xref="GeneID:62196502"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="PFAM:PF08118"
                     /translation="MRRYRFTELGLRAGLDFGVGFGSGFGYPIGVRQRRLLFTFSNVN
                     LMWKSSRKRLEKLKWTLKKSKRPFNTDDISAFVSWMLAGNIVLLIIGTTTFFSLLLYT
                     LNTMLAQEMVAEWVGNLITKNSNLTVTFENAIVPDWKDGKIQFKNCTVSRRPRNKEMF
                     KKKNKTIPSKGLFSRWSTSRQKNKVESTKPVYDDGCYTQFDLTLEEVNISLSFKKWLN
                     GRGILKEVSSKGVRGVIDRTHVYWEEGDSATNYKNVAQPGDWEINNFKLEDVLLTMLN
                     GGGFRAFSISIYNCEIPLLRKNWLMFDILNSKHISGSWDGSLFTMNRLQRVDSFNEEK
                     KIDREVNIHLGRNKYRRLDLMNDESFSKVTRFRIDNLKIDHLNAGMSGPFGWINKGTV
                     DMIADVIVPRKNSSLKEVSIDEIMRYYSKNLRGEVSTVQDSSSPANMGNLFIMDFYLR
                     LNNPRASVPLFSNELSYVNNALIRPIVAYINSNKTFIPIRCRIYKDVADFDGSWTLYD
                     SLLMDDLSVGVYESFADYVTNEEYRSDRVKKVGFWSLQFLLQLILWSLSTLNG"
     gene            <910886..>911776
                     /locus_tag="FOA43_003102"
                     /db_xref="GeneID:62196503"
     mRNA            <910886..>911776
                     /locus_tag="FOA43_003102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923379.1"
                     /db_xref="GeneID:62196503"
     CDS             910886..911776
                     /locus_tag="FOA43_003102"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779307.1"
                     /db_xref="GeneID:62196503"
                     /translation="MPVYSGQIIHGSSNGDRETPININFQGISQLAYQVSQKIPVPPF
                     TDKEPARESMSLEKPKRNRRRSKFTKEQDEMIIAMKREGKSWVEIAESARVGSYLAAR
                     NRYQVLIGQQGRGNSESGPQDVLELRNLVDEAELEKWKYLSKELSKDTGRNYTPEQIR
                     EVVRYLFWKNPQEFDVDEKYLVQLIKQQSKEVAEIPTGSTGSMGSTGSAGSTVSRIPT
                     MPAVPSIPAMQPMTQSQISTQQVQPSQQQPYYPFPRFQPQYIQPQGLGVQLPGKRPGP
                     ASTEKASSEENLRSPRHHKQ"
     gene            <912173..>913882
                     /locus_tag="FOA43_003103"
                     /db_xref="GeneID:62196504"
     mRNA            <912173..>913882
                     /locus_tag="FOA43_003103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923380.1"
                     /db_xref="GeneID:62196504"
     CDS             912173..913882
                     /locus_tag="FOA43_003103"
                     /note="CAZy:GT8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779308.1"
                     /db_xref="GeneID:62196504"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01501"
                     /translation="MGHAYAYTTLLLTSSYLPGTLALCQSLRNSGSIIPIVLLYSKGN
                     VKPEIVQRLTDSGLFSQMLNVDNDIIVSRNRYELVNLLKRSELDKTLTKLNCWRLISY
                     EKIIYLDSDTLVVRNIDHLFDLHIDSSQIYAAPDCGWPDCFNSGVFLFKPDLETFRQL
                     KEFSETADSFDGSDQGLLNEFFNLSGPQNYHWSRLSFSYNCTLNTNYEYVPALIRFHN
                     DIRIVHFIGSLKPWNNRISSYDSKLFKLDLYGTGVLKNFQQLWWDCYDSVVVGDINSV
                     KLLELSGNLQPRPSLEPPKSESASQNLINQQKDHSQTESSPQKGGASEINFPTYYYKQ
                     ADYQKPLEDQSAKGEAWRLDEPRFNFPTDTTDSIPPASEITSNSKTTTINFKSPAEAD
                     VTAHDYTQDYVKDHPIFPWEKEVSRSSATRVFYNSPAYKPPAYTISMYKEKKTLSSPS
                     YTQNPDNSPKERFVGFDDGDELEHYLEAVEKLPSVQNEDEVEEDEARIENEEDERIAT
                     NPEMAKVEKDLDDDDLKDAILEENHQDQYLKDSEQREEANKQVDAVIEDLTDKVSAQL
                     QIQ"
     gene            complement(<913976..>914992)
                     /gene="CDC10"
                     /locus_tag="FOA43_003104"
                     /db_xref="GeneID:62196505"
     mRNA            complement(<913976..>914992)
                     /gene="CDC10"
                     /locus_tag="FOA43_003104"
                     /product="cell division control protein"
                     /transcript_id="XM_038923381.1"
                     /db_xref="GeneID:62196505"
     CDS             complement(913976..914992)
                     /gene="CDC10"
                     /locus_tag="FOA43_003104"
                     /codon_start=1
                     /product="cell division control protein"
                     /protein_id="XP_038779309.1"
                     /db_xref="GeneID:62196505"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030379"
                     /db_xref="PFAM:PF00735"
                     /db_xref="PFAM:PF01926"
                     /translation="MADTQPQTQPVRTTAGTDATSLLQPTNYVGFDTITTQIENRMVK
                     RGFTLNVMLVGASGLGKSTLINTLFSSHLDDSCGRNTVYEPIERTPDIKVTSHDMIEN
                     NVILHLNIIDTPGFADQINNNHCWDPLLKYVKDQHNQYLRRELNASREKFIKDTRVHC
                     ALYFVAPNYYGLSRLDVQALKKLTEVVNVVPVIAKSDTLTMEERANLKRTLQDQFKHY
                     NLRMYPYNNQYDDRLTSEEIQFNKDIRSMLPFAVIGSEDVITTPKGETVRGRRTKWGT
                     INVEDVTQCEFVYLRDFLTRTHLYDLIETTSLQHYEAFRTKQLTALRENVGARNSSQS
                     QNQS"
     gene            <915451..>916005
                     /locus_tag="FOA43_003105"
                     /db_xref="GeneID:62196506"
     mRNA            <915451..>916005
                     /locus_tag="FOA43_003105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923382.1"
                     /db_xref="GeneID:62196506"
     CDS             915451..916005
                     /locus_tag="FOA43_003105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779310.1"
                     /db_xref="GeneID:62196506"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="PFAM:PF01783"
                     /translation="MSFVIRSMGALSFGPSLLPRVTLPTLSIPLPWFLQPQKQAEVSE
                     KSKKLSEWAKAHELSNNEIPFFHDNGILLAAPKKKTSHMKRRLRLYAPGSKQVKLNNN
                     LNRCPACGHYKRSHFLCMNCVSQIQKHWKARDAKLQPEPFREEFGNPLDEEVLYPGKT
                     ERPYERKLRSKEYLVKRPKTLPVE"
     gene            complement(<916045..>916878)
                     /gene="PET8"
                     /locus_tag="FOA43_003106"
                     /db_xref="GeneID:62196507"
     mRNA            complement(<916045..>916878)
                     /gene="PET8"
                     /locus_tag="FOA43_003106"
                     /product="S-adenosylmethionine transporter"
                     /transcript_id="XM_038923383.1"
                     /db_xref="GeneID:62196507"
     CDS             complement(916045..916878)
                     /gene="PET8"
                     /locus_tag="FOA43_003106"
                     /note="BUSCO:EOG09342VSX"
                     /codon_start=1
                     /product="S-adenosylmethionine transporter"
                     /protein_id="XP_038779311.1"
                     /db_xref="GeneID:62196507"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /translation="MTQPNLYFISLVSGGCAGTATDLTFFPIDTLKTRLQASGGFFNN
                     GGFKGLYKGLGSALVGSAPSASLFFITYDTAKRYFHRVLPAYFNKESTAFNVAHMISA
                     SMGEIAACTVRVPVEVIKQRTQSLQFRTSWESFKYLTSNKSGEGVLRGLYRGYGTTIM
                     REIPFTVIQFPLYEGLKARWASYDHVDRLPAGKGAVCGSIAGGIAAAVTTPLDVLKTR
                     LMLNKERIGARHMIKKMIREEGAKVFFSGIGARTIWISAGGAIFLGVYEVVSSTMYEP
                     K"
     gene            <917299..>918693
                     /gene="NFS1"
                     /locus_tag="FOA43_003107"
                     /db_xref="GeneID:62196508"
     mRNA            <917299..>918693
                     /gene="NFS1"
                     /locus_tag="FOA43_003107"
                     /product="cysteine desulfurase"
                     /transcript_id="XM_038923384.1"
                     /db_xref="GeneID:62196508"
     CDS             917299..918693
                     /gene="NFS1"
                     /locus_tag="FOA43_003107"
                     /note="BUSCO:EOG09341U1X"
                     /codon_start=1
                     /product="cysteine desulfurase"
                     /protein_id="XP_038779312.1"
                     /db_xref="GeneID:62196508"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010240"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="PFAM:PF00266"
                     /db_xref="PFAM:PF01212"
                     /translation="MLPEVATNILKASSIRLFATNAARATSQTAVNRMASVTERKKKP
                     TEEAHINFKNAYRDDSKFGKRPIYLDMQATTPVDPRVLDKMLPFLTGLYGNPHSSTHS
                     YGWETDKEVEKARKNVADVINADPREIIFTSGATECNNTAIKGVARFYGKTKHHIITT
                     QTEHKCVLDSCRHLQDEGFEVTYLPVGTDGLIDLEELEKAIRKDTCLVSVMAVNNEIG
                     VMQPIEEIGRICKKHKVFFHTDCAQAYGKIPLDVNKMNIDLMSISSHKIYGPMGIGAL
                     YVRRRPRVRLEPLINGGGQERGLRSGTLAPPLVCGFGEAARLIREEFDDDQAYIGKLS
                     SKLTNSLLSLPYTQFNGSKEHHFAGCVNVSFAYVEGESLLMALKDVALSSGSACTSAS
                     LEPSYVLHALGADDALAHSSIRFGIGRFTTEAEIDYVISAIKERVTFLRELSPLYEMV
                     QEGIDLSTIQWAGH"
     gene            <918891..>919757
                     /locus_tag="FOA43_003108"
                     /db_xref="GeneID:62196509"
     mRNA            <918891..>919757
                     /locus_tag="FOA43_003108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923385.1"
                     /db_xref="GeneID:62196509"
     CDS             918891..919757
                     /locus_tag="FOA43_003108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779313.1"
                     /db_xref="GeneID:62196509"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR023106"
                     /db_xref="InterPro:IPR035808"
                     /db_xref="InterPro:IPR036919"
                     /db_xref="PFAM:PF00327"
                     /translation="MSETIEMNTNPEVILKKRKDARKLRLEKKQQSLERIELKRKSNK
                     SHRNGKFMRAETLIARHRASEREEYRVERVSKFERELMEKADNSKEDDKEESKLMFVV
                     RVEGPYGARIPAKSALVLQLLRLSSIDMGTFIKFNSTVRPLLRLINPYIVLGTPSLAT
                     VRDLIQKRATVRIELSEKSEPVDDMEENDDGKISVPLNDNNLIEEKMGEYGVICVEDI
                     IHEIATLGENFKSCVKFMEPFRLNPPVSGWSPLSKLKRIELKEEKGRKVNNSARAPLS
                     EVDIDKYIEQQI"
     gene            <920008..>921099
                     /gene="LEU2"
                     /locus_tag="FOA43_003109"
                     /db_xref="GeneID:62196510"
     mRNA            <920008..>921099
                     /gene="LEU2"
                     /locus_tag="FOA43_003109"
                     /product="3-isopropylmalate dehydrogenase"
                     /transcript_id="XM_038923386.1"
                     /db_xref="GeneID:62196510"
     CDS             920008..921099
                     /gene="LEU2"
                     /locus_tag="FOA43_003109"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="XP_038779314.1"
                     /db_xref="GeneID:62196510"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="PFAM:PF00180"
                     /translation="MTTKKIVLLPGDHIGPEIVGEAVKVLKAISEVRPEDQFEFDTEL
                     IGGAAIDAHGVPLTDEALEASKKADAVLLGAVGGPKWGTGKVRPEQGLLEIRKELKLY
                     ANLRPSRFASEKLLKFSPLKPEIAKGTDIMIVRELIGGIYFGKRKEDEGDDYAWDTEQ
                     YSVREVERITRMAGFLAMQQNPPLPVTSLDKANVLASSRLWRKTVTKTMQNEFPKVTL
                     KHQLIDSASMMLVKSPTKLNGIVLCSNMFGDIFSDEASCIPGSLGLLPSASLASLPDK
                     NTAFGLYEPIHGSAPDLPRNVVNPMATILSAAMMLKLSLGMVEEGEAVEKAIKAVIEN
                     GIVTADLGGKAKTTEVGDAVAKEVKRILS"
     gene            <921409..>922395
                     /locus_tag="FOA43_003110"
                     /db_xref="GeneID:62196511"
     mRNA            join(<921409..921736,921998..>922395)
                     /locus_tag="FOA43_003110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923387.1"
                     /db_xref="GeneID:62196511"
     CDS             join(921409..921736,921998..922395)
                     /locus_tag="FOA43_003110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779315.1"
                     /db_xref="GeneID:62196511"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="PFAM:PF01822"
                     /translation="MVLLLAWLALIDVVTGLTYKGCYSSVPGLVSQGTYIYQTSSYCQ
                     SICSDSYVVALKDGGDCYCGDTLPTGDSDDDLCAVSCFGYSSETCGGSDSYTVYTNDE
                     NQANEVNASKSTDSTATASSDSLSSNNNKSSSSHKLSGGAIAGIVMGCIVGAALLGIA
                     LFFCIWRRRQDDEYSYEEKSENDISPILRDSVSDDYPTPPSLGIKRFSNGSLPDAAID
                     GQRRELRVINPDVADTVSGLHRV"
     gene            <922608..>923135
                     /gene="ATP7"
                     /locus_tag="FOA43_003111"
                     /db_xref="GeneID:62196512"
     mRNA            <922608..>923135
                     /gene="ATP7"
                     /locus_tag="FOA43_003111"
                     /product="ATP synthase d subunit"
                     /transcript_id="XM_038923388.1"
                     /db_xref="GeneID:62196512"
     CDS             922608..923135
                     /gene="ATP7"
                     /locus_tag="FOA43_003111"
                     /codon_start=1
                     /product="ATP synthase d subunit"
                     /protein_id="XP_038779316.1"
                     /db_xref="GeneID:62196512"
                     /db_xref="InterPro:IPR008689"
                     /db_xref="InterPro:IPR036228"
                     /db_xref="PFAM:PF05873"
                     /translation="MSSVAKTAASKINWSTIIPQLGLAGKTATSLAAFKKRNDEAKSV
                     LYELKHSPTTVDFEFYKGKLHNSQIVSKIESDVDKFSASKPDLSKQLNLISTFEAKAV
                     ENAKETESLVLKELTNLERTLENIETARPFEELTVEDVVQARPDVEDKVQSMLDKGKF
                     EVPGYKERFGSMVIM"
     gene            <923201..>925428
                     /locus_tag="FOA43_003112"
                     /db_xref="GeneID:62196513"
     mRNA            join(<923201..923204,923279..>925428)
                     /locus_tag="FOA43_003112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923389.1"
                     /db_xref="GeneID:62196513"
     CDS             join(923201..923204,923279..925428)
                     /locus_tag="FOA43_003112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779317.1"
                     /db_xref="GeneID:62196513"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004483"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF13086"
                     /db_xref="PFAM:PF13087"
                     /db_xref="PFAM:PF13245"
                     /translation="MNCLSVERQEDYEQTSELLASNSPKLLSKNGLAILNLEISNVRT
                     SIGGKLIIELTSAQAAKGKQKNDGKDGSIIETGDFKTGDIARLDRYSSNGSKQKKVKK
                     LANSSKTEDQEEAKEEAIDVDGVVISISEKRVNLAINIDHTTLQGTRLEEKVYQLYGS
                     AIRVWIVKLSNEITYNRMESTMRKLDELTDSSTSGIMRLLLGQSQFVASSHYKVDQFF
                     NTKLNEAQKQAIQFSISNNLSIIHGPPGTGKTSTIVELVKQLLVARRNNKRILICGPS
                     NISVDTILERLSSFFVDQSNKLVRIGHPARILPQILKHSLDLIVEEDSRDVIKGIMKD
                     IDKLTRKIKKAKQYKERRELYQEMKDLKKDLRARTHKGFSDALLRSDVVVATLHGSSS
                     RELVSCIRENCPDGLFDTLIIDEVSQSLEPSCWIPLIYHRSINKLIIAGDNKQLSPTI
                     KTKKNKRVVDTLSTTLFDRLLKVQRNHHEFTCFLNVQYRMNQKIMGYPSDALYSGKLV
                     ADRSVKYGKVIDLIENGDKDCKDNDDLVEPIIWYDTEGGDFPEMDYDSVNASASSKYN
                     DGECLVVLKHAKELLSKGIAQEEIGIITPYSAQVTKLRQLFRSGTLQEDQNSDRYLDE
                     PLNGIEISTVDGFQGREKEIIILSLVRSNDKRRVGFLSDEKRLNVSITRCKKQLCVVG
                     DFETIGNSGVKFLKNWCKWCEDNDVDIRYVDLGEL"
     gene            complement(<925436..>926419)
                     /locus_tag="FOA43_003113"
                     /db_xref="GeneID:62196514"
     mRNA            complement(<925436..>926419)
                     /locus_tag="FOA43_003113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923390.1"
                     /db_xref="GeneID:62196514"
     CDS             complement(925436..926419)
                     /locus_tag="FOA43_003113"
                     /note="BUSCO:EOG09342XNZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779318.1"
                     /db_xref="GeneID:62196514"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MLPLHISKVFKNHTPDTPITSISYDTSGQYLLTSGTDESLQLYE
                     IPKGRHLKSIYSKKYGCHLAIFTNTSHSQCLFASTQENHVIRLLNLDDNSFIRYFKGH
                     KQQVVNLINATSATRLESFYSSSIDGTVKCWDMRTNTCTASLGLSSTPLIALDPTNSV
                     MAILETGSFQLRLVAMGKFPTGSIKVVDLSSLFKQSLPKNLQFTNDNKYIIITTDSTE
                     HIVLDSFSLQIMGTLSGQVPFISRKYPDSGNITVTPSGKYVIGGSGNGELLVWDLSYL
                     SNNTSMKQLAPTSKLTNSAEGTLSIPRMVLFNPHYEMLATADTEVSFWTSK"
     gene            <926550..>926897
                     /locus_tag="FOA43_003114"
                     /db_xref="GeneID:62196515"
     mRNA            join(<926550..926555,926613..>926897)
                     /locus_tag="FOA43_003114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923391.1"
                     /db_xref="GeneID:62196515"
     CDS             join(926550..926555,926613..926897)
                     /locus_tag="FOA43_003114"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779319.1"
                     /db_xref="GeneID:62196515"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="PFAM:PF08520"
                     /translation="MSLGKLFHYSFDIVVISIILAGIKSSTGYELRVDSIAHTKDSIS
                     ILRKYLNLGETLFSRCCSYAKSSKSFRMVMLPGTQQVKDAVNDARKKYDKRQ"
     gene            complement(<926935..>927354)
                     /gene="GRX5"
                     /locus_tag="FOA43_003115"
                     /db_xref="GeneID:62196516"
     mRNA            complement(<926935..>927354)
                     /gene="GRX5"
                     /locus_tag="FOA43_003115"
                     /product="monothiol glutaredoxin grx5"
                     /transcript_id="XM_038923392.1"
                     /db_xref="GeneID:62196516"
     CDS             complement(926935..927354)
                     /gene="GRX5"
                     /locus_tag="FOA43_003115"
                     /codon_start=1
                     /product="monothiol glutaredoxin grx5"
                     /protein_id="XP_038779320.1"
                     /db_xref="GeneID:62196516"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR014434"
                     /db_xref="InterPro:IPR033658"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00462"
                     /translation="MFASTMLRVRSIIRPTVGLRFMSAETKKAITEAVSSAPVVLFMK
                     GTPEAPACGFSRATIQMLGQQGVDPAKFAAYNVLEDSDLRQGIKEYSDWPTIPQLYVD
                     SEFVGGCDIIMSMAQSGELSEVLEKANALVPEEEEKQ"
     gene            <928133..>929797
                     /locus_tag="FOA43_003116"
                     /db_xref="GeneID:62196517"
     mRNA            <928133..>929797
                     /locus_tag="FOA43_003116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923393.1"
                     /db_xref="GeneID:62196517"
     CDS             928133..929797
                     /locus_tag="FOA43_003116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779321.1"
                     /db_xref="GeneID:62196517"
                     /translation="MSSTDAMSGLNGRSNRVHMTPGLNEDPVFAFLDLSSNSAYKQQN
                     TNRTTGLGISQQSDRRSYGVDENITLEDLLSEDPLKDYDVETEQNKTQSQPSDTDDLM
                     EQLLQFNVNQTNDYDTNPTSVATLSSISPSSSAGTFLSADTTNTTTMTTTAQNAGTLS
                     AEDLSIKKSLSLNSLSAFSSPSLTKPPTFDIFNHNNNNNNDDTLLISPQSTPTIRQQP
                     FSGRRISSSSSVSIISDGVPLSTSRRSSAATSSPSRRLSKRNSMDKLGRMTSIRKEKS
                     NRKTLTKAQMATSAAAAAAISSKRTPKRRSSMPSMITAAAASATSQYRVVSAGGRPNN
                     GPASTGFLSFDGGNNSSRTLLTSRPIRSPIASRYNPANATNISFIFESPSGHRKEVER
                     QIPRRSPAATIPQSSSTYEAAHAASSASQAQFAHAAHVHAQAAQAKAQANAQAQAKAN
                     AKAKAEVQARARAQFQSSLHSQKQTYSRVSPASSASSASSASSSSSSAASSYHTRNKA
                     VHNKKNAEFQNLITKFPKEDEVPFNPKTYNNIKQGLMEFQLAIPEK"
     gene            <930148..>932109
                     /locus_tag="FOA43_003117"
                     /db_xref="GeneID:62196518"
     mRNA            <930148..>932109
                     /locus_tag="FOA43_003117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923394.1"
                     /db_xref="GeneID:62196518"
     CDS             930148..932109
                     /locus_tag="FOA43_003117"
                     /note="BUSCO:EOG09343IV3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779322.1"
                     /db_xref="GeneID:62196518"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00072"
                     /db_xref="PFAM:PF00447"
                     /translation="MESNPGDIHVKEEAQLRSSQQQVTNNGNISFDAIGGPIVPAQLS
                     AIHHHEGKKSGTDFVKKLFQMLEENTFGEIVRWSDTGNSFIITDTNEFTKKVLPSYFK
                     HSNFASFVRQLNKYDFHKVKLSHDIKQRYKLENIWEFKHPEFSEHNRSALDSIKRKAP
                     AKRDAEGSLVMTSPTNFVSINQFRTLQDRMDFLERDNQQLHVEVQKLHGDLASLHGKY
                     NSLVTTLLTSRTVNESFSSAISILAKSLSQIGVDIPRIDLPFAPLSQSQARSPISASP
                     IIASSNNSGNISPRQVSQVPQVPRVPRVRLPHVQQVPHVPQVPHVPQVPQVPQVSQVS
                     QVSQVSQVSQVSQVTQISQIALQQQPGSRLQPSLIAGTTPGQAMTTLSPQKRQERILA
                     RPKGSTLHVLLVEDDDVCVQLCKKFLMKYGCTVVVVKDGLAAISAVEKVKFDLVLMDI
                     VMPNLDGASATSVIRSFDSDTPIIAMTGNYQKEDLMTYLAHGMTDILAKPFTKLDLYM
                     ILEKHQMGNNFKRPSHDSDVLLSGGTVKMSTSGETSGASTGPSGDVTSTRQDSNATTA
                     PPPGVIVDSPTTAELMSAGLVDSTPQKKQSGPQQPQESRLEQQPVPIVPEDVSVNILE
                     PDLINGIGAPENPDTDDSYESPMKRPRYA"
     gene            <932244..>933245
                     /locus_tag="FOA43_003118"
                     /db_xref="GeneID:62196519"
     mRNA            <932244..>933245
                     /locus_tag="FOA43_003118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923395.1"
                     /db_xref="GeneID:62196519"
     CDS             932244..933245
                     /locus_tag="FOA43_003118"
                     /note="BUSCO:EOG09342RST"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779323.1"
                     /db_xref="GeneID:62196519"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR033947"
                     /db_xref="PFAM:PF00766"
                     /db_xref="PFAM:PF01012"
                     /translation="MFSTRLLFRTIRPVSVRLGSTLAFLETAGGQITPASLSTVTAAT
                     QIGDPITVLLVGAGSMEAAKQAYKLPSVQKIIVSESEKYNHYLPEEVSPLVVKLLKEN
                     SGFKHFLVPASTAGKNFLPRVGAVLDLQPLSEIIKVVSADTFVRPTYAGNAVLTVKSK
                     DDVILASVRPSAFEPAAEESTATSASVEEVDYVKSGNKTEFISEKLITSERPDLSSAK
                     VVVSGGRGLKSKEEFDQLLYPLADKLNASVGASRAAVDAGFCDNSLQVGQTGKVIAPN
                     LYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFNVSDVGLVGDLLDIIPELTKKL"
     gene            complement(<933669..>934535)
                     /locus_tag="FOA43_003119"
                     /db_xref="GeneID:62196520"
     mRNA            complement(<933669..>934535)
                     /locus_tag="FOA43_003119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923396.1"
                     /db_xref="GeneID:62196520"
     CDS             complement(933669..934535)
                     /locus_tag="FOA43_003119"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779324.1"
                     /db_xref="GeneID:62196520"
                     /db_xref="InterPro:IPR018838"
                     /db_xref="PFAM:PF10382"
                     /translation="MGTDFTLNEQLKHSEYSEYRILYTFDIYKKAKVWQDGTLRLFKI
                     NKKLIVYDDSKVLVYEDFWKLYETFHERQVIKFDDVWITVDATLGVYERDVLGQFLRV
                     NSSCNDVTLNAKRIVQPVKKLNKKQNSLLPLTPAKRKRRVVGLRHSRGDFKSPLLKKT
                     PKTPARKTLHIDRSYETPQISMLTPPISSYSYRRLDLQTPLKKHLPSQQLDLLQVDVY
                     DSDSQENDDLSDFGEDTNATPKNAQKKLFDKLELGNSGNEIATETWGHKEDSSDRAKA
                     VLDLSKRLLGKP"
     gene            complement(<934640..>935974)
                     /gene="ARP3"
                     /locus_tag="FOA43_003120"
                     /db_xref="GeneID:62196521"
     mRNA            complement(<934640..>935974)
                     /gene="ARP3"
                     /locus_tag="FOA43_003120"
                     /product="Arp2/3 complex subunit, actin nucleation center"
                     /transcript_id="XM_038923397.1"
                     /db_xref="GeneID:62196521"
     CDS             complement(934640..935974)
                     /gene="ARP3"
                     /locus_tag="FOA43_003120"
                     /codon_start=1
                     /product="Arp2/3 complex subunit, actin nucleation center"
                     /protein_id="XP_038779325.1"
                     /db_xref="GeneID:62196521"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="PFAM:PF00022"
                     /translation="MASINTPAVVMDNGTGMTKLGFAGNDAPSWVIPTAIATRATGTS
                     GKSTVSSKPSFLSTSGATGAGNSITGTSSPSPSLSSIKRDMADLDFYIGDEALEAAKG
                     PGYSLHYPVRHGQIDNWDQMERFWETSIFKYLKCEPEDHYFLLTEPPLNPPENRENTA
                     EIMFESFNCAGLYIAVQAVLALAASWTSSKVVDRTLTGTVVDSGDGVTHVIPVAEGYV
                     IASAIKNIPLAGRDITSFIQTMLRERGEPNSSLKTAEEIKQKFCYVCPDIVKEFAKYD
                     NNPEMFAKYMVDTVSDRKITVDVGYEGFLAPEIFFNPEIASSDFLTPLPQIVDTVIQA
                     SPIDVRKNLYKNIVLSGGSTMFKDFGRRLQRDLKTIVNERVALSESLSGAKSSGVQVQ
                     VISHKRQKNAVWFGGSLLAQTSEFKSYCHTKQDYEEYGPNIVRNFSLFNVPS"
     gene            <936948..>937922
                     /gene="TAL1"
                     /locus_tag="FOA43_003121"
                     /db_xref="GeneID:62196522"
     mRNA            <936948..>937922
                     /gene="TAL1"
                     /locus_tag="FOA43_003121"
                     /product="sedoheptulose-7-phosphate:D-glyceraldehyde-3-
                     phosphate transaldolase"
                     /transcript_id="XM_038923398.1"
                     /db_xref="GeneID:62196522"
     CDS             936948..937922
                     /gene="TAL1"
                     /locus_tag="FOA43_003121"
                     /note="BUSCO:EOG093433A7"
                     /codon_start=1
                     /product="sedoheptulose-7-phosphate:D-glyceraldehyde-3-
                     phosphate transaldolase"
                     /protein_id="XP_038779326.1"
                     /db_xref="GeneID:62196522"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="PFAM:PF00923"
                     /translation="MPSSLEQLKATGTVVVADTGDFESIAKFQPQDATTNPSLILAAT
                     KQPQYAKLIDVAVEYAKKHAKTPEEQATVALDRLLVEFGTRILAIVPGRVSTEVDARL
                     SFDKEATIKKALSIIALYKSMGIDKKRVLIKIASTWEGIQAAQELESKYGVHCNLTLL
                     FSYVQAVACAEAGVTLISPFVGRIMDWYKAKTGETYDSTSDPGVQSVREIFNYYKKYD
                     YKTIVMGASFRNTGEIEALAGVDFLTISPKLLEQLSDSSKAVPKLLDSKKAKSLEIPR
                     DSFINDEPKFRFLFNEDAMATEKLSEGIRKFSADCATLYNKLLDKVSA"
     gene            <938087..>945430
                     /locus_tag="FOA43_003122"
                     /db_xref="GeneID:62196523"
     mRNA            <938087..>945430
                     /locus_tag="FOA43_003122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923399.1"
                     /db_xref="GeneID:62196523"
     CDS             938087..945430
                     /locus_tag="FOA43_003122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779327.1"
                     /db_xref="GeneID:62196523"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="InterPro:IPR036738"
                     /db_xref="InterPro:IPR036940"
                     /db_xref="PFAM:PF00454"
                     /db_xref="PFAM:PF02259"
                     /db_xref="PFAM:PF02260"
                     /db_xref="PFAM:PF08771"
                     /db_xref="PFAM:PF11865"
                     /translation="MSAVSLAAHAGFLPNMGSSLESFTMDEIFKELRSKDEAVRLRAA
                     KLLRKHVVAVSRDITSPEQLSVYNNYINKRIFDLINSSNVREQLGGIEAINSMVDLIT
                     NSNEDPSVPQLGLTTTAEQNSNMITRYASYLRRLLSSNNLYVMKAATTTLGKLAIPGG
                     SLTGDFVEFEVKRSLEWLVSEKVQGKRHAAVLILGSLAFNAPAMLYPYIKDILLNIWI
                     GLRHPTLSLREDTAICLRYCLSIVYERDSELLNYWFTKLYNEALSIFKSVGTGVSTSA
                     AAGVSSGTNNSSVINSNIYNSPPEFVHGSLLCYRELILQGTSILDPKIDEIYETLMTV
                     KDNRSQDIRKEFAMIMPRLARYDRIRFVDKFMHRVLLYYISQLKIGKDRSFILTSVGD
                     IAIEAKNNIVNYLDGVVLESIREGLSSRSPKTRKELSSPCFYCLAKLAIALGPPLTKF
                     INSYHVLTLVLKCPITDSMLSVLKIFIDHLPSLEPIINDNLINTISYCLSGYEFKHPG
                     APDFKVLMDPQLAFRYRRHMLSREGGPSFQPPRSEVDVTSLAGLPNVSEYEDGDVVVI
                     LQALKALSFFDFRNYNLTDFVRHAVTYYISHNTPEVRLQASLTSSNIYMRSAICLERS
                     AASLKAVNDVLSKLLTICITDPVPEVRLDVLKSLGDRFDAQLSQAENVRLLFMALNDE
                     LFEIRKATVKLVGRLTFINPAYIVPPLRKMLIQLLTTLNYAGQSTRRKEETAILISLL
                     ISSTGELSKPYLKSIMDALIPRATDSSTSVASAAIAAIGEMSIVSGAEMLEFVPQLMP
                     ILLETFQDQSLSYKRDAALKTLGQLAGASGYVIRPLIDYPQLLGLLVNILKSDSSPSA
                     RRETVRLMGILGALDPYKYREVERSGRDSQTVAEQNAPSIDMELLMKGKSPSNEDYFP
                     TVVITTLLKILKDPSLSNHHPAVTQAIMHIFKTLGVKCVPYLDQVIPGFASVMHSCPK
                     SMLITYFQQLGDLTKIVKLNIRPYLGQIFDLIKGFFKYSELQVTIIGVVEQVSKSLDD
                     EFKLYVLDVVTMLLDLLNQDSSPKRAPSLRVLKAFMVFGDNMEPYAHLFVPQMVKLFE
                     YAPLVLRQASIETVGKIARVINLSDYTSEIVHPLLRLLANSDNNELKNTVMMTICSLM
                     IQVGQEFSIFVPVVSSVLIMNKLHYPLFDQLADKLLNGESLSSGLVVYPDDASLNNNN
                     LEVEATPRKLPVNPQALRNAWDCSTKRTREDWHEWMRRLSIELLKESSSPALRACSSL
                     ATVFPPLAKGLFNCAFASCWNELHIQYQGELAQALCIALSSPNSSPEIHQTLLNLTEY
                     LEHDEKSLPIRIQTLSQYAQRSHAYAKALHYKELEFIQEPSTPTIESLISINNQLQQT
                     DAAIGILKYAQEHHGLQLKETWYEKLQRWDDALAAYNEREKEEPNSPEITMGKMRCFH
                     ALGQWEQLSDLAEKKWDASSSDMRRSIAPLAASASWGLGQWEKMGTYISVMKHESPDR
                     AFFNAVLLLHNNNFEDAASQISKSRDLLVTEITALVSESYNRAYGVVVRVQMLAELEE
                     IITYKKLPPGSEKRAHIRETWNKRLLGCQKNVDIWQRMLKVRALVVKPKQDMDIWIKF
                     ADLCRKGGRLGLSEKALNLLLDEGTPGQQTSRAPPQVVYAQLKYIWARGQKKEALNHL
                     IDFTSKLSRDLGVDENEAINEPLPTEVVGASENIERYTKLLARCYLKQGEWKIAMNSK
                     WGDNEASGILGSFLLATHFDPKWYKAWHNWALTNFEVIPSESKQLNNYDDNTQRRNES
                     EADLNTVIHYVVPAVKGFFHSIALSQESPLQDTLRLLTLWLNFGGIKDVSNAMEEGFQ
                     MVKIDTWLDVIPQLISRIHQPDPVVSKFLLGLLSDLGKAHPQALVYPLTVAIKSESVS
                     RQRAALTTIDKMRQHSARLVDQADLVSNELIRVSVLWHEMWYEGLDDASRAYFGEHNV
                     EKMFSILTPLHKMIEKGPETIREASFVNSCGKDLADAQQWLDSFKKSRDVTYLNQAWD
                     LYYAVFRKISRQLPQLQSLDLHHVSPKLLAVRNMELAVPGTYVAGKPVIRIARFESVF
                     SVITSKQRPRKFCIIGSDGKKYQYVLKGHEDIRQDSLVMQLFGLVNTLLADDSECFKR
                     HLDIQRFAAIPLSPSSGLLGWVPNADTFHVLIKEYREPRKIYLDVEHRIMLQMSPDYD
                     SLMLLEKVEVFTYALDITRGQDLYKVLWFKSKSSEAWLDRRTTYTRSLAVMSMVGYIL
                     GLGDRHPSNLMMDRVTGKVVHIDFGDCFESAILREKYPEKVPFRLTRMLSYAMEVSGI
                     EGSFRISSENVMRVLRDNKESLLAILEAFAYDPLINWGFDFPIREIIENSGRPIPSTN
                     YNELLRSGQISEEEGKRMTIQYKNEIRNARAAFVLNRINDKLTGDDFKRFKDLDVPTQ
                     VDNLIQQATSVENLCQHYIGWCSFW"
     gene            <946060..>947244
                     /locus_tag="FOA43_003123"
                     /db_xref="GeneID:62196524"
     mRNA            join(<946060..946064,946182..>947244)
                     /locus_tag="FOA43_003123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923400.1"
                     /db_xref="GeneID:62196524"
     CDS             join(946060..946064,946182..947244)
                     /locus_tag="FOA43_003123"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779328.1"
                     /db_xref="GeneID:62196524"
                     /db_xref="InterPro:IPR011333"
                     /translation="MIFSELIKTVMSQQDVITQVPNDVGQDQPMLIGGDVDDYNTEIQ
                     MNLRGQMFTITRDDLMGLPESVLLCLFPNGVFVDKDGNVITNLTEDDVVFVNFSPECF
                     QYICTVFDSAVKDLQFQEQKLLIPKQQVYDINDPSILSDKPSIIVLREDLDYYCIPPV
                     RGLSIDEMRRIKVLVGQKLVGNTRIFDGLGYKAGQQLKPAEQHLMDMLCSSGFSVNGD
                     WGHRSLEPGKTVVFSLTLVRLNNRSTGTSSPCDSPQLNPVSSASSAASSERKRSRFSN
                     IARAVSRASSRTRKEKPNSNATKLLLFWRKPARKCWWSDVVEEVDLGSLAIKGIDGDV
                     TKMKVHILRVWTLELSIIGVQ"
     gene            <947445..>948542
                     /locus_tag="FOA43_003124"
                     /db_xref="GeneID:62196525"
     mRNA            <947445..>948542
                     /locus_tag="FOA43_003124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923401.1"
                     /db_xref="GeneID:62196525"
     CDS             947445..948542
                     /locus_tag="FOA43_003124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779329.1"
                     /db_xref="GeneID:62196525"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR036052"
                     /db_xref="PFAM:PF00291"
                     /translation="MVCVFKRLFSMTRAVQLSYIDGFKPLVAKTGLAGAIGNTPLIKL
                     NKLSEETGRNIWGKAEWMNPGGSIKDRAALWLIESAEKRGMIKPGGTIVEGTAGNTGI
                     GLAHVCRAKGYKCVIFMNNTQAPGKMQTLKLLGAEVHAVAPAPFSKPENFNHLAKKFA
                     DETENAYYTDQFENLDNRQSHIESTGPEIYEQLDGKVAAFTCSLGSGGTWSGVTHYLK
                     SKDPKMKSYVAEPPGSCVYVYVKSGGKSIDVDGGSITEGIGQRRITGNVAADIKYAED
                     AFLVPDEETISMLYRLIDDEGIYVGSTAALNVVAAVRAAEHVPEGSNVVTILTDSAHK
                     YSDRIFSKKWLQSKNLYDCIPDHLKKYAALV"
     gene            complement(<948568..>951159)
                     /locus_tag="FOA43_003125"
                     /db_xref="GeneID:62196526"
     mRNA            complement(<948568..>951159)
                     /locus_tag="FOA43_003125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923402.1"
                     /db_xref="GeneID:62196526"
     CDS             complement(948568..951159)
                     /locus_tag="FOA43_003125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779330.1"
                     /db_xref="GeneID:62196526"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR035983"
                     /db_xref="PFAM:PF00632"
                     /translation="MPPNGSTKRSGWLNRQVNKRAEPTVQASKPPIKELICDSCACCG
                     TIIKYPSDVSRVMCMVCQTSFTTCISSTADSPQLPQFSISFNELKDTIQQCHGQPDFK
                     AVQNLIIRSFSSDSVLNASFKLDSRSSSSYHSPNLNYAELRKFYSLLRKLPTNAVFYR
                     LLITSLHLLRHPPRISDVHSISWLLILLEIPLLPESLISGNDTATNGTSSLAPQLKSI
                     CYDILKRVIGLMAHMDRKCMQYVTNWWSKLPDNEFVRKIDFLNLYITFQLTRCINYEI
                     YNTVINTSSYVCAQNIPDDDINYKDTLRAHFIRPTSQSSDFGLSIRIPLFISSGGRRL
                     STTNGQLHQQSSSPWGGAGSKTNKEHYIKIKIQQYSDEWHLRTAARVLSLLFSANKNR
                     SKVPEAAFYNCLVDYVNVKQDFDSWQFTTTTKMHERDLKLSNDSSLLVLDYLKAESNG
                     IYLNVTSRDGASLRKPSFTFCQFPFLISLGAKITILEHEAKRNMERKAEEAFIQSINK
                     KIPFGMYFKIRVRRTHVTNDSLRSIKAHQNEFKKLLRVEFVNEPGIDAGGLKKEWFLL
                     LTKELFDAEKGLFSYNETSHLCYFARSPINSDELYYLVGAVLGLAIYNSTILDLKLPR
                     ALYKKLMNRKVTLHDFIQLDPETGAGLQRLLTCHGVQDLAIFFEVTYKDIFDDIVTKE
                     LIKGGSQVPVTDENKYEYVERYMNFFLNDTCKQPFEAFCKGFYNVVGGNALSLFTPEE
                     IQLILIGDESSSKLDTSIMRSITKYNGFQADDEIIDWFWNYFDNCSTAAQKKLLFFVT
                     GTDRLPATGLPSLHFKITRLCDSSIKLPTSHTCFNELCLYDYQSQEIFKEKMDLALDY
                     GEGFGLR"
     gene            complement(<953665..>954825)
                     /locus_tag="FOA43_003126"
                     /db_xref="GeneID:62196527"
     mRNA            complement(<953665..>954825)
                     /locus_tag="FOA43_003126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923403.1"
                     /db_xref="GeneID:62196527"
     CDS             complement(953665..954825)
                     /locus_tag="FOA43_003126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779331.1"
                     /db_xref="GeneID:62196527"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="PFAM:PF00022"
                     /translation="MSSETIYNQPIVIDNGSGMIKSGFAGDERPKINYSNIIGRPKYT
                     KVMPSSISEQDTFIGSKAQKLRGLLRLKYPMSHGIVENWSDMEQVWNQVISDLDCKPE
                     EHPLSITEQPLNPRSNRTKMCEVLFETFNFPVLHVAMPAVLSLYSTGRTTGVVVDSGD
                     GVTSIVPVYEGFAIPGSIKRINLGGRDITKRLQIELMRSGYSLTSSSEFEIVRSMKER
                     LGFVAPELQSLHMGGRSLISEYLMYDSTADVKSFKLPDNKVIKMSESCLSRPCEVMFQ
                     PESSGFEETSIQDALYYAIMQTDADLRSKLFQNIVLSGGSTLFKNFGTRLLREMQRLD
                     TEAKLKIYASADRKVSCFVGGSILASLSTFKNIWVTKSMYQEDPYCIHHKFP"
     gene            complement(<955194..>955841)
                     /gene="FUR1"
                     /locus_tag="FOA43_003127"
                     /db_xref="GeneID:62196528"
     mRNA            complement(<955194..>955841)
                     /gene="FUR1"
                     /locus_tag="FOA43_003127"
                     /product="Uracil phosphoribosyltransferase, synthesizes
                     UMP from uracil"
                     /transcript_id="XM_038923404.1"
                     /db_xref="GeneID:62196528"
     CDS             complement(955194..955841)
                     /gene="FUR1"
                     /locus_tag="FOA43_003127"
                     /note="BUSCO:EOG09343LVI"
                     /codon_start=1
                     /product="Uracil phosphoribosyltransferase, synthesizes
                     UMP from uracil"
                     /protein_id="XP_038779332.1"
                     /db_xref="GeneID:62196528"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="PFAM:PF14681"
                     /translation="MTEVYHNIFKLRLSNQLRCLYTIIRDEKTSRADFVFYSDRIIRL
                     LVEEGLNQLPVKSKTILTPTGSTYHGFEFEGKICGVSIIRAGESMEQGLRACCRSVRL
                     GKILIQRDEETALPKLFYVKLPTDISKRYVLLLDPLLATGGSACMAIDVLKQKGVSED
                     RIIFLNVLASPEGIEVFRSKYPKIKVITGMVDDGLNEHKYVIPGVGDFGDRYYCI"
     gene            complement(<956095..>958458)
                     /locus_tag="FOA43_003128"
                     /db_xref="GeneID:62196529"
     mRNA            complement(<956095..>958458)
                     /locus_tag="FOA43_003128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923405.1"
                     /db_xref="GeneID:62196529"
     CDS             complement(956095..958458)
                     /locus_tag="FOA43_003128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779333.1"
                     /db_xref="GeneID:62196529"
                     /db_xref="InterPro:IPR011502"
                     /db_xref="PFAM:PF07575"
                     /translation="MFGAKNKRGNGVRADSGHGIFNMGSSTNGEELVSQRSDDDDKDD
                     EMMDAIRIPSEQDGFDDAETEDALQIDRATQLPITKLPYAEGGPIPKSSPDWLKNGRH
                     LELSIDKAHNFGILYVTRKLEGEEEEGKTDKLDKPETSKLYPFELEPKMDKSEERVSL
                     LNKLYEDFEPLLKNRAYKTYSDDDDTGLEIGVLSIIRNRREEKKTFLRSVITNTIENL
                     KEIISIQIRENDETTYVSMFNYEEILNVINLLNALKFAKEDEIIILLQMWVNRASLQP
                     DNELVDRAMDNENGSPYKNLIFWSAYLKKLILRGYFDQAMSALDESGYEELEQSDVNL
                     FNLITDLRTLMGTYDAVEFSRDSKSFFQWKKNVVELRERLSELEFVNKEISVEVREMI
                     STMSGFGKTIQANCSSWYEYLLARFMFSLPSMKMINGYVEEAVAAFPVNQVSSWESIC
                     QELFECKYLNVISSLEMLDRSIATYMGVLMSAAGLLKPYSEVMGNDHESDIKTTIDQM
                     LEDLTLSYFAERELFSTAVGILVTTGNSKAREIVSQMLPKYQIQDNDDFEWSLSVCAK
                     LKLTQTAVDIYNIQGEVLLNQGYEYESLECFAEAGNAVKLVDTVWKIFENLLLDGEHE
                     DSLLNEKIDANEIQSSILRQALSPLALLRDILKYDLKSSHSERLSFEKLIKLLQFKYL
                     PAHCKPVLLLMLLPFFNTASLTLHQLVEIIKILNDYEKQLREEEHASKYSEQMYRMAL
                     KRKNIHKSGSEFDWRNRQELPVSCQALILKIRELISFEISFKFLEQN"
     gene            <958884..>962474
                     /locus_tag="FOA43_003129"
                     /db_xref="GeneID:62196530"
     mRNA            <958884..>962474
                     /locus_tag="FOA43_003129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923406.1"
                     /db_xref="GeneID:62196530"
     CDS             958884..962474
                     /locus_tag="FOA43_003129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779334.1"
                     /db_xref="GeneID:62196530"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="PFAM:PF10441"
                     /translation="MLSNKGLKLGLASEYDFKTTEGITRYLRSRKTSINEIYQVSFKL
                     IKDDPEYHLPQKEKFIFELLCDRLSQPNLGEFKRSPEVWDLFNQIWSKLNDIKQIVLG
                     KTRLCNILTSSIEEIDNSESYQNEKLVRFFSSCLQLAIRHSKLPFSQDQSVSIISRIL
                     KFITSEGSSYGESLVEEMASVLITVYNQSNSSAIRYSKNVVSQFCGSCLPNLTSLITE
                     DLISSTIRSKLELIVTDTLFSENNSVHCKDNLGFFINSARAQNKIGTKELVYLFKMVI
                     PKVSIAEIEDIFKFFTMRYPDSSADLLQEVITINKTLSTEFLADLVKRELDAPKKDSH
                     KIIVLALKRNTEVGIKFSHRIIDVSLKKDDEEALFLLKALFQCYVRARELPSFVKLWS
                     DYIARGSSLQTQTVLTSSEMVGSCSSYFVSLSYVQLERLMKTLVNQYRDDPKNSFIPL
                     LSISRGLLAGITGSINSSNNVSLISNIEKLKPLYVEILRISSKISTEGYTWKLSSYIF
                     MLYDLDELTSEIDVKWFFEDPKTHMDNESYFFTLFRILEQDPLLYSKKVGSAFIKGFS
                     KADSKDFQRAVFFRWCVLLNSLMDIEDIRKLVKVLFGHHIDDQLVFDILSYPVLHEQS
                     KFMDAIVDSIIVQFDKKKGASLRFVDLIPVYCYGKHQRQKMLDGLLDMAILSDCSNEN
                     KLCASHAILDLLELPTFKSLIETDPKSMVKLVSSSTDTESHDSSLEIARKICIEYMRQ
                     SSADDSGFIPKLQKLLDSKLRSKSKKLVFAPYLSICLCLLKSSSNKSEEFKPLLTLAA
                     SKALEIFSKNPSDADICWLCGLLSDVYCLDPSCIEKSALKHDIKSLGQTGSIEVQQAL
                     FGLVTAVSGIYEPIYVVSMFLALGDSESNVANIDSFIEHLSTESEDGFKMLWLSVLKI
                     LEEEDQTYKLKCIYLLCSFFKHLKKPSDDALIDEQQTLVVKSISFIVSMRNKSSFPST
                     LLIELLKSLRTIISAKYWSLTQYSIELIVVLANQIVDASISTEVYVHLTQLVASILLF
                     QRFRLSSRLHLIITVVNELMELLFVKDDSRSLIFSSQDCGIAFERLMGNLCEPSVTTI
                     TGHTEGGSLETSGKVDGTDASATTAVSRMKTNLRRSLPVVVLNYLRLFLKYEVEPDVK
                     KHLLNSVFLIMKALTSNEFNYINASVDSQSRAAFKKLYEDYTKFGKWREE"
     gene            <962625..>963779
                     /locus_tag="FOA43_003130"
                     /db_xref="GeneID:62196531"
     mRNA            <962625..>963779
                     /locus_tag="FOA43_003130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923407.1"
                     /db_xref="GeneID:62196531"
     CDS             962625..963779
                     /locus_tag="FOA43_003130"
                     /note="BUSCO:EOG0934391Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779335.1"
                     /db_xref="GeneID:62196531"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF18972"
                     /translation="MVEITELHDDEPIEVTTPESTMEGAPQLPPGMAEFTGKSSEEML
                     AELKKSPFFMDSYDANGDHGDNPQLEALKSLQSEGTPKEIAERQKSRGNDFYKRKQYR
                     EALKCYTEGIDARCGVKFIEAALYTNRAACNLEFKNYAMCIGDCRKCLDRQPKNVKAL
                     FRCSKAMFAIERYEDAEKTLLYAVSIDDENVAVNAMLKKVRARIQAIIKAEERKARAK
                     AEKEQKDKALKEALSLRGIVNLRTNEPADTPDGSKLHLEDSKDVQSQLIIPAMVLYPT
                     TDEFDFVSEVSELTTPLQLAEIVMDRPDSYFEDGKHTNFRPKRLEAYLETQSGGLIKV
                     GKKVIFSKALMQAHAPLFDGILRVYLVPRIDSTNWISKWDKMKALGKRQQ"
     gene            <963959..>966901
                     /gene="DIS3"
                     /locus_tag="FOA43_003131"
                     /db_xref="GeneID:62196532"
     mRNA            <963959..>966901
                     /gene="DIS3"
                     /locus_tag="FOA43_003131"
                     /product="exosome catalytic subunit dis3"
                     /transcript_id="XM_038923408.1"
                     /db_xref="GeneID:62196532"
     CDS             963959..966901
                     /gene="DIS3"
                     /locus_tag="FOA43_003131"
                     /note="BUSCO:EOG0934099L"
                     /codon_start=1
                     /product="exosome catalytic subunit dis3"
                     /protein_id="XP_038779336.1"
                     /db_xref="GeneID:62196532"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="InterPro:IPR033770"
                     /db_xref="InterPro:IPR033771"
                     /db_xref="PFAM:PF00773"
                     /db_xref="PFAM:PF13638"
                     /db_xref="PFAM:PF17215"
                     /db_xref="PFAM:PF17216"
                     /db_xref="PFAM:PF17849"
                     /translation="MSISLKRKRLSSGLSVSQKVFVRSRNGRATKIVREHYLREDIPC
                     SSMACSKCEEFYFVDANGEMRHPILSDSPFDLQNNDIGKHYLIVDTNVVLNAIDMIES
                     SSVFYDVIVPQTVLEEVRNKSYPIYMRLRDLTKNEEKRFVVFYNEFKVDTYLTRKKGE
                     TMNDYNDRLIRECAKFYSEHLKPCGITTVLITGDKDNKAKALKAGIISMTLPEYVSLL
                     PNSKELQDILPSKEGFSSNYKEIRYPEYCSVARLVGGVKNASLQQGIINISSYNFLEG
                     SISVPSLPKPLLILGRENLNRAFNGDTVVVEILPKNMWKKPSTEIVDEEAINKNEIGD
                     NDENEVIITDQERRILAREAIKAQGDSSVDETEKIVPTGRIVGVVKRSWRLYVGQLSP
                     NSVDKNRIGGNSAKNCFVILMDRTLPKIRIKTRRARELVGKRIVVAVDSWPTTSKYPE
                     GHFVRTLGDIEEKDAEQEALLLEHDIEYRPFSKNVLSCLPKEGHDWKVPENLNNGDVL
                     LAKREDLRDRLICSIDPPGCVDIDDALHAKKLSNGNYEVGVHIADVTHFVKPGTALDQ
                     EGASRGTTVYLVDKRIDMLPTLLGTDLCSLMADVDRYAFSVIWEMNNNAEIVNVRFTK
                     SIIRSRHAFSYEEAQLRIDNKSNQDPLTEDLRILLKLSKVLKKRRLEVGALNLASPEV
                     KVHMDSETSDPNEVEIKELLDTNSLVEEFMLAANISVARKIYEAFPQVAMLRRHAAPP
                     ATNFEILNDMLHVCKGLSISTESSKAMADSLDRCVEPEDPYFNTLVRIMATRCMMAAE
                     YFTSGSYSYQDFHHYGLAVDIYTHFTSPIRRYCDDVVHRQLAAAIGYEPLSELHMDKD
                     KMDLVVKNINKRHRNAQFAGRASIEYYVGQVMKNAEATEDGYVIKVFSNGIVVLVPKY
                     GVENLIKLELLGDANTAKFDEDKYRLSFKDKEGKQREVAVFDKVKVFVKSHLDEFTGK
                     RKVQLLLK"
     gene            <967069..>969318
                     /gene="GCN20"
                     /locus_tag="FOA43_003132"
                     /db_xref="GeneID:62196533"
     mRNA            <967069..>969318
                     /gene="GCN20"
                     /locus_tag="FOA43_003132"
                     /product="ATP-binding cassette, regulator of translational
                     elongation"
                     /transcript_id="XM_038923409.1"
                     /db_xref="GeneID:62196533"
     CDS             967069..969318
                     /gene="GCN20"
                     /locus_tag="FOA43_003132"
                     /note="BUSCO:EOG09340L34"
                     /codon_start=1
                     /product="ATP-binding cassette, regulator of translational
                     elongation"
                     /protein_id="XP_038779337.1"
                     /db_xref="GeneID:62196533"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032781"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF12848"
                     /translation="MSNLGLQIRQAASSVDPIVADYTVGYVQHIIKSTEDSVLSQQLD
                     IPTKVEFLRGMLISAGGDSKKVEKLCSHIESTLVDRLKKNMAKLKVEGDTSKRLLDAS
                     LLSSHERDDTSMTFLSSSVDVEHIGRQMESKVDKKKLKKAEAKIARKMAKREDRYVKY
                     EASKLINEQKQDDYDSFYLKVNPLDVEETGGRSKDIKIDSFDLFVGDAQRILMDASLT
                     LAFGHRYGLVGQNGVGKSTLLKALSRRQLDIPKHITILYVEQEYTGDDSLVLQSVLDA
                     DVWRKQLLVEEQKTNERVEEIEKLRKEFEDGSPEMKKLDTEQDDLYQNLEKVQERLAD
                     IESDKAEGKAAHILYGLGFSEEAQNRPTKEFSGGWRMRLSLARALFCQPDLLLLDEPT
                     NMLDVPSATYLAHYLKTYPSTVLVVSHDREFLNEVATDIIHQHSERLDYYRGSDFDSF
                     YNTREERLKTQKREYENQIAYRKHLQAFIDKFRYNAAKSREAQSRIKKLEKLPVLLPP
                     EQEHSYQFKFPDAEKLSSPTLQLLDVSFGYKPEELLLNHVDLDLQMDSRIAIVGANGC
                     GKTTLLKIALGELDPTGGSVYKNHNLRIGYFAQHHVDALDLSQSAVSWMGKKYPGKTD
                     EEYRRHLGSFGITGSLSLQKMALLSGGQKSRVIFASLCLNNPHILVLDEPTNHLDTAG
                     LDALATALKNFKGGILMVSHDVHMIKEVCHDILYSEDGKVRKFPGTMDDYKDYILEEA
                     DSVGVVKRH"
     gene            969634..969705
                     /locus_tag="FOA43_003133"
                     /db_xref="GeneID:62196534"
     tRNA            969634..969705
                     /locus_tag="FOA43_003133"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:62196534"
     gene            complement(<969831..>971579)
                     /locus_tag="FOA43_003134"
                     /db_xref="GeneID:62196535"
     mRNA            complement(<969831..>971579)
                     /locus_tag="FOA43_003134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923410.1"
                     /db_xref="GeneID:62196535"
     CDS             complement(969831..971579)
                     /locus_tag="FOA43_003134"
                     /note="BUSCO:EOG09343CKC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779338.1"
                     /db_xref="GeneID:62196535"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF00226"
                     /db_xref="PFAM:PF12171"
                     /db_xref="PFAM:PF12874"
                     /translation="MKADYYELLGVTNSADDSELKKGFRKRALKYHPDKNSSDDAAIL
                     FNEIRVAYETLTDPQERAWYDSHKYQVLAEAEDISGDDADTDNSTVYYSGTTVQDIEK
                     YFNDGMYTKFNDSASGFYQIINVLVTRISSEEVSSGKKQGLPGFQSFKDDTTMSNACD
                     ASELMYPRFGNSRSEYGNDVRLFYKAWTNFQSIKTFTWFDEYRYSTAPDRRTRRLMEK
                     ENKKRRQQARKEYNEIIRKWISYIKHRDPRVTPIIQRKYEKDRVKKQQKDLKRQAQKE
                     RQQRKEEDSEYVEQDWQTIDADELADIEQQLDKLYNEEDMLNGEKVDEEDFNRDIYEC
                     VVCDKVFKSEEQLKDHERSKKHIKKLRRLKWEMRQEGVELGIDDKGFLDEETEEELFD
                     DALEEMVEEELDDEESVVDESALKDHSAVDEGNKTIKEPANISDSLEAAVDENLDDLD
                     NSSLSRLQLSGDEASSAASESKTRGSNRSKDMKLQELSAILNGTTLESDSDDDWSTGN
                     KKSRKSKRKGRSKPSSGSNSHAPPSAADGCESSWVCAVCGKSFFSRNKLFQHVNDTGH
                     VAPPSKVKKGKKKNRN"
     gene            <971848..>973473
                     /locus_tag="FOA43_003135"
                     /db_xref="GeneID:62196536"
     mRNA            <971848..>973473
                     /locus_tag="FOA43_003135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923411.1"
                     /db_xref="GeneID:62196536"
     CDS             971848..973473
                     /locus_tag="FOA43_003135"
                     /note="BUSCO:EOG09342OSV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779339.1"
                     /db_xref="GeneID:62196536"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="InterPro:IPR036168"
                     /db_xref="PFAM:PF00928"
                     /db_xref="PFAM:PF01217"
                     /translation="MVVLAGSICTRGGKPLLSRQFRELSKDRVTSLLANFPTLLSDST
                     QTQHTSVEDEFVRYVYQPLEEFYVVLMTNKHSNILQDIDTLHLFAQTITSILPSVDER
                     EIFDNCFEIANAFDEIVNLGYKENLSLSQVLTFLEMESHEEKIQEIIERNKELEAAEE
                     RKRKATEIFLSNTVSEIRNKEMMRKANMNAYGDNAVLIGQQDYSQANYSRPSAQQQPP
                     ALAGSGIRAAPPRKGGLQLGRKASGFGGNSDAQPLLVDPTPTGIGAAASASAVSVASS
                     TAAVTAAKSQIANNGILIITNEKFSAQITRDGSITSSEVKGDLQIRINNTDYAHAKLQ
                     LSLNKPDDVNTQFKTHPNIDKALFHSTSEIGMKDPSRAFPSNDQTLGVLRWKSVPKSS
                     VGDANLLIPIMLTTWVNNNNDGTIGLTFEYENLSFKFIDELTIVIPVVNATIDSSDYD
                     NVTLEFGDDGLHVKLTGLTENQEGSLTITCKDVDDEEALFPMELAFDVTKKLEAGDKA
                     CQVSVDAVTNTSNDEDLPYDIYYRGVSEGFYIV"
     gene            <973867..>975330
                     /gene="FUM1"
                     /locus_tag="FOA43_003136"
                     /db_xref="GeneID:62196537"
     mRNA            <973867..>975330
                     /gene="FUM1"
                     /locus_tag="FOA43_003136"
                     /product="fumarase fum1"
                     /transcript_id="XM_038923412.1"
                     /db_xref="GeneID:62196537"
     CDS             973867..975330
                     /gene="FUM1"
                     /locus_tag="FOA43_003136"
                     /codon_start=1
                     /product="fumarase fum1"
                     /protein_id="XP_038779340.1"
                     /db_xref="GeneID:62196537"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="PFAM:PF00206"
                     /db_xref="PFAM:PF10415"
                     /translation="MLSAFTKPLSIRMASRAFSTTACTKRIETDAFGEIEVPGDKYWG
                     AQTERSRQNFKIGGEKARMPEPVVRSFGILKKAAAIVNTELGVLDPKLSQAIQQAATE
                     VSEGKLDEDFPLVVFQTGSGTQSNMNANEVISNRAIEILGGQLGSKKPVHPNDHVNMS
                     QSSNDTFPTVMHIAALTQISNNLLPALQALRDSLQRKSDEFEHIIKIGRTHLQDATPL
                     TLGQEFSGYVSQLDNGLRRVKTASESLRYLAQGGTAVGTGLNTRIGFAEKIAEQITKL
                     TGIQFYTAPNKFEALAAHDAIVEVSGALNTVAASLFKIAQDIRYLGSGPRCGYHELSL
                     PENEPGSSIMPGKVNPTQNEALTMVCTQVFGNNSTITFAGASGQFELNVFKPVLIANL
                     LSSIRLIGDGCNSFRVHCVDGIKANEDRINYLMQQSLMLVTALSPKIGYDKASKIAKN
                     ANKRGLTLKESALELGYLTSEEFDDAVKPEEMLGPKA"
     gene            <975709..>979329
                     /locus_tag="FOA43_003137"
                     /db_xref="GeneID:62196538"
     mRNA            <975709..>979329
                     /locus_tag="FOA43_003137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923413.1"
                     /db_xref="GeneID:62196538"
     CDS             975709..979329
                     /locus_tag="FOA43_003137"
                     /note="MEROPS:MER0000496;
                     BUSCO:EOG09340NRT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779341.1"
                     /db_xref="GeneID:62196538"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF02190"
                     /db_xref="PFAM:PF05362"
                     /db_xref="PFAM:PF07724"
                     /db_xref="PFAM:PF07728"
                     /translation="MLTFHLLAKKQFRFAARMCPRLLSRNASWLSDIQTRAVLAKGKP
                     IFSSRKLNPLRSAPAPALVDIPIQNMFQGRVSTVSGPDSMISPSFFTSSDNLFYSQTP
                     LLMRRSNDHDKKDDQTDTSEKPKDKDDDIDTSDKETPKSNDVPDSKPTPKPAKSSRKA
                     SKTSHVASAGASGAAGSSNGSKGGDSGDGPRPKPKAKPHNVVELPEVYPKIIALPISR
                     RPLFPGFYKAVIISDINVIKAIKESLDRQYPFIGCFLFKDENMESDVIESKDQVYDTG
                     VLAQITSNVYTKDSETGVETLTTVLYPHKRIRIDELYPPLTHSEKAIVPEIDAKTIAE
                     NVANKSADNSKQIIEGITGEKEGDEPQKSVEPSEIISAAEKEENSNDSLASPADEEDN
                     PTVFLEKYPITLVNVSNVEDEKYEKNDPVINSLTAAILEVLKDMSSLNKSFSDQLATF
                     SASLHSDIFNCPEKLADFAAAVTAGDQKDLQEILECPDVAKRLEKALTVLKKELMNKE
                     MQKKIEKDIEERMTKRHREYHLNEQLKWIKKELGIDDGREKLIAKYNERAKKLHMPPD
                     VKKAYDDEINKLQTLEPMMSEFTVTRNYLDWLTQIPWGKQSKDNYSIKRAKKVLNDDH
                     YGLDDVKDRILEFIAVGKLLDKINGKIICFVGPPGVGKTSIGKSIAKALNRKFYRFSV
                     GGLSDVAEIKGHRRTYVGAIPGRVVQALKKTETENPLILIDEIDKMSRTHSVNGGDPS
                     AALLELLDPEQNSAFLDNYMDVPVDLSKVLFVCTANTLNTIPLPLLDRMEVIEISGYI
                     EDEKIKIAEKYLAPEAKKHAGLEHVKVDITEDALKSLIKSYCRESGVRNLKKQIEKIY
                     RKAALNVVETVGDPEGEEAESVVEESQEKEIEKREAAEAKKEADTEAEIEAEKNLKED
                     PATVYGKKTASEVKKDEKADVLFKSQKPEKEAVAKKIRDKVTRIVVPDDYSVQITPDN
                     LKDYVGPPVFISDRMYQTTPPGVAMGLAWTSMGGCALYMESVLEHVLSRDSHPKVERT
                     GQLGDVMKESVSIAYSFAKGFMAREFPENKFFDKAQIHLHCPEGATPKDGPSAGVTIT
                     SSFLSLALNRPLRPDVAMTGEITLTGKVLRIGGLKEKTLAAKRSGVKTILFPKDNEVD
                     WKELSENVREGLTPIPVDWYSDVFKALFSVSKEEGNNVWKKEFDDIKEEEDKERQRIR
                     QS"
     gene            <979516..>980070
                     /locus_tag="FOA43_003138"
                     /db_xref="GeneID:62196539"
     mRNA            <979516..>980070
                     /locus_tag="FOA43_003138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923414.1"
                     /db_xref="GeneID:62196539"
     CDS             979516..980070
                     /locus_tag="FOA43_003138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779342.1"
                     /db_xref="GeneID:62196539"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="PFAM:PF06058"
                     /translation="MPSEVTKTEVERDDEQEEDENNIQEQEQEQQTLEIYRKALTFNV
                     IAKYDPLINQLIHLSSYCVVYKYEENDWNKLDYQGPIAFYSRSAAELSEATKFSVEQV
                     LKQDHYKYGLIILNRAKPENFTIGFLGNDNLIAEDAGKGMFVESKEKLVIVRDFKGDT
                     FGLWLFDPQDREYLYKFLKYCVDN"
     gene            complement(<980139..>982367)
                     /locus_tag="FOA43_003139"
                     /db_xref="GeneID:62196540"
     mRNA            complement(<980139..>982367)
                     /locus_tag="FOA43_003139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923415.1"
                     /db_xref="GeneID:62196540"
     CDS             complement(980139..982367)
                     /locus_tag="FOA43_003139"
                     /note="BUSCO:EOG09342KK5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779343.1"
                     /db_xref="GeneID:62196540"
                     /db_xref="InterPro:IPR021950"
                     /db_xref="PFAM:PF12090"
                     /translation="MNIVNGSNSTNGINGTNGTNGTNGTNGTNGTNGTNGSNGNDGRG
                     APTGSSAPNAIEHTTSRRNNTQAYLINLLNRIQPGPGMTRQQKLQQMIRTGELKREDI
                     VLLQRHQQYLKQQQQQQRQKQQQIQQVQQAARRNVAPGGKNLSPSLIPEKSTSSGFQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQQQQQQHPQRTFLGLTQ
                     EQLAKLTPQQRKTLMLQQLRRRARTQRFYESNAEILKKYEKYPASLELHIHENHYRFG
                     NKDTVIPKNSPTIKEFLKYVARGDIPEALMEVIRDGGIQMYDGSLILKVFDHRNIEES
                     TLEGSRSGKASAANNTGTENDGLVITGSTDAKLNANTNTSSSNVANSPTALKPKEYRT
                     ILRMTQLALYDDLAMQTDSQQFHDTFALTFESEVLTAADRSINLQPILNPYLYDRTLR
                     PDYELMAPQYNTDTDAVIFCHRDDAREIDDNGKRLLEPITCYNFKYKPLHEDLSRSNS
                     KYEQLMTILSQTYRHSNRISEPSKELGDEPADFERLRFIEMWRRKLAVLKQQAMNNSL
                     KQQLGAGGASTASISPTGAGMIRGNNSMPGTASAATGFGGFMTQQERAMLNQRQFMSQ
                     RHKEQMAAASVSGSVSNSSANSKSGSPGMETGKKGGRKRAERKRKPRKPTKKQLAAQA
                     AVTAATAAAAGAAGAASTTTDHSAVAGKAPPAASYEPPAKKRKTYKRRKKDTAAAVKA
                     EN"
     gene            <982740..>984842
                     /locus_tag="FOA43_003140"
                     /db_xref="GeneID:62196541"
     mRNA            <982740..>984842
                     /locus_tag="FOA43_003140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923416.1"
                     /db_xref="GeneID:62196541"
     CDS             982740..984842
                     /locus_tag="FOA43_003140"
                     /note="BUSCO:EOG09341P4G;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779344.1"
                     /db_xref="GeneID:62196541"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MNQLLNLQQDVGKDSSSNTSPFTSSPQQVPAMNFSGTFNNDFVT
                     TPSSTPSSSSSSSQSYPFNAPQFVPSSTSSYFKIFQNQLQPGSSQLNYQFPPSTAPLI
                     AAQQLNASESRLFQSQVTPQTQGSLVNTGFPKGHLANLIESANPDIPAASTVTATPQL
                     LPDIGTAPSRTVYLGNVPNFISAYELLNHVRSGIVESVKIIPSKNCAFVSFLDENSAM
                     LFHSDAILKRLTIGNHEIKVGWGKSTPVQTIVASCVTRYHATRNVYLGNLPEDTTESE
                     LASDLAEYGEIETVKVLSEKRIAFVHFTSIIAAIRCVQSLPLVPKYRDRKVFYGKDRC
                     AFITKTQQHNAAQYLGLNPNSDNFLRQVDREMIANALVQQSNAASMIATAAGGVSNMG
                     NRTIYLGNLHPDTTIEEICNVVRGGILQNVRPIPERHVCFVTFVDPISAAQFYAMSSL
                     HGLIIHNRKIKVGWGKHSGPLPNSLSLAVGNGASRNIYIGGLDKIPEISFTREKLFED
                     FKEFGEIEQINFFEERHCCFVNFTNISNALKAIDGIHNNPDYEKCKINFGKDRCGNIP
                     RQFQLGEHHSSTNSSHSNSSGSGSGSGSGSGSGSGSGSGYGSGSVSKPASSTPSQQSS
                     STLDILRYPLYASDKPPPLRPLHQQSQFGLMTPSSSTSSELQSPRKDLDDDSSDNGFV
                     NDGAGKYGPLGIMMGGHH"
     gene            <985495..>987174
                     /locus_tag="FOA43_003141"
                     /db_xref="GeneID:62196542"
     mRNA            <985495..>987174
                     /locus_tag="FOA43_003141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923417.1"
                     /db_xref="GeneID:62196542"
     CDS             985495..987174
                     /locus_tag="FOA43_003141"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779345.1"
                     /db_xref="GeneID:62196542"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="InterPro:IPR038271"
                     /db_xref="PFAM:PF02133"
                     /translation="MSPILRAMNSVSKWLDSHGGESRGIHRYLPEERANTNLTRAFIS
                     IYGLWISGCGGLTSMSSYFLGPLLFGLGYKDTLLCGIFGTIFGCLVAAYCATMGPRSG
                     LRQMCSARYLFGPYMVRFVSLITIIGFLGWSVTNSVLGGEILSEINGGGLSLSLGVTI
                     VCLVSLVVAIFGIHYLLKFESLVGLLVIIVVMLMYIIAGPYVTQYHNLQSLPGTNAVT
                     KIGARISFFNLAYSVTATWGGCAADYYVVLPETVTQRRVFISTFLGIAIPTLFGAVIG
                     MLIGNSAVGYQPWNEAYEQSSLGGLLNVMFSRWNGFGKFLLVVFWLSLITNNTINNYS
                     SALSVQLIDDFFFKYFPRWFIVVIIFVITLVCSLVGRNSFSVILSNFLPMLGYWISIY
                     ATLLLEENVIFRSTRLVRLYRYELYGDDKSPVDTSTTTTGMATKGEKLEETTIKVPRD
                     HDHGHDHDHDHEDPAAEYPPPYSTTKSIPYYNFEVWNDKKYHTHGIAAFISFCCGVAG
                     AVMGMYQAYYIGPLAKLIGEDAADIGTFLCIGFTGLIYPVFRYAELKRYGK"
     gene            <988103..>989506
                     /locus_tag="FOA43_003142"
                     /db_xref="GeneID:62196543"
     mRNA            <988103..>989506
                     /locus_tag="FOA43_003142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923418.1"
                     /db_xref="GeneID:62196543"
     CDS             988103..989506
                     /locus_tag="FOA43_003142"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779346.1"
                     /db_xref="GeneID:62196543"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="PFAM:PF10104"
                     /translation="MTGKVLQNTNESFSVASTVDSTNLLANSGLSDITLTPIKSLKDV
                     QTHNPTELTETLRRAQNGETFLPEQINFLGPGSGVPKRKIVFPQAFSSPKHSNSGVSL
                     SFFNSQPGLQLSQTSSGTLNPVKGAYNIFDKRKVSNSTPGRKRKRKRILTPETSQGVI
                     NRSLHEPQEYLDRANKETPQNRTEPSSSSPSPSPVSSSLSLTQKLLTDPQCITNLTLI
                     IQILLNALIFTCFILVILMCFLSVKRDVDHKVQTYVNDLIHQINGCRREYLRNNCAPE
                     MRVPALESSCNEWENCMGQDPESVITSVAYFEVMAECMNAFFHNLSFRTLISMAVLLL
                     CSVVLPNVLFNKFRSTSSNTTTNNTTYYNITHDQSTQQSPVRSDFSGSPRRLIDNTVF
                     FTPMQGPEPVQAGSQTATGRLSGGLLTPSPKKSSETSVRFNPNVSYSFYDSEYTGNNT
                     SYVDASPTLKVRNRNRY"
     gene            complement(<989559..>991388)
                     /locus_tag="FOA43_003143"
                     /db_xref="GeneID:62196544"
     mRNA            complement(<989559..>991388)
                     /locus_tag="FOA43_003143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923419.1"
                     /db_xref="GeneID:62196544"
     CDS             complement(989559..991388)
                     /locus_tag="FOA43_003143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779347.1"
                     /db_xref="GeneID:62196544"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR034261"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="InterPro:IPR039515"
                     /db_xref="PFAM:PF14570"
                     /translation="MSDHSDSFISEGDDLDYCPLCVEEMDVTDRSFKPCPCGYQICQF
                     CYNNIRTNPELNGRCPACRRHYDDKNIEYTPIDPDDLKQQQLKLERRKREKRQQEKER
                     KDAEMAKRHHLAGVRVIQKNLVYVVGLSPPCPPEELPSLLRSDKYFGQYGRILKIVIN
                     KRTPGPGSHHQGPPLNSGAGFFTGAGAGSSYGVYVTFARKEDASRCIKSIDGSISDGR
                     ILKAAYGTTKYCSSYLRGVPCPNPNCMFLHEPGEEADTFSRQDLSTRSVNNRMLEEQE
                     QQERVALHGLVPPLPESGNSSPHISHIPLTTHHVHEPALPSTASWGKGTNGNGSSSTH
                     HQQSLPSETFSSFPTLGDALQKAQKQQEAQILLQQQQGKKKDKREKESNHTIVLNDTL
                     LSYKMIGESLKQLNNQDEFSYTIKPSFRKDSSDSFLLFHTLDMDSLENNDMGSLEDET
                     ERRHMQQLVNSLLFTPYSKSYAYKPAVQAASATSTASPQENQLQLQQQQQQQQQQQQQ
                     IQQLQLQQQQQQLFLQQQQQQQQRQQQQQQRSGTPVQQQSSQQFLQQQFLQQQFLQQQ
                     RQQLQGTSTPPPPGLVNGSSTEMNSKTHSTELLNQLMGKKVTA"
     gene            <991658..>994843
                     /locus_tag="FOA43_003144"
                     /db_xref="GeneID:62196545"
     mRNA            <991658..>994843
                     /locus_tag="FOA43_003144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923420.1"
                     /db_xref="GeneID:62196545"
     CDS             991658..994843
                     /locus_tag="FOA43_003144"
                     /note="BUSCO:EOG09340G62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779348.1"
                     /db_xref="GeneID:62196545"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR016024"
                     /translation="MDDLLELLVNLMSPDNGLRTRSELQFKHMIESDPDSSLYNLAQV
                     GLNHSVDATVRLASILHLKRYTPKYWSAAFDKYVGPKTTNQHVKQTVRDALFTLLADD
                     SSKIRSAAAYAMVQIAVVDYPDEWPDLLNKLYDSIINKRDNTSAVLGSLSALHQLFDD
                     LITDEQFFQGGLAVEMMKTCEIMLTSDAYTIDVKVATLPLVKSIIDMLEDSAYYEDSQ
                     RRNFINTVIPKMLELLSGLSLQITASPTSFLGNIMLWDFKSKLYECLNALVNSFSKFL
                     KSKGSSLIDVVTADLSKEQPLYNSLCCNNQVSTESLVESAFSDLELFRHTEKEGATPV
                     DIVVATIRSQVEFLQSLLELQPLERSEKLSVLIDLFTKLNFLTSDKAADYQSDFNEFV
                     TDETDLSIAATVRSSLIGFFTELNGQDNALAIDILVRQLTSHPNEPQVLESLTVLLTC
                     SFDNDTEIATQPSFSLKDLFDFITSCIDDIFHRPDNFSEILLANFVILLPKFLMKYSQ
                     NNANLRSLAVPSLKRTISYLDNIDGNSDDYQLLKSALVISFQYYNQFIRTKEFDNEIQ
                     FKMMGIINQLKDDSEEDTNIMTLEAFTVLISIDNKALSSSDDAFLLILAIGYKDCSNF
                     SLNTPTLECISDLIKNLPLENYMTLSSKVLVLLIPIISHCSGEYSAEVDLTLQILAEY
                     VKGPNDDFKLPHDFFEYVFSPICKFILRSEDDHLLQSASTAFNEIVRRSSCEIDRYGD
                     AESGDTGNEMLLRIVAKFLKPGVSDQAIVNLGSLIVLIIDNFSGSDLIKRYFSDMLRG
                     VTVRLLSSKEVPTIENMILIFNKLMTASPSQTLQFLKSFNLGGHDFSSALAEILPTWF
                     QAFEVMRGYDKILDNIRAFSELLKLNDPILATIQVKGDLLPNQIPDDVILTRSMTKNI
                     ELKYQSIPADAKVIRLLVKELRFQLQSIRQEDNDVIAGAQTLVRKEVASAKEDTTEEE
                     EEEEEESDWEDLDDVKAPSFSELQQYVEGENIDEGYLKRSGRANSDIKNYLVDFFKDC
                     FVGKVTRFQEIYTHYLHGNDKKLLTESLVSS"
     gene            complement(<994891..>996465)
                     /locus_tag="FOA43_003145"
                     /db_xref="GeneID:62196546"
     mRNA            complement(<994891..>996465)
                     /locus_tag="FOA43_003145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923421.1"
                     /db_xref="GeneID:62196546"
     CDS             complement(994891..996465)
                     /locus_tag="FOA43_003145"
                     /note="BUSCO:EOG093431EL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779349.1"
                     /db_xref="GeneID:62196546"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="InterPro:IPR036128"
                     /db_xref="PFAM:PF03126"
                     /translation="MSDSDDELMALAGLESDERSNKEDDEYEPQISTSRRSSKRHIEE
                     EEEDDVEADEGEKDPYPLDGKFKDEEDRSKLLSMDEVSREQILYDRMQEKETLRERRY
                     LALRARQSKAESSAMEHTGSKTKKLKTSKLSELKRQREKKNRRRSKGNEDYDEDEENL
                     DDLVEDDDEDDRDLDELAGYGDEDEAYYSDEYEPSAGKTKGSKSGSSWGGYDDKYQRE
                     AKLDDLNKKVRFSRTVLDRFMYREEFDNVVSGSYVRLNIGLSRETGKPEYRMAKVEQV
                     KRDRKPYPLYGRACNTYLLVSQGDSKKVIDIACISDFPFTAEEFDNYKKRLENSEVEV
                     PSLGEVEEKFNELRAMSTRKLTDEDINKMVARKQELVGSMDSASRVRRLAGLREELQA
                     ALERVELDNVQELTKQIEELTKLKEKTGASTKMSEINLRNKRTTQVLIKRAQRKKAEL
                     EKMQSKAVKEDPNDPFSKLALAEAKRQQAEEDEVDRRELDPIETIKATAVGCKYRREG
                     VESVIKDIPFEIELEL"
     gene            <996704..>998779
                     /locus_tag="FOA43_003146"
                     /db_xref="GeneID:62196547"
     mRNA            <996704..>998779
                     /locus_tag="FOA43_003146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923422.1"
                     /db_xref="GeneID:62196547"
     CDS             996704..998779
                     /locus_tag="FOA43_003146"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779350.1"
                     /db_xref="GeneID:62196547"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="PFAM:PF02582"
                     /translation="MSPYSPKLPSQDRESVTGDLGSSSRNVAAGVHNLAPSVHKRPSG
                     STASAGAKRSPSILVTDSRKGQVKAPFAGNRRRQIEKTQHIDNHSYPVRMGNPSRYVE
                     KGRRSQSKYSDITVSNLTSNISDIPSSIRREAPPRYMSAGTVHARGPSGLHPIPQFLR
                     ALPSRSSKSIERLVLIPDQATFSKTGDNMIEGKSEATTDNIFLTGYKRTRAESMTKEQ
                     RELDYPRVTAYMIAEGVNLKLTSKFLAKQHLVSPRLYDDMLYVPYSLPLLPGDNGYRV
                     KSNNTAKNERGNELMEQFINKSELKEHHYEFYSGEDVESNVNNPGTGPGSETNTDFDP
                     SEPQFFVSTSPTESLIEEEVVNKPDNDQAKIKVIENSKPESKCNESAIDDSTLSSSGV
                     NIHSRRSSRKHRQSGLPDLTKHAEMFILNYGVVVFWNFSEIHEKNILADLVFAKIDPG
                     EFDDDEEEEEEEEEEEEEDDNDDNDDNESQRNLEDDQPVSLILKPVHEEDIEIEDFHF
                     EYNKEVSTPRIYNDMITLKSGDHLIKLTISHAIAQSTKLSMFESKMSIILNSISKLPK
                     LLALTGRLQNYTTKKLLMKTGRLLQLRSEVNLSSNVLDTPEYFWSVEPGLHPLYVAIR
                     EYLEIDQRVEVLNDRCKVFLDFFDIVSDSLAENQMVKITKILIVAIGLSVVVSIFEIV
                     IRYLLIRRV"
     gene            complement(<998831..>1000975)
                     /gene="GUS1"
                     /locus_tag="FOA43_003147"
                     /db_xref="GeneID:62196548"
     mRNA            complement(<998831..>1000975)
                     /gene="GUS1"
                     /locus_tag="FOA43_003147"
                     /product="glutamate--tRNA ligase"
                     /transcript_id="XM_038923423.1"
                     /db_xref="GeneID:62196548"
     CDS             complement(998831..1000975)
                     /gene="GUS1"
                     /locus_tag="FOA43_003147"
                     /codon_start=1
                     /product="glutamate--tRNA ligase"
                     /protein_id="XP_038779351.1"
                     /db_xref="GeneID:62196548"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="PFAM:PF00749"
                     /db_xref="PFAM:PF03950"
                     /db_xref="PFAM:PF18466"
                     /translation="MPYTLKIAAKAPVVDYALLTASAFINESDADTIKVEYINEKTIA
                     DTKLSAQLLKGDEVVASSSDEILNAVASTFPNVLLAKESSAEWIKFAYEKLTVKNFKE
                     LSKDLEKLDAHLNFRSFIIGYKITTADIAVWGCLRANPVMGSVIRNSVYINVSRWYHF
                     LEADKRFGDMATVLSKAMNELKKEAKQKQGGKKIHKANFDIDLPGAKDGEVVTRFPPE
                     PSGYLHIGHAKAAILNDTIAKAYHGKLIIRFDDTNPSKESQEFEDAILDDCKTLGIVG
                     DRITHSSDYFDEMYNYAITMIKEGKAYCDDTPLEKMRAERMDGLKSARRDRSVEDNLH
                     IFTEEMKNGTEEGLKNCLRAKIDYTNKNKALRDPTIYRCNLKPHQRTGDKWKIYPIYD
                     FCVPIVDSLEGVTHALRTIEYSDRNSQYEWMLEALHLRKVYVWDFARVNFVRTLLSKR
                     KLQWFVDKKLVPGWDDPRFPTVRGIMRRGMTVEGLRNFILGQGPSRNIINLDWNIIWA
                     ANRKVIDPIATRLIALDSENIVPVTLKDGPELHTEQKPKHKKNPKLGSKDIYFSSNLL
                     LEQEDAVALKEGEEITFMDWGDCIIEKIDKDDKGVVKAISAQLFLNGDYKKTEKKLTW
                     LAAEKTVPVVLKDFDHLITKDKLEEGDNFEDFLTPQTEFTAKAIADTNVENLKVGDII
                     QFERKGFFRLDSDKDGQKIFFSVPDGRNKSRI"
     gene            <1001072..>1003634
                     /locus_tag="FOA43_003148"
                     /db_xref="GeneID:62196549"
     mRNA            join(<1001072..1001084,1001168..1002285,1002543..>1003634)
                     /locus_tag="FOA43_003148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923424.1"
                     /db_xref="GeneID:62196549"
     CDS             join(1001072..1001084,1001168..1002285,1002543..1003634)
                     /locus_tag="FOA43_003148"
                     /note="BUSCO:EOG09342538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779352.1"
                     /db_xref="GeneID:62196549"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="PFAM:PF05347"
                     /db_xref="PFAM:PF08652"
                     /translation="MLAAVMFAKVYPLAATSKDATVRQPKELVCFSRDGDNEIHIDDS
                     ELRYYYLPNSELDTPGGIDLQGGFGNFKKNPNNDVGELAGLLKAVESYERTVGNKIPV
                     NIITWRGLMRQLMMLPYENRDKVVLNVVIFDGQLFIQADALTIMASRKIEESTLTELH
                     RRQIFSGYKFEAISTLESPWAQCSRKHIEKRSKKTVSNIEQYSTVVRTTIGRAKLLLG
                     AEVDCAWDYKPDHHDIEEGQKADPLRHYVELKTTGVVDSPNACSIFEKKLLKTWTQCF
                     LVGIPKVIYGFRDNNLILRSVEQFNTEEIPLLLRDGPFQRSQQGSQQRPINKCMHCLK
                     FFSGLINWIAENIPKNDEAKTYRIEYDPVANKNYINVRENEEEHRDVVLKVYRALLKN
                     ALHLELPLVDYKGRANLLDRVRKSFRKQKQVNNSLVCQELLRDAMEWNNIFYQWYEEK
                     PSDTDPKYLQLVRAVHPKKVEDEVELHGISLLIQNDKKQSIPSEEEILSKIRERKLNS
                     WIKLYIERRQEKNLLPRKTKLDAKYVKEILKSKVLYERRKKILYRVSAKLHRPSTAGL
                     KCVNGTFNDITVIYTPWNSRVFTEKGNFIYKQRKRHDQYLLDLLDYEEYRKKWINVYK
                     DEMEWEDTVEQLRGGYPRKDRSWMELFQWYEDYLSAISRDIERDTITYNKRQYCYYEK
                     LKPQFEEMYADSKKNMKRLMEVVKRNEVGPYTDAVGEDLGQIMKEHGFKDPSDQENDQ
                     "
     gene            complement(<1003636..>1004391)
                     /locus_tag="FOA43_003149"
                     /db_xref="GeneID:62196550"
     mRNA            complement(<1003636..>1004391)
                     /locus_tag="FOA43_003149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923425.1"
                     /db_xref="GeneID:62196550"
     CDS             complement(1003636..1004391)
                     /locus_tag="FOA43_003149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779353.1"
                     /db_xref="GeneID:62196550"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="InterPro:IPR038534"
                     /db_xref="PFAM:PF04181"
                     /translation="MTSLLERTSIGPNTYTFRSLEQLLKPYEGKSLLTPREANTLNFH
                     IVENLMVENCDRDTLKILARYLSKKGLDDLVEERVTNHYCGYPLCRFHDPKQIKEMQI
                     NKLVAKLKMPRYYLSKFCCKRHYQATEFYKKQLSADVLFMRTNINQPFFQSDTYENSI
                     VLLEEYFEAKKNKGSINLNTPAMNELMELMEKMQIEDDEGDDGVKGANETNGTNGAHE
                     VADMDKSMSDISIVEKEGPQESSRNYAGSVGYQ"
     gene            complement(<1006247..>1009021)
                     /locus_tag="FOA43_003150"
                     /db_xref="GeneID:62196551"
     mRNA            complement(<1006247..>1009021)
                     /locus_tag="FOA43_003150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923426.1"
                     /db_xref="GeneID:62196551"
     CDS             complement(1006247..1009021)
                     /locus_tag="FOA43_003150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779354.1"
                     /db_xref="GeneID:62196551"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="PFAM:PF01490"
                     /translation="MSSSSSSKTGSKQRKNSGLTAESFRHSEDTQENLFAIGNFSAKY
                     IRRGESLRPGSRQDSKTRKPSEYRQPSESRKQSELRQANKSSSPVISGTTQVDVKNSR
                     PVTITGGFPDVFSNPGSFNSGVHITSITNKDVNKVPDDRRDSRTSRHSALSSSLSCSL
                     RNKADSSLLDSPADPQLVHLVEQHLVHEGRKDTRDLGTPYNSEIEAAQGGMHSQIVPR
                     SQSDDQVLPQDTFDSLKLKGGDVTRGIYNWVSNQRRGQSPLRRVASSGSITNTEERSR
                     RSTDIYGSMVEAGVGSSGEDHMSVHDMLAPGGFRRNFVASKRRNSETGFMTRNFIEFL
                     ALYGHFAGEDLSEDDEALSQLDEESETEYSTDEEVSSTESEHVITSDNEAETGEDLTE
                     MPLFVASPPASSPNVTYKNAMDTVRRGRSSFQSLGSPKTPITNGTRRKIKSHTHRKLK
                     HLPRLRLRTAVSSSSKRKKTSTFKSLLLLLKAFIGTGIVFLPKSFSNGGLIFCNVMIL
                     IFSAVSYYCFVVLVKTTCKTNVKGYGDVGMKLYGDRFQFLILLSLTLSQLGFASTYVV
                     FVAENFRYLAQTILDQSNGIAWFIFLQPLFFVPLSLTRSIGKLGAAALLADLFIFLGL
                     IYIYFESSLTLIEHGVSQTSPFKSETWTLFIGTAVFAYEGIGLLIPIQESMAEPQHFD
                     SLLLTVIVITTVVLTTLPTIAYLSFGEDVKTVVLMNFPRNTASLTIQLLYTLAILLST
                     PIQLFPAIKIIENYLFHTDRDHWTTKIRRNSEALSLMPDVDDSTMYESTVTPEMEYHD
                     LSRLKPPSTSAAATDLSTYNENMVNDEGLVSGKSDWKIKWMKNLLRVFIVLLMCTISY
                     LGSNDLDRFVSLIGSFTCVPLIYIYPPLLYLKCFEGKVSGIAKFANYAITAVGTILMV
                     YISYQTISTW"
     gene            <1010056..>1011843
                     /locus_tag="FOA43_003151"
                     /db_xref="GeneID:62196552"
     mRNA            join(<1010056..1010059,1010075..>1011843)
                     /locus_tag="FOA43_003151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923427.1"
                     /db_xref="GeneID:62196552"
     CDS             join(1010056..1010059,1010075..1011843)
                     /locus_tag="FOA43_003151"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779355.1"
                     /db_xref="GeneID:62196552"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MENEPNTTSMSRDGTSQTAASESSTGSRSNTSTDFLKLDVSEFR
                     QTTWSIRNSHCTYGLVGKKLRCLITFVCVVAFSLFGVNQGLMSGIITADQFIDTFPAV
                     GGSSGHSTVVQGAVTSCYELGCFFGALTALWIGEKYGRRPMIITGSSILILGTFITIF
                     PFKGHWALGHFVIGRVITGIGNGFNTATVPIYQSELSKPEIRGRLVNLEGSAVAVGTF
                     IAYWVDFGLSYVSNSASWRFPISLQIIFATVVLIGIIGLPESPRWLIAKGRLNEACYI
                     ISQTEDLPPDDDEIIAEISAIRDAVDRFDSSQMSLTQLIKGGKHQYLRRILLGASGQF
                     FQQFTGCNAAIYYSTVLFENTIGMTRRMALILGGVFATVYALFTVPSFFLIDRLGRRP
                     LFCIGAVGQGVSFVIAFACLIPGTVGAAKGAAFGLFLFISFFAFTMLPLPWVYPPEIN
                     SLRTRTLGTSVSTCTNWLSNFTVVMFTPIFINETKWGCYLFFALMNFLYVPIIYFFYP
                     ETAGRSLEEIDIIFARAYSEGVSPVSISKSMPNLSFEQVEKESERLGLHGEFKAEAAY
                     EENFNEKHLLIKRSTSRAKSKESV"
     gene            complement(<1011890..>1013206)
                     /locus_tag="FOA43_003152"
                     /db_xref="GeneID:62196553"
     mRNA            complement(<1011890..>1013206)
                     /locus_tag="FOA43_003152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923428.1"
                     /db_xref="GeneID:62196553"
     CDS             complement(1011890..1013206)
                     /locus_tag="FOA43_003152"
                     /note="BUSCO:EOG09342UI6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779356.1"
                     /db_xref="GeneID:62196553"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="InterPro:IPR036393"
                     /db_xref="InterPro:IPR036974"
                     /db_xref="PFAM:PF00696"
                     /db_xref="PFAM:PF01472"
                     /translation="MTKDSQFTIVVKLGSSSIVDEHTREPRIANMSLLVETLVKLRRQ
                     GHRIVFVSSGAIAVGMRKLKIFSKPKKLATKQALAAVGQGELISMWDELFAHLNQTTA
                     QILLTRNDIMDFSQFSNAENTLRELLDMDIIPIVNENDTISTQEIKFGDNDTLSAITA
                     GMCNADFLFLLTDVDCLYTDNPRTNPEAKPVFLVKNMNSLDVNTKSSGSSIGTGGMKT
                     KLIAADLATNAGVTTVICDSKHPQNMLNIVKYSCKEDNDLRLSADTLPQEDSKEFTKT
                     NEDELVKMKRCHVPLHTRFIGQPKNTVKNKQFWLLHGLKPHGEIIIDTGCYKAITRRN
                     RAGLLPAGVLGVEGNFHQMECVEIRLGFRDESGKWDTSKGTYLIGKGRSNYSSSEVNK
                     VKGLHSRDIRSQLEYVDSEYVVHRDNLAFPIHEDQELLEALGKWKI"
     gene            <1014023..>1015336
                     /locus_tag="FOA43_003153"
                     /db_xref="GeneID:62196554"
     mRNA            <1014023..>1015336
                     /locus_tag="FOA43_003153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923429.1"
                     /db_xref="GeneID:62196554"
     CDS             1014023..1015336
                     /locus_tag="FOA43_003153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779357.1"
                     /db_xref="GeneID:62196554"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="PFAM:PF04180"
                     /translation="MPTKKWIDKKKALNFALVHRSHEDAHYYDEDASSGVFMPISKDN
                     KKKHQVENHEKNQKQLRVETKDDLAEELGVEGKIRSNEGEAALYGITYDDSEYDYMQH
                     LKPIGGTGDGVYIPKKQEQESNKKPFELKEILPEGMLPSEQEKYDYQRQQDVPDEISG
                     FKPDLNPDVREALEALDDDAYLDDSKDVDDVDVFATLLSDKRQKDLTLREYDVLTQEE
                     AKSKDQWDLDQYDDEYENNGETKEVGDFSWEKDFKNFKSAQTKGKIRNDWDTDDEFES
                     EEEEEEEEERDTVGEMPKIGGISSGKKAKSKKAKRKKGATTDTSSYSMSSSALCRTEQ
                     LSIIDDRFDVMKQKYDKNDGEDEEEEGEKAQPFDFKNERSDFASMIDDFLDNYEQKGK
                     RIIKKDAEAEKIKKAADTVSKSKLAERRRKEKKALTKGIRDLNLN"
     gene            <1015472..>1017088
                     /locus_tag="FOA43_003154"
                     /db_xref="GeneID:62196555"
     mRNA            <1015472..>1017088
                     /locus_tag="FOA43_003154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923430.1"
                     /db_xref="GeneID:62196555"
     CDS             1015472..1017088
                     /locus_tag="FOA43_003154"
                     /note="BUSCO:EOG09341WMK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779358.1"
                     /db_xref="GeneID:62196555"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="PFAM:PF08164"
                     /db_xref="PFAM:PF13339"
                     /translation="MGRKEGTLGEEITRELVTPKNKDIDIEDVEFNDKAVESESETEG
                     GEESDEELEKEHYVRVAKSKLRRDGVKLGREYVGERTSRSEVFGEGDGEGDVSEDDGD
                     GDGEGDGEGEDDDDDDDVDADDADDDDVDQVDDDDDDVDADDDDVDQVDDDDDDADDD
                     DVDADADQADEEYKRKQVGKLLEREKKQIIGRLTSSAKEDALKGYFVLQQYRLFDRIL
                     DARIKLQKALISSNQLPIDAEAYLEYKSDETDHKIGKVKKALAELTTKILIARAKLYE
                     KDGISNVKKRKFSDYLNESEQMDTILKPYRKSILMKWSGRVQSASGSSALNAGKFKTI
                     NQNVYIQLESNMQDMDRLVKRTRMNRRRVIPLGYEKRMEESRKETEGNVDEDDVKEEE
                     EEEEKEAYSNIDKSLQENPYIFDDDDFYRVLLNDMVDKKIGDKQSASSAAIVTLSRSK
                     VQKNYERMATKGRKIKYTVQEPLRNFEAPISSQYRWDDDQIDQLFASLLGQKVSMAEE
                     EEGDFQETGEADKPAEEITALRKSSLKLFG"
     gene            <1017286..>1020411
                     /locus_tag="FOA43_003155"
                     /db_xref="GeneID:62196556"
     mRNA            <1017286..>1020411
                     /locus_tag="FOA43_003155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923431.1"
                     /db_xref="GeneID:62196556"
     CDS             1017286..1020411
                     /locus_tag="FOA43_003155"
                     /note="BUSCO:EOG093434JV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779359.1"
                     /db_xref="GeneID:62196556"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="PFAM:PF00780"
                     /translation="MENKGKEDEKNEEDTHDTGDQPLSRKSDYHEISKNDVIVTTKES
                     DDAVDQDDASVKISLRKPSFTITPGPYKLTDFIGNIMLENPEFLESNGAEITCLEAWD
                     QNVYIGTSTGELIHMYRVDDRLGYIQISRQRFNSNKVSSIKKMLLLPEISKILVLSGR
                     TMSAYILPELSPANIGRLRDVSDMVIDYDTMKLDTRKKNYTSAISHINGEVYLSVMVF
                     TSKSIRLVRIFEESIKLFKEVHYVGSVTGVQRSAVAAVATQTNYDLVDVNQSQKIPLF
                     PTCSGRGEDGNTVSLMPFVIPVGKKEFLMVCGGQSAEEPAVAMVVNSSGDVSRGTIPW
                     KSYPVSVAVDYPYVIAIFDNGEASIHSLHSQLEVQRIIFDSQTSAHAFGVKSVFRIFE
                     IKDAELTKALTKRPIISQMTPEELEKIVLESDLAQTNLIKSSCLLYNADGSFVKIFQR
                     YPQPLRWIDLYKGVNKQSFQNVFDELIDELEEETSGRDSTEGQIILSLLAFLSLKYYS
                     FNQAFDILSSNMSHLDPRLVIYIVDGSKYKQIYGSVWEFDGLIGFIEQLKIQYAANEN
                     EAQVCDFMQLYLNVCIASPDTFPEGDKESIMKTIEIYLLNLSLDTEDPIDLHPLLMNL
                     KYGSREAIEILLLRKRYYFLSNLYSSLNDHEQSLYYLKGLITGDFNDVYYHKHFPDLS
                     KALQFLVNYLLAHCSAKENVVKSYLQWLLEGYPEYGFKVVTDKRVESIDFNDVGVLHS
                     FEEHGRSDLKAKYLEYMLGVKKKKQFRGDVILAVLDELLNRLQNDEGLVKQIELCMDR
                     YSKLKVPKMSFQNFWAMEKKLNTVDSSFSVLHNKLYSYLSKVTSGTVSVLSQCSVLER
                     CEKEIVDTKYGQLLPLISMMIHYKKGDLKTVIIELCNLGDFKTAEQVATTLALPELGK
                     VGTEDADTESERKESEDAQKVSEGLLLLIFDVYLNMGNTELIDSFLSHHNLLQDDTRE
                     VKSVLERMDKFAAILQRIPDNFPLLQLQNFLKRSLLEFHDYQEVLVLQKSLYRSRHLQ
                     MKGMKESLEDK"
     gene            complement(1020526..1020598)
                     /locus_tag="FOA43_003156"
                     /db_xref="GeneID:62196557"
     tRNA            complement(1020526..1020598)
                     /locus_tag="FOA43_003156"
                     /product="tRNA-Val"
                     /db_xref="GeneID:62196557"
     gene            <1021408..>1022712
                     /gene="LYS21"
                     /locus_tag="FOA43_003157"
                     /db_xref="GeneID:62196558"
     mRNA            <1021408..>1022712
                     /gene="LYS21"
                     /locus_tag="FOA43_003157"
                     /product="homocitrate synthase lys21"
                     /transcript_id="XM_038923432.1"
                     /db_xref="GeneID:62196558"
     CDS             1021408..1022712
                     /gene="LYS21"
                     /locus_tag="FOA43_003157"
                     /codon_start=1
                     /product="homocitrate synthase lys21"
                     /protein_id="XP_038779360.1"
                     /db_xref="GeneID:62196558"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PFAM:PF00682"
                     /translation="MNGSSKNPYGPNPCDYLSNVNSFRIIDTTLREGEQFANAFFTLD
                     FKVKIAKALDEFGVDYIEMTSPVASEQSRTELETVCKLGLKTKILTHIRCNINDAKVA
                     VNCGVDGVNVFIGTSQFMRKYSHGKDMSFITNAAVQVIEFVKSKGLEIRFSTEDSFRS
                     DIVDLLNIYTTVDKIGVNRIGIADTVGGGNPRQVYDLVRTIKSCVSCDIETHFHNDTG
                     CAIANAYTALEAGSKYIDTTVLGIGERNGIVPLGGFMARMVVSSPDYVKSKYKLTKIR
                     ELETLVAETVKVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEIINPADFGLSRYI
                     HFASRLTGWNAIKARVEQLNLDLTDDQIKEITKKIKHLGDVRPLSIDDVDSIIKDFHA
                     DTTKIELAKEDQDKKRQALESSAAKDGDNSEDHQQKKRKLDN"
     gene            complement(<1022809..>1025112)
                     /locus_tag="FOA43_003158"
                     /db_xref="GeneID:62196559"
     mRNA            complement(<1022809..>1025112)
                     /locus_tag="FOA43_003158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923433.1"
                     /db_xref="GeneID:62196559"
     CDS             complement(1022809..1025112)
                     /locus_tag="FOA43_003158"
                     /note="CAZy:GT91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779361.1"
                     /db_xref="GeneID:62196559"
                     /db_xref="InterPro:IPR021988"
                     /translation="MALSLFTILPHSKSRIRRLTLTVVLLVLIVLTLTRGHAQLQSLG
                     NIAGISGDEKSIKNLFDDRLKQLYEEQKPAALKETESSDRERFSKMHAALPVGVDPHH
                     GEPTGSCISETVLHADYEPIEVDGFVGMRPFPDDKNYFIDQSCDDILYRPDTSDSRRI
                     IQHTETKLLPDDFEYLNDYLRTSGYGALIAGKDANLDEVDFASLPDWYRFTGSSVWLS
                     DEECHLMASRLVYSPSKIPVISLIRLQLYDSHWHEMKGRRLRYVDVPDEELKQVLYKF
                     ARSGKKTELDNVTIHFPTILDIDLDSESRSDLLGPEDPRIIYKTTGKIHEPIIVFNQD
                     FRGRRTMFSTFPLRRVTPGTRKRTLQMRTALMGDYPFEKNWTPFFDTLTPEITKESRG
                     YMHMFYGLDPLRVYKCSLDTGDCDVVQAGSKKTTIDRGGSLTSVRGGTSLKAVPRTIV
                     QRLLRREGVFDPDYPVQMWIGFAKTHIDDCGCGHMIYRPTLLVLVKQDNSFRVDLMTD
                     SIDFGKDVMAWNDHSSIYCDDGNNVMNPNEISFWDVGEEEPMEAANWDPENDPLPYYN
                     DYMGLTLSEADENVEVIFLKNVMNYVLGAYEHNKLVLGLKDVYGGVEERSKKVETCML
                     RAGIKYCEKYAASHKMPSSEKEAVSEDEAVSEDEVVSEDEAVSEDKVVGEDEVDVSED
                     EVDVSKDKVDDNEADASEDKVDISKDKVDVSEDEVESSNIGSDNDVDKSSSDETTDDS
                     GNDTDKNSNDETDDSVQLKKPDPETVE"
     gene            <1025783..>1026367
                     /gene="RPS9B"
                     /locus_tag="FOA43_003159"
                     /db_xref="GeneID:62196560"
     mRNA            <1025783..>1026367
                     /gene="RPS9B"
                     /locus_tag="FOA43_003159"
                     /product="ribosomal 40S subunit protein S9B"
                     /transcript_id="XM_038923434.1"
                     /db_xref="GeneID:62196560"
     CDS             1025783..1026367
                     /gene="RPS9B"
                     /locus_tag="FOA43_003159"
                     /note="BUSCO:EOG09343Z78"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S9B"
                     /protein_id="XP_038779362.1"
                     /db_xref="GeneID:62196560"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR036986"
                     /db_xref="PFAM:PF01479"
                     /translation="MPRAPRNYSKTYSVPKRPFEIARLDAELKLCGEYGLKTKHEIYR
                     IGYQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGILPEDKMKLDYVLSLKIE
                     DFLERRLQTQVFKLGLAKSVHHARILIKQRHIAVGKQLVSIPSYMVRLDSQKHIDFAA
                     TSPYGGGRAGRVKRRSEKAKADAAKAEEEGADKE"
     gene            <1026714..>1027256
                     /gene="RPL21B"
                     /locus_tag="FOA43_003160"
                     /db_xref="GeneID:62196561"
     mRNA            join(<1026714..1026724,1026794..>1027256)
                     /gene="RPL21B"
                     /locus_tag="FOA43_003160"
                     /product="60S ribosomal protein L21B"
                     /transcript_id="XM_038923435.1"
                     /db_xref="GeneID:62196561"
     CDS             join(1026714..1026724,1026794..1027256)
                     /gene="RPL21B"
                     /locus_tag="FOA43_003160"
                     /note="BUSCO:EOG0934462H"
                     /codon_start=1
                     /product="60S ribosomal protein L21B"
                     /protein_id="XP_038779363.1"
                     /db_xref="GeneID:62196561"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="InterPro:IPR036948"
                     /db_xref="PFAM:PF01157"
                     /translation="MGKSHGLRSRTRYAFSRDYKKHGGLPMSTYLKVYRVGDIVDIKV
                     NGSIQKGMPFKFYHGRTGIVYNVTKSAVGIIVNKIVGNRYLEKRINVKIEHVKHSKCR
                     AEFLERVKENAAKRIEAKTAGKTVQLKRKPAPPRGSKVVTGVPTTLAPVAYETYI"
     gene            <1027389..>1028573
                     /locus_tag="FOA43_003161"
                     /db_xref="GeneID:62196562"
     mRNA            <1027389..>1028573
                     /locus_tag="FOA43_003161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923436.1"
                     /db_xref="GeneID:62196562"
     CDS             1027389..1028573
                     /locus_tag="FOA43_003161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779364.1"
                     /db_xref="GeneID:62196562"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MAIDNKKIGRIESDINQSMPYLASDEKSSTLKDPYPSTETRGQP
                     TPDDDIEGIKQQLYRRKGQILLQQQLQKEKEAEQVKPWVHFVSGGLGGMCGAIFTSPF
                     DVVKTRLQSSVFHEVYKTQVGSRSLVSSIGKHFQETCSIIYNVYKIEGSRALFKGLGP
                     NLIGVIPARSINFFTYDYTKGLLKKTDYFKGEETSFIHLLAGLNAGIVTSTATNPIWL
                     IKTRLQLDKATKKEYKNSIDCLRKTIKNEGFFALYKGLSASYLGSAESTIQWILYEQM
                     KGMIRHRAERLAALGRERTRVDNVADWFARSGAAGFAKLIASLITYPHEVVRTRLRQA
                     PMENGKPKYTGLIQCFKLVFKEEGFVSMYGGLTPHLMRTVPNSMIMFGSWELFTKALS
                     KL"
     gene            complement(<1029265..>1029855)
                     /locus_tag="FOA43_003162"
                     /db_xref="GeneID:62196563"
     mRNA            complement(<1029265..>1029855)
                     /locus_tag="FOA43_003162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923437.1"
                     /db_xref="GeneID:62196563"
     CDS             complement(1029265..1029855)
                     /locus_tag="FOA43_003162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779365.1"
                     /db_xref="GeneID:62196563"
                     /db_xref="InterPro:IPR019364"
                     /db_xref="InterPro:IPR020178"
                     /db_xref="PFAM:PF10232"
                     /translation="MSKSPSLNFQEVPILPLEQVRPRLTQLTHSLRKIEDMLRANQPL
                     PNWTTVQNQFNVIMSQLNSFARTLDANRQPLESSDVFPNQEFDTTQHEGLLTTLLRKK
                     HLPEVDDWINSTEVVNEQIIAKDDEMTRKCLEIVEKSLQEYIFGGYITKEEGEKGVEL
                     EDIFEQKEQPVNTAKGLDEGDMYRFIYQGLDSKISL"
     gene            <1029978..>1030430
                     /locus_tag="FOA43_003163"
                     /db_xref="GeneID:62196564"
     mRNA            <1029978..>1030430
                     /locus_tag="FOA43_003163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923438.1"
                     /db_xref="GeneID:62196564"
     CDS             1029978..1030430
                     /locus_tag="FOA43_003163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779366.1"
                     /db_xref="GeneID:62196564"
                     /db_xref="PFAM:PF12622"
                     /translation="MSQRKHHLQRIHALQERYISSSNLLGKVTRLESKSPKTATDYKN
                     IEKLNGKYKLLLKYEQDHSKLSEATSDFSSEAPKLLKHHSIYYDAELNPLGKAPFSGL
                     PNFASYKVKQSTIPSNTDEPIPLPSTPKPRFYKLKQVQTTYVSKSYNE"
     gene            complement(<1030486..>1031235)
                     /gene="ATP4"
                     /locus_tag="FOA43_003164"
                     /db_xref="GeneID:62196565"
     mRNA            complement(<1030486..>1031235)
                     /gene="ATP4"
                     /locus_tag="FOA43_003164"
                     /product="atp4 subunit B of the stator stalk of
                     mitochondrial F1F0 ATP synthase"
                     /transcript_id="XM_038923439.1"
                     /db_xref="GeneID:62196565"
     CDS             complement(1030486..1031235)
                     /gene="ATP4"
                     /locus_tag="FOA43_003164"
                     /note="BUSCO:EOG09343MVB"
                     /codon_start=1
                     /product="atp4 subunit B of the stator stalk of
                     mitochondrial F1F0 ATP synthase"
                     /protein_id="XP_038779367.1"
                     /db_xref="GeneID:62196565"
                     /db_xref="InterPro:IPR008688"
                     /db_xref="PFAM:PF05405"
                     /translation="MLATRLALRAVKPVVFRSALLVSARPISPIGLRFLATKTPQSDK
                     SPSKVDPKTKASSLIAALPGSNFLTKTGTLATATAATIYAISEGLYVVNDESMLVITF
                     FSFVYLIVKTVVPMYGEFAKNRMAAVTKLLNDARANHVQAVKDRINQVATLKDIVSTT
                     KALFEMSKETAALEAESFELKQKVHVASEAKSVLDSWLRYEAQVRQLQQEQLSSTVIG
                     NVQKNLKDPKLEDRVLAESISEIERLFAKEK"
     gene            complement(<1031507..>1031956)
                     /locus_tag="FOA43_003165"
                     /db_xref="GeneID:62196566"
     mRNA            complement(<1031507..>1031956)
                     /locus_tag="FOA43_003165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923440.1"
                     /db_xref="GeneID:62196566"
     CDS             complement(1031507..1031956)
                     /locus_tag="FOA43_003165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779368.1"
                     /db_xref="GeneID:62196566"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="PFAM:PF01217"
                     /translation="MINYLILLSRQGKVRLCKWYIPLSQKEKQLVIKELTAIIPLRKP
                     KMCNVIEYKDSKLVYKRYASLFFVASIDTEENELLTLEVIQRYVEIMDKIYGNVCELD
                     IIFNFELAYHILDELIIDGIMQESSVSEILKRINYQEQMEHNDGLQT"
     gene            <1032104..>1033648
                     /locus_tag="FOA43_003166"
                     /db_xref="GeneID:62196567"
     mRNA            <1032104..>1033648
                     /locus_tag="FOA43_003166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923441.1"
                     /db_xref="GeneID:62196567"
     CDS             1032104..1033648
                     /locus_tag="FOA43_003166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779369.1"
                     /db_xref="GeneID:62196567"
                     /translation="MDKEIKEPGNKTRHSERSRLLKQQRRKKRLLAQLYMSDSDFEVE
                     EEDLNREGRSFRRVSKINYDENKKMPTHQIVVPKNKRKSRSPRDSRDIKRTPSSRSSR
                     SSRSSRSSRSSRGSSIISTRENSQTREDSKFREKNEELDITGTALKRGRPRKRRKVEA
                     THKAEVIHKAEATHKVEEASNRVKNVQRDHSSSAMNFPLMLSVPRRRRGRPPKKRLIE
                     GNTESASLPERPMTEFQKQLLQNTSNQFLKKLAKSDIGRKMEKIAKNLNVYSRKGLQI
                     REGEGRDVIDLSFLDTNDAEELNGYQNMISDQYYKLSRQFTEAQVMRIDELIKVIDTS
                     VSKVKLDYTKYQGRLENAKRRYENEKRMDPTNAGRVLSEIVERTRLPNRVQKIIFPSV
                     FDRVLGARYDRLRQLKQSVQYQLKMIDKEDKGNEEIVKKQFEMSLKENRENMRQQILK
                     DLEAMNEEFLKSTGIKIREAEEVKKREEQEPTATDEINNIRKNVELNSLEGLAEVSEM
                     VLKQNK"
     gene            <1033766..>1035307
                     /locus_tag="FOA43_003167"
                     /db_xref="GeneID:62196568"
     mRNA            <1033766..>1035307
                     /locus_tag="FOA43_003167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923442.1"
                     /db_xref="GeneID:62196568"
     CDS             1033766..1035307
                     /locus_tag="FOA43_003167"
                     /note="BUSCO:EOG093433XW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779370.1"
                     /db_xref="GeneID:62196568"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00789"
                     /db_xref="PFAM:PF13899"
                     /db_xref="PFAM:PF14555"
                     /translation="MDFESLIPTFLEITSTQDAQVASSYLEMSGGNLDTAVNLYFESG
                     GVGTSDRNGTVSGSISGPGSGSERTPVESDEEIARKLQQQLYQEGNPNGDEGVRRPIQ
                     PVHEQLLSQYNYGLGANDRSVNPVERMFGSARRGIFNQAEVEEEEGSRDDSYGDEDND
                     NDNDNDAETPDYEYEEIPSSSDNETALTDEVVDLTGERRRRPRRRRRSSSYRTSTQKR
                     LAKMFRPPWDIIDKLDFDSAKKKARAEKKWVLVNIQDVTDFRCQCLNRDFWSSNQIKD
                     LVRENFVFLQYQHDSANGEMYRNLYPFSEYPHISIIDPWTGERLKMWSANPEIHKFIE
                     QVVDFMTRFSLDKNTLNPVVQHKQKLNLDKLSEEKQIDLALKESLSEANEINDVDEVV
                     ILEGTSQKSPMVVSEPATYTEKLAQIKATDVPDPEGDAKQITRIQIRSGMDGKRIVKK
                     FALIDPVETVFEYTKFAFKDSLLGKPFTLKMQRKNLFDNLHETILDAGLKNASILLDV
                     EGEEE"
     gene            <1035587..>1040144
                     /locus_tag="FOA43_003168"
                     /db_xref="GeneID:62196569"
     mRNA            join(<1035587..1035695,1036042..>1040144)
                     /locus_tag="FOA43_003168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923443.1"
                     /db_xref="GeneID:62196569"
     CDS             join(1035587..1035695,1036042..1040144)
                     /locus_tag="FOA43_003168"
                     /note="BUSCO:EOG093404F5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779371.1"
                     /db_xref="GeneID:62196569"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="PFAM:PF00627"
                     /db_xref="PFAM:PF12763"
                     /translation="MNSKVTPTNNTSAGDPSQDDADFNYFWNYVHDNFYHDTLKEPLT
                     IEEKKFYSSIFRALDPGKSGQISGLAAKPLLEASGLPLITLGEIWNCADPDNTGFLNQ
                     FGFCVVMRLIAHAQQGELVTPEVAQRVTGLAKFHTIPVATTGGSFGGMTGSTGVPVSA
                     SATGSSSDPFSGSRKSSGASVTSPPGSQLAVPFLTAQQAANFGAMFDRTAQGPTLPGL
                     QARDILLKARLPVQILEKIWNLVDLDKKGQLTRPQFIVAMHLIRSFLNKSMAILPTIL
                     PDQIWNSAKTVGQAQAQAQKPTPESAPTPPPVPSTPPVVLGVPPALSSDSSYSVASST
                     NLDTWIMSPQQQQQYGAMFDSLDRAHTGSLLGSQVANFLMTSKLSNDVLATIWELANL
                     NNQDDFNRQEFAIAMYLVQKKLAGYQLPEETPVELCQSSNSLVNSSGGVSQTAIAGAA
                     ASEPENTSHMDDLKDIFGNSIEPSAFPSLPSRPAAPPVPVSRTATTQHEFVPSSSFGK
                     QLQMQQIEKDTQAKQATIVQTQDELSSDDDESPVDLDNPKLPPVIPGRDNKPVFSSSE
                     VFSEPPAQNPVPAPAPVQTPLSPQKSVEPTVFSNQSTELTGQPSGFTNQPSGFTSQPL
                     GFTNQTTGFSDTGSYGSAGAEGTIQEQLSQATVNIANFSNQINSLSHQSANMSIRKGK
                     AQKELTRVLKVKEDIQSKLTQMKSLYHTETQSVQGTENKLIEVSEELKNLQQELSIAE
                     ANHHSEEAKLKDLQQRCREASEKKLVMKDQLITLNQETEQLQTQIVQLNSQATQSQNL
                     LAVAEGQVSSQKSKNVALKQQIADLTSLIQTLMTRRTGLSEKYDQLEDEALELHDKHT
                     DLSVEYAENNLSYSQAVSSGAEIPKESEFEGEETEVPTASLDDFDEKELDAGLREPVK
                     TEPEEATKSVETVAEPVAEPVAEPVAEPVAETTNKVESDARVVEPEFISSTNNPKDTI
                     VTEPVANATKPAESAAIESIGSGAKSVASIVKLDSEEGANISESTLPPKTAISSKKNT
                     APATEFVFDAKRPPEEDNSAENSPSSKSQAESFEMLNHEDAEPEQRGSEEQTGVEEEP
                     HTEPETKDDDETPAVQEIKTESVASAASTGLISPNLSSSGLISSGINMPGGFSGILPS
                     SSVSQSSERELVRDSSIDDEFPPIQEHHISDSESSDDDHFEDTLSTPVKNEKEPDDQV
                     EEERKSEFGDEETRTEKVQLAEAAPVISSAPAVSTNPFSGFEDLGLEEAKAEDNENSD
                     NFEQFDGDFSDPVGFSFTQTDSVDAPVQPSNSAVASTNAGETGDDWEQVFAGFGNGPI
                     DSSKVPAQTSAFQAFSTSPLPDSSFTNVPSNSTTPPKYEYSQSQTLAIDELNGMGFDK
                     EKSVAALKKNGWNLDEATNFLLDSA"
     gene            complement(<1040204..>1040848)
                     /locus_tag="FOA43_003169"
                     /db_xref="GeneID:62196570"
     mRNA            complement(<1040204..>1040848)
                     /locus_tag="FOA43_003169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923444.1"
                     /db_xref="GeneID:62196570"
     CDS             complement(1040204..1040848)
                     /locus_tag="FOA43_003169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779372.1"
                     /db_xref="GeneID:62196570"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="InterPro:IPR029012"
                     /db_xref="InterPro:IPR037202"
                     /db_xref="PFAM:PF07200"
                     /translation="MTLPSLPERPEISQQPMIVDPDKLEYSLVPPDVAESYKQFEVSV
                     SPYFKELPNNKLDELYKDKSLMDGYLLEKYGDQYTMFRDTIVSDLKKQLVYCQKQSEK
                     YEKETVPQIDRINKALENYHTLLDRFNSSQVEMYDKMNKSSKKSMMEMMEADLREADD
                     QCKQTVDEIMGIPGEVAEEELGKFIQKYKLIRQKYYLKKEKLSRMSEERVGEIV"
     gene            <1041064..>1041759
                     /locus_tag="FOA43_003170"
                     /db_xref="GeneID:62196571"
     mRNA            <1041064..>1041759
                     /locus_tag="FOA43_003170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923445.1"
                     /db_xref="GeneID:62196571"
     CDS             1041064..1041759
                     /locus_tag="FOA43_003170"
                     /note="BUSCO:EOG09343CKP;
                     MEROPS:MER0209507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779373.1"
                     /db_xref="GeneID:62196571"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF02230"
                     /db_xref="PFAM:PF03959"
                     /translation="MSSSADNDMLPVIRIAAPAKATASMIIVHGLGDSGEGWTFMSDM
                     FHQHDEFKHINFIFPSAPEKPLYVNGNQPVARWFNIYEFGNPFGKQDEEGYWKSCKYI
                     DSLVKKEIDAGISSDRIVVGGFSQGAVLSLGLAASCEHKLGSIVNMSGIFAMRKALDK
                     HLNDNNKETPIFHGHGDLDPVFNVQYARDTAELFKSLGFKNYDYHEYVGMVHTTCPDE
                     LRDIANFVKRTIP"
     gene            <1042809..>1048223
                     /locus_tag="FOA43_003171"
                     /db_xref="GeneID:62196572"
     mRNA            <1042809..>1048223
                     /locus_tag="FOA43_003171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923446.1"
                     /db_xref="GeneID:62196572"
     CDS             1042809..1048223
                     /locus_tag="FOA43_003171"
                     /note="BUSCO:EOG0934046C;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779374.1"
                     /db_xref="GeneID:62196572"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF04118"
                     /translation="MTSSSSSSHLKGSSFLRSISPLPLFLGRGAETRNDSKKLTSKEK
                     KYVGNIERALAAFESVDEWADYISFLGKLQRALQSNPDPHANNWIPHEFDVSKTLAQC
                     ISPKLPSGVHLKTIEVYRTIFDILGQDQLSVQVQLWIPGVLPLMSYASISVKPELIGL
                     YTQYLTNIDPKFLRTIFKPLLLSLLPALDDTTSEFFDSVLTLIDSFRTKVHDDIHFWQ
                     CIFLCIITSPDKRTGAMEFCFKRLPDFNTANDCKDREETLKQLSQEARDCVMPESGLL
                     IRAFCQGLRDDNLFVQRGFFDLLLSKLQLRSSTLQCLANEEDIELLILSASETVLRRD
                     MSLNRRLWNWILGPENAATTLTTPVTVESSATTVTSMSQYFDKYGFKYFSRAIFSLIN
                     GTATSEPVYKQNIKVCRIAVAVMDRWEIGQLIVPKILVPIVKAAKLVLDTRPLKEFDE
                     LLKSANVFFDGIETISIWSDVYRLVKNGDVDLVMFILKNFHIEDEDMIVTHIPLLGLA
                     IMCLYPQEENKQWLELLKNTLEFIPQRALLPLDHSDRKYLDDTSRYNDPSLADDILHH
                     LDKYYSRANSSEEVDNESDSTPERPFNAADLSALYLGLIGNITCRLLRQKRANDFYNF
                     CELLGQLLETIPSGELIWQNPTLLNALQRIDPKSLLDSEIPIAFGAAIMFKHIARGLS
                     KLEMSRLLKVVIGLLWKCLIHPSGRYQVEAVRKLWDLEISVDPHYIEAGISSLFLLSD
                     ESTRIRAFNILWTQSASFNETDSILSRPLYIILDGLNSDNNVFSVLIAKWLQNTLISG
                     TLNRIFKICCSGLLSHHEFIFSSKFANNENDDFALFAYELTILYKLLTILPHEILPVF
                     NSELCVIDNDSEMGIISANEWNISTYKSLALAILKQFISIDPPKGVEEFQLFCSCVKL
                     SLDLMGLLMDGSEQDFDATLSMLTEVCQRKIPGDEDHLLGACYLSTIVRLMKISSKNQ
                     LKVALFEIPKGSKKSSRFLEFVSSGITNSVTSMEFHSWMVLIQETSQYYSELVFGITT
                     GLTECICNKMEELFALNKRYFTDLGEDTVTDVDDSICELIGGLQSLLIRSHKYLSYLL
                     SGSLAYGNTDSSDNSGSQVPGFFGSMIQGVFQVEAPTDKGEIHRRKILLLKALKKSVV
                     TVYGVWLWSDENSKVRAEITNSANEAMAPGLATGEMLDNEKPPFLSFTRSVKYNASKL
                     KFRSKKLLECVYSIEPMETLETLIRCYVARKGGKDRYSAFKIIHILDGSKLQTTLHYM
                     INSLVSRVSITSLEPEKRSLLLTNLSASNISHFLVEYVKTLSSDAMEDSWEDLLRLMK
                     EASSGSSSYRMIYPDILEFAALVGSRLSQTNFGDQKKVKREIVDSFTKILNIALSAKF
                     LQQYDDGINSTSSVDLLTAVGLKEGESGQLESEPSVKLRSGKIVVRDDLSYALVVAIP
                     LIPIIVNDVDKRTTCFTSIANSVAIPLAKHSISELTSPAVIALFKVMGEVKEMSSLRI
                     WKNLCYDILNDSDFFSLDVRNHKEWNGIFKSWITHEPEKLGELIMKLSAYLGTNAAAN
                     IFNWSDSESNAGANDLKRIAYLIMVCPKDEFINSDPALQERLIELFASSNNTSLKPYI
                     FLVIRMMIVKFSQIHLSTFWPTIYTELERVFHNLLEKLLELKFDDDVLGIDHSKIDLS
                     VFDNNLILQACKLLDYLLVLGLEEFQLSEWLFVNDNSDVAYGREDGCSAILSLIDRIS
                     SMKNLKMVEMKSSISITSSVLDSKTKRPLLYMVKQVSRIFELKPFFDKLSVYKYESDS
                     EMKQVDWAAIEEDLLTDIFD"
     gene            <1049674..>1050969
                     /locus_tag="FOA43_003172"
                     /db_xref="GeneID:62196573"
     mRNA            <1049674..>1050969
                     /locus_tag="FOA43_003172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923447.1"
                     /db_xref="GeneID:62196573"
     CDS             1049674..1050969
                     /locus_tag="FOA43_003172"
                     /note="BUSCO:EOG09341P1V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779375.1"
                     /db_xref="GeneID:62196573"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="PFAM:PF13874"
                     /translation="MNGSGNANNNNASTSFGFGSGNNNNNSNNNLNKPLGFGFGNNNN
                     NTSSNNNTTPGFGGNKTSNTRSFSLGGGGFSFGSQPNTTPGVTSNMGNTGAGNGLFSK
                     PSGFGIGTNSNTFGNNTSGTSGTSGTSGGLFSNQQKPMVNTQPTFSWSQQQNNQQVQP
                     QQQLQTQFQVGKQGQQQKTGYTPTISDQLDKIKNSWDANSTQCIMKTHFYNKVPQEFN
                     NYQRPVDESPEEWERAMKERPKEYNSIPIKAKGFEDLLKRSNLQIEYIKQSRVILNQI
                     NDNLVKLGDKHDLEYTSILLKCKMKQKQLDIKLLKIAINLSILRYKGYPLTNDEERLV
                     LKFKKLLDKIDDPIGLNRANELWARLSNLKQRLGTLNEGTKQQIVEVEVDSRVTSKNE
                     AVIAKLVKVLSKEQQGIQYLYEMIEGDKEMLEKVKKAKE"
     gene            <1051102..>1051822
                     /locus_tag="FOA43_003173"
                     /db_xref="GeneID:62196574"
     mRNA            join(<1051102..1051135,1051188..>1051822)
                     /locus_tag="FOA43_003173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923448.1"
                     /db_xref="GeneID:62196574"
     CDS             join(1051102..1051135,1051188..1051822)
                     /locus_tag="FOA43_003173"
                     /note="BUSCO:EOG0934430H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779376.1"
                     /db_xref="GeneID:62196574"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="PFAM:PF00957"
                     /db_xref="PFAM:PF13774"
                     /translation="MESTLIYRVSDGLPLAGSSDDDNTRELLALKKQCKRLVSKFSQQ
                     PEHNTSMGDIASTVEENGSMKNIHYLISKGMIYLCITPSKFPKKLAYSYLSEISNEFG
                     HVYGADLDKPDLKPYQFMQFDSFLGKTKKIYSDSRVQSNLDKLNSDLSDVKMIMNKNI
                     EDILYRGDSLDKLQDLSQNLKAESKKYRRYAEKINFRLLLKQYAPVAMVALIVLFILY
                     RLLF"
     gene            complement(<1051847..>1054453)
                     /locus_tag="FOA43_003174"
                     /db_xref="GeneID:62196575"
     mRNA            complement(<1051847..>1054453)
                     /locus_tag="FOA43_003174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923449.1"
                     /db_xref="GeneID:62196575"
     CDS             complement(1051847..1054453)
                     /locus_tag="FOA43_003174"
                     /note="BUSCO:EOG09340FKX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779377.1"
                     /db_xref="GeneID:62196575"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR035639"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="PFAM:PF16661"
                     /translation="MFEFISVVPPNDNDNYDPLVLDSDNEDDDPTDSLSNTSNIQARL
                     ITLDHETNILADPGWDGVSDISYLEDVIPKIDLIILSQTTVEYLGAFAYLLHKYPILK
                     KVNTYATLPICKLGRLSTIELYRSAGLTGAVEGSIMEVEDIGTYFNSIIPLNYSQSIS
                     LQGKLAGITITAYNSGHTLGGSVWLFNKEAEKVVYAPVWNHSKDLFLKPCKLLNHSSL
                     ARPTTFLTGSDLGSSTSHQKRIDNFLQLVELTLYNGTSILIPTSLSGRFFELLPFLDQ
                     KVPREIPFYLVAYTGIKSLKSSSNMLEWMSPDVTKNWESQNRSPFDSTRIKLITMKDL
                     TSRGSSGPKIVFVESLGFSEGSLARPTFIELCSKQNTALFLTERPSSGTMLFDIYKSW
                     EETVSKDGNLKDGSLIIFEKELSVKVTKETALRGKDLNKYLKKIDDRREKKKQMELEE
                     KKTNNLLDNMIDEDEDEDEEEDEEEEEDKDEEAEKEEKEDEEKVRREKLGLNNGENDE
                     FKASATTLSAISKSRTKDEEIHVTAKDLLEMPMDFDIRNVKANKNKMFPFIVDRINVD
                     DYGTVINHDDFKREEEKFFSVKRDFEEINEEESNDGTRKRRRLRPQIQEDVVTLYSMD
                     SKKNPVLRTVKTRKVRVRCGLTFIDLSGLTDMRSWKFNTNGIKPRKVIVLPNNTYSGY
                     LGDSRTIMESLIKQQRNKLGLHGTDNGENLNAFHSQSSNGVLGIDFIRGKLNEKINLG
                     SVISSYSLQIDDEIGGELQWQVITGGYSLSHISGEVIRLKNGFKLVPSNKSIKTTNNK
                     ISIGDVKLNELRKRLKELNHIVEFKGDGTLVVDNQLAVRKVSDGNLMIDGGTGELFYK
                     VRDQIQSMLAYV"
     gene            <1054681..>1055235
                     /locus_tag="FOA43_003175"
                     /db_xref="GeneID:62196576"
     mRNA            <1054681..>1055235
                     /locus_tag="FOA43_003175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923450.1"
                     /db_xref="GeneID:62196576"
     CDS             1054681..1055235
                     /locus_tag="FOA43_003175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779378.1"
                     /db_xref="GeneID:62196576"
                     /db_xref="InterPro:IPR016680"
                     /translation="MSTSNTYDTISASVASDKKRGTEYVLENGKLPPEIPHVKEIGAT
                     TGPLMSASYYIGDRCGEFNDDFMLCQKENGANGPIKCLKEGRRVTRCAASVIKDLNAS
                     CKKEFELHYKCLNYSNMEFKNCRKAENLLNDCVFKNLKLIKTIPDDGGREVFKPGHQL
                     YTPVHPHYPSEKAYELKQKEKQTQ"
     gene            <1057742..>1059255
                     /locus_tag="FOA43_003176"
                     /db_xref="GeneID:62196577"
     mRNA            join(<1057742..1057745,1057766..>1059255)
                     /locus_tag="FOA43_003176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923451.1"
                     /db_xref="GeneID:62196577"
     CDS             join(1057742..1057745,1057766..1059255)
                     /locus_tag="FOA43_003176"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779379.1"
                     /db_xref="GeneID:62196577"
                     /db_xref="InterPro:IPR007701"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF05004"
                     /translation="MNDFSVASVDQLDVTNNPEIQQQLSQDLHDVKILRSPSFGALSR
                     EESRNNSVIGSLIDDELDDDNSGNSESRSNSVATNSGIRIYTLADMIEALSKPRSKIN
                     TDSRLFLLSLAYKMLIRRPDMANVNEQDMEQLIGYIKTSRSDIEMVLSIKLASAYGAT
                     DTDEVGTELMDELIPLLFGKIFDFTNSVFLRSNCIAAYFSLLLVIFDGSDCYSVADNV
                     NGFLELVEGYQSPKNASSESDKDTEFQWDIVAGSINGICVILTLLYKSGKNDINELIQ
                     DCLPRLIPFFGSEFPRKVHKALCILIGVMYEAFDYKAEEREEEEEGNDEAGISEGPYY
                     DVEELKMMIGDLSRESTKKVGKKNKREVRSIYRDALRTIEEANKEKDEDEEELDDADI
                     RVISRFSISKNKQVPIRSWFAFVRLIHLKYLFDTELSSHYLYSKEVRELLARPDEQVE
                     YDNDDEEVSGVKHWKGRQDKVSGKKKDSRIQRARDRKLLEKMEGLNI"
     gene            complement(<1060495..>1061106)
                     /locus_tag="FOA43_003177"
                     /db_xref="GeneID:62196578"
     mRNA            complement(join(<1060495..1061051,1061103..>1061106))
                     /locus_tag="FOA43_003177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923452.1"
                     /db_xref="GeneID:62196578"
     CDS             complement(join(1060495..1061051,1061103..1061106))
                     /locus_tag="FOA43_003177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779380.1"
                     /db_xref="GeneID:62196578"
                     /translation="MMVDVLLKPSKYGISNDELFEYLNKCMINGENGEDQQAQKESEQ
                     DISTKMVDFRKLIELGRILASKDVASLDSLYRCLSTNVYINHLQTTAEFATRSFDSPT
                     RCPYYMPDLRLPIKNVLILFINYFKKLESHLTIQQTTDEYTSLCENMRNLMLLLNVSM
                     LNKLVAIFKTLNPEIRLKNEALIVNV"
     gene            complement(<1061308..>1062912)
                     /locus_tag="FOA43_003178"
                     /db_xref="GeneID:62196579"
     mRNA            complement(<1061308..>1062912)
                     /locus_tag="FOA43_003178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923453.1"
                     /db_xref="GeneID:62196579"
     CDS             complement(1061308..1062912)
                     /locus_tag="FOA43_003178"
                     /note="BUSCO:EOG093419GS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779381.1"
                     /db_xref="GeneID:62196579"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF02005"
                     /translation="MTSEAFPTIDLSKYDQLTEGSATILFPKNKVFYNHVQQYNRDLS
                     CLAIRAFTELYQEEKVLLRRKRNKQPVTDGAQPSTEDVTETLTKADAEEKAKKQPYAI
                     VMEALSASGLRAIRYAKEIPLIKSIIANDLSAAAVDSINVNIQHNQVGNKVTSNHADA
                     IQYMSQHKDEYHVIDLDPYGSAAPFLDSAMQAVKNGGMMLITCTDMGVLAGNGYPEKC
                     FALYGGSNVGGDATHETALRLVLNMIATTGAKYRKSIEPLLCLSIDFYVRLFIRVHQS
                     PIKVKELAYNTMMMSKCSGCYSVTEQRLGKISHNKNGSKKFGLATGASHIGPNCSFCG
                     YVNHIGGPMWAGNLHNKDFIDRVLSLQAKADDKIYKTLPRIKGMLTMAKNELDAHFYF
                     KPTSVSSVLKIPAPSIETFTGALGNLGYHASLSHTVPNSIKTDAPWETIWFIGKKLAE
                     KCKLDKSKLSETTAGYKILSNDDVGKDIDLNKLKAESGSTDMEDSDWLFQRNEVSDQV
                     NQLRRIKIVRFQENPTKNWGPKSRPK"
     gene            complement(<1063150..>1065186)
                     /locus_tag="FOA43_003179"
                     /db_xref="GeneID:62196580"
     mRNA            complement(join(<1063150..1064982,1065178..>1065186))
                     /locus_tag="FOA43_003179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923454.1"
                     /db_xref="GeneID:62196580"
     CDS             complement(join(1063150..1064982,1065178..1065186))
                     /locus_tag="FOA43_003179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779382.1"
                     /db_xref="GeneID:62196580"
                     /translation="MPVSEEVEKQSRLIQESHNLLCHSSTESTTRHGFRKTNIKPKVT
                     KDGTPLEFLFVDCNSTNQSSVGEEASHDKKKNKKKKKKKSTMSMLGKSKKSKNTHDAG
                     PDSSCFSSSSSTLSELATINGSLQELPETEKEEEKPPGRVTRLFRNRSLRKRRHEIDP
                     LVRSSQPSSSSKRSILRQLYSRKSRPEKIVRPSLAVRTSLEENDSSPTTSETTPTQSS
                     STASSTMFSVRTPNPSISSNVLTPITPIVSTTSSLASMGSAANYKQQQQQQQQQQQMV
                     FANSPLTHTPSQQHQDEDDYSLLEVCSVNTSNTKKIKAFRRSNSIVSMASTCSISQFP
                     PTSPAVTSTAVNNAVRPRGRVQSCSSAHSFGGAVTRTLVSQPVKFRSASHISLSPQSQ
                     ELASGSADTWSLEPRKMSESQVRQQHLQYQLQELQQQMSFQRQSWRQQRLKAQSQISP
                     VSATIAYEVPESTEKLYFEKFSKETPGDSYMISPGQTLSMTSSAPTAPESSTIPVIPV
                     MPMMPIAQSEPMSWMDSTPPTLTASPQQSTPFDFPEETSKELSTCGVDDTHPNISEEE
                     LDRLLKDAFGLDMGPKEPSTNESFSVTDLEDQNFDLLAFIDSAKPSK"
     gene            <1065840..>1068662
                     /locus_tag="FOA43_003180"
                     /db_xref="GeneID:62196581"
     mRNA            join(<1065840..1065846,1065886..>1068662)
                     /locus_tag="FOA43_003180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923455.1"
                     /db_xref="GeneID:62196581"
     CDS             join(1065840..1065846,1065886..1068662)
                     /locus_tag="FOA43_003180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779383.1"
                     /db_xref="GeneID:62196581"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /translation="MSIQLSFDEDDEDSASRSALWASKSRDKVSFKRIKKEDAIKLKT
                     EAIDVRIGDQKSKEDQLGGDDEAREPKVMASVTKFEMPPVSYEHKSILEELAQRERQW
                     KDEAAGAQSPSSSLSDREVDRDWYMQDERVNHVYMDDYDMDDEDRVSKIDEDDLEEVS
                     NDIDIHVHRLTPPFLDSHTVMSNHTGMIDVIRDRTGDLFKFSKNGSSVVNERRKNRDR
                     QRNARESVRSDNSALEKVVRKGSNGTRHDGRGTRTNPPPRYSRADIQRQRQALPAYKV
                     REQFLKVVRENQVVVVIGETGSGKTTQLPQFLYGEGYKERGLIGITQPRRVAAVSVAQ
                     RVSEEMNVKLGEEVGFSIRFEDRSSSKTRIKFMTDGILLRETLQDEDLDKYSCIIMDE
                     AHERSLNTDILIGLFKKLLARRRDLKLIVTSATLNADKFSSFFGNAEQFIIPGRTYPV
                     DIMFSSVPVMDYVEEAVKQVLRVHLSAENKGDILVFMTGQEDIEVTCSQIEEELDNLR
                     KLDETIKPLQVLPIYSTLPADLQARIFERSEYRKCIVATNIAETSLTVDGIGFVIDTG
                     LMKLKVYNARLSMESLQITPISLAQANQRAGRAGRTGPGTCYRLYTLTAAQTEMLPEP
                     IPEIQRTNLENTILLLKSLKVKDLSRFPFLDRPSIESISTAQYQLWSEGALDNFGDLT
                     LLGERMSRFPIEPTLSKFLILSTLDRFHCSKEVVTIVAMLSIPPIFVRPNNDMGLQKK
                     SDSSREKFQVAESDHLTLLNIYDQFMSHGRNEKWCQHNFLQHKSLRRASEIREQLVQI
                     MKNNKLDLTVQDCEDWNLIRECVCAAFFLNGASFKKYGQYQHLRSGLEMALHPTSALY
                     GMGDLPKYVVYHEVILSGRVQHMNYVSTVKGEWLIEYGGVFYSKRVRGVSSKEHQRRK
                     ETEYEEYLQASKK"
     gene            complement(<1068678..>1069526)
                     /locus_tag="FOA43_003181"
                     /db_xref="GeneID:62196582"
     mRNA            complement(<1068678..>1069526)
                     /locus_tag="FOA43_003181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923456.1"
                     /db_xref="GeneID:62196582"
     CDS             complement(1068678..1069526)
                     /locus_tag="FOA43_003181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779384.1"
                     /db_xref="GeneID:62196582"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF02569"
                     /translation="MGFLHQGHQSLVTRSLEENDVTVVSIFVNPSQFAPGEDLNSYPR
                     NLDHDLSLLSNTSVTKRRVTLVFAPTVSEMYPSGIPLETSQQRGGFINVLGVTEQLEG
                     RCRPAFFRGVTTIVGKLLNIVEPDNAYFGQKDVQQTVVVRRMVKDLFFNTKITVVPIV
                     RNETGLALSSRNAYLSDPVKNKATILFKSLKLAHDAYENSQLEVVKLTGLITGSIKSA
                     STEFQIDYVSFNDPDDLHYLDAIDPAKGCIVSMAVFVPNVFGKTEQTRLIDNWILQPM
                     KNGKFN"
     gene            complement(<1069796..>1070737)
                     /locus_tag="FOA43_003182"
                     /db_xref="GeneID:62196583"
     mRNA            complement(<1069796..>1070737)
                     /locus_tag="FOA43_003182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923457.1"
                     /db_xref="GeneID:62196583"
     CDS             complement(1069796..1070737)
                     /locus_tag="FOA43_003182"
                     /note="BUSCO:EOG093436XW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779385.1"
                     /db_xref="GeneID:62196583"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00763"
                     /translation="MSAEKPTTACKVVTASRIAKKYTEEIKAHIAKLDHPLTLVGLLA
                     NADPAAKLYANWTGKTAKQLGFNYRLIEIPQKDQLEEEIYQVNNDESVDGIIVYFPVF
                     GNRQDQYLQQCVAIDKDVEGLNFKYISNMYHNVRYMDDGETKKSILPCTPLAVIKIME
                     YLGVYNELLDYGDRLYGKTVTVVNRSEIVGRPLAALLANDGARVYSADINDIQIYERG
                     VGLRLRQHQVKECNLTLEQCAKSSDIIITGVPSKDYKFPTQYIKRGAVLINFSSEKNF
                     DDEAVRKVASMYVPMIGKVTISMLLRNLLRLRENRLA"
     gene            <1073404..>1074825
                     /locus_tag="FOA43_003183"
                     /db_xref="GeneID:62196584"
     mRNA            <1073404..>1074825
                     /locus_tag="FOA43_003183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923458.1"
                     /db_xref="GeneID:62196584"
     CDS             1073404..1074825
                     /locus_tag="FOA43_003183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779386.1"
                     /db_xref="GeneID:62196584"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="PFAM:PF00349"
                     /db_xref="PFAM:PF03727"
                     /translation="MPAVNKKLQTRANQVCKCFEVSQDLILRGVDYFIDSCERGLETD
                     DDPTALMMIPTYVTSIPTGHEQGVLLAVDLGGTNFRVVSVTLKGDHTFSLVQAKSPIP
                     LDMMSGTSAMLFQWMSEKIDKFLKTHHSDSLKEGNNFKMGFTFSFPVKQKSLNSGTLT
                     RWTKGFDVSDCVGKDVVALLQEHLDALKVPVTVGALANDTVGTLLARSYTGANKEGET
                     IIGCIFGTGTNGAYAEDVSKIKKLPEDVRKHLKEAGVTQMVINTEWGSFDNQMKILPN
                     TKWDQVVDKNSSNPGVHIFEKRVSGLYMGETLRVVLFDLWKEGLLFKDYATEEALPHR
                     LTTPFNLDTEAMSLFEIDDSTGLKASELKLQQMLRLPTTTEERLVIQQLTRAIAHRSA
                     YLAAIPISALLMKVGAFDGHHVEVDVGADGSVVEFYPGYRTMMRDAVSLTQLGPKGER
                     RLHINISKDGSSVGAALCALSEE"
     gene            complement(<1074905..>1075738)
                     /locus_tag="FOA43_003184"
                     /db_xref="GeneID:62196585"
     mRNA            complement(<1074905..>1075738)
                     /locus_tag="FOA43_003184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923459.1"
                     /db_xref="GeneID:62196585"
     CDS             complement(1074905..1075738)
                     /locus_tag="FOA43_003184"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779387.1"
                     /db_xref="GeneID:62196585"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /translation="MLQSCLYKHPTVVRITTRCITENHYKNLDLDPTADLKQIKKSFK
                     RLSMKLHPDILLSQELPQDMLRKKKNHYLQIKKSYELLMDPEKKASYDRNIAVRTAAG
                     ARKAASTNSQRGNFFHYTRVRYPQSVGYDFGDSSHFDSKKHMKRNMANEQRIRERKII
                     QFGDLFRHDLNTRNIAYGVHKGLHQFHTGIDEAEREKAFLWRLFVGFVGMMVAWELTI
                     GRVDSGNTSKKNEIHYSPHSETHRDELTPSLASSEYTATLLSNAIEGSGGRTKKANTK
                     S"
     gene            complement(<1075986..>1077371)
                     /locus_tag="FOA43_003185"
                     /db_xref="GeneID:62196586"
     mRNA            complement(<1075986..>1077371)
                     /locus_tag="FOA43_003185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923460.1"
                     /db_xref="GeneID:62196586"
     CDS             complement(1075986..1077371)
                     /locus_tag="FOA43_003185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779388.1"
                     /db_xref="GeneID:62196586"
                     /db_xref="InterPro:IPR027532"
                     /db_xref="InterPro:IPR031468"
                     /translation="MSFEINWDTISTDESLRSALKDLLNERLSSINLPKYMDNLQVVE
                     VDLGNVSPELAIRDIDHPFAEFYGQEDDNSADSSQGGSGGIHPTRVRSGKFNGTSFDA
                     EGSAITAPHIPGISAPPISRSPSPSLVGYNPHLSSPIPRGSTAGLLIPRPSSPYFQGL
                     HNGVGIGAFGMKENDTLSHNDTEAFAPVPMEPNLSIDGVQEDTPASTNTSVKPETLNN
                     SDNSGLPRGKNDFQLTLDLQWTSKIYIEVTCNLVVNYPSPGFITLPVRLKISDLLIHS
                     LAVCAYLDHRVFISFLCDLDDDESSSNREESRQDSRKSSIGDPTGGGFLNSDTFHSGS
                     GDRIDMIKDLKIEGELGDYEDSSEGFDRSKTTSTSSNSTNLESPLKQSYYSSKPIRRE
                     RQSLQQLGTTMTTSDSGTVAETSGNGSVLRNIGKIEKFLVSALRKVLINELAWPSWIE
                     LDLREDEETSD"
     gene            complement(<1078843..>1082162)
                     /locus_tag="FOA43_003186"
                     /db_xref="GeneID:62196587"
     mRNA            complement(join(<1078843..1082116,1082155..>1082162))
                     /locus_tag="FOA43_003186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923461.1"
                     /db_xref="GeneID:62196587"
     CDS             complement(join(1078843..1082116,1082155..1082162))
                     /locus_tag="FOA43_003186"
                     /note="BUSCO:EOG093406A8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779389.1"
                     /db_xref="GeneID:62196587"
                     /db_xref="InterPro:IPR007673"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024324"
                     /db_xref="InterPro:IPR032682"
                     /db_xref="PFAM:PF12717"
                     /db_xref="PFAM:PF12922"
                     /translation="MTLSLPNSVKYQLAYLINNSLETEIERETRPALQEGDVDSFAIH
                     RQILELYGYLVFVLLYHFGKEEADPKNLELKNHIKKTSEIIESCLVTVSHLFTLRLSL
                     LFQTTPERNLFVGNLFLNPINVLLENPYRAKVTSVKLHAFKAICLAVKYHGQASHTQN
                     AILQHLTYFPHLSTTMAELLQVMTDHYDYPQLTDSILKEVSAKKFNENDTTGPKSISN
                     FLIKLSELSPMVTMRQMSLIAELLDNNSFTLRCAVVEVVGNIISTLAKSQEEYDLHKE
                     SANDYIELLEERLLDVNPYVRARALQGLIKLTEMQVKFVNRRLRWTKLAVRHLEDRSG
                     LVRRNAIKFLSHLIMAHPYSAINDERLDYDTWDDRFKLLTEKLKELQPDIFEEEEEKE
                     EEKEEEKEEEKEEKGETGGDPEEEEDDDNADGVSEVDNDDMDSENGEKNNSKVAEKPA
                     EMEPSGSDPAMVQKLFLTWQIYQDCLSFIKLIEKSAELCCELLHSKSKIEVIDVMSYF
                     VLCDAYGIHNSVKGIKQMLHLVWMKGSNEEGNQVVDKLIECYQSLYLNSPSTDTQLQR
                     AARIAKSLVELTYNASLADLASLEKLMGEFYSKKLIGSDVVNVLWSLFREESTPRECK
                     RGSIIILGMLALANNEISLKGLDLILDVGLDPESKDWILSSYACIALRRAVPAKAGTT
                     YRMAKEAVVVGKLTTVLLLYTEDGRWFGMAEEALNSMYAIASRPDDIATEILRRKTAE
                     VFNTEKETEKQVVGLTQLLFLVGHIGLKTVIYLEKCEAEFKKKQIAKENKKSEEDNEL
                     DMIGGTNEDDFSDAVQVIKEKELLYGKKSFLAKYVPLVKEIVVHRKDYADPRLQRQAI
                     LCLGKMMCISPRFCEDNLKIFLNAMEHSEDPIVRSNATLALGDMAVCFNSIIDTNKNY
                     LYERLQDSDIMVQRTCLMTVTFLILAGQVKVKGQLAQMAKLYVNVDPAIVDMCKLFFS
                     ELATKDNAIYNGFMDMFSGLTTDEKLNPKDFKEVTKFVIAFIQKDKHKQQLASKLYQR
                     LIKTDSEKLWEQTALVIKEIIPRQDATVTSRKDEESAKGRLYNEILETIEQGYEKPAE
                     KVEGS"
     gene            complement(<1083330..>1084280)
                     /locus_tag="FOA43_003187"
                     /db_xref="GeneID:62196588"
     mRNA            complement(<1083330..>1084280)
                     /locus_tag="FOA43_003187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923462.1"
                     /db_xref="GeneID:62196588"
     CDS             complement(1083330..1084280)
                     /locus_tag="FOA43_003187"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779390.1"
                     /db_xref="GeneID:62196588"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="PFAM:PF05236"
                     /translation="MSKKSESTDELSGLATPRLATPTFMTPGDGMINEGNNNSSNGSN
                     EYFTQHDIDKIIGSDGKPKTSFKIGASGATGTTKSNNLNNPEELADAVAAAGVNIRAE
                     EEAMAGSIGLSVSRRLLHQNHFLKPQQLAWFMNKAMEEQGMTTMGFDLDLLNLMSSAC
                     ESYMTSLVADSVVMSRHRRRGMKTRRKQSLTGSKSEISRALKEIAVKQKFREEKRVQR
                     RIALGLEEEKKDEQAEEQTQTNITASLMMSGSMKKRYSWMQTPASGSKTLNSRGDNGI
                     RYREAREESGIVMRDLLAAIENRRMGVSSAVLKGYAKLRD"
     gene            <1084512..>1085597
                     /gene="RCL1"
                     /locus_tag="FOA43_003188"
                     /db_xref="GeneID:62196589"
     mRNA            <1084512..>1085597
                     /gene="RCL1"
                     /locus_tag="FOA43_003188"
                     /product="rRNA-processing endoribonuclease"
                     /transcript_id="XM_038923463.1"
                     /db_xref="GeneID:62196589"
     CDS             1084512..1085597
                     /gene="RCL1"
                     /locus_tag="FOA43_003188"
                     /note="BUSCO:EOG0934268M"
                     /codon_start=1
                     /product="rRNA-processing endoribonuclease"
                     /protein_id="XP_038779391.1"
                     /db_xref="GeneID:62196589"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="InterPro:IPR036553"
                     /db_xref="InterPro:IPR037136"
                     /db_xref="PFAM:PF01137"
                     /db_xref="PFAM:PF05189"
                     /translation="MAVTTFQGYENFRLRLVLSTLSGKPIKIEKVRADDLNPGLKDYE
                     ISFLRLLESVTNGSVIEISYTGTTVIYRPGLIIGGSFTHNCPTSKACGYFLEPMLYLA
                     PFSKKKFSIVFNGLTSSKADPGLDFIRWGLLPVMEKFGVREVELHTLKRGCPPNGGGE
                     VHLLVNSLIPQPITIHILDIQKISAIRGIAYCARVSPSVANRLVDASRNVLRPAGCEV
                     NITTDVWRGENAGKSPGFGLTLFSESKKTQLRYAVDDMGGPGETPEDLGERVAYNLLE
                     LVQKSGCLGRNQLALAFTFMVIGKEDIGRIIVNKQQIDAKLIGLLRDIKELFGTEFFF
                     KDCEDYDNCLYATAKGVGFTNASKKIA"
     gene            complement(<1085633..>1086744)
                     /locus_tag="FOA43_003189"
                     /db_xref="GeneID:62196590"
     mRNA            complement(join(<1085633..1086687,1086738..>1086744))
                     /locus_tag="FOA43_003189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923464.1"
                     /db_xref="GeneID:62196590"
     CDS             complement(join(1085633..1086687,1086738..1086744))
                     /locus_tag="FOA43_003189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779392.1"
                     /db_xref="GeneID:62196590"
                     /translation="MQLKHPVLCKENLVVMFLTVPNDFTNWKKFANIELTDEFEGVRV
                     HIPSRFKINVNHLLRGLRDNESDDSTGSSPAGGNNMAARNDSVINNITQIWNESPVNH
                     KSVDFVDNFDHLNTSLTRMADLWSKFAFLAERIERRELAVASDHQKAGAFLENFANVN
                     TNVFGMDNIIENRSRKTTEESQNLNIINTILKQAIGFFGNTKKVKEEEMTSVCLDVIE
                     NFKKFQDYMASLHFLMERITNYRNESEKRIHILLNKLTRANERLSHIKGKSDIKGSEI
                     DRLVTITTQTSDQLNNLISRIILVKLTFVNEYALYQKTKYIISEVFQDWFRERLKFGD
                     VQQEAVQRLFTDLQDLPLK"
     gene            <1087950..>1088729
                     /locus_tag="FOA43_003190"
                     /db_xref="GeneID:62196591"
     mRNA            join(<1087950..1087953,1088032..>1088729)
                     /locus_tag="FOA43_003190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923465.1"
                     /db_xref="GeneID:62196591"
     CDS             join(1087950..1087953,1088032..1088729)
                     /locus_tag="FOA43_003190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779393.1"
                     /db_xref="GeneID:62196591"
                     /db_xref="InterPro:IPR019258"
                     /db_xref="PFAM:PF10018"
                     /translation="MLIYKKFCEFEDELQRLTASIQQYKPDPEIASEIVVTADKINAE
                     LEKIELLHEMRSNQVVKQNTENDQLNESLRSILTTLNDCRQELELLPKLTIEEEQDVA
                     EGELQRALKEPDLDATKQLLAYAMKLSKFSRIPRTFDGFLLPNNFLWPGDDNMRRGML
                     AMASMMPDKVINRENSNSGQEEIEVEVEEEKKDEESNQVQVNEEEDVLRRDGAQTKDA
                     SEVMAGLDLFDEDED"
     gene            complement(<1088770..>1090425)
                     /locus_tag="FOA43_003191"
                     /db_xref="GeneID:62196592"
     mRNA            complement(<1088770..>1090425)
                     /locus_tag="FOA43_003191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923466.1"
                     /db_xref="GeneID:62196592"
     CDS             complement(1088770..1090425)
                     /locus_tag="FOA43_003191"
                     /note="BUSCO:EOG093419A5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779394.1"