GenomeNet

Database: RefSeq
Entry: NC_052377
LinkDB: NC_052377
Original site: NC_052377 
LOCUS       NC_052377            3303233 bp    DNA     linear   CON 13-FEB-2021
DEFINITION  Brettanomyces nanus chromosome 4, complete sequence.
ACCESSION   NC_052377
VERSION     NC_052377.1
DBLINK      BioProject: PRJNA691332
            BioSample: SAMN12257692
            Assembly: GCF_011074865.1
KEYWORDS    RefSeq.
SOURCE      Brettanomyces nanus
  ORGANISM  Brettanomyces nanus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
REFERENCE   1  (bases 1 to 3303233)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 3303233)
  AUTHORS   Roach,M.J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2020) Research, Australian Wine Research
            Institute, Adelaide, SA 5064, AUS
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP064815.
            Annotated using 1.8.1.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: OCT-2018
            Assembly Method        :: Celera Assembler v. Canu v1.7
            Assembly Name          :: AWRI2847_1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 50.0x
            Sequencing Technology  :: Oxford Nanopore MinION
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3303233
                     /organism="Brettanomyces nanus"
                     /mol_type="genomic DNA"
                     /strain="CBS 1945"
                     /isolation_source="Bottled beer"
                     /culture_collection="AWRI:2847"
                     /type_material="type material of Eeniella nana"
                     /db_xref="taxon:13502"
                     /chromosome="4"
                     /country="Sweden"
                     /collection_date="21-Jan-2014"
     gene            complement(<4265..>4686)
                     /locus_tag="FOA43_003223"
                     /db_xref="GeneID:62196623"
     mRNA            complement(join(<4265..4539,4680..>4686))
                     /locus_tag="FOA43_003223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923477.1"
                     /db_xref="GeneID:62196623"
     CDS             complement(join(4265..4539,4680..4686))
                     /locus_tag="FOA43_003223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779405.1"
                     /db_xref="GeneID:62196623"
                     /translation="MAGTDSTLHATLQATLLYATCYATGYSTLRYMLRYRLQATCYST
                     LQATLHTLRYMRYAASSGEGQRQTGKLKRTSGLGDGRKKVMGREETRVD"
     gene            complement(<5482..>6239)
                     /locus_tag="FOA43_003224"
                     /db_xref="GeneID:62196624"
     mRNA            complement(join(<5482..5621,5759..>6239))
                     /locus_tag="FOA43_003224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923478.1"
                     /db_xref="GeneID:62196624"
     CDS             complement(join(5482..5621,5759..6239))
                     /locus_tag="FOA43_003224"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779406.1"
                     /db_xref="GeneID:62196624"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR036259"
                     /translation="MNAESEKEVSYAELFKATNLKRVVLSIFALTGQLWVGVSSVLTY
                     ISYFFELAGVSSSIEKTVGMFTLCVGGNLVSYFVIERVDRRVLYIGGVALCTIMNLLI
                     ACVSYGSSQAAAYTTVVFVFLWAFIYEATVGPLTYALITELPQGRMRAKSVAITSNVN
                     KTRGRTANEIEQLFVNKVGALKFKRAKFDEDDKLIMSSVGKEVSQA"
     misc_feature    9013..14391
                     /note="contains ribosomal RNAs"
     gene            complement(<26189..>27841)
                     /locus_tag="FOA43_003225"
                     /db_xref="GeneID:62196625"
     mRNA            complement(join(<26189..27790,27833..>27841))
                     /locus_tag="FOA43_003225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923479.1"
                     /db_xref="GeneID:62196625"
     CDS             complement(join(26189..27790,27833..27841))
                     /locus_tag="FOA43_003225"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779407.1"
                     /db_xref="GeneID:62196625"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MASAEPVDEKEVDEKEVGENIFSDTRPVKTRLWEIRNSYKYLMI
                     VYISAIGIGIDSLLFSLLLGMESFRKAYGYYDEATSGWVIRAKYQSGWNGGSFGCQVL
                     GAFFAGWYNDKFGRKSSLAISCIITIIGNTVAITAPVGHPINLVMAKCVIGIGIGILV
                     STCPVYLSELMSPTLRGIGSMGINFSICFGQWIGSLIYFGCSKNYTGIDDSTGYKIAF
                     GIQYLLVGGYLLLFWFMPESPSYLIHRGKLEEAKAAIKKLYHNKNNTEYDIDSHYEIL
                     IKEVEEEKMNAESEKEVSYAELFKATNLKRVVLSIFALTGQLWVGVSSVLTYISYFFE
                     LAGVSSSIEKTVGMFTLCVGGNLVSYFVIERVDRRVLYIGGVALCTIMNLLIACVSYG
                     SSQAAAYTTVVFVFLWAFIYEATVGPLTYALITELPQGRMRAKSVAITSNVNSLCSFG
                     LGYLIPYLFNPDEVNMGARIMFVWTGTGVVLFVVMLFFLPETRGRTANEIEQLFVNKV
                     GALKFKRAKFDEDDKLIMSSVGKEVSQA"
     gene            <28688..>31879
                     /locus_tag="FOA43_003226"
                     /db_xref="GeneID:62196626"
     mRNA            <28688..>31879
                     /locus_tag="FOA43_003226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923480.1"
                     /db_xref="GeneID:62196626"
     CDS             28688..31879
                     /locus_tag="FOA43_003226"
                     /note="CAZy:GH106;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779408.1"
                     /db_xref="GeneID:62196626"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="InterPro:IPR033400"
                     /db_xref="PFAM:PF17132"
                     /translation="MTASSRILYPLSNKEFDNELFKNPSSDYRGAPLWCWNCKLDKER
                     LLFEIDTLKDMGFGGFHIHSRVGLDTPYLGDEFMSLVKECHDYGKSKGLITYLYDEDR
                     FPSGSCGGKVPRENPEYRAKYLMFTSIPYGEFEIPKENPFPMSASRNENGELLCAFKV
                     YLKEGYLSDYERVDISNQESLNKARSEAEATPGCKLWYGYLEHAVPSGWYNNSTYVDT
                     LNADAIKCFIETTHVKYRDLLQADFKKTVKSIFTDEPQFSHKSIFEKAESSDQAFVPW
                     TTDLPETFQKAYSYSIFEKIPELFWELPDRKPSVFRYHYHDHVCQRFTDAFVKTISKW
                     CSENNLGFTGHMLDEEDLLTQTTSLGEAMRAYPHFDIPGIDMLQDKHEYHTAKQCQSV
                     VHQYGKEGMMCEMYGVTNWDFTFQGHKSQGDWLAALGVTFRVPHLYWMSMRGEAKRDF
                     PASIGYQSSWYKKYTIVEDHFSRLNIALTRGSPVVRIGVIHPIESYWLAFGTWEQTKL
                     EREERQVNFDHLIKWMLFGLLDFDYVAESLLEDTTKLGEITEQFPCGVMKYDVIVVPS
                     LRTIRRSTLERLEMFAAKGGKVVFMGEVPSLVDAVPTTSPAELAKECTVIPFTKRALY
                     TTLEPYREIGIDFVDPVDHDCLLYSRLKDSILYNMRQEVDGSRYLFLCNTSTEQKRTG
                     SIITIKGNWDLTIMDTFTAEQKHFADVTIKNGKTTFHWDFSMVGSLLLKLVPTKQIVN
                     SAEPIVEEVPSDIVPVEDDIKYTLSEPNVLMLDFAESFRIDEGEWQASEEVLRIDNIV
                     RSILKLQAKNMEFPQPYSFKDERTFRHSVTMRFNFVSEEDVESPILASELKEDIEISI
                     DGVKVEELIDDGYFVDKDIYKIKLPSFKAGSHTLSYKMPMNQFSNIERLYLLGDFGVR
                     VNGKHTKIVKKQDTLVYGNWVEQGLPFYAGNVVYRIRIPDDVSSFQGSVKLRIREFKA
                     PLIGVSIDGKDVGSIAFDPFKINLGNLKGKREIELTVYGDRFNSFGHIHFANSKFPWC
                     APNAWRTVGDQWTYSYLLQPKGITETPTFELYA"
     gene            complement(<34105..>35652)
                     /locus_tag="FOA43_003227"
                     /db_xref="GeneID:62196627"
     mRNA            complement(<34105..>35652)
                     /locus_tag="FOA43_003227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923481.1"
                     /db_xref="GeneID:62196627"
     CDS             complement(34105..35652)
                     /locus_tag="FOA43_003227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779409.1"
                     /db_xref="GeneID:62196627"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSEESVEKKERLSPRVTTSEVGDTESVRIDHWYDGFVRLFVWYP
                     SYLEKKEKKLLLKIDFIILTYVCASYFTKALDKSNITNAYVTGMKEDLNFGGNDLAYA
                     KSLYSAGYIVSMCCGVMFVTRSWARFMLPILETIWGVLTFCQAAVNTPSQMFAIRFLI
                     GLAEGPIFPSIVYTLGSWYKRDEVYRRVMVFSISSSLGGMFSGFLQSAAYSNLSGKGG
                     HSGWQWGFIIDGIFTVPIALFGFVLFPGTLEQAGNVFWLRSSEWELAKVRMRQSGVKE
                     PTKLSFALVKRVFLRWHVHYFAAFWVLLNIVALPDGTGFPLWLKANSPSRYTETDVNN
                     FPSIQSAVGVVAQFFLAGLSDSFSIYPFLSVTQILFIISYSSLAAWNIPIGYKWFCFM
                     IIGFDSVNQSIVSGQINRACRRDAEERAFVLGYSDAVSQAMNIWTNIVFFPTEKAPEF
                     HLGYIISTVAAAVMLFMPIISYYGERWDVNKYENKVESVISQEEESSEIEVPDVVSGN
                     GTKSIDT"
     gene            complement(<36557..>37208)
                     /locus_tag="FOA43_003228"
                     /db_xref="GeneID:62196628"
     mRNA            complement(join(<36557..36858,37202..>37208))
                     /locus_tag="FOA43_003228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923482.1"
                     /db_xref="GeneID:62196628"
     CDS             complement(join(36557..36858,37202..37208))
                     /locus_tag="FOA43_003228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779410.1"
                     /db_xref="GeneID:62196628"
                     /translation="MSTKGYFNAEEIPVCQGERAKIARWVISQRQVYPPKSSSSGQLL
                     EHMFRDVVDSHEGTVLRGASFVESHIDGLFAKKHISECEVTLVHDLDDSIHFILLHKI
                     "
     gene            complement(<37396..>39690)
                     /locus_tag="FOA43_003229"
                     /db_xref="GeneID:62196629"
     mRNA            complement(<37396..>39690)
                     /locus_tag="FOA43_003229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923483.1"
                     /db_xref="GeneID:62196629"
     CDS             complement(37396..39690)
                     /locus_tag="FOA43_003229"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779411.1"
                     /db_xref="GeneID:62196629"
                     /translation="MDRIRVQMAVLEKKFDILRDNAGKSSNASSVYNDSTGSAVSAEG
                     LSTGQHSHTAHLNEISVLDEKLQGLKKMTIAGKPSWITFLGPLSRFWLFYSRDMLRNM
                     LSGMRSIMNQYKQIWTQTHDQMVQGMGLIGDSEKEDVVVKLINQIICPNYQAFSERLT
                     YFENQLNGMIFGGFIPMDVIHSLFSSYFTESNEPAKLCVFNKPEKPFFYADIAVVVAL
                     VHLVVIFTQNNTQKRQFNHHLDASTSILSSLAVNLMDISQFRRKRTQEALLAVILLRS
                     GLYVFESSKGLAGEVDSYPIFQTALDMCYQLGIHSDPDIANMFIFKNDQFMKTRVMSH
                     QEIRELWNYMQIEDACYSVGTGSPLQISYTFSAEFHRRSDFFFENKREEALKLMRDVA
                     LIVNSRRAVSIREILDLIHAMIEFCRQLPCHMFVPGGTVGDIDELAALCRIKLIFFQT
                     LQCLCRMVMVGIKDLHRKDSPSIHDKVTANILSNITREMFRQSLVSCALSLHEILLIC
                     EGKSIFGSDRNSKYVVFLRETFCRTFGQSFILWFTYLLPRATKDSELIGEFEKETTLF
                     EYPPRENSYEGEMDYKVLERALYYQHSQESPEFSERLCARLLLPSELISFASDFYKEV
                     SENEIMKNNLDSFLMAKTVIIWRYITEAIEESKNSCSTKETRVPDIISRAREKLERDF
                     CLEGDIIQLETQGIQFEKMLDSLFAEQDWLNIPAGLNFEGGQSIPTSVATSTTNTLDA
                     SRSDYIDAESLSDYHALTGKGNEI"
     gene            <41450..>43180
                     /locus_tag="FOA43_003230"
                     /db_xref="GeneID:62196630"
     mRNA            <41450..>43180
                     /locus_tag="FOA43_003230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923484.1"
                     /db_xref="GeneID:62196630"
     CDS             41450..43180
                     /locus_tag="FOA43_003230"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779412.1"
                     /db_xref="GeneID:62196630"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF06609"
                     /db_xref="PFAM:PF07690"
                     /translation="MTESVSSSPSEQQLSGIEMGLQSTGLVKTFEEQMLNADDKLSHI
                     DSAHLGEKPEKFRESDAGDGTRREDQILTGARFYTCVSSLLLCTFLVALDQMITASVL
                     TTIADHFNEFNKMTWITAAFMMPMGCCAQGWGRLSISFGRKWILVSGMALFEFGSLIT
                     GISISMNMFICGRAIQGVGGSCIQTVVMIIATEITTIDKKPILYGTLTLTFVFASVIG
                     PVIGGIFGTYASWRWCFYLNLCCSAIIFPFFILSYHPKPPVGTFREKLKTVDILDNFL
                     IVASTVLILMGISFGITGSSWKTASAISCLVIGGILLIAFCEYNFKFSKYPVLPSNIV
                     FNKKIFASFIVITFNYSAMMVALQFISIYFANVIGHNAFHTGLSLIPCAVSSCVSSIG
                     SGILIQKLRIIKPFSLLAGLLLPAAAGLLMLMKQKDNLGRDIGFQILLGVSTGLNMQG
                     PIMSGLINAPKTPGTNILMTAYFIFGRSMTALFLEIAEEIYTATLTSGIAKISPMIQG
                     SEYAISEVIVRSDLLDKLNEHDRSLVAGKILESCHDVFWLCFALAIVALIATLFMSNK
                     KLPKSEDVEA"
     gene            complement(<46908..>48557)
                     /gene="LAC12_3"
                     /locus_tag="FOA43_003231"
                     /db_xref="GeneID:62196631"
     mRNA            complement(<46908..>48557)
                     /gene="LAC12_3"
                     /locus_tag="FOA43_003231"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_038923485.1"
                     /db_xref="GeneID:62196631"
     CDS             complement(46908..48557)
                     /gene="LAC12_3"
                     /locus_tag="FOA43_003231"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_038779413.1"
                     /db_xref="GeneID:62196631"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSETINSQEATLEREETSNSRPLEKLNEDVPENMDNIELPPAFS
                     RQYLPLYGMCLVVYLVSTMQGYDGSLMGSIYTMKDYLAYYNLDVNSSTSTGLVFSIYN
                     VGQITGAFFVWLMDWKGRKIAIWIGCLGAVIGAIITAATTNKEGLIGGRWFLSFFTTI
                     ANTAAPSYCVEVSPPHIRGKVAGLYNTLWYCGSILAAFTTYGTNKNMIGSDKSFKIPL
                     YVQVCFPGIVVLLAWFLPESPRWLVGVGRYDEARKFLVKYHCNGDENNPLVDLEMAEM
                     EESFKDVKLSDPLTAMDIRPLFRNRSDRYRLGLVVAMAWFGQFSGNNVCSYYLPTMLT
                     KVGMTSVSTNVLMNGVYSIVSWISSILGSFAHDKVGRRKMFMISTLGSALALTGLAIC
                     TARYEATQSDGASKGTLVFIYFFGVIFSFAFTPMQPIYPGEVSSNLIRGKAQFVLSIV
                     AGVAQFVNQFASPKAMENIRYWFYVFYAFFDVFEFIIIYFFFVETRGKTLEELEYVFE
                     APNPRKASTDPEFLKDIRLANGFEAENMRTSEPKATVEQSE"
     gene            <49849..>52917
                     /gene="LAC4_3"
                     /locus_tag="FOA43_003232"
                     /db_xref="GeneID:62196632"
     mRNA            <49849..>52917
                     /gene="LAC4_3"
                     /locus_tag="FOA43_003232"
                     /product="Beta-galactosidase (Lactase)"
                     /transcript_id="XM_038923486.1"
                     /db_xref="GeneID:62196632"
     CDS             49849..52917
                     /gene="LAC4_3"
                     /locus_tag="FOA43_003232"
                     /note="CAZy:GH2"
                     /codon_start=1
                     /product="Beta-galactosidase (Lactase)"
                     /protein_id="XP_038779414.1"
                     /db_xref="GeneID:62196632"
                     /db_xref="InterPro:IPR004199"
                     /db_xref="InterPro:IPR006101"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006103"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR023230"
                     /db_xref="InterPro:IPR036156"
                     /db_xref="PFAM:PF00703"
                     /db_xref="PFAM:PF02836"
                     /db_xref="PFAM:PF02837"
                     /db_xref="PFAM:PF02929"
                     /db_xref="PFAM:PF16353"
                     /translation="MTTELVPSYLKDPKVVSENRLPTRAYTYDPEIFQSLNGEWSFKL
                     FDSPILSPDLTKLRDSDFDSWSSIAVPSHWQLQSNGKYGHPHYTNVQFPFQIDIPNPP
                     ILNPTGVYSRRFYISNPEEFNHRIRFEGVDNSFQVYMNQMYVGFNKGSRNGAEFDVQK
                     LLVKGQNLICVKVFQWSDSSYIEDQDQWWLSGIFRDVSLLTLPRAAHIENYKVDPRFL
                     GSSYKDARLLLDLSVVGTDYDSVKFTLYDFEDPHKSIDTEALLNDFDKPTTPAIKSVE
                     FSKEDAQKTLEISVTTPKHWTAEDPYLYKYALELIRVDGTSVHTVHNHVGFRQIELLD
                     GNIKVNGRTILFRGVNRHENHPRCGRAVPLEFVVRDLALMKSQNVNAVRTSHYPNHPR
                     VYNFFDKLGFWVIDEADLETHGVQEPYNRYNNIGAEDSDTKHLYYDPNVHFLSSNPDY
                     KTAYLDRASQLVLRDINHPSVILWSLGNEAGYGTNHQLMYKLIKKLDSSRLVHYEGDV
                     NAKTADVYSFMYPPLDLMERWRKNHTDSNGKFDKPLILCEYGHAMGNGPGNLKEYQDM
                     FYSHDFYQGGFIWEWANHGIEFETISKKDGKLHKAYAYGGDFNEEINDGIFIMDGLLN
                     SEHNPTPGVVELKKTLEPVVIDLTSSEVKITNRYDFSTIDHLKFLDVDNDKVLEVTSL
                     KPGESITLDVTTKNVSAVLKRDSGVLKAGFEVAWGQLEPDLQVIEPTSETVRDEAAIL
                     ETAQLVTITSKNVVFEFNKLLGKIERLTIGDRTVSTKYDGSSITFWRPPTNNDNAKDA
                     PNWKKFNMNLVKQNVREVIVKKGTGEYLAKVIVKSRVGPPVFYYGFDVVQEYIIFPNK
                     LTLHTTLKITGDYQPKDIPRIGYEFWLGDNYDSYEWTGRGPGESYPDKKLSQRYGNYN
                     SNDVEDFVYDYPQENGNHTDTHYLKIKYKNAEKLVISEKNKTFNFKLSDEYGVEEADH
                     PCDVKHYDQYYVRLDDAIHGVGSEACGPPVLDKYRLKIQDFDFTFDLCFD"
     gene            complement(<54963..>56769)
                     /locus_tag="FOA43_003233"
                     /db_xref="GeneID:62196633"
     mRNA            complement(join(<54963..56524,56766..>56769))
                     /locus_tag="FOA43_003233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923487.1"
                     /db_xref="GeneID:62196633"
     CDS             complement(join(54963..56524,56766..56769))
                     /locus_tag="FOA43_003233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779415.1"
                     /db_xref="GeneID:62196633"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="PFAM:PF01425"
                     /translation="MQYYVSSEELPTVDQLNDVSKFLDTTDLISEENRYLTEIPVSKL
                     RNLYFSGETNVERIALAYFHRVALAQQLVNCITEVRFEEALDEAKKQDCYFRKTGDLC
                     GPLHGVIISLKDNIRVTGLSTSMGFAALAEQLEEHDSVIVKLLKDLGGIIICKSNTSS
                     GMMYSETTNELWGRTLNPYNRKYLNNGGSSGGEGAIAALGGSCFGVGSDIGGSVRHPA
                     GLNNVYSIKPSFGRIPCFGTASGQQGQESVRTVYGLLSHHLENVQYGFKAIVDSQPYR
                     LYDCSCIPLKYKPYHIAERKLIVGFLDQDGLTSATPPVLRGLGIVKKAVKDAGHYTID
                     WPATYLKEIREAIYPFYEANGFKGILKIIEKTNEPVDKMLSKWFPKARDMPVSELWQL
                     QSKRTTLAQQYLDLWNTHCDHGRIDAIIMPVSPFPACLKDGVVPLPCTAIWNGLDYSA
                     STFPVTRCEISVDGPILKTQYVSELDKKVHQTYSDNLTKFEGGPVALQVVCNRLEEEK
                     CLELTKYISSLLR"
     gene            complement(<56917..>58609)
                     /locus_tag="FOA43_003234"
                     /db_xref="GeneID:62196634"
     mRNA            complement(join(<56917..58489,58605..>58609))
                     /locus_tag="FOA43_003234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923488.1"
                     /db_xref="GeneID:62196634"
     CDS             complement(join(56917..58489,58605..58609))
                     /locus_tag="FOA43_003234"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779416.1"
                     /db_xref="GeneID:62196634"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MEMTDSDTRSKTPDLDIEVRKISEEEGVQNEDSYDDIKDENFDL
                     FKEGGLNDEIDQKESTRVARKFDYHMMWILCTLYGINYVDKAALGWAVLLNFKEDLNL
                     VGDDYSWVSAIFYFGYLGAQYPASYLLQRFPVGKVISISTLLWGVIMFGHIGCTNYAG
                     ILVCRFLLGVFEAPISGGFVLFTSLFYTRKEQVTRTMFWGSMQGIFYVIFSFISYGLG
                     FAHNSHLSEWQMVYLVLGLCSITVACIWLVMIPDSPKNARFLNKEEKIIAIKRVSQNM
                     MGTKTSDWKYSQMWECTLDPKTWFLVAFIVLSMIPNGGLTNFGTLVLSDIVHNRVQSI
                     AISVGSSFFSSGQMLIYSYFASRHNNLRTIGMSCPLLLAIAGLSAVYATEDHGAKWGR
                     VFAYWMINSYAVVWPFTLSIIGSNYAGHTKRATMSMYLLIFFSVGNIIGPFCFISADA
                     PKYTKALATNLGCFCACFAIAVCFRLYLVWENKKRDAKYGVVQLEDVKNEERHEGVLN
                     GMKDLTDIQNKDFRYVL"
     gene            complement(<59779..>60621)
                     /locus_tag="FOA43_003235"
                     /db_xref="GeneID:62196635"
     mRNA            complement(<59779..>60621)
                     /locus_tag="FOA43_003235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923489.1"
                     /db_xref="GeneID:62196635"
     CDS             complement(59779..60621)
                     /locus_tag="FOA43_003235"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779417.1"
                     /db_xref="GeneID:62196635"
                     /translation="MVHAHFRIPYPGERNATNWDTQTTGPCGGDNSVVLPRYKWNPEG
                     SPMDLYIEHNKSVASIYFCPGDDCSTDNDFSVLLYKPWQMEAAANFCIPALTLPSKYD
                     IANQTGTLQVIFAGNSKKEGEYTYMYNCVDIVVDEEGPVYNGSQCSNTTDVDMYFQSD
                     IDNEIASTRFDNISTFTILDAMFSKTMNMSSTTADEMAGMSGMSGMSGMSGMSGMSDM
                     SDMSGMSDMASTADMSGMSGMSSTATTSGTSSSSSSSSDGAGRAFIVDSGILAFATFL
                     LAVI"
     gene            61739..61811
                     /locus_tag="FOA43_003236"
                     /db_xref="GeneID:62196636"
     tRNA            61739..61811
                     /locus_tag="FOA43_003236"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:62196636"
     gene            <61954..>64374
                     /gene="ERB1"
                     /locus_tag="FOA43_003237"
                     /db_xref="GeneID:62196637"
     mRNA            <61954..>64374
                     /gene="ERB1"
                     /locus_tag="FOA43_003237"
                     /product="Ribosome biogenesis protein erb1"
                     /transcript_id="XM_038923490.1"
                     /db_xref="GeneID:62196637"
     CDS             61954..64374
                     /gene="ERB1"
                     /locus_tag="FOA43_003237"
                     /note="BUSCO:EOG09340LUQ"
                     /codon_start=1
                     /product="Ribosome biogenesis protein erb1"
                     /protein_id="XP_038779418.1"
                     /db_xref="GeneID:62196637"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR028598"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08145"
                     /translation="MTSRKRNHREDEVEEEEEEEEEFEVNGLIDADESGSESEVEKKN
                     EDKDFDDDEKNAPESDDSDAELDRLLREEDEEEKESEDGNSSDFEDAVEDTRSITDKL
                     SGMKLRTLSSGSLNSIGERKGKWADGNSRILKPDIEPVYDSDDSDGEQYNTVGNIPLS
                     IYDEYPHIGYDINGKRIMRPAKGSALEQLLESIDIPEGWTGLLDKNSGKALNLTEEEL
                     ELIQKIEKNENPNDRIDPYAPTIEWFTSEVEVMPLMATPEPKRRFVPSKHEAKRIMKI
                     VKAIREGRIVPPSQKIKQEEEEAEMDYDLWEGVDDEISKDHIMTLRAPKLAPPTNEES
                     YNPPEEYLPTEAEKKQWEETDPIDRERGFLPEKYGALRKVPGYSEAIRERFERCLDLY
                     LAPRVRKNKLNIDPESLIPQLPSPKDLRPFPIRTSTIYEGHTGRIRALAIDPSGNWLA
                     TGSDDGTVRIWEVLTGREVFKIIIIEDVKENSEDHIEALAWNPLSDIRLLAIACGSSV
                     YLVVPPIFGYQLENMSKLKIENGWGYAKTGSDKTKMDVNEEDNDKVATKAEAAKWLKP
                     TVSQSARDIACVIVTSRGSGSTSSSAIKKISWHHRGDYFVSVSPEGGNKASVLIHQLS
                     KHASQSPFRKSKGIIMDAQFHPTKPSLVVMSQRYIRIYDLQQQKLEKKLLPGARWLSC
                     MDIHPRGGDHIIAGSYDKRVLWHDLDLSNTPYKTLRYHEKAVRSVSFHKGGLPLFCSA
                     SDDGSIHVFHATIYDDLMSNPLLVPLKKLTGHKVINSLGVLDVCWHPKEAWLFSAGAD
                     STARLWTS"
     gene            <64639..>65304
                     /locus_tag="FOA43_003238"
                     /db_xref="GeneID:62196638"
     mRNA            <64639..>65304
                     /locus_tag="FOA43_003238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923491.1"
                     /db_xref="GeneID:62196638"
     CDS             64639..65304
                     /locus_tag="FOA43_003238"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779419.1"
                     /db_xref="GeneID:62196638"
                     /translation="MKFFSTILSLTIVATAARVANAEADPLAFAKAQGVAIADDDSAS
                     YDCHSNCGYAILAARKCSPDGNSDSDYNSTCLCEDSETFLSLAPQCLDCGWCLWSDYA
                     EYLTSAFSECGFSTQPTGTDCAAEKTSYIEEYGTAAVTNSNTTAASYYASQYADSSYS
                     ANSTSITETSFSNSTEETTVATSAISTESSSSSSSSSSAIAATNYMTSLGPIALAISI
                     LLM"
     gene            complement(<65339..>65740)
                     /locus_tag="FOA43_003239"
                     /db_xref="GeneID:62196639"
     mRNA            complement(join(<65339..65643,65734..>65740))
                     /locus_tag="FOA43_003239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923492.1"
                     /db_xref="GeneID:62196639"
     CDS             complement(join(65339..65643,65734..65740))
                     /locus_tag="FOA43_003239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779420.1"
                     /db_xref="GeneID:62196639"
                     /translation="MSPQGATAFLLTKITDPPPILSNTKMAGRANGVEDDMAAEPSNR
                     FLSPSSSSARLVDLKILTSWLDEQSEWSKDYYEGLDEIFDDLDYVIPGTFINKPSTVF
                     Y"
     gene            complement(<66783..>67316)
                     /locus_tag="FOA43_003240"
                     /db_xref="GeneID:62196640"
     mRNA            complement(<66783..>67316)
                     /locus_tag="FOA43_003240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923493.1"
                     /db_xref="GeneID:62196640"
     CDS             complement(66783..67316)
                     /locus_tag="FOA43_003240"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779421.1"
                     /db_xref="GeneID:62196640"
                     /db_xref="InterPro:IPR020915"
                     /db_xref="PFAM:PF11578"
                     /translation="MSTIPDLSKPNQATLKPIIFIDEIAKEPITAYSNESALMQHVPL
                     TGGFVKSLDPENFPFDAVIEEGGDDITLREGIPNIGHLDCNLYLRFKDDPTKRAYINY
                     SGIVHLDGTSGEIIGKKKTGMSFQEGYVTCHPQFYVSEDCKAERWVDRKNFLGKGRFL
                     RDDNGVLKVQYWLYILE"
     gene            <68161..>69219
                     /locus_tag="FOA43_003241"
                     /db_xref="GeneID:62196641"
     mRNA            <68161..>69219
                     /locus_tag="FOA43_003241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923494.1"
                     /db_xref="GeneID:62196641"
     CDS             68161..69219
                     /locus_tag="FOA43_003241"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779422.1"
                     /db_xref="GeneID:62196641"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MSSPSSEALSQCHDAIMLSAMTFPEQFRVKPERSTIPGTASSSS
                     SSSFPTLLQCTLAGAIGGVVGDTSMHSLDTVKTRQQAAPHIAKYRNTLNAYLTILKEE
                     GFARGLYSGYSAAMMGSLPSSAVFFFAYESVKRVAIEDFGFNDTASYLGAGFVGDLVS
                     SVFYVPSEVLKTRLQLQGRYNNPYYNSGYNYRGLFDAANTIVRTEGWKTLFFGYRATL
                     FRDLPFSALQFTFYENFRNWAFTLSARKKNDDPLPTSLEMLTGAAAGGLSGILTTPCD
                     VVKTRMQTQNVSSGNVLLKSNSLIKNLLTIYKSQGVAGLFNGVGPRFVWTSAQSSIML
                     LLYQLCLRTLSSDDITFE"
     gene            complement(<69343..>71526)
                     /locus_tag="FOA43_003242"
                     /db_xref="GeneID:62196642"
     mRNA            complement(<69343..>71526)
                     /locus_tag="FOA43_003242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923495.1"
                     /db_xref="GeneID:62196642"
     CDS             complement(69343..71526)
                     /locus_tag="FOA43_003242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779423.1"
                     /db_xref="GeneID:62196642"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR032189"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="PFAM:PF01119"
                     /db_xref="PFAM:PF02518"
                     /db_xref="PFAM:PF13589"
                     /db_xref="PFAM:PF16413"
                     /translation="MPPRIKPLDKNVVNRIAAGEIIIAPSNALKEIVENSIDAHSSAI
                     EISVKDGGVKLLQITDDGGGINKEDLPLLCERFTTSKLRKFEDLETISTYGFRGEALA
                     SISHISHLSVVTKTAADQCAWKCYYLDGKLVPPPTGGSSEPRPIAGKCGTSIIVEDLF
                     YNVPSRLRTLRSYGEEYAKIVEIVSRYAIHTENVGFSCKKQGSSSTDLVIRAGMSRKD
                     RIRSIFGSSVANELIDVELEPNSDIGLVKCSAYVTNSNYSNRKSIKPIFFINNRLVVC
                     EPLRRAMNQVYSTYLPKGHKPFIYLALEIVPGNVDVNVHPTKREVRFLNEEEIVQSIV
                     DAVEGKLSSLDSSRTFLTQQVITQSQRVEERLKRQPLDEESDTTHKRRSTASISSIKQ
                     FKRPYEKDMVRTDFSQATLEEYVSSQAVVGASEEVPRSNHVIDSSIEGRVIENHDDAD
                     ADDVISDHVTLSDNEVTNSSNTSSLPAVVKLSSVNELRKEVESQLNVELTALFSKHTF
                     IGVADYSRRLLCLQYGVKLFLVDYASVCNEFFYQVGLSDFGNFGRIRFSKPVDIRMLV
                     KEEIYEDEQLMKRYPGAPDLDGLIQSVYVEMAEMLEEYFCMKVDVSDAENPKLLTIPM
                     LVKGYIPSFNKLSLFLFKVGACVDWEDEKQCLGGILRQLALFYVPEPLSDLEDDAESR
                     RSTSEQLENILFPLIKKRFLATENLVRDVVEIANLPGLYKVFERC"
     gene            <71687..>72559
                     /locus_tag="FOA43_003243"
                     /db_xref="GeneID:62196643"
     mRNA            <71687..>72559
                     /locus_tag="FOA43_003243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923496.1"
                     /db_xref="GeneID:62196643"
     CDS             71687..72559
                     /locus_tag="FOA43_003243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779424.1"
                     /db_xref="GeneID:62196643"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR037143"
                     /db_xref="PFAM:PF01648"
                     /translation="MSLADSFHSLIDDTPIFCFYINLNGSLNILLDEYNFEMCSRLLP
                     LDKQIRIRQIRSAKDRALKLLNSILVQYIVSLYERDYKQLTKLKISYGEFGKPFLLSR
                     DYAYNIADEDGITSLCICFQTKLPIGLDLSNPKDIDRFALSDLRDFYRSEFSDIFSQK
                     EQTDLKMAFARSDGSRETQLEILCQYWAFKESMAKYEGFGLHRGLQVYQFDSPRTLEQ
                     LTDVGGVDNSSPFKAVAKLELSEIAPHVYNTCFTLPNSNIIGSIIAKYPSVKIIKLDL
                     GKMVAFINKETVWE"
     gene            complement(<72589..>72954)
                     /locus_tag="FOA43_003244"
                     /db_xref="GeneID:62196644"
     mRNA            complement(join(<72589..72903,72952..>72954))
                     /locus_tag="FOA43_003244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923497.1"
                     /db_xref="GeneID:62196644"
     CDS             complement(join(72589..72903,72952..72954))
                     /locus_tag="FOA43_003244"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779425.1"
                     /db_xref="GeneID:62196644"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="PFAM:PF03647"
                     /translation="MDHPTWALGTISLAGGIAGYARKGSLPSLIAGTAISTLYFGAGY
                     LLHNNREYGIHTALLASSLTLFAGISRAFKSSIKKPVPLTLTTIGAVATAFYAKKYSE
                     FYM"
     gene            <73161..>74150
                     /locus_tag="FOA43_003245"
                     /db_xref="GeneID:62196645"
     mRNA            <73161..>74150
                     /locus_tag="FOA43_003245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923498.1"
                     /db_xref="GeneID:62196645"
     CDS             73161..74150
                     /locus_tag="FOA43_003245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779426.1"
                     /db_xref="GeneID:62196645"
                     /db_xref="InterPro:IPR010585"
                     /db_xref="PFAM:PF06632"
                     /translation="MITRLIFVENKFDSINYSANCYTKIKLSRISPLVEIEENKHLDQ
                     VVINELAISIDILCEKAGEIDEGSAPIQQFRGEFDGLRTLQYDKEMDTNKWLHWCLEL
                     LIVGSLDSEVQYEISPGNQKNMGLYFRVRKKIEGIFVVVLEILLDRVSIDEESMDIMG
                     DLYEKWQSELKYKVKVKRLEQENVRLRRDFDESEKSKELFVETNQKIRRNVEQVFIPV
                     LNEQKQVIRDLKKQLGQLPDLNFSSIHRRQLINYQEPNKEVEFEFDENKRDEYRREIE
                     KVSPRKKRAKKETSHADDNSTDKDSDNDDDEPQWKRRKERLSGSSDETQADTE"
     gene            <75330..>76271
                     /locus_tag="FOA43_003246"
                     /db_xref="GeneID:62196646"
     mRNA            <75330..>76271
                     /locus_tag="FOA43_003246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923499.1"
                     /db_xref="GeneID:62196646"
     CDS             75330..76271
                     /locus_tag="FOA43_003246"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779427.1"
                     /db_xref="GeneID:62196646"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MVITVPWFRKKNRQLRNHYTFPKKYGTKKRLVNKGSTAKVYMYQ
                     KDAQTYAIKLFNPREPHETRQLYMETIEHEMLIHRKLRLNNNGRFVVDLLEVFTINRD
                     NVYYVMEYLPFNLERIYNRFGYMMEREIRLCYFRQLVQALQFLQSRDISHRDIKPQNC
                     CIDYEGRLKLVDFGSSIRGQYAVGLAGSRKYAAAEVYRGQRYDSFKADVWSLGVCLVL
                     LYYCSDCRWKMARDDSFYEAYCRHRSLDMVVKVPGNVELSQIYDHDSVDRTILSLLDP
                     DPQLRPELATLQLEHWFQAIPDHSQPDHCINHKKYLC"
     gene            <76317..>78393
                     /locus_tag="FOA43_003247"
                     /db_xref="GeneID:62196647"
     mRNA            join(<76317..76320,76466..>78393)
                     /locus_tag="FOA43_003247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923500.1"
                     /db_xref="GeneID:62196647"
     CDS             join(76317..76320,76466..78393)
                     /locus_tag="FOA43_003247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779428.1"
                     /db_xref="GeneID:62196647"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR031160"
                     /db_xref="PFAM:PF00611"
                     /db_xref="PFAM:PF00620"
                     /translation="MHTSTIPSSPQLLEEPLVKEILISDSSFEILLYRLKQSIKSCDE
                     FANYIRKKHSYEQDHARDIRKTTSTCKSSIRSSGLTTKGSFAQSLRDVIAYDDRLVTD
                     VRTPYIKALDTMYGELCSLSQNFTRLRKQLKEEGNRREKEVIDAINQAEKSKNKYQSI
                     CSDLEKLRNSDQSQKKITLQGRKTGSQQEEELTRKLHIADTDYNKKAHYSQKCKNELV
                     EVHRPQISYKIKDLVLELDHALQLQLSKYAVYNESLIIGIGNQISPIAHSHTSMQETA
                     SSVDVEKSLYNYLKNSKVKHKSSFIPVNYERHSVFGGLTPDGSFAKIPQSGQIIGASI
                     GAPISAPISAPIGASGLQYSVPPAPVYRTTDPRAISQSSMQSNPNLTGPRPLPPVGAE
                     PVIGATIGTDESASNGPTTTSTPSGISVPIQSSYRQFPTLDVESQSTDGALFGVPIDK
                     VAHDDEMVPLFAKRCIELLEKYGADSEGIYRSSPNKAKLEELKEIVDKNPEDFSVLDP
                     PDPSSITNDYVFVIASLLKKFFSMLPEPLLTLEQSGNFLKAAQIEDIKTMHLQLHRIV
                     FELPDANYFTLRDLLFHFIRLSQIPKVRMGVRNLAIVWSNNLFAPGSATTTEDLQLQQ
                     RVVEELINAAPDIFNPVDD"
     gene            <78651..>81194
                     /locus_tag="FOA43_003248"
                     /db_xref="GeneID:62196648"
     mRNA            <78651..>81194
                     /locus_tag="FOA43_003248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923501.1"
                     /db_xref="GeneID:62196648"
     CDS             78651..81194
                     /locus_tag="FOA43_003248"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779429.1"
                     /db_xref="GeneID:62196648"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="InterPro:IPR036317"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00888"
                     /translation="MNSEFDILLDDSNVTQFGFPSFPLSSSSDHSYGYEPSVVNGKRD
                     LVHTNSARPRKRRITDSSEGESSEEVQSRLKYFEGAKALLPQAFEEIIRGKTTSQLQR
                     SLVELQHLCQSMAEDEEFIHSLCLKGNEIFDDELLSSFQDKLISTEDDPMTAFVEMYS
                     DWYLRVQRLQQVFLILDNSRVFRRSYLERPLIAYWMLKFSAGIIESRQRNPADITLFD
                     MEESRTRNNILLGLCDLLKELLQSPPYIFESPKGVIFDRFLTIMQDLRIFHSQVDSSN
                     DTVLIATLSLCFKKAASDLRDNWLSLAAEDYLGHCENAYNQIVIIIDMLGSRLGDKFT
                     HEINLFGESAMSILIKSEQVQTRILTILFPDFLNNHAPCAFLYKVYSVNVWDIVPLVE
                     LFCESVSTYLHGWLQEQMLSCQKASKDKSYSIIESLIEYIRSVSAAIEIAFKGEQRFI
                     FHFSTTCEKTVADIDHCDEFIAESLVHYIFGRMSADSSDKTISSQDQELWSYIMKILV
                     MIPDKKRMFLSRYKMLLSRRLLHSSFITPYSNTNDEPACLWREKRLLEMLQENFGVDY
                     TESLNKMIGDLSHSNKVLYQFRRKVHTPVKLSFCCLNSSNWRPPPGNRRVNIPDCLRG
                     IADKYEAMLSQENPVIFDWKFYLHRVTIAITFDVSDPSSCQTVQCSIYQAAILLAFEG
                     IDILDKVSLLTTTGMEENFLDANLKYLTDGSYKVMLQTDNNYMINDSFKCDKKIVKLS
                     TNISSSVQSTTEIPVAVRTGTERDPVEMLTARLRAFMMRTLKNLGPRKHERLTAEVLE
                     SLSKDRVDFEEILKNSGRSFTTLIKETVEQLIGEEFIRRDDTDGYKYIP"
     gene            complement(81271..81341)
                     /locus_tag="FOA43_003249"
                     /db_xref="GeneID:62196649"
     tRNA            complement(81271..81341)
                     /locus_tag="FOA43_003249"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:62196649"
     gene            <82649..>84335
                     /locus_tag="FOA43_003250"
                     /db_xref="GeneID:62196650"
     mRNA            join(<82649..83357,83407..>84335)
                     /locus_tag="FOA43_003250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923502.1"
                     /db_xref="GeneID:62196650"
     CDS             join(82649..83357,83407..84335)
                     /locus_tag="FOA43_003250"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779430.1"
                     /db_xref="GeneID:62196650"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MSLSEGIKSTQSVVSVDEVPVKSIISGSNCKILVDHLVDKDETV
                     VLALGYKQEFKRDFSLWTTFGVAFSVLGLLPSIASTLFYSLAVAGNAGITWGFLLGVI
                     GIVPVALNLAEIASAYPVAGGIYYATAMLSPPKYKAILSWIAGWSNYFYQVTGAPSVG
                     YGCASMILALAAVANPHYQYQTWHCYLLTVAITFVCSIIASLPTKWIAYINMGSSILN
                     IGFLFISWIFMLCGNNREDNLTDWPDGMAVLLSFMAVLWTLCGFDSPFHIAEECSNAQ
                     VATPRAVVMTATIGGGLGFVFQLAIAYTIVDIDNAVNDELGQPYIAYLNQIMSKPRVL
                     AIGSFAAILAFSMTFSCMIAASRVLFSYSRDNCFPLSRYWCKVNKYTKTPVNAVWANW
                     VIGVLLLLLMFGGVAIDAIFSVGSIAPFISFCIPILLRITYARHTFKPGPWNLGRWTY
                     LSGYIGCLFVLLMIPISVFPDYKGADNTMDMMNWTCVVYYGSMLLAIAWYYAYAHKTY
                     KGPKSNITGDIIIGNDVDEIVEKVSMNKDFEAEKKIK"
     gene            85300..85370
                     /locus_tag="FOA43_003251"
                     /db_xref="GeneID:62196651"
     tRNA            85300..85370
                     /locus_tag="FOA43_003251"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:62196651"
     gene            <85729..>86724
                     /locus_tag="FOA43_003252"
                     /db_xref="GeneID:62196652"
     mRNA            <85729..>86724
                     /locus_tag="FOA43_003252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923503.1"
                     /db_xref="GeneID:62196652"
     CDS             85729..86724
                     /locus_tag="FOA43_003252"
                     /note="BUSCO:EOG09340CKN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779431.1"
                     /db_xref="GeneID:62196652"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="PFAM:PF02137"
                     /translation="MATGVKAISSRKIEQTSHGRIVHDMHAEVLSLRIFNFFLLKDVE
                     EMTRMNERQGRLLEMTDNDRYKLKDKTMELAMYVTDIPCGDASIDNVREEMDDDKKEN
                     WKESSSEIEDNLRGRAFFGAVGKVRTKPGRIDSPISYSKSCSDKLCMKQFTGILNSTT
                     YDLIEEGEARRQMYLKYLVLPEKRIRVKGIERCFYNRFQRKLGEFQEIRDCLQPLKVI
                     TTNLSSQKFHLCLDKEKKSCDQSILYCPPLKYVQVLNKGIRNGCSAKKKPIDKQSRTD
                     VSREALMDRLKSTKEVNSSTYLQFKMNIRNLRAIRIKVKQLLGNWTKSSTDNFPI"
     gene            complement(<86758..>87315)
                     /locus_tag="FOA43_003253"
                     /db_xref="GeneID:62196653"
     mRNA            complement(<86758..>87315)
                     /locus_tag="FOA43_003253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923504.1"
                     /db_xref="GeneID:62196653"
     CDS             complement(86758..87315)
                     /locus_tag="FOA43_003253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779432.1"
                     /db_xref="GeneID:62196653"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /translation="MSDDAIRGASSEEQIIEAARRNNMDLFNSVEADYRDKPQEFIGV
                     INEARDATGDSALHLCCKYGCYEVMDVILDFQGINLEPKNPMTGDTPMHYAAYYSFQE
                     PDYALFLIEQLIEIGADPTVKNNDGLKPVDIVGGSNEKLKKALQSAEYAMSAQLAIEI
                     VDDEGEDDKEEEEDNKEDEALEQSK"
     gene            <87629..>90241
                     /gene="ARG5,6"
                     /locus_tag="FOA43_003254"
                     /db_xref="GeneID:62196654"
     mRNA            <87629..>90241
                     /gene="ARG5,6"
                     /locus_tag="FOA43_003254"
                     /product="Protein arg5,6, mitochondrial"
                     /transcript_id="XM_038923505.1"
                     /db_xref="GeneID:62196654"
     CDS             87629..90241
                     /gene="ARG5,6"
                     /locus_tag="FOA43_003254"
                     /note="BUSCO:EOG09342EZG"
                     /codon_start=1
                     /product="Protein arg5,6, mitochondrial"
                     /protein_id="XP_038779433.1"
                     /db_xref="GeneID:62196654"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="InterPro:IPR036393"
                     /db_xref="PFAM:PF00696"
                     /db_xref="PFAM:PF01118"
                     /db_xref="PFAM:PF02774"
                     /db_xref="PFAM:PF04768"
                     /translation="MISDTVLRNILARRTIGAVASRAFKPVMISSTSFSCKASASVRV
                     YSTRSTVIQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIITQQLPQLASCLAF
                     LYHLGLYPIVVHGTGPQINEILEGQGIEPDYSDGIRITDEKTMAVVRRCFLQQNLKLV
                     TALEKMGVRARPITGGVFQADYLDKEKYKLVGDITGVNKAPIEASIEAGSLPILTSMA
                     ETPSGQLLNVNADVAAGEIARVFEPLKIVYLNEKGGIINGSTKEKISVINLDEEYEDL
                     LQQSWVKYGTKLKLKEIRDLLMYLPRSSSVAIINVDDLQKELFTDSGAGTLIRRGYKL
                     VTRKSVKEFGQPDLLRSALERDPDVASGKSSVASYLTEMEKSNFKAYGDEPMDVLAIV
                     KQDNQFCNTVPCLDKFLASKAGWLNNVTDNIFNAIHNDYPSLYWIVREDDPYTAWHFN
                     KADGSYTKDGEILYWYGCNNLGEISKLIDSFSKRGTLNGESGVFSGKQTRSYSTICGS
                     TGLRVMGCGFHSQFRRGLSGIARAKANPPIRKGTNHSKARVALIGARGYTGKNLISMI
                     DEHPYLELAHVSSRELNGQKLKGYTKSEIIYENLQVEDIQRLEKNDEVDIWVMALPNG
                     VCGPFVKAIEEASGSGKSKIIDLSADYRFDKTGQWVYGLPELNDRLVISKARKISNPG
                     CYATASQIAISPIIDYIGGTPSIFGVSGYSGSGTKPSKKNDINFLRNNLVPYSLTDHT
                     HEREISYRLGRQVAFMPHVGQWFQGITLTINIPLREKLSSRDIRSMYQERYEDEQLIT
                     VTGEAPYVKDISGKHGCVVGAFDVNTAQNRLVVVATIDNLLKGAATQCLQNINLAMSY
                     DEYAGIPDDLVIRG"
     gene            <90532..>91551
                     /locus_tag="FOA43_003255"
                     /db_xref="GeneID:62196655"
     mRNA            <90532..>91551
                     /locus_tag="FOA43_003255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923506.1"
                     /db_xref="GeneID:62196655"
     CDS             90532..91551
                     /locus_tag="FOA43_003255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779434.1"
                     /db_xref="GeneID:62196655"
                     /db_xref="InterPro:IPR029427"
                     /db_xref="PFAM:PF14877"
                     /translation="MFGAPLARLVKEGCAYMTQSTIHLSPSFCGANKLRGACFYSKSL
                     RGHKGKKRNMHGKKREELFRNGTTRDKEAAQVIIGKARRMNGQGLVKVIKDGEDKGVV
                     SVFECCKELDLDKEGMMIVSKLRKQLGGSQEELVPVIRIVGQQQARKAYSDYLSEQVT
                     RRLKVSNPGLIRKQERGKNNNEENGIAGESGDYKVVRVSWQITSNDLQGQKRHEIESQ
                     IKKGENVRIVFDDKNNFDRTHGRRRGNEEELNEMETTKRGKVVKFVEKLIEEELETSY
                     EEEGTVQDKLIFKVKPLQMHSLSKEEKKRMKDTKKTERQEKLRIKTERKREREMEQLK
                     ILSVD"
     gene            complement(<91625..>92221)
                     /locus_tag="FOA43_003256"
                     /db_xref="GeneID:62196656"
     mRNA            complement(<91625..>92221)
                     /locus_tag="FOA43_003256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923507.1"
                     /db_xref="GeneID:62196656"
     CDS             complement(91625..92221)
                     /locus_tag="FOA43_003256"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779435.1"
                     /db_xref="GeneID:62196656"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="InterPro:IPR034751"
                     /db_xref="PFAM:PF03226"
                     /translation="MGLRYTTCLDPNDMGSELNENLIYKTSKLSALQSYYEYSYSDED
                     GEDGDIDGDGDGDGDEDDDEVSNTNSNGSRYSSFRISRLNPFFRMHQKYNDNGRAITY
                     ACSHCLTHVSASNLIISDRYHGATGDALLIYDAVNIQLGPSQMRRMTTGVYTVCELLC
                     RQCGKYLGWKYIKSSDPTQKFKEGRYILEVDLVKEVKS"
     gene            <93046..>94089
                     /locus_tag="FOA43_003257"
                     /db_xref="GeneID:62196657"
     mRNA            <93046..>94089
                     /locus_tag="FOA43_003257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923508.1"
                     /db_xref="GeneID:62196657"
     CDS             93046..94089
                     /locus_tag="FOA43_003257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779436.1"
                     /db_xref="GeneID:62196657"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MFQVDIMKDTSSHHTCPKQRDGVSAPSNSTDDVKIQIDYEALPR
                     NSPIFAQLTAGAFAGILEHTVMYPVDAVKTRMQTAHLQSSEGLIQAFSRISSSEGISG
                     LWRGISSVILGAGPAHAVYYLVFESTKTALCKHFDQSNGHIHMKNTLITDEKHPLIAS
                     ASGIAATTTSDALMTPFDVVKQRMQILQQVHPANVTATTNHPPTSAFQVASQMYRNQG
                     IRPFYISYPTTLVMNIPFAAINFGVYEYASSKVNPGQIYNPLLHCVSGGLSGAVAAAV
                     TTPLDCIKTALQTESVPNATGFFSAAKSLFQKEGPRAFFRGIKPRVVFNVPSTAISWT
                     AYEMAKAYLLPGH"
     gene            <94681..>97074
                     /locus_tag="FOA43_003258"
                     /db_xref="GeneID:62196658"
     mRNA            <94681..>97074
                     /locus_tag="FOA43_003258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923509.1"
                     /db_xref="GeneID:62196658"
     CDS             94681..97074
                     /locus_tag="FOA43_003258"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779437.1"
                     /db_xref="GeneID:62196658"
                     /db_xref="InterPro:IPR021102"
                     /db_xref="PFAM:PF12222"
                     /translation="MKGSLAREWSLWNQLQQGYSKFTPEESEQEKELNPIELDADETV
                     TFDEKHPLTYVHKDPPSTSDRHFKKFIKAVFILEFIGSLFALFGLLRTKTTFITPGSH
                     QFSGDQTVIGTYGNDSKPVPHEFIEIPVLPALEYGSPVYQQSLLNATFENSWGHPAII
                     KYSPPPQGANFSQVVLTLDLWVDGVQFDRLFHVYIGGSEIWRSSTPEPAGKYSHTFSQ
                     KDVSVYHRLFRKDTKLMVQLDNLINSRLTGTFNISLNAFYYNNPRNASLIPHKHIEES
                     ETEPAQESDFFTNDVGDVVIPGLGDSVFYREEGASHVIPLVEAPDGRPPLIYYPDTDF
                     KLSLPKLAKNTTKVKLMVYSSGNAGEEFWFSNLMEEFKDRFKNHGHTFGGHGPCRVIN
                     IYHDDVRIATANPLPVIFTGGLSPALWNPVVSTGSYDIKAIEFDITTILPYLWEDSIQ
                     LKIDVSNCLDDDLKLGEEPSGISSNWISSANLAVWENEYIADSSGEILSIDNTTKVSS
                     FAFEPPFAGVLNQIVNAKFTNQIRTHFNYTLLNGTSIDFISENYKKVKQSNIQLVKSF
                     GDKQKVISVPQSKASFAILDPLDNSTSFTFNTSKSFPLVFSLNTKPIVGSETEYQVNI
                     TKKASYKIGVNGTKILQLKAKENGTSNFTLSPNGNHGVGRVEHNYTVSNIHGHVYNRH
                     ALGDNGVLVYDNTTIINAPGTKRLEEVELDTSKLYSTSDRVAKLMKGLGAEAFDKLGF
                     IEEDDPEFIQADTEALETFIEMTQQMLEENDGADEDLELSGTYNDGMGLFRPVLFDY"
     gene            complement(<97180..>98328)
                     /locus_tag="FOA43_003259"
                     /db_xref="GeneID:62196659"
     mRNA            complement(<97180..>98328)
                     /locus_tag="FOA43_003259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923510.1"
                     /db_xref="GeneID:62196659"
     CDS             complement(97180..98328)
                     /locus_tag="FOA43_003259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779438.1"
                     /db_xref="GeneID:62196659"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="PFAM:PF02116"
                     /translation="MNEASVSSIPLTYESAYGSSEITFKILDSYVNELLIFGIVFGVR
                     IGMACICLPVTFLITKNKKSPIFVLNMACLVALFIHSIMYVCSLTDWYNTLAYEYSGY
                     LLFSGYASQLTAATNTVYTVLIALVEISFGYQVFVLFRSPKKRIQYTGYLITLVSVLL
                     GLATVVLYFIYMVVANKVAFDNTLSIPKWLVNTPSICFTASSCVTSLLLVCKLAVAIR
                     TRKTLGLKQFGIFHILFIMSFQTMIVPTIIILVSYNKNGSQNAPHALTAIGTALVAIS
                     LPMTTMWANSILDSSVPTSAANTYLKTISDTSYRSYGSSSTPTSTGAFTYENEKEDFN
                     NTALTSPQTLRNKDQGEDTKFWRQIEMYADELDPRDLENGVDEKQQAK"
     gene            complement(<98623..>101292)
                     /locus_tag="FOA43_003260"
                     /db_xref="GeneID:62196660"
     mRNA            complement(join(<98623..101012,101289..>101292))
                     /locus_tag="FOA43_003260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923511.1"
                     /db_xref="GeneID:62196660"
     CDS             complement(join(98623..101012,101289..101292))
                     /locus_tag="FOA43_003260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779439.1"
                     /db_xref="GeneID:62196660"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="InterPro:IPR037198"
                     /db_xref="PFAM:PF01119"
                     /db_xref="PFAM:PF08676"
                     /db_xref="PFAM:PF13589"
                     /translation="MTMPIQRIDYGDVHKITSGQVIIDLTSAVKEVVENALDAESTQV
                     NVIFKNYGLDSITVSDNGTGIRPEDFENICLKHYTSKLTSFEDVETVGTFGFRGEAMS
                     SLCAIAHVSIVTATKEEAPKGCSLKYNQLGVLESKELVSRSCGTSVIIDSLFHNLPVR
                     KIDLTKNIKREYHRAVDFLQCYALISTGVRLIVHHIDSRGRKSIILSTTGSINLKNNM
                     LSVFGSNGMYGLEAVDLNIKVAAKFHREQMALKVSGFVSNASFGQGRSASDRQYWYIN
                     KRPVLLPRFSKAINETYKKFNYLQYPTILLNIEVDAKFADVNVTPDKRTVLINNEAAV
                     LEAFREGFHGLFSMNGVKIPKNNGVTEKITERNKKQTTLESFSMGGRNEVVQSENREV
                     SEDESVGSSNSNDSKHIAYPEPITTSKPTDTPDSIADPEPIDDLEPIDSSRPMVDPEP
                     IDDLEPIDSSRPMVDPKSSDDLEPIDSSRPMVDPKSIDDPIESFEPIDALNECVQDTD
                     NTSTLASSSFTSKPASRVTLSKKLGNVAFSTLNVDQMVEFELPKSSTNAKRRKSLISN
                     SCMNKKQKLDDISDNNAEELLTLTVSKKDFMSMQVVGQFNLGFILVTKKNVETGKMDM
                     FIVDQHASDEKYNFERLQKETTFKNQPLVIPQKLELNAVDEMVVINSKKIFEKNGFKL
                     RINMENNPGTRVQLLALPYSKNTIFDLSDFYELINLVRKSDGNPDVRPSKVRSMFAMR
                     ACRSSIMIGRPLSKKIMTTVVQHLSGLDKPWNCPHGRPTMRHLVELQGWGAFTEDCQ"
     gene            complement(<101912..>105012)
                     /locus_tag="FOA43_003261"
                     /db_xref="GeneID:62196661"
     mRNA            complement(join(<101912..104942,105005..>105012))
                     /locus_tag="FOA43_003261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923512.1"
                     /db_xref="GeneID:62196661"
     CDS             complement(join(101912..104942,105005..105012))
                     /locus_tag="FOA43_003261"
                     /note="BUSCO:EOG093426YG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779440.1"
                     /db_xref="GeneID:62196661"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF07819"
                     /translation="MRGEQNKDPLPRNKDDDDDDENNRSLHLTGTPVLFIPGNAGSYK
                     QVRSIAAEAASVFYDQKERIKRLNSNVTSLDFFSADFNGDFTAFHGQTMMDQSEYLND
                     AVKFILSLYQDNPTPARSVILLAHSMGGIVARVMLSLPNHLEGSVNTILTLAAPHSAP
                     PATFDGKLLRVFKKTDDFWRNEFSKSGGRLENVTIVSITGGILDNMLPADYTTLTGLV
                     PETNGLAVTTTGIPGVWTPIDHLAIVWCDQLRRVVAQSLLEVTDRSMIGYSIEHRMDI
                     FRRNFVTGVSADSLASSSKTFGLKIDVNRLSHSMRERSFQFPNIRKKRDSASPGIHMF
                     HVPRDDQSHAKFSYISSLKPTPIEELSVGSAPAILLCRTVPAAAINSGKFAAVLDYTS
                     DSTSQFVQLECVDLHNSVQMIPRSYPGTASMEASSLGGSEQPFYSLELSPEYLEGFSS
                     VVIVESGIIIDSKDFVLADMELQESSQVSLGEASLWKLLSRGYDLTLPSHRPLVVDID
                     VPCARSSLLTYNFDIRYQKSSSERFSPLIRQKIGDEVKWHIDLAHNPNVVSRTMGVPP
                     FCPYKKSSHLQLKLYADTFASDQIMDIYLSVDWFKSLRNLVLRYRLSIVGLPVFVTCL
                     VLFLQLAAYIDYGYYPSFGEGLLKFCSRKIMGPLVLIFCILPSFTSHSFFKRLFGWLD
                     PIPTANEQLFQKIGGSDVRNNEYFLGIGEGALWFLGPLSLVIATSSVGTLHLIVSSIC
                     QLVVFVSKKLSFVFHGVPIYTGSVAGNRRRTIAVILLMTLVLVYLPYQFAFVVCFFTQ
                     SFVVLKSCIQSASSQAVKQNSPQKSEKVTSTALLSSSSSSSSSSTTSFSLLPPSASSL
                     SSSSTTVPCHRVLKSFDNYKNFNFSLLLLMTWILPINIPILMVWVHNFSLKWATPFSS
                     HHNFLAVLPIVLLVQLGNAGYMFSKPSWKISVIGTKLLVAYVAIYALMFSTRHLFWLH
                     HLFNLMCSWFLVLILEDRFLGKLNHYTTPDKAVTTTSKLH"
     gene            <106475..>108190
                     /locus_tag="FOA43_003262"
                     /db_xref="GeneID:62196662"
     mRNA            join(<106475..106478,106503..>108190)
                     /locus_tag="FOA43_003262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923513.1"
                     /db_xref="GeneID:62196662"
     CDS             join(106475..106478,106503..108190)
                     /locus_tag="FOA43_003262"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779441.1"
                     /db_xref="GeneID:62196662"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MEITEEIDASPNKNRQTSTSSRTYSISGSGELSSDSEIQLNLDS
                     EKFLQDEKNENPFLKPKVADYYRDIYEKTKYECRGRFDPYFVWTKKEQDKLRRKLDIR
                     VAFLACIMFVALQIDRGNLSQAVADNMLDDLGMSTNQYNTGSTIFYLCFLSAELPSQL
                     ISKKLGCDIWIPIQMVCWSLVSISQCGMRSATGFYITRALMGLLEGGFIPDEVIWLSY
                     FYTGSELSIRLSWFWTTLSLTQVFSSLLAYAIFHMRGTGGLAGWSWLFLIEGLFTLVI
                     GISSFFLMVPSAVQTKRPWNKKGYLNEREEKIVVNKILRDDPLKGTMMNRQGLTFRMF
                     FDAISDYYLWPIYLIGLVAYIPAGTLDAYLTLVLKSMGYSTFNVNLLAIPYYILKVIL
                     LLSVTWFSERVKSIFNVALLQPLWAIPLIGVLRWWNGSFYEKWPTYIILIMILATPYI
                     HAMMVSACSRNSQGVKTRTVSASLYNMFVQAGSIVASNIYRTNDKPFYHRGNTVLFGL
                     AFAMIPILVGTKLFYVFTNRKREKVWNSMTSGERETYILTTKDSGNRRLNFRFAH"
     gene            <108255..>110093
                     /locus_tag="FOA43_003263"
                     /db_xref="GeneID:62196663"
     mRNA            join(<108255..108260,108519..>110093)
                     /locus_tag="FOA43_003263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923514.1"
                     /db_xref="GeneID:62196663"
     CDS             join(108255..108260,108519..110093)
                     /locus_tag="FOA43_003263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779442.1"
                     /db_xref="GeneID:62196663"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024607"
                     /db_xref="PFAM:PF00884"
                     /translation="MEKLAEEGLRFTDFHTASACSPTRSMLLSGTDNHIAGLGQMAEF
                     ARNFPQAFKGKPGYEGSLNYKVAALSEILHDSGYFTFLSGKWHLGLLPKYWPSARGFE
                     KSFTLLPGAGNHYKYFPRDEKTGEFSNFMAPLFEEDGHKIDPSGLPDDYYSSDYFTDK
                     FLEKLNDKVRNDRPFLGLLTFTAPHWPYQAPPELIEKYAGVYDNGPRILRSSRIANAT
                     KRGIIPDGIEPHSVWTQRQDSWENLPEKEKKTQSKIMEIYAAMVDRMDYNIGRVITEL
                     KKKDEYDNTFILFMSDNGAEGMLMEAMPLKSQNFSDALKKYYNNSFKNLGKKDSFVWY
                     SDEWAQAATAPSYMYKMWASEGGIRCPLVVHYPALIKKPDIKHEFVTVMDILPTILDI
                     AGVCHPESPYHGREIVEVRGKSWLPFLIGKSNQVHSEDTVTGWELFSQLAIRKGQLKA
                     LFIPKPYGPGVWQLFDLSKDPAEMHDLSQSRPEKLNELINHWAEYVAETGLVETNISE
                     FDMTKEMGVIYTKKKLYD"
     gene            <110247..>113918
                     /locus_tag="FOA43_003264"
                     /db_xref="GeneID:62196664"
     mRNA            <110247..>113918
                     /locus_tag="FOA43_003264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923515.1"
                     /db_xref="GeneID:62196664"
     CDS             110247..113918
                     /locus_tag="FOA43_003264"
                     /note="BUSCO:EOG09342M86;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779443.1"
                     /db_xref="GeneID:62196664"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR017173"
                     /db_xref="InterPro:IPR024293"
                     /db_xref="PFAM:PF03399"
                     /db_xref="PFAM:PF12209"
                     /translation="MNTVGPSASGNFSSVNSFQSGRKESNNKNNKRRVGETRQSEQKH
                     VISNDKPNRKSNMRPFNKNGKGKSFSKKSNLKHNTSEEQQKQPVAIVSNPHSSSSSPE
                     KSANPTKKTNRFASQFVGALLLFPDQFGYQKINHVPRITPKYLLPGQTLFESTSFVPN
                     EWDRKNQEMLAARESEFEGDPQMLFQEFQDDRKKERQMMESLNLVDKENAKKSLDAAI
                     SFRGSCLDMCPTFERVERQYKNQVSKWEKDSMTGRISRHYAIKTFMRPSGQPPPLPSD
                     VRAPHILSKTLDYIIDNLLLKMPDSQSFIWDRTRSIRQDFTFQNNYSGIESIDCHEKI
                     CRIHILSLHVMAGAHDPDYQQQQELEQFNNSMQTLTYMYKDVRSRGGFCPNEPEFRAY
                     ELISKVDDTELDRNLQQLPESIISAPILQRALMLRGLILRGIGNLNLYTQFFEAALNG
                     ETPFLLACMSEIHFNEVRYNALKIMSRSLHSKSKSLPDARILVADLGFDTLEEFLKTC
                     KLYSLPVIHDSENIPRVEVSAFNTAFKHSQAQPYTIRINDISHGSSYKDIVNSGLPNY
                     ALNLASAKHLEEVARESFREGKEGSRIIADVLKGASHVSIPQAVIKAIKKQPDAFGIT
                     TEPPRSTVPSFDPQPSQEQSASSLFGGTLAHGSATPFNPGSLFNSTRPKLEFSSPSLQ
                     KSRPPKPIQQPFQITENASIPQSLAQTPVKPLRLPAAPSKEPNPPVSLPKRKLLGLPE
                     FDTAAKEVVDDTIHHMISKITPQLVERAIKNATEVQQNHREQLVGQLTEELYSAFMRE
                     QIYLFALKVRAQGFREKKLKLWAVQRLIHAARRSSIKNKEKNERLIEVDTFRNNVTTP
                     LIASLRAPRTGFYTPKDPTGPIDISLLLEKSQIQLSQMRMLTIARNWNASTSKWIANK
                     LGLKQIGSEDELTAEWKSSKTALKIHSLSDSFDPKTDFRRVDFVVIQVGTLEANRHTD
                     KYNLKESLEADGKVVAKVLEYLRKYNKGYYTSVLVTFFDCTDFNFTDSEVIEYLKLDS
                     YSTDVHDVTIEVVNLSTLFALQYVGTKRQFSSAIFDMLGRCHSKELDLQRAEEESTRL
                     QSTTIDEASRSSNGQSLIGLMKGGDRLASQERRRRYDKKRVHYIKSQLSETGKSMFRI
                     RLKRKRREEASNTSWLTTSNSTNELRNISLLSTTSSPISTGRFYLPYSEEDNSQADNN
                     RKKKVDELTALADSILNDS"
     gene            <117092..>117994
                     /locus_tag="FOA43_003265"
                     /db_xref="GeneID:62196665"
     mRNA            <117092..>117994
                     /locus_tag="FOA43_003265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923516.1"
                     /db_xref="GeneID:62196665"
     CDS             117092..117994
                     /locus_tag="FOA43_003265"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779444.1"
                     /db_xref="GeneID:62196665"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="PFAM:PF11124"
                     /translation="MQSQGQIDPKLNESLPVEEVPKLEISYVTPNCAEAVVNLQMDYL
                     LSRKSKLTKKMLGAKGIIAIIIGWASLVSYYRLGDYFSDYTFQNGFQNGLFKLLLNSS
                     FRYNAVETISVVLLGMVTIWVNLFLQTNFLKEESVGVPERQKDYFGADMKEYSLLALN
                     DKKKKLCSDKRKKVEFFKTNSVIIVYRSTPIAFAVKQVVQDNDDALIYRITGLGIRRV
                     YIQAGVLTDLITCTIKNLPLVTSRTVKCYIDVYNFEGAEKHILKRLGFNLEKTQPTNH
                     GFILDTLFGFRKETFVYTIAPNND"
     gene            complement(<118019..>118651)
                     /locus_tag="FOA43_003266"
                     /db_xref="GeneID:62196666"
     mRNA            complement(<118019..>118651)
                     /locus_tag="FOA43_003266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923517.1"
                     /db_xref="GeneID:62196666"
     CDS             complement(118019..118651)
                     /locus_tag="FOA43_003266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779445.1"
                     /db_xref="GeneID:62196666"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="InterPro:IPR036874"
                     /db_xref="PFAM:PF00484"
                     /translation="MSTNGPFTLSKESTLKEILAANKASTESLKTSKPEILEIAAKGQ
                     SPHTLWIGCSDSRVNECTTLGCFPGEVFTLRNIANVVTAGDLSCMSAIQFAIESLKVK
                     RVVVCGHTDCGGVWGSLADRKSGGPLDSWLLPIREIRYEHLEELNKIGSDQERNRKLS
                     ELNVLHSVDVIRKHPSFVKAHRDDKVEVYGVIYDVKTGLIRELVSPEGTA"
     gene            <120734..>122455
                     /locus_tag="FOA43_003267"
                     /db_xref="GeneID:62196667"
     mRNA            <120734..>122455
                     /locus_tag="FOA43_003267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923518.1"
                     /db_xref="GeneID:62196667"
     CDS             120734..122455
                     /locus_tag="FOA43_003267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779446.1"
                     /db_xref="GeneID:62196667"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF17667"
                     /translation="MSSRANLQVAAGSPVVIPSSPVTPVTGNVVNVANGAGFQSPAQP
                     SRISSHQNHSTSNLQLAGVQQVQVQQVPLQAPQQVSQQVQGQPQTQAQVQAQVQAQQH
                     TQQQQQQQQQQQQPSQSQSSGGGGQVVGLHYKIGKKIGEGSFGVIFEGTNLINGIPVA
                     IKFEPRKTEAPQLRDEYRTYMHLIGVLGIPTAYYFGQEGLHNILVIDLLGPSLEDLFD
                     WCSRKFSVKTVVQIAVQMISLIQGVHEHDLIYRDIKPDNFLIGRRGMPDENMVHMVDF
                     GMAKRYRDARTKKHIPYREKKSLSGTARYMSVNTHLGREQSRRDDMEALGHVFFYFLR
                     GQLPWQGLKAPTNKQKYEKIGEKKRTTAISDLCQGLPTQFGEYLRRVRDLPFEEEPDY
                     DGYRSLLLSVLDDIGTTADGHYDWMDLNGGRGWDYSINKKPNLHGYGHPNPPHRHQQR
                     RTRSNQPYYQQPHHHSHQALAPQQVQQQTQQVDQGQQYHHHQQNGTGDRPLPNLPDSR
                     INDLGHSNRQQFRQQLSQYDQHDVLQQQPHATSEPVRASQQHKIQPDQLSSQSGKGFF
                     SRVFPCC"
     gene            complement(<122714..>123895)
                     /locus_tag="FOA43_003268"
                     /db_xref="GeneID:62196668"
     mRNA            complement(<122714..>123895)
                     /locus_tag="FOA43_003268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923519.1"
                     /db_xref="GeneID:62196668"
     CDS             complement(122714..123895)
                     /locus_tag="FOA43_003268"
                     /note="BUSCO:EOG09341SQW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779447.1"
                     /db_xref="GeneID:62196668"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="InterPro:IPR036068"
                     /db_xref="PFAM:PF04095"
                     /db_xref="PFAM:PF17767"
                     /translation="MQAAIHNCFPDAQVTFNYHNRTPEKKLNKKAIDWLKQQIKLLGD
                     LKFSEEEIEYLRKEIPFLPSQYYDWLKTLRLRPKDQVIMNDDPAQFSIKILGKWDEVT
                     LYEIPLLSLVSEAYFRFVVTGWTLDEQFGIAKKKALELCQHDCAFSEFGARRRRSLET
                     QKVVMEGLIAGAKEAGKEHLLLGTSDVYFAKMFGLKPMGTIAHEWMMGIGAITQDYEN
                     ANKDAMDCWLRTVGNSHAGLALTDTFGTDVFLRCFKPPYSDYYVGVRQDSGDPLKFAE
                     TIAHHYHDVLKLPRFSKSICFSDSLNVDKCIKYKQKADQVGMKCSFGIGTNLTNDFPD
                     SKPMNIVIKIDSANGNPAIKISDNLGKNTGDPETVKRVKKLLGYEEEDWSEGDEKHRW
                     D"
     gene            complement(<124201..>125925)
                     /locus_tag="FOA43_003269"
                     /db_xref="GeneID:62196669"
     mRNA            complement(<124201..>125925)
                     /locus_tag="FOA43_003269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923520.1"
                     /db_xref="GeneID:62196669"
     CDS             complement(124201..125925)
                     /locus_tag="FOA43_003269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779448.1"
                     /db_xref="GeneID:62196669"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="PFAM:PF07738"
                     /translation="MSKARSLQSIISYSEKLFDSDPSEEYEYDFERDDHSVPITIDES
                     DTRELNGNLSRGLFVKGLKKDINEHNSDDSASDLDYVPTEADDDDDDDEYSNEKDFEY
                     LNSDGETADLTYESYHPEGFTSHAEEVETETEEIDEIDQLEPPGSVKTRFLLYMLKCA
                     PLVLVVLFLVLLSNVSASFPSQGTDSGYVHHKLYLLEKQLSILRQQQDRLIAGVRENK
                     VVLTNGTEITDYIEQFRSNITSIDDKIRRLQQQDTTITDNDIERIWKILKDKLDDETK
                     EKKPTVTVIRPEIQPKMSSSVSGSSSGLGLDSDSDLDSSPVTYRTQNYGSHGLNNVAS
                     TARVLPQLTSMAKVKRVRTKVMDRVLHGFSDFASRKIWKKSSRKPLIGLKGINLGGQD
                     NNPNNVLIEDPRRYWQGLVEDLPLSFTMALREPVCLVEVGISHPRYRYLMSSAPKFVE
                     LFVKPSRDLSTIRQQVARYYNQDFRSAVLRSSFAKVGELTYDIGSNQQYQKFTIPKEV
                     KLILMEYPIENVMLVIDSNWGHSNVTVLDTLRLFGLNEVDRKRSFGDRSTGMETVPDL
                     GRDTPMDK"
     gene            complement(<126075..>126530)
                     /locus_tag="FOA43_003270"
                     /db_xref="GeneID:62196670"
     mRNA            complement(<126075..>126530)
                     /locus_tag="FOA43_003270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923521.1"
                     /db_xref="GeneID:62196670"
     CDS             complement(126075..126530)
                     /locus_tag="FOA43_003270"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779449.1"
                     /db_xref="GeneID:62196670"
                     /db_xref="PFAM:PF17733"
                     /translation="MSFSPENIEVYEAFSRYEFDSNREYKEGLEVVYQQYLMLEGDKD
                     SEIKKDLDAGKLDSGKIKSDIKEQLTTQAKVFFFCKQTGNILDLQEYQKWEETNHGGK
                     PPYSLNYEQLVDMIMNNKPIPGIKTIPDTVLDSSKSSKHVLSERTKPWQ"
     gene            complement(<126678..>126908)
                     /gene="RPB10"
                     /locus_tag="FOA43_003271"
                     /db_xref="GeneID:62196671"
     mRNA            complement(<126678..>126908)
                     /gene="RPB10"
                     /locus_tag="FOA43_003271"
                     /product="DNA-directed RNA Polymerase II subunit L"
                     /transcript_id="XM_038923522.1"
                     /db_xref="GeneID:62196671"
     CDS             complement(126678..126908)
                     /gene="RPB10"
                     /locus_tag="FOA43_003271"
                     /codon_start=1
                     /product="DNA-directed RNA Polymerase II subunit L"
                     /protein_id="XP_038779450.1"
                     /db_xref="GeneID:62196671"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="PFAM:PF01194"
                     /translation="MIIPVRCFSCGKVVGDKWETYLQYLEEGMSEGDALDRLGLKRYC
                     CRRMVLTHVDLIEKFLRYNPLEKKDIDDERSY"
     gene            <127179..>129698
                     /locus_tag="FOA43_003272"
                     /db_xref="GeneID:62196672"
     mRNA            <127179..>129698
                     /locus_tag="FOA43_003272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923523.1"
                     /db_xref="GeneID:62196672"
     CDS             127179..129698
                     /locus_tag="FOA43_003272"
                     /note="BUSCO:EOG09340CJ2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779451.1"
                     /db_xref="GeneID:62196672"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR017986"
                     /translation="MVTADWNLAFNSGGKLLSRGHVITPDGKFAIAIFKTHLRVYSLS
                     TRQSIRSIKLNRDLSDVVDSKLSNANSCLLYLFTSSNEILAVNWRDKSLTNAIVKNYS
                     VKTIESDGKNSFGQILKLVNFNDKEDEFLLIFGKPTTSLHSAHSRSLIKISIKEEVSS
                     EELATVDNVLLFNKSTDGKSLVFVTNTSDVYYTSLVESENQVQVNLHQIPFAYKSTIC
                     SVAISNGEAPMAALGTVSGVIQLLYLTSHSEQRLLKWHVDQVKAVEFNSDGSYLISGG
                     IEKVLVFWQLDTEKQQFLPRLNGCINQITIDDRIGQLYGITLELSDGNTSDEKYMEFL
                     VLNALDLSSKLDVNGLRPHFSTNLDKTIQRDDRRMKKLDIQLDEESLTKIRHNFTTDF
                     EIHPTTKSMYLPSGARIQVYDIVKNDQVFVTTMARTLQQGKVRSETSIQDPSIDHFAF
                     TQDGNWMCTFDKLATPKLDHLMSENDVKYSLKFWKYIASSSTSLSDNPHWELCTKIID
                     PHGSSVPIASIISAPVTYCGGLAFVTADTKGGLRLWRPRIPKEIYAKLGNKKLEQTAW
                     TLRKFRSGNGRLETTSIDISWSGDASVIVVGQENAITLVDVNNFEEIKETPLPSLADG
                     RIRALKIVGYNLIMLTKERLISFNLLTYQINQLCVRVHSPIGGKSLLAVDDDRNLVCF
                     CVNYYSHSDQTQESSSLTYPLRSRIFVFEPSKLKPVYIADHSSPISCVKYSKGHSGFV
                     LLDIDAKVGILNAVTSKFLFEEEEKKQLDKAYEMNTLLSNAQIVAKVAKESANKSVST
                     IEDDEELFTRRTLNPDSLEPVLENMEGLSVEALFDRVMNLL"
     gene            <129858..>130295
                     /locus_tag="FOA43_003273"
                     /db_xref="GeneID:62196673"
     mRNA            join(<129858..130217,130272..>130295)
                     /locus_tag="FOA43_003273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923524.1"
                     /db_xref="GeneID:62196673"
     CDS             join(129858..130217,130272..130295)
                     /locus_tag="FOA43_003273"
                     /note="BUSCO:EOG09344DZL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779452.1"
                     /db_xref="GeneID:62196673"
                     /db_xref="InterPro:IPR020164"
                     /db_xref="PFAM:PF14138"
                     /translation="MGAFGDHTFRSKRSQAEFEKSFVGKYQRLVKKNSFLYMGLPMML
                     SLAFASIFMTNLTSLRFERRDARVKELDEDEALKLANIKKRKVNINDEYYKLQGLMDD
                     SKDYEPKRVERLPGETENKLSLLAL"
     gene            <130635..>130966
                     /locus_tag="FOA43_003274"
                     /db_xref="GeneID:62196674"
     mRNA            join(<130635..130642,130657..>130966)
                     /locus_tag="FOA43_003274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923525.1"
                     /db_xref="GeneID:62196674"
     CDS             join(130635..130642,130657..130966)
                     /locus_tag="FOA43_003274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779453.1"
                     /db_xref="GeneID:62196674"
                     /translation="MTICVSEAEKYQKGFYKGKKKQQPQKQKPKQMLSPKNGESDQKS
                     KIKPQIKGSLELSKFVKKDVPMSLYKVFKKVHKSDKNLDKKSFLKSLKLTLNKNGSWS
                     ISP"
     gene            complement(<130991..>132157)
                     /locus_tag="FOA43_003275"
                     /db_xref="GeneID:62196675"
     mRNA            complement(<130991..>132157)
                     /locus_tag="FOA43_003275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923526.1"
                     /db_xref="GeneID:62196675"
     CDS             complement(130991..132157)
                     /locus_tag="FOA43_003275"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779454.1"
                     /db_xref="GeneID:62196675"
                     /db_xref="InterPro:IPR020981"
                     /db_xref="InterPro:IPR038608"
                     /db_xref="PFAM:PF12539"
                     /translation="MPRRKGSKKKSATTGRKRITRSSKKVVEEKSPKAEEEAKVEGID
                     KGEDMSNKEPTKPIEEPKEAIEEPEGPKEPIKEPFKEPIKNQVNEPINAPTVEPTMES
                     TKEPTRRSINNLLSESKKHEHPHDNDNDNPETPTKKRQINRLSMGHAHLPTEASVSQL
                     FQRRDMKELTNLSQSLMRKSEKTFQDYKKLAEKRAKSAESIISKLSSENSILRNRIKD
                     MRSESRPHNEVEQLKKRIETLKKTEMNKNEEMEKLRTRKEEVEAQLEEALKEFDLFDS
                     KQEIIELLSGASCVAYEENQKSIIFRLRQTGEICTLFYELVISKSGLGELVYIPLLEK
                     PKEWEETEEIDWETNLVNSRKVLPEYLMDNLTFPSNTLRNFYTKIARSVSKGRI"
     gene            <133514..>135544
                     /locus_tag="FOA43_003276"
                     /db_xref="GeneID:62196676"
     mRNA            join(<133514..135074,135477..>135544)
                     /locus_tag="FOA43_003276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923527.1"
                     /db_xref="GeneID:62196676"
     CDS             join(133514..135074,135477..135544)
                     /locus_tag="FOA43_003276"
                     /note="CAZy:GT91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779455.1"
                     /db_xref="GeneID:62196676"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="PFAM:PF12141"
                     /translation="MSEKLQDDSRSSSGPAFPLHQKDRTLKSSKSEEEDFFYQPIKRP
                     VRGDFNPDRDDIEVPQVIKPELIDNALKKLHMRPMRRKALKERYSLLGGGATNVVTER
                     NYRVLDDLQAFTGNLEDFSSDCEKLSYSIQYNVPEDHKVEHTDPIPLSDKSLLEDITE
                     YLENSGLEENIPSLKDKGKLDPSHWYRLSGSAIWLPDEECYMMVSRIMYAPTKRDAPL
                     ISLVRMQLYDNEWKELKGRRIRYHDATDIDADRALRKISVLGTSNKHSAEILDHISVK
                     FPSFMDIPLEVKSKGNMLGPEDPRIIYKPSETGNNEPVVLFNMFSGLRRRSMYAAFPL
                     RKPKSNASHKVTILQFRHSGSSSLTIKAVEKNWVPFFEDTKNPEYISFLYGLDPLVVF
                     RCRLDNGKCDKIQDDGYGTGMIASNKIALRGGTNLMAVPMEIVRQLPELKKDPLHNVK
                     LYVAFAKTHAWKCGCASAFYRPTLYLLVMVDGTYRIDLMTESIDFGLDVLSFDGRSTS
                     CDSSGPNVLTPNKLLAKRSIISHIITTLRITTID"
     gene            <135599..>137431
                     /gene="ILV3"
                     /locus_tag="FOA43_003277"
                     /db_xref="GeneID:62196677"
     mRNA            <135599..>137431
                     /gene="ILV3"
                     /locus_tag="FOA43_003277"
                     /product="dihydroxy-acid dehydratase ilv3"
                     /transcript_id="XM_038923528.1"
                     /db_xref="GeneID:62196677"
     CDS             135599..137431
                     /gene="ILV3"
                     /locus_tag="FOA43_003277"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase ilv3"
                     /protein_id="XP_038779456.1"
                     /db_xref="GeneID:62196677"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR004404"
                     /db_xref="InterPro:IPR020558"
                     /db_xref="InterPro:IPR037237"
                     /db_xref="PFAM:PF00920"
                     /translation="MSSMLSTASRATTKASSAIRCSSRLHFSTSRVQCEEEGEGRKTK
                     FNKYSWIITEPKSNGAGQAQLYATGFKKEDFSKGQVGIGSCWWSGNPCNMHLLGLNNL
                     CRDSVEKAGLKGMQFNTVGVSDGMSMGTTGMRYSLPSREVIADSFETIMQGQHYDANI
                     GIPGCDKNMPGVLMAFARHNKPSIMVYGGTILPGKGSCAGVGDKLDVVSAFQSYGAYL
                     AHDISEDQREDIIRHACPGPGSCGGMYTANTLASASEVMGMSLPTSSSSAAISDAKKA
                     ECLNVGEAIKKLIIEDIRPRDIMTRQAFKNAIAYIIAVGGSTNAVLHLIAIAHTAGIK
                     LTIDDFQKISDNTPLLGDFKPSGTHVMAELAQLGGTPAVMKYLLKEGIITGDGMTVTG
                     KTLKENLAQYKDLPDGQDVIRPVSNPIKKTGHLQILRGTLAPDGSVAKITGHEGTYFK
                     GKARVFDDESGFIHALEKGEIKKGEKTVVIIRYQGPKGGPGMPEMLKPSSALMGYGLG
                     QDCALLTDGRFSGGSHGFLIGHIVPEAYEGGPIGLAEDGDEIVIDADNNSIDLNVSQE
                     IMSQRRKLWKKPALKYTRGFLFKYCKLVSDASKGCVLDYDGADN"
     gene            <137672..>140935
                     /gene="FIG4"
                     /locus_tag="FOA43_003278"
                     /db_xref="GeneID:62196678"
     mRNA            <137672..>140935
                     /gene="FIG4"
                     /locus_tag="FOA43_003278"
                     /product="phosphatidylinositol-3,5-bisphosphate
                     5-phosphatase"
                     /transcript_id="XM_038923529.1"
                     /db_xref="GeneID:62196678"
     CDS             137672..140935
                     /gene="FIG4"
                     /locus_tag="FOA43_003278"
                     /note="BUSCO:EOG09340N5P;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="phosphatidylinositol-3,5-bisphosphate
                     5-phosphatase"
                     /protein_id="XP_038779457.1"
                     /db_xref="GeneID:62196678"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="PFAM:PF02383"
                     /translation="MPESRNNSVVESTETNDASLEVGHTSIQGVSAEGSQMQPQQQPM
                     TTKARKFGLTKYTVYVTSRRMYVVGSNTRETMFRIIEIDLTSPEKLIIMEDNVYFNRT
                     EIIDVLNGLEESSEGGLTKKITAVGLLGFIRFTKYYYLLVVTKRRPVAILGGHYLYHI
                     DATELIPMSDNQRKPARNSEESRYLQTFLSIDLSKTFYYSYTYDLTNTLQVNCLRQKT
                     RSLGLFENDSVHELYNDRFVWNSHLLELALTNFDRVYDWFQPIIHGFVDQIKISIFDA
                     EVYVTLIARRSHHFAGARFFKRGVNDSGNVANEVETEQIVTDMLTSSFHDPAAGFFNN
                     PRYTSFVQHRGSIPLSWSQATAPNIRMTKPPIELNVIDPFYSAAALHFDNLFKRYGAP
                     VQILNLIKQKEKTPRETKLLTEFENCIHYLNRFLPEEKQIEYTAWDMSRASKSHDQDV
                     IAWLENYSEHTVSSTGFFHNGKTLETTQLQQGICRTNCIDCLDRTNAAQFVIGKRALG
                     HQLHALGFINQKYLEYDSDAINIWTELFHDHGDTIALQYGGSHLVNTLQTYRKINQWS
                     SHSRDMIESVKRFYSNSFMDAQRQDAINLFLGNYVYKEGHPMLWDLNTDYYLHNNYVG
                     VSLNYRPSYTHWFSDCNLDNQKKELLELQVERKGAFFTRIEELTAFKIEPIPGFYDNY
                     WNNKYLPRELTSFSELFEFNMNSTLQYSGSSNTNTNSADINQDTANNSNVSSFSMNPA
                     SRSQGLSVSSTDNSSVFTNDKLAVDSADLTKQLVSPFKSRKPHRERRLEQGLHFENEA
                     RQIVTDSEVAEHESLELSSFNLRELRFSHDEYEKVKKGHENFDKILRNIGNEIGRSIR
                     ETKKLPIITKATNQTMDEKAFDFVDETYLDSVKPSQDLFMADIHKNHYNCNPIVSKSD
                     MECYRKSINAGKEIEVSRQPESSKIDQLSHEYSKLLKVTVLQSDLSLYGQFVDCMNEW
                     KVEKALSDVPLKKSAPVRYVQSDQTNTERAENVDFKPNTMSVLEEVAYSSFQNKNEKT
                     ETSSMRSANSSTRPISNSTPQIHPATTSTSSTSTLVGGLHNEDILNSPFSHGDSRVS"
     gene            complement(<140961..>141671)
                     /locus_tag="FOA43_003279"
                     /db_xref="GeneID:62196679"
     mRNA            complement(<140961..>141671)
                     /locus_tag="FOA43_003279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923530.1"
                     /db_xref="GeneID:62196679"
     CDS             complement(140961..141671)
                     /locus_tag="FOA43_003279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779458.1"
                     /db_xref="GeneID:62196679"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR036612"
                     /db_xref="PFAM:PF15985"
                     /db_xref="PFAM:PF18311"
                     /translation="MSFVLPGNQIQVKSANVVLGPNVDIAPGSINETVLTPTTAGMLK
                     VKKANPQSSLYYVESNTKRYVPQINDFVIGVLFGAFGEYFRISLNSFSPPVLLNQYSF
                     PNASKKNRPRLSNGDLVYARVSAVERNVDVELSCIDATTGKEGGFGVLSDGLVFDVKL
                     AFARYLLFNSDAEIFTQLVKRCKFEIAIGVNGRIWIKTDDIKTTIACVNVIRNSQNWT
                     KEELPAKIEDTFKVLKTN"
     gene            <142509..>144500
                     /locus_tag="FOA43_003280"
                     /db_xref="GeneID:62196680"
     mRNA            <142509..>144500
                     /locus_tag="FOA43_003280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923531.1"
                     /db_xref="GeneID:62196680"
     CDS             142509..144500
                     /locus_tag="FOA43_003280"
                     /note="BUSCO:EOG09340Q5A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779459.1"
                     /db_xref="GeneID:62196680"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="PFAM:PF03074"
                     /translation="MGLLSQGTPLSWMESRKYNEHVRDNGVEQLINCFRAAKDRSQDP
                     FLWGDEIEYQMIRIDDDAKSAKLALDETEVLINLAENGKGRSNSVNHGVLFHPEYGRF
                     MLEATPLKPYDGRKLSDYSYVEQNMAVRRDVARSEMSDRKVYPITLTAFPNMGCGDFT
                     YPKATTNGPASQSLFLPDEIINKHVRFPTLTANIRIRRGQKVDINIPLYRDVNTVLDQ
                     IDPTIPKRDLFPCDAEPFLGAAKPGHIYMDSMGFGMGCCCLQVTMQPSDIYEARFVYD
                     SFVNISPALLSLTSATPILRGHLADQDVRWNVISGAVDDRAPDERGVAALNGHNPRGG
                     IADDVKLQRIPKSRYDSVDQYLGDLRKDSCKTDDPQYTYYSSSFNNINSPINSKVYKN
                     LLDNGFDQQLALHFAHLYIRDPLVIFAEKINQDNTKETDHFENIQSTNWQTLRFKPPT
                     QEAVPGNSSVPGWRVEVRPMEISITDFENAAFGVFTILLARAIIKYKPNFYIPMTKVE
                     KNMRVAHTRDSITEGRFSFRTNGWHGQSQPGKYAELSLDQLFNGYQDFEGLIPITRKY
                     IHETFQASSAKDQDDLEQVEVYFQLVSKRASGELPSTAKYLRDFVLSHPDYKHDSIVS
                     ERINYDLIKLADRIGNYDHELLPGFFGKEISDWLFRRGY"
     gene            complement(<144637..>146453)
                     /locus_tag="FOA43_003281"
                     /db_xref="GeneID:62196681"
     mRNA            complement(join(<144637..145934,146450..>146453))
                     /locus_tag="FOA43_003281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923532.1"
                     /db_xref="GeneID:62196681"
     CDS             complement(join(144637..145934,146450..146453))
                     /locus_tag="FOA43_003281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779460.1"
                     /db_xref="GeneID:62196681"
                     /translation="MDAYMDQDVILEKKAAMEIEQKVVLTEKQLFEMKDQQKEQIDKK
                     SRLDDTVKDMKKNVSNINELVKLKQNNLKMELNRHKDFVEEQKKKVYRVFGKRLDEIK
                     SRFADLAKSSVSDDETERNRRQRFEKLRDDNELTERTLKRARTTIQLRLEKLENELQL
                     KESNDNDEILHLRIELNNKEAKMRKSNKCLDEYKGEVDRIRKQNRILATEVDQLGEFR
                     GSLDDKFKELKVRRVKLLDELDETKQKVAELLSGRVQTGLKKHNESKKKYFRNRRRRL
                     LIENCIDKHQGIVRKMYAICDTPIEIKGFDVVNCEFDIHSVLDIYLEDSLQGVSHKIV
                     IVGEGLDRYISSTKDHLLWMSQRDKYKQWRVDIKENCDATCLRVQLTKDEVVRKSEVQ
                     FISLPLTEEGIRQFKEVYDGFGIVKLKHDKNDNLIEKMATK"
     gene            complement(<146460..>148193)
                     /gene="CDC14"
                     /locus_tag="FOA43_003282"
                     /db_xref="GeneID:62196682"
     mRNA            complement(<146460..>148193)
                     /gene="CDC14"
                     /locus_tag="FOA43_003282"
                     /product="cell division control protein 14"
                     /transcript_id="XM_038923533.1"
                     /db_xref="GeneID:62196682"
     CDS             complement(146460..148193)
                     /gene="CDC14"
                     /locus_tag="FOA43_003282"
                     /note="BUSCO:EOG09340WEX"
                     /codon_start=1
                     /product="cell division control protein 14"
                     /protein_id="XP_038779461.1"
                     /db_xref="GeneID:62196682"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR003595"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="PFAM:PF00782"
                     /db_xref="PFAM:PF14671"
                     /translation="MHRKVKVDAIEFLKNKVYLGAYDNTPENTDQLIYFTVEEALPYN
                     AFHLDFGPLHIGHLYRFAVALHNILNDPENGNKAVIFYSSQSPNSRANAACLLCCYLV
                     LVQDWAPHQVLQPIAQMEHPFMPFRDAGYSRADFELTIQDVVYGIWRAKERGMVDITN
                     FNLEEYEQYERVDQGDFNVISNDFVAFASPKQSRPGAPLNEPFRKVLQYFVAHDVQLV
                     VRLNSHLYDKKEFEKRGINHIDMIFEDGTCPTMELVQKFIGASETVISNNGKIAVHCK
                     AGLGRTGCLIGAYLIYTHGFTASECIGYMRMMRPGMVVGPQQHWLYLHQNEFRDWRHT
                     MVLDTISDSSIGGLFSLISLDLYKSRERERRRRERLQHASRNSRSTEMDEDEDDVVDV
                     DDSIELPPSTPLRRREASGQLKRATSNAVPIENPGQPRKYVGADGRFTNSDEEQDEGP
                     YNSTANTTVEIGSPKKKADVGTVMTLGKENRYSSKKIGNHSSPVAHHRYPQSQFYRKI
                     TTTTTTTTIASSPPPTRVGHNADGGLLKVPKQRAVTNGKEKSSRIGSIERVLGKPGVR
                     KVSGKRYTSGL"
     gene            <148535..>153093
                     /locus_tag="FOA43_003283"
                     /db_xref="GeneID:62196683"
     mRNA            join(<148535..152998,153046..>153093)
                     /locus_tag="FOA43_003283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923534.1"
                     /db_xref="GeneID:62196683"
     CDS             join(148535..152998,153046..153093)
                     /locus_tag="FOA43_003283"
                     /note="BUSCO:EOG093401YB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779462.1"
                     /db_xref="GeneID:62196683"
                     /translation="MGFGFGSNFGSTSSFGDVEGGLGTNGFEVSLNYITGVPDANILP
                     SNDLQLCFKGFQKRDNTTREKSIANLLKLIELDPKQIDKDLVIISWCQVYAKLSIDES
                     KRVRAVTHEIQSKFVSTLGKKYAKYLKDTIGIWVAGLFDSDRSVCRACKTSILRAFGN
                     DTTKTSNLWKIYFHQIVNYCYQVFAIETMNTLSDERFADKDEIKTKYQRVTLGAVLLF
                     VQALNKLKEDDIGLKEKTKDLMSKILENKRFQDLFSNKDTHIKKAMYQLTRVLLTNEQ
                     VICLLDDQFFSKFASAALFGLKINKHINPIVYSGAVISMLDALVVLTRHDSSFWTTTK
                     NADAYLLGILRLGSLNSDPVYYEVLSILLDILPQSYLDSFEKLNIYLTVLENDLDREK
                     ISAFQERAWKCYLKLVRSFLSRLEEDNSDTVITSVTSHVIQYLDTPRSLSKSFVIEFS
                     TLKEFSSGSIDVLSDINSGIMNSLPCRRIEFQDFKVPSIVHETQFLDNFVTVLAANKS
                     DLLEVLLANSIDALKDETEEHPTLSLSIIDIYIKKNFTSYRSAVDELIPSLDKYLSLD
                     YIDQPLRVLVDYSNSKFCNTSILASLVNSIFIKLHKLNQESSLLKDISHIKGFEVKQA
                     PDIRKYLLERSQNEAVNTHASEDSTLFKFLTPKILINMFNNADTSEKFHLFVSGCLLH
                     YQEDPLIEFASETPKFIESLYQYLDDEDASELLSKLETRLTDKTFKSACFKALLSTIE
                     SRTITPELLIHVKDFDMKTWVDFLPGEILSEIEAVLPSQPDNRLVISNPFGTGIYWFT
                     DGKGERLDNESIPQLIRKALFYTTVLKDYPKLVDDKPTLVVELAVLGQIALDYILLKD
                     SPSEAIQTASSSLENDSLDMLKSLFKECTLKDVLTTKELPFKAAKYLFQMLNNENQCC
                     KYYFYRVYQRIVQSFNESTDYIPELAGSPVKISILLNYDKKLLVSKDLFRLRNGTAAS
                     LVGLRSSEDIIRKGLPSIVLLNKLIDLDVDYEIPEDLELFPPQRFMMVLSSINNWPDC
                     ETAYDPEFISVRVALMEFVQNYVNGIYHICDTDYPSSIIDKVFDLGLRLLTESISVIN
                     SGNGTMELTYCTLKTYLLLNNYSDQIEEWEDNVEDIEKELVDLLFKRLQMPGSSRADH
                     LVNGLLPNIFFKLIPAKMIVSQYDKFYGVLMDTPSIDTERIIVSLLAQLIPIVQDGLV
                     VESTLDKAKLESAKIPEQLLQIVRNEHECSEQKYLWSWLLILCHFNKITHQLRESYIS
                     QLGEELISEFLTYLVTGIDVIRFKVPVDMDTTYSYNYSVIDAGSVEVEDEMKKLLVNL
                     LFMTMKYIGGSTIQKWYNSIRDKQLKTSTDGFITKYISGTLIDDILETLSSKEKIEDE
                     TFKIKVNRATNEIKCACDIDDQTMEISIILPADYPLSQIAVKGISRVGVDEKKWKSWL
                     LSCRYVINFQNVSILDAVKHFRENVQANFENYDDCAICYSIINIIDHSTPNKMVQELR
                     CIYMSSLQK"
     gene            complement(<153131..>154862)
                     /locus_tag="FOA43_003284"
                     /db_xref="GeneID:62196684"
     mRNA            complement(join(<153131..154785,154856..>154862))
                     /locus_tag="FOA43_003284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923535.1"
                     /db_xref="GeneID:62196684"
     CDS             complement(join(153131..154785,154856..154862))
                     /locus_tag="FOA43_003284"
                     /note="BUSCO:EOG09340U0G"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779463.1"
                     /db_xref="GeneID:62196684"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="PFAM:PF04084"
                     /translation="MHKPISPVKRPPSGHLGERSPRKKRVVDQLDEMSSIKLRSPMKR
                     SMNDLNKQALRMALQIKFRNIVGESYGDEEDKEIIEDEDKALADKIIELSKRDGYEPM
                     HLEGENSDDDNEVRDATIGVDNFRLSSPVSPISLSPTHSSQKRRERRSTAKFQDLKIA
                     SPVKLMKIPDLDGKKDALLNEDVGGGVKSLFYDGYEGYFEQQKLKVKKLSAQSMTMAP
                     QISYDQFHRYNKLMDLICENQLNNLNLYYRQQYTQWLFELEEGFSLMFYGVGSKRLLL
                     LDFVRSFLLARLPKSTKCIVANGYNSELHPRTLLKTIWKIMFNKRPTTWHMVDSVGDL
                     KNEFNRYVDEKRLVLVLNNIDGESLRQDKYHYILSELSSISQIYFVSSMDNMSTPLFW
                     NSSMMSSFNFIWHNVSTYKPYTTEISFKDPLSIGKSSDFIGSKGAKYVLSSLTSNAKN
                     LYKSLLIQQLEKIDSSLTSDQDMENRGPIKGNIKFPILFRDFYEFCVEEFITSNEISF
                     RTVLHEFVEHRMCNLTRNTAGTEVLYIPFTVDEMEKILQEELLDN"
     gene            complement(<155099..>156250)
                     /locus_tag="FOA43_003285"
                     /db_xref="GeneID:62196685"
     mRNA            complement(<155099..>156250)
                     /locus_tag="FOA43_003285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923536.1"
                     /db_xref="GeneID:62196685"
     CDS             complement(155099..156250)
                     /locus_tag="FOA43_003285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779464.1"
                     /db_xref="GeneID:62196685"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MSKKSELKRSNKSKKGEKKVEEKAAKELKEKKEESSSESESDSS
                     SESESESDSKPESVKSESESESESESDKSDSESEAEKVAEKKETSESESASDSESDKE
                     DTESTDSKKRKSDDEEAEPATKKVKAKSSDDSEPATVFVGRLSWNVEDDALKEFFETK
                     CEGVVSARVLTDRSTGRSKGFGYVDFDDKEHAEKAIQDLQGSEIDGRAVNLDMATSRP
                     RNGSSNDRANDRAKRYGDAPSEPSDTLFVGNLSFEATYDDVRGAFEAVGSVVGIRIPT
                     HPGTEDPRGFAYVQFGSAEEAKGAMEKLNGENINGRAIRLDYSTPKPQGNSSFGRSSR
                     GGRGGRGGRERGSWGGRDGGRDGGRERRPAASGANSVPVHFKGSKKTFD"
     gene            <156543..>157250
                     /locus_tag="FOA43_003286"
                     /db_xref="GeneID:62196686"
     mRNA            <156543..>157250
                     /locus_tag="FOA43_003286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923537.1"
                     /db_xref="GeneID:62196686"
     CDS             156543..157250
                     /locus_tag="FOA43_003286"
                     /note="BUSCO:EOG093449HR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779465.1"
                     /db_xref="GeneID:62196686"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /translation="MDFTSIVVPGQPIVPILSKKKQAKYLAGRNCRIETITYNGTEMP
                     SIVSSVVGKVKVISKDEDKSLQNFTVNVVSKHDPEYVHDDDDIGVKYASNTPMLDDIV
                     LAKVTKITNSRVHVEILSIDTQTGNEEELMMSSLITNENGENFRGIIRSLDIRSTERD
                     KVKTWECFQPGDIVRAEVISLGDGINYYLSTSKNNLGVVLARSATGGELMYALDWETM
                     VVPNTGELEKRKCAKPF"
     gene            complement(<157316..>159483)
                     /locus_tag="FOA43_003287"
                     /db_xref="GeneID:62196687"
     mRNA            complement(join(<157316..159050,159243..159249,
                     159477..>159483))
                     /locus_tag="FOA43_003287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923538.1"
                     /db_xref="GeneID:62196687"
     CDS             complement(join(157316..159050,159243..159249,
                     159477..159483))
                     /locus_tag="FOA43_003287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779466.1"
                     /db_xref="GeneID:62196687"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF00070"
                     /db_xref="PFAM:PF07992"
                     /translation="MAARIIALRTGARNVPLGIHMPIVRMTLASMASMTPMTLLTPVA
                     SRSSRLFSTSQPNFEEIKPVVVKKARKRGWFNLFFKASVLSVVAFWGWLTWEVYKESN
                     PGDQVPQSELKENGNRKKNIVILGSGWGAISFLSKLDTTQYNVTIVSPRNYFLFTPLL
                     PSVPSGTIDVRSICDAVRTIARGTPGEVRYMEAEAIDIDPKARCIQLEHTSQRFSVGD
                     AFINNHEPIRSTISYDYLVYSVGATVNTFGIPGIPENASYLKESNDATAIRQKLFNSI
                     EAARLLPIESAERARLMNFVVCGGGPTGVELAAEVKDFIDQDLKKFIPDIEKELQVTL
                     IEAMPNVLASFHPRLIKYTKNVFKEQGVHLRTNTMVTKVDDRNVYCSLKNADGSKDDV
                     VIPYGTLVWAGGNAQRPITKLLASKILEQQTARRGLLVDDYLKLDGDDYIFALGDCTF
                     TTNPPTAQVAYQEGHFLADYFNKLSKLDDYEFIQVKEPEKMEKYASKIERVKQGMLPF
                     KYRHQGSLAYIGSDRAVADLSWGSWSTVALGGSLTFLFWRTAYVSMLLGMKNKILVVT
                     DWVKVAMFGRDCSKES"
     gene            complement(<159534..>160712)
                     /locus_tag="FOA43_003288"
                     /db_xref="GeneID:62196688"
     mRNA            complement(<159534..>160712)
                     /locus_tag="FOA43_003288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923539.1"
                     /db_xref="GeneID:62196688"
     CDS             complement(159534..160712)
                     /locus_tag="FOA43_003288"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779467.1"
                     /db_xref="GeneID:62196688"
                     /translation="MADPQRLDKNLDVAAAEAAVAAAVAATTSVTVQENIQELKSPNY
                     FAQLIQGEPSKSSNLDSTSAIEAKDSGELIEPILVVKCSRCRVKRVKETEEMLHKYHT
                     CVNCRMKRRVMKRKLRSPSRLPNLIDDWGKYQQKVATNATMDLFEHNYRNYTDEVLFP
                     RYKVGELNDEIVERISKKLVDHYISPLQMLTGFRFTVRDHHRPLLQQSNRAKKITWMF
                     VCSQDKLHRRESRSHHKRRVINRLKTEECASKITLNYDLLTGMIQMSYNHKHHYPYNW
                     KKHSRKRKLNAENIDAQDVINEFIAQNESTGHQLNTSQIVELATRATQEGRGKESEVP
                     KEPKEPQEPQEPKEPNKFCQLDIAKSLDSSAESLVTEQPTSTRQRIMIDQRLLKEDAI
                     "
     gene            <160873..>162123
                     /locus_tag="FOA43_003289"
                     /db_xref="GeneID:62196689"
     mRNA            <160873..>162123
                     /locus_tag="FOA43_003289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923540.1"
                     /db_xref="GeneID:62196689"
     CDS             160873..162123
                     /locus_tag="FOA43_003289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779468.1"
                     /db_xref="GeneID:62196689"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="PFAM:PF04795"
                     /translation="MPETKRSSNKATDEDYEDELNADVEFIEDDDEEEVVDDDEPDPV
                     DDDYEEVDVEREGEVGEVEDMDTEEPEEPEEAEEPEEHEEPEELEGGDMESIDEIEDV
                     DDAEVDDAEDTDESVDIEEERESEMESVSAEPEEPASSSPVPQDEDIDLEAPLIEDDE
                     EDEAATDSGTKTKQANVSVKKETDGQLSVKFKFKFMDEVQKRQFNELTSSPSSSRTTS
                     RENSPSVRRTRHNRVNYKEDDLGEEEEEGINNIDEEEEEDEYSEQKKKPDPSRMTERQ
                     RDKYFGTPTSEEPELPPIKKNNIKSKELLSLYDEPLKKAKILTEEEIQLRRVEQARKR
                     KNFSIRKLEAEKRDTLNKLLMKRADKVRDLNKLTGKEYGDEEENQDIKRRPQIKHNAL
                     FRWDSKTVTLDGEKTNRQLYSWNI"
     gene            complement(<162143..>162787)
                     /locus_tag="FOA43_003290"
                     /db_xref="GeneID:62196690"
     mRNA            complement(<162143..>162787)
                     /locus_tag="FOA43_003290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923541.1"
                     /db_xref="GeneID:62196690"
     CDS             complement(162143..162787)
                     /locus_tag="FOA43_003290"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779469.1"
                     /db_xref="GeneID:62196690"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="InterPro:IPR037119"
                     /db_xref="PFAM:PF10615"
                     /translation="MSTQSIIDHLNHGHQHNLEDLLVVYGKLSKSELGSPKVAKIDLK
                     SLTISYGSEPNRKSKKIEFLQSVKSYDDFEDVVLSMFEQAADKRGFSAYKITTIPLAS
                     KPLELAYWVAFMLLVFLAFAPGTTVDLLVNQFGLSLNRAVTFNQVARWIINTLCVTHS
                     TETAMTLNPQLAAHRVPVPKRMVACFLCMIEGVFFIRRFEREVKKAEGTKMKVN"
     gene            <163001..>163633
                     /locus_tag="FOA43_003291"
                     /db_xref="GeneID:62196691"
     mRNA            <163001..>163633
                     /locus_tag="FOA43_003291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923542.1"
                     /db_xref="GeneID:62196691"
     CDS             163001..163633
                     /locus_tag="FOA43_003291"
                     /note="BUSCO:EOG093447UZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779470.1"
                     /db_xref="GeneID:62196691"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="PFAM:PF04101"
                     /translation="MAKQALVTTGATVTFSKLIEFSLATEYVAELMDLGYTDYVVQYG
                     KSEGAKQLVVGLLEKIKRKFELGSNRELQEEENGQLNLTVIHESNKLHIRCIRYDKDI
                     ASKYTAESNLVISHAGTGSILDSVRLGKKLIVLINDSLKDNHQLEIAQAFEELNVLKV
                     AKGNLKEFVQLTKKMENCQFEKLAQPKGWILEEVLHSIWNQGQDNHRLSK"
     gene            <163858..>165345
                     /locus_tag="FOA43_003292"
                     /db_xref="GeneID:62196692"
     mRNA            join(<163858..163865,164439..>165345)
                     /locus_tag="FOA43_003292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923543.1"
                     /db_xref="GeneID:62196692"
     CDS             join(163858..163865,164439..165345)
                     /locus_tag="FOA43_003292"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779471.1"
                     /db_xref="GeneID:62196692"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="PFAM:PF00399"
                     /translation="MILNLGVALVLATSAIASYVPSEAWSTLTPDQTLSGATTDYDTT
                     FGIVVNAISTSSSATTTAANQKRDVASQVGDGQVQATTSAKATASKVTVASQISDGQI
                     QATSATKAGVVSQIGDGQIQATSATKAGVVSQIGDGQIQATTATKAGVVSQIGDGQIQ
                     ATTKTTNGASQIGDGQVQATTGASEISDGQVEATGSADSTGVNLESCKSDGSLAMTLN
                     AGILTDSKGRIGSIVANDQFQFDGPPPQAGAIYAAGWGISSEGNLAIGNTTTFYQCLS
                     GTFYNLYDKSIGSQCHPVNLEVVDLVEC"
     gene            <165897..>170900
                     /gene="CHC1"
                     /locus_tag="FOA43_003293"
                     /db_xref="GeneID:62196693"
     mRNA            <165897..>170900
                     /gene="CHC1"
                     /locus_tag="FOA43_003293"
                     /product="Clathrin heavy chain"
                     /transcript_id="XM_038923544.1"
                     /db_xref="GeneID:62196693"
     CDS             165897..170900
                     /gene="CHC1"
                     /locus_tag="FOA43_003293"
                     /note="BUSCO:EOG093401X1"
                     /codon_start=1
                     /product="Clathrin heavy chain"
                     /protein_id="XP_038779472.1"
                     /db_xref="GeneID:62196693"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="PFAM:PF00637"
                     /db_xref="PFAM:PF09268"
                     /db_xref="PFAM:PF13838"
                     /translation="MSDNPPIDLIDVCQLQSLGINPASFNFMCTTLQSDHYVCCRETS
                     DTKNTVAIVDLKNNNQLTRKSMSADSVIMNPSDFIIALRANGTTLQVFNLGTKQRLKS
                     NVMHEPVIFWQWLNDKEIGLVSANHIYLWNVLDGTENGPVQLTARHVSLASCQLTQMV
                     SNYDSSWFALCGIAQENNRVVGHIQLYSKERNISQPIEGHVCCFGKFRQQSAAADTQV
                     FACASRTATGGTLHLLEIEHQPNAPAYQKKSVEIFFPSEIANDFPVSIQVSDKYGVVY
                     ILTKFGFIHLYDLESGKKIFLNRISSDPIFTAAKFNDGRGLITVNRAGAVLAVEIATD
                     RIVPYILSNLADVDLALSLASRAGLPGAETLFTQQFNQSLATGDYQAAVKIAASSAQL
                     RTPDTINRLKALSAQPGQPAPILQYLVFLLDRGSLNKFESLELVRPLVQQNRADTLEK
                     YLKEDKLTCSEEMGDLVKSSSIPLALAVYYKANSSSKVVNCLAELGQTDKILPFCEKV
                     DFHPNYTALIQSILRVNPDKAAEFSTQLLVSQPDLKIEQIADIFFSQNYIQQGTAFLL
                     DALKDDKPAQGELQTRLLQVNLLNAPQVADAILGNNMFSHYDRPTIAALCEKANLNQR
                     ALELYDDTKDIKRVITQHGAEIPADWLVAYFGKLSVEQTIACLRSMLASKNKTQNLQT
                     VIQVATKYSDLVSAPTLIKIFEEYDCTEGLYYYLASIVNTTQDSDVVLKYIQSAAKMG
                     QTKEIERVVRDNNVYNGEKVKNFLKDANLEDQLPLIIVCDRYDYVHDLILYLYKNKYF
                     KFIEVYAQQVNPSKTPQVVAALLDVDCDENIVKTLLLSVVGRVPIGELCDEVEKRNRL
                     KILLPFLEASLQQGVTDGAVYDTLAKIYIDSNNNPEKFLKENDQYNTLVVGKYCEKRD
                     PSLAYIAYEKGQNDAELVQITNENAMYKYQARYVLNRCDAQLWAIVLSDDNQHRRQLI
                     DQIVGTAIPELEDPQPVSIAVKAFMDNGLTNELVELLEKIIIEPSPFNDNPSLQALLI
                     LTAIKVDPSRVMGYVEKIDAYDPEEVAPLCIENNLYEEAFAIYDKFEKYPEAMHVLTD
                     DIMSLDRASDYSEKLDKPQIWSQLGAAQLNGLRVSEAIESYLKAQDPSNFEQVIDIAE
                     HAGKEESLVPYLKMARETLQEPVVDGALINAYATLDNLDGMGKFLQLSNVADLETIGD
                     KLYDAANYQAAKLIYSNISNYAKLASTLVYLNDYQGAVDCARKASNVGVWKQVNQACL
                     DNKEFRLAQICGLNLIVHAEELDELVTQYEYNGYFSQLISLFENGLALERAHMGMFTE
                     LAILYTKYQPEKTMEHLKLFWSRINMPKVIEACDEAHLWPELVFLYKHYDEWDNAALT
                     MMDHSECAFDHASFKEIIVKVSNLEIYFKAINFYTNFHPSLLNDLLAALVLRLDLPRV
                     VRIFQKSDNLPLIKPFIISILDKNNSIVNQAYHDLLIEEEDYKSLQSVIEAHDKFDQI
                     GLAERLEKHDLIFFRKIAAIIYRKNKKWNKAITLLKTDKLWSEAIETAAMSEQSKVAT
                     ELLEYFVETGNRECTIATLYSCYSLVNYDKVMELSWLYTLGDLIKPYEISVAKETQTK
                     IAELYSDLKDRESKKEDDEDEESNAPHRLLITNGTGIPTGASLNYNPTGAGFGNGGF"
     gene            complement(<170996..>172168)
                     /locus_tag="FOA43_003294"
                     /db_xref="GeneID:62196694"
     mRNA            complement(<170996..>172168)
                     /locus_tag="FOA43_003294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923545.1"
                     /db_xref="GeneID:62196694"
     CDS             complement(170996..172168)
                     /locus_tag="FOA43_003294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779473.1"
                     /db_xref="GeneID:62196694"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR005251"
                     /db_xref="InterPro:IPR011559"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="PFAM:PF01008"
                     /translation="MDIDSMAPGEGCQFSGFDAIKGMYTRGAPAIMLVGCFSVVVELD
                     RAINKGEAELLGYNLENRAMFEHRFMERLKSLVESRPTAVNLANGCEKIRSIVNAEKL
                     NDLSSLFNCILTFSSNLYKDDLQANLSIGKNGVKYIYDELESENFHGDFAVMTICNTG
                     SLATSGHGTALGIVRSLHERARLDAGNGAFQMSHVYACETRPYNQGSRLSAYELKYEK
                     IPFTLITDSMASFLVETLCSQGKATSRGLRDPAPVKFIIVGADRIVKNGDLANKIGTF
                     QLSLIASLYPSVNFIAAAPTTTIDNSHSIGDEIVIEQRPERELCEVRGGEIEKASGDF
                     AIDPTTDHVKLTKVRIAPRGIHVWNPSFDVTPHKNIDCIVTELGYILKDSSGEFHM"
     gene            <172541..>175042
                     /locus_tag="FOA43_003295"
                     /db_xref="GeneID:62196695"
     mRNA            <172541..>175042
                     /locus_tag="FOA43_003295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923546.1"
                     /db_xref="GeneID:62196695"
     CDS             172541..175042
                     /locus_tag="FOA43_003295"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779474.1"
                     /db_xref="GeneID:62196695"
                     /translation="MPKEAPRVSQDLLQSSDNSAGGSSPTGATSSGGAVIPPYPLIDT
                     FATLTILMVLPSWLSVLFLLFYILLGSPKFFESSISLLFKHRLLGLHSTLPNSSEDHS
                     VTYFLSWFSFDSLLVGTILLVNPSILEYTKLLAKAFLAARLTSTRHRQVLDAIVSCVL
                     LLFVERFIQYLIKFIQLGDLHLALPFILHSSLTSSQDQLQQPKLQDQSESYKNTHPSS
                     ALTDLLGSTYIGSHRNPLKLLVYHLSFSNIESASRIVFGFDYFVEFFYSTLAVYTILH
                     RISPFLSKVVFYNSISKSLDNITTVAIPKRRRAHSRLGSSGTSSTSLKSLNVHSRLPS
                     LSGIHHYEKKVKANSTVVETINVPRDVSKSVLPSLLLQDNYSTAAEQAFSLGDSQLPN
                     SDAEHTFDGNTSTTNTSDTPASFPLDKQMGIMNDISSSSLVVAQNFENYCRVALFPLL
                     FPILNNNLTPTKGKLNPYLEKKIKYMGVRVQQPLWVFVNAARTMFGRKDLYSGDYYQH
                     NAVVAADPAVEDYVRSSNGSPQCFVWYTGETAVAFELRNISLDQLLVRVNGIIWEHVS
                     SAGLYGRELVMVNGLSPLSQYDIDFIKILDNGELRHFAATTVSTVHKNRTLTESKPST
                     PLATLQESVVTTQNAIDREKAKLKKLKNDWRKRSTALKSEIENLNNRSNMADESRNYK
                     KVESLRQAVAKLDIEVSNLSKRFEEIYAQQTEVDEKYLDEKRTYDSELRCHKSFQEEH
                     DEKIKDHEKKIKDLTLEKKQLLQKKDKLNQKKNRIQKDIEDMETEIEELKKKEIIWRQ
                     TQRKERSDKREQKYLLLMSDINKYEKREGLKNVKD"
     gene            <175959..>177584
                     /locus_tag="FOA43_003296"
                     /db_xref="GeneID:62196696"
     mRNA            <175959..>177584
                     /locus_tag="FOA43_003296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923547.1"
                     /db_xref="GeneID:62196696"
     CDS             175959..177584
                     /locus_tag="FOA43_003296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779475.1"
                     /db_xref="GeneID:62196696"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MSEELNIQEQGSESSSLVGETSEKENILSNDAPAAKDSQIPKEE
                     HGSYLALTIITFLISFGAFIYGWDSGTISGIVNTPDYLERFGQWSDSDKDYYLSEVRM
                     GLIVSIFNMGATFGGVTLGRLGDMWGRREGILFSTCIYIVGTVIQIAANHSWVQYFVG
                     RILTGLSVGCNCVLCPMYISELAPMDIRGTMVTVYQLMQSAGLFLGYCACYGSNKNYI
                     DSRSWRIPLGLCFAFALLLICGLIFAPESPRFLVKNNRIDRAKHSLSRVTRVPDASPL
                     IQREIDALLEGVEAEELAGNSSWKELVTGRPKIFYRVVMGVILQALLQLTGANYFFYY
                     SNTVFASVALDNSYVTSIIIGVVFFGSTFVPLYTMDHFGRRVTLLVGSAALAICLLVF
                     ATIGVKALYPHEYGVDPKKSVGGGMIFLVCLYMFFFSISWGPGPYVVVSESYPMRIRA
                     KGMAIASMGNWLWGFLIGFFTPFIAGAIHFAYGYVFFGCMVFGFIFIFTCVPETKGLA
                     LEDVDELYRKLKPGFAWRKIEIEGHDGEKKNDA"
     gene            complement(<178977..>183992)
                     /locus_tag="FOA43_003297"
                     /db_xref="GeneID:62196697"
     mRNA            complement(<178977..>183992)
                     /locus_tag="FOA43_003297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923548.1"
                     /db_xref="GeneID:62196697"
     CDS             complement(178977..183992)
                     /locus_tag="FOA43_003297"
                     /note="BUSCO:EOG093402IT;
                     MEROPS:MER0010982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779476.1"
                     /db_xref="GeneID:62196697"
                     /db_xref="InterPro:IPR030397"
                     /db_xref="PFAM:PF03568"
                     /translation="MDCLDNWTAIENRLLNYLKDPQSCDHGEALKYVTSVLDSLNQCI
                     LHKAANFDAELYKRSKLCIRVLDIFDNKEILIINAWLVLIESLLHYRECTPLAVTDLW
                     WTFGLFSSILPYDDTNFTEAPNWRTMFEGFRYKKNVYSLETVSLMTQFNVLLLKLYSK
                     SAQAKYGDLISMKEMIELTKKGSNFSAWFEGLPEDGFCDMSRELSLICQKLVSHSPCD
                     YSVRLLLLLRCLSYDAQCETIDSDLLTLIRSALNKTNRPLLNSTRQMFKEILSTYKSK
                     NIDTTQLRQVSMIYDETHSLDQEIDSDSSTSSSALTELLDGMEIVQFSKFSRMLATCS
                     DWSLLDSLSFGKGLYNAIKEANFTDPDSQYMICSTLSFIRRAGDVRIGRIVHILDYII
                     IKIKNMQVCDHSVFVNSVLEDLFDILSMKSQPKRVRNVSNLFFHFGGELLTTDNQSAL
                     QFWNRCVDIEYHIVLNSVDESERKLNFTSFKTKSERIANLLLETSEYQNAAQFLSKVF
                     SYPDCSTIFEYETCLMQNDFSVPVKLAVKLLLMSQSPELLLLISQKESYLVALADRLV
                     SVLTSTKHYACQKLVSKIIILLKNELHDNGLFLYFLSRIAFVMEFNMTFKSMGNLEFE
                     PESDVYSLRKIIKAHIYILQSFSSTFDPDKSLLNAYNNLLEFWRRPNTTSILDYEIDV
                     IVSAAEVFEYHYLFCPAASFLEPYVKTQLVNLPSRQQRRVALELAKCYFYLHQPAHFC
                     SLNDIFIGQDDVASMSYRLLKLWINLRLGNSPKQLEDQYNILLSRLSEDTFSISKERN
                     RYAVIDKLFLLSQVSNEYSLLCASNSQYVCSVISSKRAIRILQSILKNFMLQSNSSSF
                     GLNLSSKVLLKYRFSKSMIECYETLLENLHQSGLGKEFDYFTKEFWTFVNSQPSLYVK
                     SRCLFQFAIYYSYQNRLVEAKRCLDLATSQYIHLGIMDKLLGLTKLLANEIYYEKLGD
                     SQTFLGFVHQYDHCIKQLLGAVPMQSSKTKFSNAEILRSYDYSNDTDMLTKNWMSIQL
                     TRSLSPYWQHTESPFPSSDKLFAARVQFNERCTYSSAYSTLQILNDSVISFPSSCSVK
                     NMGTEVSTVSNSAEVFSAACSDLRASSSVEFKDSLLRLALSIITMIPCSSVDSAKKWI
                     SRWKDYANSYNSRQFAIERCLSKTIEDPKVFLSPHFSFEVSEVDSLTCQQLTNIIPDD
                     WMVIELECMPLESGLTVTRIKSQDSNPLVVRLPFGWQRGGDIHERFTVTDAIQAFEEI
                     IKKSDETTAYEVTSRIRTKEDKAEWWSIRKGLDKGLGRLLRKMESCWFGGFGSLFGSM
                     LFTERVVKDFKNTLVEAIVFRLPKGTSSKVVDRLNGLETWIFEMFLQLQENPDDQDSL
                     TEDLVYFVLDTISGYGEDIAYDEVDVNKLCQEIGQYQLGVPSCGDSIHHIILVASGEC
                     VKLPWESIPSLRNKSVSRMPSLGMITEYLQDNHSLLEEGINPGNGYYVLNPGGDLMKT
                     EQRFKDKFETMAGWEGVCNNKPTENDILKSFERSDLYFYAGHGGGEQYIRSKTIKSSS
                     KIPPCLLMGCSSGYLHVEGDFYPYGTVYHYLAGKCPMILANLWDVTDKDLDKFTLNVL
                     EKWGLLVDYDSFASMDEDPEVLTICRCVADSRDVCKLKYLNGAAPVVYGLPLKLKPND
                     TDI"
     gene            complement(<184224..>185696)
                     /gene="SHM1"
                     /locus_tag="FOA43_003298"
                     /db_xref="GeneID:62196698"
     mRNA            complement(<184224..>185696)
                     /gene="SHM1"
                     /locus_tag="FOA43_003298"
                     /product="glycine hydroxymethyltransferase shm1"
                     /transcript_id="XM_038923549.1"
                     /db_xref="GeneID:62196698"
     CDS             complement(184224..185696)
                     /gene="SHM1"
                     /locus_tag="FOA43_003298"
                     /codon_start=1
                     /product="glycine hydroxymethyltransferase shm1"
                     /protein_id="XP_038779477.1"
                     /db_xref="GeneID:62196698"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="InterPro:IPR039429"
                     /db_xref="PFAM:PF00464"
                     /translation="MFTRSFLRPATRAWTVQAKRYYAISAKQLDLLSNHVDKVDPEMN
                     ELLKEERQRQKKSITLIPSENFTSEAVMDLLGSELQNKYSEGYPGERYYGGNEIIDKV
                     ESLCQKRALEAYGLNPDKWGVNVQALSGAPANLYAYSAVMNVGDRLMGLDLPHGGHLS
                     HGYQTKSHKISFVSKYFQTMPYRVDETTGLIDYDMLEKTATLFRPKIIVAGASAYPRI
                     IDYKRMKQIADKVGAYLMSDMAHISGMVAAGVTDSPFPYSDIVTTTTHKSLRGPRGAM
                     IFFRKGIRRVTKKGKEIPYDLEDKINFSVFPAHQGGPHNNVIGALAVALKQAMTPEFK
                     EYQENIVKNASAFSDSLNKKGFDMVTGGTNTHLILIDLRSKNIDGARVEAVLERMNIA
                     ANKNTIPTDSSAMFPNGLRVGTPAMTTRGFMAPEFDKVAEFIDRAVQIAVDLKSKEQG
                     GKAKEKLANFKKLADCDPRIKALDAEVVTFASEYPNPGDH"
     gene            <186912..>189248
                     /locus_tag="FOA43_003299"
                     /db_xref="GeneID:62196699"
     mRNA            <186912..>189248
                     /locus_tag="FOA43_003299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923550.1"
                     /db_xref="GeneID:62196699"
     CDS             186912..189248
                     /locus_tag="FOA43_003299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779478.1"
                     /db_xref="GeneID:62196699"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR019734"
                     /translation="MSDWADDIYDDDEEEEELSFEEYSNADEDKSGNNSEMSDDNSDL
                     DIEGQYFLGKEHKEDEDYNSALQIFEKIIDLRKSSEYSQNDYIFKAIKQAIKVCQEMA
                     NYDGIVKYVGLFFLQARQVSKSYRDSSISKLLHRFDRGCNIPQVFLKAIYQRFLDYLT
                     TVENATTIEKKIYVRVSLCMANSLISEGDYENASEILIKLESIVLNSTDGIRSSYLLD
                     VLASEMVISSKYKFNLAELARLTKLANSSVSGIPQSRITGTIMECSGLVAMYDDDFKA
                     ANKYFQDSFKGFNECGDDKRIGVLVKFIVSNILSESEINPFKSSDFQGFLKLENIKLL
                     MSAYNSVHDVDIDRYNQIIRGDQFAQLVSEDLFLRDFLPHVTEIVQVRYILKYLSIFT
                     KLSFQTLCSKLRMSDVQLESLSLRLFNSGRIEKIKLDFVDKVLLRSDSDDTQLFDKDL
                     SSFDVLSNILNSHSDNTDISQLPEEAEEIRLKVNNNQGQFLPYSSPFEVSLSRSDENM
                     DLNPTPSMSSTRTAVIGDTVKRLKRMDNQAIGSNFLMVGSSSSSDGKSMANLKQLQND
                     ICLPFKIIPHESLPGCFCQVHSKTELLSKLGDYLEFMKSGIPTVKFHKVSHIEKVMRD
                     KLESEFNDLNQKEVGKNEAETLSSNIDENVPEVLQTTTMSNLEPSQPEDEAETEARRQ
                     LFNMSKDQILERKMESVMKIARTLNEHRIGSLLAFKKGLNMSMFDKNLEGVKILGSNQ
                     DNNNSTSNLRVSPLIWRPTERLDTESIESGSMGGYDDE"
     gene            <189449..>190021
                     /locus_tag="FOA43_003300"
                     /db_xref="GeneID:62196700"
     mRNA            <189449..>190021
                     /locus_tag="FOA43_003300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923551.1"
                     /db_xref="GeneID:62196700"
     CDS             189449..190021
                     /locus_tag="FOA43_003300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779479.1"
                     /db_xref="GeneID:62196700"
                     /translation="MKTVTPELREDSEARNLLMSHSKLTPKSTKRIMKGKELKKHLRI
                     TQLYGKRPKAKKYSEKELDLPILNETVNPGAIKRKGKKGKKFIPDGDDVTMNRLIRQV
                     NDDKDKVSESKLEKSKRLEEIRELRKKEIDRKDQRKKDELEVVKDELRSKASLARSVR
                     RKNAKLKRQGDESVANDDDEKNKKKKVSFA"
     gene            <190349..>191503
                     /locus_tag="FOA43_003301"
                     /db_xref="GeneID:62196701"
     mRNA            join(<190349..190357,190411..190418,190486..>191503)
                     /locus_tag="FOA43_003301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923552.1"
                     /db_xref="GeneID:62196701"
     CDS             join(190349..190357,190411..190418,190486..191503)
                     /locus_tag="FOA43_003301"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779480.1"
                     /db_xref="GeneID:62196701"
                     /translation="MLRGVGTSLASSNMKFGFFALRLVALQPLSISAGSSFENTAPLL
                     VSSPLYSTDEYRYITRMKDAQKTVSQLSEKICGSSDDDDKLLYLRIQRLDEISNIQDL
                     IAGLKSPTHPLAKLADHVIYNKKDQDDLLVSGSCSNGITHINSKGVSTEQWIDKLLNS
                     DSRVNIIDFYSQDKSQLAESLKALALVYSPENLIVQGLPSFEKPDSVFKLASQKLSSF
                     AIFGKRDDEEDEKEEEEDLEKLQQELDESFLEINQMMAEEGSSDEPVHAYEEDEEVDT
                     NSKGKKKYVPPEGSLFDKYTFFSSGLWMAIIVSGFLFTIIAVAFSWLNSIQISYGAFE
                     KPVNMSKKTQ"
     gene            complement(<191553..>192878)
                     /locus_tag="FOA43_003302"
                     /db_xref="GeneID:62196702"
     mRNA            complement(<191553..>192878)
                     /locus_tag="FOA43_003302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923553.1"
                     /db_xref="GeneID:62196702"
     CDS             complement(191553..192878)
                     /locus_tag="FOA43_003302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779481.1"
                     /db_xref="GeneID:62196702"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="PFAM:PF01222"
                     /db_xref="PFAM:PF06966"
                     /translation="MSDLNPKSKTLDFGGSVGALILTIFLPLVVLGLYLCSNQQYHLD
                     GVNLDSEKIIEIVKSELIDNWANYFCNKTCWIAYLCWFFGLAILDLIIPGTWKQGVEM
                     RDGTKLWYLINGKELSLALFALLFSRTWFTGSGFTLPELSFLYDNTLPLMITTWEFSL
                     CLATLCYILSFVPLFSPNGKGTRERILALGGNSGQPLFDWFIGRELNPRIGLWDIKLY
                     CELRPGMLLWFLLNLSCLQQQYQKLGYVTNSMFLTNFLQAFYIFDGVFNEEGCLTMMD
                     TTTDGFGFMLAFGDLCWLPFSYSLQARYLSLVEVNLPTWAAIGIVLIMLLGFWIFKSS
                     NNQKSAFRQGKLPQMKFIQTDRSTKLLVDGWWGMAQHINYFGDILIASSWCLPTGFNT
                     PLTYFYVIYFTCLLLHRQKRDEEKCSDKYKKDWQQYKKQVPWKIVPYMY"
     gene            <193276..>194340
                     /locus_tag="FOA43_003303"
                     /db_xref="GeneID:62196703"
     mRNA            <193276..>194340
                     /locus_tag="FOA43_003303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923554.1"
                     /db_xref="GeneID:62196703"
     CDS             193276..194340
                     /locus_tag="FOA43_003303"
                     /note="BUSCO:EOG093424I0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779482.1"
                     /db_xref="GeneID:62196703"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="PFAM:PF00459"
                     /translation="MSEIPYSKETYVAQLAVRRASILTKKIADEHLQKGISKQDRSPV
                     TIGDFGAQAIVINSILKNFPQDQVVGEENSSLIKSQHLEASILKEVSWVQKQDSKFND
                     ILGTIDNADQLCNSVDKGDSKGGRKGRFWALDPIDGTKGFLRGDQYAVCLALIVDGQV
                     QVGVIGCPNLPHELRNSSSKRGGIYTSIRGHGSYFQDLAEEVNISFNSSKRIHLHNEF
                     DVSQSRVVEGVEKGHSSHELQALIKQKLGISQPSVNLDSQVKYCAVANGDAEIYLRLP
                     RNVDYREKIWDHASGWLLVNEAGGKVTDMYGNDLDFGYGRTLNSQGVIASTSTLHPKI
                     IAAIKEIVGDKGEELYKYCK"
     gene            <194495..>196093
                     /locus_tag="FOA43_003304"
                     /db_xref="GeneID:62196704"
     mRNA            <194495..>196093
                     /locus_tag="FOA43_003304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923555.1"
                     /db_xref="GeneID:62196704"
     CDS             194495..196093
                     /locus_tag="FOA43_003304"
                     /note="BUSCO:EOG09342LHF;
                     CAZy:GT57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779483.1"
                     /db_xref="GeneID:62196704"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="PFAM:PF03155"
                     /translation="MARIVSLFKSSPLNDFLIPFRKAQNQWVARYIIIVFALIVRSAV
                     GIGPYSGEATPPMYGDFEAQRHWMEITNHLPISEWYFYDLQYWGLDYPPLTAYHSWLM
                     GKLGSFIDPSWFALNTSRGLETADLKSYLRITALIAELAIYIPAVQMFTRWMGRYYRK
                     VTTIDQTIISAAILYQPVLIIIDHGHFQYNSVMLGLSLLAVVHLLYDNYCLAAILYVL
                     SFSFKQMGLYYAPIFFFYMLSACTWSSDTHSFDLQRLISIGLCVIVTLGVQIAPFLIF
                     GGLGQPQQILIRMFPFDRGLFEDKVANFWCATNIVIKYKKLFTSEQLKAMSLALTLLG
                     ILPSSLVIFFNRRKELIAWCLASCSMAFYLFSFQVHEKTILLPWMPIVLLLNEVDPDV
                     ISMVCWFCNVALFSMWPLLKRDNLIIQYFVLGVLSNWLMGNLSWIRRFLRMIKLPVKY
                     RDLATPVLPHNWFWSLVIVTSYLAASALHIADAFVQPPRSLPHIWIIGNVVLSFGCFM
                     LFWLWCNYKIFVMCTTPESKLKTN"
     gene            complement(<196153..>198141)
                     /locus_tag="FOA43_003305"
                     /db_xref="GeneID:62196705"
     mRNA            complement(<196153..>198141)
                     /locus_tag="FOA43_003305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923556.1"
                     /db_xref="GeneID:62196705"
     CDS             complement(196153..198141)
                     /locus_tag="FOA43_003305"
                     /note="CAZy:GH17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779484.1"
                     /db_xref="GeneID:62196705"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR017853"
                     /translation="MSSSKNISAFNHSGSSLAVSAILDDYGEPESLTEENYENNDFTE
                     ESTAKEGEDSIHVRPLLAAQKSQLQVLPECIPGSSYPEMVLLNTSSPAKRTKQKGKNG
                     ISPTSGSAYSNLQRYKAFKEPSSDISNSKASHKESFEHLNLVSPTETEEDASSSGTYA
                     GTLREAKTVGVDTAEKSNKGQESLEENGFLPKSYAFSENNQNVGSQTPHVKYPQQETS
                     KFQDKSPKLQIEDTLENQLGDVQDEENGENDRTGKASRFPEINLWKYVCLGVLGGLIL
                     VYLIAVAVRILDVTLNPNKSAQPENFIQSFERFDNLTKQEIVSYILENYSGMSDVVVE
                     KKNKSGPGANTTHWIGIENSFENINHAYRSDKEIELLMTSDNLHQVFHSLAYAPKGVM
                     EPQCGVTQRDVILDVARLSMVTNKIRTYGTQCNQAEYILKAIQDLGVNMTLSLGVWVA
                     EDDYVNWRQMDEMKYLLKTYPRDMFDAIFVGNEVLFREDKFPEELVQLITEAKNYAIS
                     LGYADLPVGTSELGSLVNEKVMEASDFFGINIHPFFGGVNASSGTNWVLEYYKQQVVP
                     LINPQYNKKIVISEVGWPYKGGSYQGADATPEDMQKFLNDWICKVPQDKYHTIYFEAF
                     NEPWKSIFYEEGREWETEWGFFTEDRKLKPGISLPICD"
     gene            complement(<198298..>204096)
                     /locus_tag="FOA43_003306"
                     /db_xref="GeneID:62196706"
     mRNA            complement(<198298..>204096)
                     /locus_tag="FOA43_003306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923557.1"
                     /db_xref="GeneID:62196706"
     CDS             complement(198298..204096)
                     /locus_tag="FOA43_003306"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779485.1"
                     /db_xref="GeneID:62196706"
                     /translation="MGAPNIISDSQSEVDDDTCITWNYIEAANKKNEEQIFRRQQHIL
                     KDLKPLTYDFSDLPTQRTRRHVFCQRHVYTADLSEYLNLSSREQLDTLSKNGKSDEEI
                     LYMLNRKYKKLRKFYEGLGIKRHRFKKKNFDVYLDDFKKYQTGRDGRSFYEMQDQALD
                     DLEDQKRLNDLLEKELQDVDTTEDENEVDTDNEKVPEQLDPNAYLNDNEDASQQVIMS
                     TNRRRGRVVEEKAVVSLLSDDKKEEEKINEAKSTSQEMIVSAGHEQFDKSRSSTFDQH
                     FPPDKIVPVVQSFHSTDRLPSSLSSSPVAPLRVSRRTRRHKFSQDHVYVTDTAVHLGL
                     VSAYVLNDMYDSNESYDQVIQFLEVSYKHKRDQRVVKEIGLGPFAKSTFQSYLDDENK
                     HLISDGRRLVVGQNEQEDSMKEFLKNDNFDISDEDYVFPDDEHSTHDPNTDTYAESED
                     DHVFDIPSDSNSRQLTTGFASRSLISSSEPSNDDDKFMFRNRLLNKRMALHGILPASF
                     YKVSGERGSRSHLNVYKSKRGFNADSGPLLPGIARRKKAVHAQVSAPLDEMTRFLAPD
                     SEPIEGMEADPAEYHKVSKTLEDLKGNTDESVFLIPSDSENGSGINSDSSHEMSEVED
                     DDDLITVNDYDVFIDHMRDDMNMDGSAEEDNRTGMNYMLSREPRKKGVTTKKRKRPSK
                     GSNTLKMRSLPKMTRPGGKYTKPGFHRLPSSRFRKLSARNHISSSSISHPDVVWLSEP
                     EDGHMTVYDDGFEGSDDSVKKSFLLNNSPTTKSVKETDNKTNEGYARTYWTPRISKSG
                     QRSERKHVRQETRPSRSRRSRDSYQTSGVWNASSFQDAFYFGRNKVNGTPQVEGTFSE
                     PYSQCPGVTPNERLKIDVKRHAPSRNTFIDTVTKLDRAVNEQRPLATSLDNITLQMYQ
                     SLQLRSNSVVYSRLIQECLKLEGDYFKEDDTVFEYCSVRFSISSYGPFSECPGLITAL
                     LKTIQASLGEAKTITRQVLIELRKCLIRMIQLLWNLKHSSFNNLKAVGRILLEFVREQ
                     QINLKSDKLKLLCLPYHLIFMDLLHKIMRSENDMEYVKYEKEAGELERAYIILFCSMP
                     APKVYKYFKGGSDKQSFFFEAGCLFLSLSPNPWQYVASIAMVEKKRLPVISVVNFLYF
                     VHSRLPVLVDWEYFIMKMDALKSESDPEKWLLVFRSILKVMQDTSWTFEEDLLVKMYR
                     LLSSRRFENIGALRPTMLWYSTLPVSNVFLERDGCLDMYLKFLVLYVRSRLDHSREAN
                     LMERLVPIASVKTSTIMLLKNRANVMLVMSYLFRKDFLGHFRMIFKAILDFKTSESYK
                     IILELLLALSRCYFSLFQKLPLGIIRHALPQVISAVNEGGIGIVIVAESLRNLVDCFD
                     NQLGNGIDDPRKLLQTVDLTCIFLKLEVVGTGSRMTYIPNTILAVLKRVLEITDTKIL
                     LSMEPKLKTELVVSLKSVIMSISFKNDDLKAKCVLLWIYLSSRLNVTAGSLTYIEWQY
                     FADSSIRTRFELPFYTALLKYYRPVDLRYLHENLFMILMKNLPIEDNHFFSSFFVALA
                     AQGFMHRYVTFRSGLDVTKFSEKDLRHYKQQITVKILAQLVLELKKVNPDGKFRDFLT
                     EYIKALEKEYTFHERTTLNPGKYNVYATRIVRYLYTVVGKMLQDLPEFIILKRKLSIT
                     QILSSLNEQLESVSSTNELYLLLESEYITSLKCNKFREFETDLVNYCLNNDGFIDDDQ
                     RVSPIIALSTLISSHVSLVLFDKKFWFHFGNWFSIFTHLVLSECTYNSDEIWHIIKVL
                     TLLTKISGTSEYPSYTYHENVSIICVYRIIERLGTYLLGFEDMVEFLESIDVLRGLDS
                     VVELSVARDLFISISNEELDKQVRKVYSESDAVLSRVVKPEMREEMIASSRLEKNEVS
                     KAVMEYITNFKTSVDVAANDFNTVLTQNLQFL"
     gene            <204773..>206790
                     /locus_tag="FOA43_003307"
                     /db_xref="GeneID:62196707"
     mRNA            join(<204773..204778,204793..>206790)
                     /locus_tag="FOA43_003307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923558.1"
                     /db_xref="GeneID:62196707"
     CDS             join(204773..204778,204793..206790)
                     /locus_tag="FOA43_003307"
                     /note="BUSCO:EOG09340DA6;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779486.1"
                     /db_xref="GeneID:62196707"
                     /db_xref="InterPro:IPR005613"
                     /db_xref="InterPro:IPR022782"
                     /db_xref="PFAM:PF03915"
                     /translation="MLSLRKSYITSGLDVSDMTDVPRLLRGVLEESLILEPSQQSLDS
                     FLPKVGQIITDLMKILKMKQAEFQRVTEARKSSSTMLSVPETFPDSLSTPSSSHSAPS
                     IKISPINNSQASSENLQSSSPNKSMLFSPSPKDPLARLQNNHALMRRASKRFSAYQTS
                     KIISMNRTGTSSPVSGYTLPTTDEDTLTKSPNGNDPQPALPSSPLQEEVIKNIRESEL
                     DKTLSHSLIEEDDSSRTSQASRTTTVYHLPGGKGRIYLKIGNKVKKADLKLPTTLASI
                     KVLFTQKFDYSPNGEIYPAIYIQETSSDVSYEMENVEDIQAGCILSLQQPDLATVICQ
                     HLDNKFGLMRDEISKIEKLTVGKPIDKEDKVDAEENSKQASIINDTVVVSLKREINEL
                     KSELIRARQQQAKTKDQLTDNVGSLLTWVQELQAISLSPTGLINNPYMDHCRTKVSSE
                     CELLVSRIDNLQDLIEVLKVDITKRRSRPSEKQVLQIQKELGSTKGNLESLTKYMVKE
                     RNNWNNRWQSELTAVLEEQEFFKEQETIVQLLGEDLGSADETFDLIVKCCEELAKNAN
                     ILKGPRLPVVDPSVSMHDVKNMVLQEVESLNPDHGQRVDAILKAEKVRDMERKMLNKT
                     AFEQELGDFVGNSKLKSNGGVDEVERQRKLKDEENLKSQFGGI"
     gene            complement(<206799..>209291)
                     /locus_tag="FOA43_003308"
                     /db_xref="GeneID:62196708"
     mRNA            complement(<206799..>209291)
                     /locus_tag="FOA43_003308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923559.1"
                     /db_xref="GeneID:62196708"
     CDS             complement(206799..209291)
                     /locus_tag="FOA43_003308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779487.1"
                     /db_xref="GeneID:62196708"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR003545"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="PFAM:PF12009"
                     /translation="MRLREYVESFVDLPLEDLITGSLYQEALRIFDAVILVPSSDPRK
                     IPRNIQFAAEYEDHEKFIDTIVAYLMNEDQQDVLTCGYIDGGQLLNVSSPFVCPGVNF
                     SIQLLKSPAFKAIRHIVPGAQGFLQLLFNYDGYMGVNGLKLWGPLHDYKYKHVKNDSR
                     TVSYRDMLYQEPATLKGRGPLPETARECLREIFPDEIQVEKKAPKRFRKITKILKTVM
                     INHTKKQYEYPYILESVCGNASVQGDDFLKMATSKKFVVRFVLIIVDKVFPLEHIGSS
                     SNKAVLFTKIAEFLHVSLREKVDVKNLVRGLKIDEICWLKPRADVRMTKPEFLRAQSM
                     LEKYLKWFFGRFISGLAGSFFHVTEGSQKSIMLFYRHKVWTSISNRFKGRYFVKHLDK
                     SLESTNSLKSFFENDDFVAKLKFLPKPKGFRLIAPPFKGISQEHFSYMEYEKDYMQPI
                     LSVLQAVRAKNDGCISSVSNLIIKVSQFKKRLVSEFGSFPKFYGLKFDVKSAYDSVPL
                     DLAKRVVRQQLNSYSETESIVVRQFQTLDEKNVVTSRKRRKVMSAQVETLESVEELAC
                     RNDKPSVEKTHPIVLTKSEIIRFVDDQLSKMAVVYHGITYKRKIGLFQGFNLSGILFD
                     MVYDTVLDYIKKATHTDTDAHTGVFRLVDDFLVLSTDEQVIHRFRKLICRPIHEFNLN
                     INRLKTDCSDESLTFVALDISLKDISFLKPVDSYISNPVNLPSFAALYKRLMYSFEIR
                     FKSPIFAFAHNEIHAIRENVHHLIKAQTLRFISSYRLIKKRDCFVPELFHSFLNDMFG
                     SIQKKLPFPKLALEEDDLKQDVYALLRSNRVL"
     gene            <209406..>210415
                     /locus_tag="FOA43_003309"
                     /db_xref="GeneID:62196709"
     mRNA            join(<209406..209411,209459..>210415)
                     /locus_tag="FOA43_003309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923560.1"
                     /db_xref="GeneID:62196709"
     CDS             join(209406..209411,209459..210415)
                     /locus_tag="FOA43_003309"
                     /note="BUSCO:EOG09343YC5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779488.1"
                     /db_xref="GeneID:62196709"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="PFAM:PF00383"
                     /translation="MTTEDNINYDNYVFYKKFKRIQLSQSMVVPKLELYWIATIEPPQ
                     SASIVKLTKSRFDYTADKIKHLKRFRKKIDKKGKVLLDVVICPEDDIEENQLREILKR
                     CLRADDTIVYKIGIPVNKPYGKELNLEWSQKYWPLVWKGNPMLQELDESFKEFDEDTV
                     MKYLKQIVELSNGHTDKQVPVVTIFVDHLTDQVMSLKMDERSEQDPMKHTILSCINEI
                     ACKEQSRREQNEDTAMTNKYLCLNYDVYTTHEPCTMCSMALLHSRIHRLIYINTSPVT
                     GAIGEQSGCRYMIHLSCTLNWKFEAFQYIGDSLRVLQLDPSIHV"
     gene            complement(<210422..>210916)
                     /locus_tag="FOA43_003310"
                     /db_xref="GeneID:62196710"
     mRNA            complement(<210422..>210916)
                     /locus_tag="FOA43_003310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923561.1"
                     /db_xref="GeneID:62196710"
     CDS             complement(210422..210916)
                     /locus_tag="FOA43_003310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779489.1"
                     /db_xref="GeneID:62196710"
                     /db_xref="InterPro:IPR018565"
                     /db_xref="PFAM:PF09447"
                     /translation="MSDTENLNSKDILRNYLEKELFQVITKQQFRSLFNKVARRSVDD
                     SMVNELFALLNQQKNRVINKRIDDNIENLKLVSYYDSKHVVETSKISDDEFSKLVASM
                     MLLDNSLREDITQVESECKNQLKEINRIVDKLQKCKCDSSDNDKSLGKLQKTLESIEG
                     ELLK"
     gene            <211162..>211551
                     /locus_tag="FOA43_003311"
                     /db_xref="GeneID:62196711"
     mRNA            <211162..>211551
                     /locus_tag="FOA43_003311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923562.1"
                     /db_xref="GeneID:62196711"
     CDS             211162..211551
                     /locus_tag="FOA43_003311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779490.1"
                     /db_xref="GeneID:62196711"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="PFAM:PF01920"
                     /translation="MELLPEGQKNNTEVNWEDQQKINNFSTLIARKDRLSEELKGYRT
                     EKEYLDDLSMEIELLDEDEKVNYKIGDAFILLKQEEAVEKLQQENDHLDNEISRLESL
                     VEDLDGKLAVLKKQLYAKFGTAINLER"
     gene            complement(<211580..>213382)
                     /locus_tag="FOA43_003312"
                     /db_xref="GeneID:62196712"
     mRNA            complement(<211580..>213382)
                     /locus_tag="FOA43_003312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923563.1"
                     /db_xref="GeneID:62196712"
     CDS             complement(211580..213382)
                     /locus_tag="FOA43_003312"
                     /note="BUSCO:EOG093416JQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779491.1"
                     /db_xref="GeneID:62196712"
                     /db_xref="InterPro:IPR032563"
                     /db_xref="PFAM:PF16282"
                     /translation="MASDILDVLNISEETRVQGKELKQQQKHEREETVEANNKKRKMN
                     RELFNLIGPNLPPVALHKQSVKFKDKLSSQELTHWSWRSFKNGARGKDKLVLHHWIKS
                     KVKTTEEDTVKDDDDLEENYQFEKYNTELDIPDFTEEYYNEHLKDLDGNWSYNETRYL
                     FDIAKSYDLRWAVIGDNYEFVKEIPENKEEKEERENGGSDANQEIDKDTNEEAIKDKI
                     EENDDEAVAKPGPTEESSLEDADGSENENAKGESEVAEKQDQDDDKADDGKENAAKIT
                     EEVSESTKASESPKNETQKEASEALGQKKDTSSSEGRTLEDLKDRLYKVSAVILESQS
                     DAAKDATLIRNLKAFDKNKEMERRSYLTHLLERAPTEIAEEESLVIEARKLELAAKKM
                     LTERAQLLQLLDSPQASASVQKYMTSAGLTQLYNSLMNADKSKKRKPEAPVAPQLGPN
                     ALPHTQLLQARQQQANHGALLKTKKKHRSNSPTSRLDNNGGNNEIQELLQSRLTPEQM
                     EVYGITVHEEKIQPGVVIRSQKLPSFKPAVQSKINETLNEMGIAVRPVMPTAKVCSRF
                     DRLLRSIASLIDLKKQSDNLETEIGLIKRQKNIN"
     gene            <213652..>216117
                     /locus_tag="FOA43_003313"
                     /db_xref="GeneID:62196713"
     mRNA            <213652..>216117
                     /locus_tag="FOA43_003313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923564.1"
                     /db_xref="GeneID:62196713"
     CDS             213652..216117
                     /locus_tag="FOA43_003313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779492.1"
                     /db_xref="GeneID:62196713"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="InterPro:IPR036317"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00888"
                     /db_xref="PFAM:PF10557"
                     /translation="MLPNSTRGRTKIRPPRKILSSEVDVEKSWAVLQKAIEEIQHKNA
                     SKLSFEELYRNAYNLVLRKHGKLLYDRVEGQIRKCLSEQVRLGLLNKLASSGIDDRQF
                     LQALNKEWEDHLLSMRMISDVLMYLDRVYAKESHLPLIYDVGLNAFRDSVIKYNNNEI
                     GDKIITIIIDYLNRSRLGEIVDKFIIKAVIYMFESLTEVVNIDISSVSGSANYGENYY
                     LHYFEPRLMLSSHEYFEDKSIELLDQRSGVIYIEKVTQLIQDEESRIQMYLPDVSAPK
                     MLELMDNDLISRNLESIMMFETDGLKLWINDDNYTLLQLLFKLITRVDSEHEMLKRRL
                     RSIILENGEEINQLSNEQLEQEVTQKKQEEEKKRIIAEAHGKKLVVRHRSSKEQATRY
                     AIRWIHNFLSLKRKYDLVAEKSFDNNIGILEEIDAAFSTFFNSNNKSAEYLSLFIDDC
                     IRRSLKDKSSDEVEQTLNNCIVVFRFIKDKDVFEKYYKNHLAKRLLQQKSLSSEIEMN
                     MITKLKQEIGSSFTARLEGMFRDIKLSQELSSDFNNRFARQDVGETDAGAEIRQKNHG
                     RKLELDSSILTTSFWPMPINKSMHSIQYPDELQVLKDQYEVFYDIKHRGRNLTWAPNF
                     GTVDIRIHYPKKTYEVNMATLAAVVILKCFNDSEDLRNKHTFEEIQGITQIPVPELKR
                     HLQSISVASRSRLLKKTPMSRDICAGDLFEINEHFKSPQTRIKVLTVASGSKVEDDLQ
                     RSETMEIINKSRIMETEAAVVRIMKARRELKHQELINEVIKQLLNRFKPQPSFIKQRI
                     EDLIEKEYLKRDEKDRSIYQYLA"
     gene            complement(<216168..>217826)
                     /locus_tag="FOA43_003314"
                     /db_xref="GeneID:62196714"
     mRNA            complement(<216168..>217826)
                     /locus_tag="FOA43_003314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923565.1"
                     /db_xref="GeneID:62196714"
     CDS             complement(216168..217826)
                     /locus_tag="FOA43_003314"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779493.1"
                     /db_xref="GeneID:62196714"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF00582"
                     /translation="MSLEGAMEEERRLIAQILERQQLNAMTTDRDGRRDRTLSRSTTR
                     GLSRSLSRSSSWDPDEHFMITSQDPSLRLMPDYGKSDSEKGDYDNEAVPGADTHYGGD
                     ETSEEEQISDTDNEFSYDDDGSVLPNYSTYTALAAASPPSSPGMKHVSLQRNSSSRDG
                     SSDNIRGSRPSSSISPVRTSSNRGTSSLYSTTFGPRIHTKDEEIVHIHNRKLIKDAIQ
                     AEKLDEMLAAERAAANARAIGRDVSTDFMKQVEETAVEAGTQIHVDPENFYKNNPKRK
                     EKLQEYAKYKKKLTSSPDPTDGFVIPYTNDIEEKIDSELARVLNENIKISAIETNSET
                     QRSVRTITRGNFFEILIGSGLKHPKSFIICLDFSEESKNALEWCIGTVLVDGSVLYVL
                     NVIEDDEYSSMQLNGIQPRGKRNSTANRSNSVKGRKKLSQKSRDRLREENVERITKDI
                     LSLLKLTKLQVHVVIQSSHHPIPRHFILCVIKHISPTLIVVGSKGASAMKGVLLGSLS
                     NYLVRKSTAPVMVVKHKLKKLTKKGKQFNNNVGTLHSLAEARVD"
     gene            <218477..>219763
                     /locus_tag="FOA43_003315"
                     /db_xref="GeneID:62196715"
     mRNA            <218477..>219763
                     /locus_tag="FOA43_003315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923566.1"
                     /db_xref="GeneID:62196715"
     CDS             218477..219763
                     /locus_tag="FOA43_003315"
                     /note="BUSCO:EOG09342T3K"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779494.1"
                     /db_xref="GeneID:62196715"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="PFAM:PF00587"
                     /translation="MPFTLSDNYCYKYETLNNLRSEMLATRQRLNIMNKQMKSLIIQE
                     KKKGVDHKEEKITTAKVIKQLKEPLERVSEKCNELEDALTAEASMLPNLIHTSVASKQ
                     KLVKYLNPTKEIIDSKLDDFPLTRNTKLDHKDIMERLGLVDFREATRVSGRGWYYLKG
                     DAALLEQALVQYALKLARNCGFKMIIPPSMVKTDITNACGFRPRDQNNEKQVYELTAD
                     DTSSNRLCMTGTAEIALAGLFSNHEFKEVDLPVHYVGVSRSYRAEAGAAGRDTRGLYR
                     VHEFTKVELFSWVKGDETVSMKEFDRLANFQMRFIESLGLTARVLIMPFNDLGAPAYK
                     KIDIEALMPGRGAWGELTSVSNCLDFQARRLTTQYRDAKDGKLRYVHTLNATACAVPR
                     VILAIVENFYDPQTDTIVIPEVLRSYMDDKERISKQ"
     gene            complement(<219798..>222440)
                     /locus_tag="FOA43_003316"
                     /db_xref="GeneID:62196716"
     mRNA            complement(<219798..>222440)
                     /locus_tag="FOA43_003316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923567.1"
                     /db_xref="GeneID:62196716"
     CDS             complement(219798..222440)
                     /locus_tag="FOA43_003316"
                     /note="BUSCO:EOG0934236D;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779495.1"
                     /db_xref="GeneID:62196716"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="PFAM:PF01465"
                     /translation="MLSRISQLSKNLTDEISRFNDEVSSARVTKQQQDGTVQSLDPER
                     AAKIMSIETPDPATITKPSEIDQEDNNKGDNVTENINGNENISGKEAEAANFVKPERE
                     SSVSSAESEKPSNGSNSRHAGVHGVQKLYVSGTKVKFSELPNEIVPLLLKFSKYERLY
                     PQLYQAYKVEKEKSVIIKGFETVLKETTPCTGISEMEVFKEYLEGLSKKADILSQQLR
                     EKANSASSLKKEKDSLLKTVNEVRNENKDFKDQLNSAREEIKGIEKTKETLDIVQKDN
                     ERLEKEIRKLKQEKEIQKSQEDKYNDDEPANAKKTEIVLSENSTLETNNESLELIIAD
                     LKKQVSANQEEIENLRDMLRDVGDELVESQKKVKRLENGVGEYQLEEKIDANNAELEI
                     LRIQNAEALKDYEQTKRSLTKKYQSCLNENDKLRKQLDDAEKEKEKLDRKINDLQEES
                     QKFQREANQSNTFKENGEKNIALVKAKEKEIGDKANRIEILQEEKDKLNEALVDLRVQ
                     VKQLEYETKISVDSKEKIANQLKSAKSHQNEMELRMNKVAAENNKLVKKIEELQDKYS
                     EAKDYKTTNDTEVDSLKRRIEEALMRSKEYESRIDVLEEELSQSRSMLQERTREAGTM
                     RKLVMDTEQNRNTKIQELEAKLDAALEEKDTTESTSTITVRESQKLIEELRLKLRTLN
                     SDCDRLKKDNANLEASLKSSQTKPKQATDVPTSLTAFGNDRDDDYTQKMTDALRASLK
                     ENEQRLRKFEEINKVLQRSSNDNAQKLVRMNKKYKLLTQQYKILRSSAASGEKVSSYS
                     ASPGDTDMSSGRRESIASSIEAPTVPTGTQHGDKDKEKSTYIKNVLFGFLEHRDQREM
                     LLPVMKALLGLDDEDEKKFMELLK"
     gene            complement(<222622..>223869)
                     /locus_tag="FOA43_003317"
                     /db_xref="GeneID:62196717"
     mRNA            complement(<222622..>223869)
                     /locus_tag="FOA43_003317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923568.1"
                     /db_xref="GeneID:62196717"
     CDS             complement(222622..223869)
                     /locus_tag="FOA43_003317"
                     /note="BUSCO:EOG09342910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779496.1"
                     /db_xref="GeneID:62196717"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSELHNLCYLGERPITKENYLDKLRLLLKKGVPSTYTVEDAFAE
                     EHGLKEAIKGSTTTPLHLICESLPKDTSREEEDIILTMIDELFLNGAGWCLTNEKDET
                     PGCVLLRRGLHGSKYWQKMVDAGVRAELLFRRLDDDKIEFIDEIESEEIPQLVEADTI
                     EGMDKEVAKNNAGLKEKTEVLDKDPTNTTSSYLKTKLAYKDGALVTNERCDGVMMQWE
                     DILMKAGCNSLFKSIDDPKEVNILNIGFGMGIIDSMIQERNPTTHYICEAHPDVLQKM
                     KEDGWMKKKNVVVLEGKWQDTVPPLLSRGIFFDGIYYDTYSEHYQDMLELFDMIVGLL
                     KPTGTFSFFNGLGADRLICYEVYKKVVEIDLDIYGLSVKFNEIRPPENALRPAQEDDS
                     VWKGIKRAYWKCPTYYHPEVSFA"
     gene            complement(<223983..>228266)
                     /locus_tag="FOA43_003318"
                     /db_xref="GeneID:62196718"
     mRNA            complement(<223983..>228266)
                     /locus_tag="FOA43_003318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923569.1"
                     /db_xref="GeneID:62196718"
     CDS             complement(223983..228266)
                     /locus_tag="FOA43_003318"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779497.1"
                     /db_xref="GeneID:62196718"
                     /db_xref="InterPro:IPR021895"
                     /db_xref="PFAM:PF12015"
                     /translation="MSTDCLLRKSSSSYSLKGQEKVEDEVVTGTPPPYRADSYYSKFN
                     HADRIRKSSSQYFTASKNQIDNEQFWKSIIGGAVYFKGHDPLFGNVIAAVYQSPRSKK
                     LNSVVISRHGQSVIMDINISKNSVYYPAINNLRTKEAKKSRVRKCLAVSLLKAYSAID
                     RNVVDSMLHHADLPIQFDWDETMAGDLASRMQLINTKSPTDIGDYLLSLGYFRDCQRT
                     ETHMIDVVYQNPIAKADDQLIDKNNMLAYLLGEQIEHLFDPLLEYSPEPTEKGYTAPE
                     TPPELTKHVGGDDDFLVKSICIELVNFQTNFTVSLVQFLQKFLVPMRVHILKGEIKGY
                     TTGRLNQIFPPTIDEVTRINCIFLDMLKLSQPYGSFELLKACGTTIPYFYKACMRHEA
                     ATKRFTEEYEQFVADLRQLGKEDLLTYDGKTIQGIMTSSSLNLVKIQLILQRLMDAKK
                     WNKCSYDENGEIEKLFHSCNDTIVSFANDKLKPYSHRIFTPTGKILTELASSWPTELQ
                     YGWLNRRVVAIFDAEDMLIDGVKNRGALIIFSDHILLLEIDDEEYYYELWSANKKLDS
                     SSKEHVHRPSISDVLMHSLINEVPVNGLPHIKVKNWCRIDEVTATHYDYGNDSYVRLF
                     NKNFVGQYRVNKYSGKYFVDIIRKAQILNKSQAFHLFRNVVDNNTLYYTAHEFNSYVS
                     EDVKSPMLVLFNTQFNPAILTKYSIFGFITLNFSKSETILMEGMSATAPKFQHIVRVQ
                     QLTEALAQKVIQLLADYTTLSNPILRDEIISDTEIVVADAIRFLERTDRMDENEHMDI
                     IHRVKNVKRESTVTEELRMTNSRSSTLDVLMNNEGKRTSSTRISKKNQIKRRRSARRS
                     FIEKIFGKRKMISQPEAHSIDRTTISRPMTIKMAPEKVRSAAGIAAPKKEISPSDADI
                     GVESSEVKDYKTGEETVATASASASLYVNSHFEFPVESGVETALEAKTTDKQTVKVLR
                     PPSIIQNNEAHRGIPQRVPAIPSAVTTASPKLEVASVCLAAAPAHKGVSDFKTPCTRI
                     HRVSSSTQIYRQLRDENFPKLGLSPHRNQIPMKLKKPPPTRPDRDSQGKAANLEMQSL
                     YPNEDENKEHVHRPPVKQIDALQRSESYYDKFKLARGMQEQTVKSEGIALVSDVKPSV
                     LTQSSIIYSPSVRAKLTSLANNDRRVDGDNWTCFTSRENTKPNLAVETIPEEQFSETM
                     DDEEKRFDDSLKDGHSSTVRPFEANNSSSGDNATLKSSPQWTEIGVNTILDGNESQAS
                     RSDDHTLASVSIDLVKDIEGYVFDSESFFDETDDKKESDSADETSMCSALEDLKDTSQ
                     AGIIVQLADGKLLPSDSTTSICDLIGDDSYDYLGHILAGEIAIGDETICGTKISEVNE
                     TIDSDYNRAYSESLRESSFQYLARYFGSRGSFIGETNGSFRGESSETAL"
     gene            <228715..>229381
                     /gene="PST2_1"
                     /locus_tag="FOA43_003319"
                     /db_xref="GeneID:62196719"
     mRNA            join(<228715..228738,228800..>229381)
                     /gene="PST2_1"
                     /locus_tag="FOA43_003319"
                     /product="flavodoxin-like fold protein"
                     /transcript_id="XM_038923570.1"
                     /db_xref="GeneID:62196719"
     CDS             join(228715..228738,228800..229381)
                     /gene="PST2_1"
                     /locus_tag="FOA43_003319"
                     /note="CAZy:AA6"
                     /codon_start=1
                     /product="flavodoxin-like fold protein"
                     /protein_id="XP_038779498.1"
                     /db_xref="GeneID:62196719"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="PFAM:PF02525"
                     /db_xref="PFAM:PF03358"
                     /translation="MPAQKKVAIIIYTLYNHIGRMAESVKSGVDAQGFESKIFQVPET
                     LPKEVLKAMHAPEKPPYEIATRDTLSGYDAFLFGIPTRFGNMPAQFKTFWDTTGGLWV
                     NGGLYHKPFGVFVSTGTGGGNESTVMNNLSSFIHHGMVFVPLGYAKVFPELTNLNEVH
                     GGSPWGSGTFAGADGSRNPTELELKIAKLHGTEFGKYLKGE"
     gene            complement(<230063..>231832)
                     /locus_tag="FOA43_003320"
                     /db_xref="GeneID:62196720"
     mRNA            complement(<230063..>231832)
                     /locus_tag="FOA43_003320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923571.1"
                     /db_xref="GeneID:62196720"
     CDS             complement(230063..231832)
                     /locus_tag="FOA43_003320"
                     /note="BUSCO:EOG0934123X;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779499.1"
                     /db_xref="GeneID:62196720"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="PFAM:PF02696"
                     /translation="MKASPKTSSFTKRLSADPAIPSVDIAKDPNTPQELLHKARRLKA
                     GAFTWTRPEPRKEYKFLTASPRALNDLGFDEKQESESEYFRQIVSGQAIVENPYPYSQ
                     AYAGYQFGDFAGQLGDGRVVNLFEITNPKTGRRYELQLKGAGKTPFSRFADGKAVLRS
                     SIREFIVSESLNAIGIPSTRSVALTALPKTYAQRSASEKCAIVCRMAPSWIRVGNFDL
                     YRYRGDREGIFQLSDYVIDEVFKGESKLCAQYADIINYEPKIKALGELTKYDKMYLEI
                     IVRNAKSVAYWQAYCFLNGVLNTDNTSVLGLAIDFGPFAFMDYFDPNYTSNHDDLMLR
                     YSFKNMPSAIWFNMVKLGEDLAELIGAGGKYLNDPFFKEKGLKESWIDDVTKRAEGVI
                     GAGGDIFERIYIDQYLKLVCKRLGITPRPSDHLGVVASLFETLQHTKLDYNLFFATLQ
                     QQHIKDNFNVDAVAAAFIPDTFKDDPFTDLTKENVTKQLKSFLIDFKKRIEEEKLTDE
                     NRYERAHKFNPLFVPKNWILDEVIDYTQENEYDPLYLNKLLKMSINPYDKSQWGAEAK
                     ELEKRWTSAPSSDIQMLQCSCSS"
     gene            <232264..>233916
                     /gene="DED81"
                     /locus_tag="FOA43_003321"
                     /db_xref="GeneID:62196721"
     mRNA            <232264..>233916
                     /gene="DED81"
                     /locus_tag="FOA43_003321"
                     /product="asparagine--tRNA ligase"
                     /transcript_id="XM_038923572.1"
                     /db_xref="GeneID:62196721"
     CDS             232264..233916
                     /gene="DED81"
                     /locus_tag="FOA43_003321"
                     /note="BUSCO:EOG09341C1W"
                     /codon_start=1
                     /product="asparagine--tRNA ligase"
                     /protein_id="XP_038779500.1"
                     /db_xref="GeneID:62196721"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="PFAM:PF00152"
                     /db_xref="PFAM:PF01336"
                     /translation="MSEIYVNPTTGVDTDSSKGTKEAPYKSPGFALFKDPDAKVYTFK
                     EVEGKADYYEISASALKKAKKICESLKRKAGKKKKLEASKAEREADESAKLMAAMKIT
                     ITKDESLPAPKKIKIRNIAQHIGERVEIHGWIHRLRLQKGHAFIILRDGTGFLQCVLT
                     GEFANAYQTLTLTVESSLTVFGTISKLPEGKSAPGGVELIVDYYEVIGLAPSGKDSFT
                     NKIQEDIDPNLLLDRRHLALRGETLSAVMKVRAAVLGSVRRFYQDEAITEVTPPCMVQ
                     TQVEGGSTLFKMSYYGEEAFLTQSSQLYLETCLPALGDVYCIQESFRAEKSHTRRHLS
                     EYTHIEAEMAFISFEDLLDHIEKLIVKVVDVVMKDPVAGALVKQLNPGFVAPKLPFKR
                     LQYVEALDWLNENGVQNEEGNPFKFGDDIAEAAERKMTDTIGVPILLTRFPVEIKSFY
                     MKKCADDPRVTESVDLLMPTVGEITGGSMRISDKDELLEGFKREGIDPAGYYWFIDQR
                     IYGTCAHGGYGLGTERILAWLCNRFTVKDCSLYPRFAGRCTP"
     gene            <234345..>238521
                     /locus_tag="FOA43_003322"
                     /db_xref="GeneID:62196722"
     mRNA            join(<234345..236359,237004..237014,237062..>238521)
                     /locus_tag="FOA43_003322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923573.1"
                     /db_xref="GeneID:62196722"
     CDS             join(234345..236359,237004..237014,237062..238521)
                     /locus_tag="FOA43_003322"
                     /note="BUSCO:EOG093416CX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779501.1"
                     /db_xref="GeneID:62196722"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="InterPro:IPR033721"
                     /db_xref="InterPro:IPR036621"
                     /db_xref="InterPro:IPR036754"
                     /db_xref="PFAM:PF00152"
                     /db_xref="PFAM:PF00587"
                     /db_xref="PFAM:PF03129"
                     /db_xref="PFAM:PF04073"
                     /db_xref="PFAM:PF09180"
                     /translation="MSLEVSLSLLSLAEPVPEGSIDLKTLVFKPKTPKSQTPVPIIVV
                     AKQTTQTPSKLIGQQAEAKDPRLANDALTTELFGVAAKEFTIASLSVKNKGAIKVLLD
                     STISEDESIHYVISNSKGRLILNGKQLIGFLSLFTPKVVDFSKAPEPAAPKKQEKKQQ
                     KQTKVAKMDDAKLIGVTADKDKDFSGWYQQILVKGEMLDYYDVSGCYILRPGSYSIWE
                     QIQSWFDKKIKENGVHNAYFPMFVSSKVLTKEKDHIEGFAPEVAWVTRAGSSELEEPI
                     AIRPTSETVMYPYYSKWIRSHRDLPFKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHT
                     AHLTAEEAETQVIHILDLYEKIFVDLLALPVIKGKKTEKEKFAGGYYTTTCEGYIPTT
                     GRGIQCATSHNLGQNFSKMFNISVENPEGSDKPKLFVHQTSWGLSTRVIGVMVMVHSD
                     NKGLVVPPRVAQFQTVIIPVGLTVKTSKDIKNKVYDTCKKLEATLKNSGIRVASDYKD
                     NYSPGWKFSQWELKGVPVRLEVGPKDIANGSALAVRRDTGTKTAIKLAEIAVKLPELF
                     EEIHKNLYETAKRNFDDHRVIVHDWKDFVHQLNQKNIVLAPWCGVGECEEDIKKASAK
                     SDNGEEFEIDDKAPSMGAKSLCIPFDQPELKEGTKCVKCGKPAVNYTILTRTQFIRHY
                     STFIASGVALKKFPLTKCIKDIYRSPPCANSPISLKGWVSGTRISKNVAFVDMVDGTT
                     YEDVKCVVRPPYLLPNAVKVGTSIKIDNGLWVEGRGKQKYEVQVTENSSIGVIGEVEE
                     LFPLLKKQHTEKFLRTIPQYRWRKPEEAAILRFRSNVETALVNFFDQHSFTKTHPPIM
                     TSSDCEGAGELFTVEAASNASLDKCFFGKEAYLTVSTQLHLEVLCAALNRVWTLTPCF
                     RAEESDTNRHLSEFWMLEAEMAFTSRVDQLTDFSELMIKSVISKLFSDFYGMGSNLLK
                     TASKEQGASMLKRWEMLLGQEKWASITYTDAIKILRTAYENDDSVFQYEPKWGDSLKS
                     EHEKWIAGEYFKNPVFVTDYPVEEKAFYMKINEGGNTPAPTVACYDLLVPDIGELIGG
                     SLREEEYGKLCTEIERRKLNLEPLKWYLAQRKNGTFPHGGFGMGFERLLQYLSCKDNI
                     KDVIAFPRTVNNCLC"
     gene            complement(<238572..>239471)
                     /locus_tag="FOA43_003323"
                     /db_xref="GeneID:62196723"
     mRNA            complement(<238572..>239471)
                     /locus_tag="FOA43_003323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923574.1"
                     /db_xref="GeneID:62196723"
     CDS             complement(238572..239471)
                     /locus_tag="FOA43_003323"
                     /note="BUSCO:EOG09343YZK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779502.1"
                     /db_xref="GeneID:62196723"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="InterPro:IPR036980"
                     /db_xref="PFAM:PF01868"
                     /translation="MNRDNSIEKLILSRCSKYNDDGQIMKVLEERYSLTGAQKNFLVL
                     EPTDGGVTREEINHSSSKKRRQQNSLPSIMHSLQNSQNSEKVEKRPANKHNPLKTKNE
                     FKRFMKSNLALQAKIMRKLKLILKKNPHYLDKVKDLASLNLCNKILKFEDFIEINRLW
                     NSYIKETIGSTENIMNISTKLSMCEFIGAYIEVTHSGCVDNVGKCGIVIWESQHNFVI
                     VVPRKDGWKNKISLIEPKYSLSEKIGGIRLINKQDTRFKVTVNLQDNLTVDYEIIGDR
                     LMIRSIDRANKKFKSHNVRDIRL"
     gene            <239704..>241491
                     /locus_tag="FOA43_003324"
                     /db_xref="GeneID:62196724"
     mRNA            <239704..>241491
                     /locus_tag="FOA43_003324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923575.1"
                     /db_xref="GeneID:62196724"
     CDS             239704..241491
                     /locus_tag="FOA43_003324"
                     /note="BUSCO:EOG09341OXS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779503.1"
                     /db_xref="GeneID:62196724"
                     /db_xref="InterPro:IPR004143"
                     /translation="MLYPLVRSGVFEYANRIIFSRRLLSHRASGPSALNLGSATSDEE
                     AVRQQLEIDPNLEHFFDDDIVDKVKNSQKPQDLNPMKPKDDFDDFLDPSEVPILGRDD
                     LGPISFPASLNGAGKPMTMTTKEFLSHLKPPQSEPTVRPIYRNIVAPKPTATARVKPL
                     EAVKAFRIPKPIKSTKPIKSTKPSVSLDPPESFNTPNFLRYIDFLHEGDIPTPVEVPN
                     NATLESLVDTELPLSVVSCFNDPRLNLSIERYIFTHLPDPKKNRFAKRLVLYRNSPCI
                     VIGKNQNPYKEINFHLANLHQIPILRRYSGGGTVVHDLGNVNFSFIADKSLFNRTGFT
                     NILAGRLNELVGKVVQDWKMPDFKLTTNDKGDIVNASNMHKVSGSAYQLSRGRSLHHG
                     TMLLNVNMKLLSGLLKLSQERKDSIEDRSIDSIPSPTENVAMDEEVFEYSCINTFASS
                     YGVPSFLKKPKFDNVQVLKFGSTECQIMKVDDLNELPQEVLDEYRTFKSWDWVFGRTP
                     KFKLRFKVAGSDDDSDLQVCLHIDHGKIQQIETSRDEPKLRALIEKCGSVRFRGDTMA
                     EYIHDIKLRNSFIWNIDQALNYQSIGINE"
     gene            <241811..>244639
                     /locus_tag="FOA43_003325"
                     /db_xref="GeneID:62196725"
     mRNA            <241811..>244639
                     /locus_tag="FOA43_003325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923576.1"
                     /db_xref="GeneID:62196725"
     CDS             241811..244639
                     /locus_tag="FOA43_003325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779504.1"
                     /db_xref="GeneID:62196725"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="PFAM:PF02752"
                     /translation="MSGLITSPLFPVEGLSTETLIKLPTKPNAASTSVKLYIIYAEPR
                     LYLEGFSSNEIASRPPTVLRGCLFIRILKPVRIKTIAMKLEGVARTDWPEGIPPKKVE
                     HMESKSVLSHTWPFFNYNNIYPVTDHSRMNADLFVPKSGGPDIDAFSLDSTLSPVSSN
                     STLDLHSMKSHSSFVGTAHANLLRHLSSSPDPELQSSTSRTRSRSDVSDNKLFIPGDY
                     IYSFEQLFPASLPESMTLTFGCVHYSIEASLERSGAFKTNLYARRPVNIVRAPCSDSS
                     EENEPIVINRDWEDRLHYEIVISSKQVILNSFLPISFRLTPLDKIRIHRLRIYITEHL
                     EYFCHDKHVHRAEPPKKILLLEHKPPAGLDNLLAVGDDEIGGVQLDFQVYIPEYYGER
                     YRIHPETCYDDIQSHHWIKICVRLSKLEPTPEDPNKRKHYELSIDSPIHILSTHCAHA
                     NTLLPSYDEQIREDVGVSDRRENLVDMNMSPNTGMILKSNLYRPDATIPVEMLSPQAK
                     PFSPLVSPELNSINPELRFDFEMKPIDLLKTLSTVSRPLAPLGGPPPPFKEATTDNPP
                     TYEEAVHGSTSSSSSSSSVSTSFRTEIEPNGRSRIERSRRGHRSLRADTYRDSADLGD
                     MEGNFHLKVTPIRSRSTSSSPPPTLSQFSSKSRLVSTSLVPGMHFYSHTSNPSSPAID
                     AALEDSLGEDGDQPEDENEEEDEESKDEIHSPKSNTSATAAGSPKSTERDRTLSRSST
                     PTITRIQSNQLPLPTRIKTTSSSQLDGRRVSTSSTNSAGGISMGSEDPLMKRPLLSND
                     ADLTVPPLYSVSANQSNPALLLRNGSIVTNLNYPEDPDSSMDISAMLGSSMDKDKNPI
                     MPVGFDLAEGMGSNEIDRMWRPFVFNSSSSRPPQVLPLSHRKTTNKYSTGTKSMASRD
                     VSEDRRKISFGVEPVLATLSGNQSSDEE"
     gene            complement(<244726..>246582)
                     /locus_tag="FOA43_003326"
                     /db_xref="GeneID:62196726"
     mRNA            complement(<244726..>246582)
                     /locus_tag="FOA43_003326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923577.1"
                     /db_xref="GeneID:62196726"
     CDS             complement(244726..246582)
                     /locus_tag="FOA43_003326"
                     /note="BUSCO:EOG09340WZ3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779505.1"
                     /db_xref="GeneID:62196726"
                     /db_xref="InterPro:IPR004140"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="PFAM:PF03081"
                     /translation="MLRTPTSATFDFSGNQAGPGATIDEDEADLTVLEESLKSTDEYC
                     KEIAQKLDIISSKNANAIRTVKPLMSRINKLKVQQNNIKATVKLVDDVKEYASEIKKL
                     DKTLANNEEMKHIGQIENYCGALSKLASIRKRLVAKRLDGFTGLMKGLNGSIRDAEVT
                     LKYDMIAKLKKLDESQVSKKSHDDDEVRLIKQIEYIYEYMKTERLKDLTDTIVRERSS
                     HDVRMLKSMAPLKPPSIVKDLYYLYSGASKTGSPSFIDYCKQASRVFQDEAHVLAKLL
                     ATQEEASTILNLVSNSLLAEITHQAEAFGAFVASNKFTHCTLLYEVTDGLHILLSSIY
                     QYNVKIPSELSHLDKKLCSEASKIFVGFFEFVNMRYHELVVPEHPNETLNNTFMMLVT
                     RLNKYSMFRDQQLFFISKMKNGSWLPAYRPPGFLEIKTSSSDAQYLLSTFYSDVIEFS
                     FFNLAEQFQAKMSEEDLGVMLLFNLDGLQNLLDSRSLLKGILGQQGISRVDRLKKKAI
                     DKATTGWSDMTTKLMEASTKQGDSFNMSNKDMGKFVDEFTKSFNENYKKLQEKNLPPF
                     FKKELSQNIRKMLGPAYRVFYMSVSQDPSAKSVLKHFKLSISDFEHKLVTLA"
     gene            complement(<247045..>248541)
                     /locus_tag="FOA43_003327"
                     /db_xref="GeneID:62196727"
     mRNA            complement(<247045..>248541)
                     /locus_tag="FOA43_003327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923578.1"
                     /db_xref="GeneID:62196727"
     CDS             complement(247045..248541)
                     /locus_tag="FOA43_003327"
                     /note="CAZy:GH5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779506.1"
                     /db_xref="GeneID:62196727"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="PFAM:PF00150"
                     /translation="MKFVLFALLFVINIVHAVQIDGLKLSSPVSEHRSKKRGTASHYH
                     YLNKRNDTSGQTSALFDYSLEKVYGVSLGGWLVTEPYITPSLYEDAASYANNTHNGTE
                     KKVPKDEYHLCKKLGKDECYTRLHSHWDTFINETDIKQIREWGFNTIRLPIGYWAFAQ
                     RKEDPFCFGQEKYLDKAIEWCRKYGVHIWVDIHGMPGSQNGFDNSGLRDQVNWLNITE
                     NYDLSLEVLDYVARKYDQPEYYDVISGIENVNEPLGPKIKMDKLKKFDKDTYGLQRSV
                     SSDNYFVFHDAFKNTGYWNNVLKENSNITTHTNSSFYNGSIYNIVIDHHRYEVFSTGI
                     LALNLTGHIDGLKVYVDEIVKNESIPVKIVGEWSGALTDCAKWVNGVDRGSRYEGEYE
                     SNEVIGKCSYSNDYTKMSNQNKTDTRKLIEAQIDLFNKTNGFIFWCYKTENALEFDLS
                     KLIQYGLFPQPLTDRKYPDLLKSSSARTALFSHRLQLLEALALILLIV"
     gene            <248758..>249069
                     /locus_tag="FOA43_003328"
                     /db_xref="GeneID:62196728"
     mRNA            <248758..>249069
                     /locus_tag="FOA43_003328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923579.1"
                     /db_xref="GeneID:62196728"
     CDS             248758..249069
                     /locus_tag="FOA43_003328"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779507.1"
                     /db_xref="GeneID:62196728"
                     /translation="MAASNIVNVLHQPEKSRVLTGEEAKDCIPCQVMGAFTAMAAGGY
                     FSSGHLFKNDKDLVKNPKWWRQSIKYFGYGLIALGVYRGGQGWLWDKDREYKEVKFLS
                     K"
     gene            complement(<249161..>250771)
                     /locus_tag="FOA43_003329"
                     /db_xref="GeneID:62196729"
     mRNA            complement(<249161..>250771)
                     /locus_tag="FOA43_003329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923580.1"
                     /db_xref="GeneID:62196729"
     CDS             complement(249161..250771)
                     /locus_tag="FOA43_003329"
                     /note="BUSCO:EOG09342OO4;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779508.1"
                     /db_xref="GeneID:62196729"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MVTDFEKQRLQNISRNKELFKKLNLGGLSSEFHRGIKTVKEEAL
                     DQGKKKRTKTGKAKGKKRTELTQEKPLRRSRRLAGMQLEPDGQNKLQDELERQKKEKE
                     EQDRLKSIRLSGNVMLSDILDSKGDAGDSAAKTLERLSRLGKSFSMGDFYEAVKDSQT
                     SDKKTSQLRDELESLQLYEKYLPNDIRLTNQRMTSIIFHPSVSRKIVIGGDTMGLMGI
                     WTVDDDTDEDLAITQFKFHGKNIPKFVVRIEQPEEVVSCSYDGSVRVLDLSKAVSRSI
                     LEFDDAWGDASGISDMNFIDQNVCFFTTLGGEFGTFDVRMKKVQNRNDSEVLRLHDKK
                     IGSFCVNPTFSNQIATASLDRSLRIWDLRKIEKSTWSEFEDAQSPHCIGSYHSRLSVS
                     TADWNNTNDIVCNSYDNTIRLFQLGEQHTEDPKYVIEPRVEESAEGMQDIPINLTPTN
                     TLKHNCQTGRWVSILKARWQSRPKDNIQKFVIGNMNRYFDVFDRNGTQLAHLGHEYMT
                     SVPAVACFHPTQNWIVGGNASGKTFLFS"
     gene            <250932..>252140
                     /locus_tag="FOA43_003330"
                     /db_xref="GeneID:62196730"
     mRNA            <250932..>252140
                     /locus_tag="FOA43_003330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923581.1"
                     /db_xref="GeneID:62196730"
     CDS             250932..252140
                     /locus_tag="FOA43_003330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779509.1"
                     /db_xref="GeneID:62196730"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR025212"
                     /db_xref="PFAM:PF13094"
                     /translation="MLNIFREHGKTPKRPSARTRIKALTGTKLGPHGFSSRRTQSQQT
                     GSQKDKSQSQASISLHEANKRNAEFNSLTKGNESLFDEVVETPPTAKPAKPKRSRGRP
                     AKSPSAVEKVRNAPRGRPKKAKQHLTTSIDRHLRNNDVITIPDDDNMSIEESETVLKT
                     YSQTIRPNSMRENWTVLLPNVQTMLESILTLFIEQSLSSIHFKNKKDRLHFGTLVRTQ
                     MIKPLMKRFLHVKLPPGIKESHLDQEQLNEEKLRLETNYDANLKQLEALQAELLKENL
                     NLKSEKKYTLEYESKFNQSKLLMDKSLKQLQDLLGNDIANLETDFINEGTTNSEFSRL
                     GLQTDSESIIIPDSSSSAYDASKDKKLQNALSSLQSQLIKINSTTSAAQDLADVLERL
                     HNILGLATED"
     gene            complement(<252183..>254654)
                     /locus_tag="FOA43_003331"
                     /db_xref="GeneID:62196731"
     mRNA            complement(<252183..>254654)
                     /locus_tag="FOA43_003331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923582.1"
                     /db_xref="GeneID:62196731"
     CDS             complement(252183..254654)
                     /locus_tag="FOA43_003331"
                     /note="BUSCO:EOG09340FGN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779510.1"
                     /db_xref="GeneID:62196731"
                     /db_xref="InterPro:IPR012387"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR015966"
                     /db_xref="InterPro:IPR019039"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF08302"
                     /db_xref="PFAM:PF08303"
                     /db_xref="PFAM:PF09511"
                     /translation="MPVKLPFESVKISPDEKLQDKQDTIELIAQLEDLAKRHPKKGAV
                     RKFTNLIADTNTPINSWKFNEWDYASKKVSLPTYARGLFTKGNEIICRGYNKFYNVNE
                     FLEVSEDQLKKNTTGPYTLTVKSNGCIVFISGLEDGTLVVCSKHSTGVRDDIQKNHAM
                     AAQRALESQLIGIGQGKERLASALYELKLTAVAEFCDDSFEEHVLEYKNDRAGLYLHG
                     LNFNTPRFRTYPMKKVNEFGQMFGFKETKSRRFETFEELIKYLSNVANEGTFEGEEVE
                     GFVVRCYRTENHEDFFFKYKFEEPYLLYRELREVTKQFIRGGPQNVHFGKHKLICMDY
                     LKYIMPLMHDNQELREQYLDNQGIIELRKKYFVARGKTGLEVIDEEVSMAKLEDEMRL
                     LSFGDSQICKYAVVTVATIGCGKTTTSLALANLFPNIIGHIQNDNIRRPVGNKLVAGA
                     LEILINRPIVILDKNDHKFIERKQIFDDFDQLNEVIPTSKLKFICLNFLRNRPQEDKD
                     LWNITRERILERGDNHQTIKAAGKGITKAEKIIQGFIKRFQPVDPGREPDSKFDLIIN
                     LDVTSPDSSYANVKTVVDNLISFASDLNLTRPTEEQFQEAFKSALDYKPSVNKIVHSK
                     GGPRAPAYFGIVIPNAEELQNKVVKLIHSTGLDWKTYETLKNTDRLLNDLHVTIIHYK
                     SRKTNGESRALWNMYVKQVFFDDLTKIDENSPKIKGCSIPLPSSPTADIKLEKLCSND
                     KLVCIKVSVLGLYHADGREIHLTAGNKFPHVTLGTISSEIKSVESNNLLNDICEFHAT
                     NGIQCLDFEDSEENTLKGLPIFAYY"
     gene            complement(<254884..>255933)
                     /locus_tag="FOA43_003332"
                     /db_xref="GeneID:62196732"
     mRNA            complement(<254884..>255933)
                     /locus_tag="FOA43_003332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923583.1"
                     /db_xref="GeneID:62196732"
     CDS             complement(254884..255933)
                     /locus_tag="FOA43_003332"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779511.1"
                     /db_xref="GeneID:62196732"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="PFAM:PF00153"
                     /translation="MDPLPKQNDDTDLLTAMMAGATAGAFQTAATYPFEYLKTTSQIK
                     NQVLMLKPPVEAMNSISIRPMYTGCAVLATGNALKAATRMCLFNSFSHFMATENGSTT
                     APRIVVAGLMTGFVETLWVIPFENIKTRMIENRMYREGMEMNMAKAVDVRASPSSPLK
                     TSKRARTADSSFTTRARHISDTRLKALKYYAKNPSITFPAVVKEIYSTQGLRGFKQGS
                     LITIFRQCMNSMVWYSTFSSLQQLIDPNRDSISELELLGMGFASSCAVVATTQPLDLV
                     KTRMQTKNYRLFYRDLMTCVFKVFVEEGLRKFWCGWFPRLIKVSCSSSVTLITYEYTV
                     KGIQKLKTMKPFSAS"
     gene            <256114..>257085
                     /locus_tag="FOA43_003333"
                     /db_xref="GeneID:62196733"
     mRNA            <256114..>257085
                     /locus_tag="FOA43_003333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923584.1"
                     /db_xref="GeneID:62196733"
     CDS             256114..257085
                     /locus_tag="FOA43_003333"
                     /note="BUSCO:EOG09343VHG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779512.1"
                     /db_xref="GeneID:62196733"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="PFAM:PF00702"
                     /db_xref="PFAM:PF12710"
                     /translation="MSYVITAIAHEDKYPSGAIDSVMELINKLPLKLTSIVKLSPDKA
                     TDFEVDLDISKTGVVNPKESFVDDLYGQVRDQLTRSSVDGVDLIFQMNDETRKDKKLA
                     VFDMDSTLIQQEVIELIAAQANCEKEVAAVTRAAMNGELDFKQSLAKRVALLKGIESE
                     HLWNDLKPQLKFTPGVRELCKFLKGKGCKLAVFSGGFLPLANYAKKQLDLDYAFANVL
                     ATEFNSEDKEVLSGETLGEVVDGLKKRELMVQIASENDISLANTVATGDGANDLPMMK
                     KAGFGIAWNAKPRVQKEAPSCLNSHSLKDALYIFGYNDTDIDKELKY"
     gene            complement(<257097..>257954)
                     /locus_tag="FOA43_003334"
                     /db_xref="GeneID:62196734"
     mRNA            complement(<257097..>257954)
                     /locus_tag="FOA43_003334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923585.1"
                     /db_xref="GeneID:62196734"
     CDS             complement(257097..257954)
                     /locus_tag="FOA43_003334"
                     /note="BUSCO:EOG09344A7C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779513.1"
                     /db_xref="GeneID:62196734"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR036038"
                     /db_xref="PFAM:PF01063"
                     /translation="MTPKQRRAPQKEHVEAAEMIVKKYLTEDFDYSKIDFSLLTTMRY
                     DPSLYRGDLPLLDAIYQEPLDESFFFLIENHIRRINIARDFFEITDMGELTKKILLQH
                     VTEAMKGLGLDKVSPYKVRILVDKQGQIHLDLVGPIDIPLNTSLDCATTFTAYLDTKP
                     TVISPFTSFKTTYRKAYNNAKARTVPENTINTDVILYNTAGSITESSFCNVALQRSVK
                     NPLTGQETMRWVTPPLSVGCIEGTFRKYLMDKEILYEAAVSVKSLKNGEVILLFNAVR
                     GIIKAQLVL"
     gene            <258067..>259608
                     /locus_tag="FOA43_003335"
                     /db_xref="GeneID:62196735"
     mRNA            <258067..>259608
                     /locus_tag="FOA43_003335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923586.1"
                     /db_xref="GeneID:62196735"
     CDS             258067..259608
                     /locus_tag="FOA43_003335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779514.1"
                     /db_xref="GeneID:62196735"
                     /translation="MSSTRKQTPPTVPAKKPGLRAAVSINKVVPIESLREKLVHVRIE
                     SNAHPKAETETELKTEIKAKPRLPVKENSTVESSVDTALAVAPSIKKKPRSLASKPPI
                     KPKPQYLSKLNAPVEFEDAPIKVKAPSVSSIFLKGMSTPPITPTSRKLASPKIGVPEV
                     PSLPRRHQQRPQVTLQEDEEQEITPPLPTRPADRVKGLGTLTSPASSSASLTSRSRSS
                     STISTPPLPPPPRSRIRTTVSTPPPLPPLHHHSRESNHWKEPDLDLEIPTCWFALNDS
                     SKLPKCFQGCNWVASHGTLGKIQYSIYAFRLSDLATVRLKFSWDGSYLSPLDTLKQEV
                     SFLPPPTASKQQLLDGSKIFGEHIANWCEVREGEKVGNGECWTLARDALQKACGNHAF
                     VSSGLNHGALLVTYKMSPTTGKLVVIQEPITDDIKRGDILQFKSSFFKCPDKSITFGA
                     PDHTALVLNVGGSKLQIIQQNNNGKKVVAEDQINLDNMAGGELKVFRPVSANWIVDLS
                     DAAMK"
     gene            <259932..>261596
                     /locus_tag="FOA43_003336"
                     /db_xref="GeneID:62196736"
     mRNA            <259932..>261596
                     /locus_tag="FOA43_003336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923587.1"
                     /db_xref="GeneID:62196736"
     CDS             259932..261596
                     /locus_tag="FOA43_003336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779515.1"
                     /db_xref="GeneID:62196736"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSQYRMSQLAPLPRLKGLQIGKTIGQGGFGVVKTATWKHGKTCR
                     VIAIKFVHIKMAVRQQVTPEMLAREAYIQKECRHKNIIALYDFGADSNWVWMAMELGS
                     NGELFDKIEPDTGVDEDVAQFYFVQLINAVDFIHSKGVAHRDIKPENLVLDSGGNLKL
                     TDFGLANVYRKKNGPKRMCTSACGSPPYLAPEVVTRKYDPEMSDIWSCGIVLLVLLTG
                     KIAWEMPHSEDPDYDYFVKNKGEVLVSPWNKLPIGALSLLRKVLNPNPKVRISIKEIR
                     RQPWFAKKNCFMDGNELCKDSLYLTTRLLVNLYINLSDEEFNKVNEISTQASGNKKIP
                     ETQPVDYFLDDMSSNVDTKIFKDDYQPIVQGFSSSQIEYTEHSKRKKLKKESKEDDLT
                     FSLISQDPASLQFISKDRKQAINAQITQFHRTQGQNPNLFAISLTRFFSVSPLKQILL
                     TILEALLKLGLRSSSDYEDNEAMVKNFSGEDTSDGIVTIPVNGRDSGHLLIVGNIKVT
                     RMADNLKVRKIDFFKTKGDPLEWRRVFRRVTILCRDVVYVDNQRSE"
     gene            <261711..>263555
                     /locus_tag="FOA43_003337"
                     /db_xref="GeneID:62196737"
     mRNA            <261711..>263555
                     /locus_tag="FOA43_003337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923588.1"
                     /db_xref="GeneID:62196737"
     CDS             261711..263555
                     /locus_tag="FOA43_003337"
                     /note="BUSCO:EOG093418DQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779516.1"
                     /db_xref="GeneID:62196737"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="InterPro:IPR038487"
                     /db_xref="PFAM:PF00149"
                     /db_xref="PFAM:PF04152"
                     /translation="MPLVSNIEPGPDTFRILLTTDNHIGFMENDPIRGDDGWKTFSEI
                     LHLAVLKDVDMVIQGGDLFHMNQPSKKAYYHVIQILRECCWNDKPIEFRLISDPSNAM
                     ATKHFSYPAEYDNNVNVGIPMYAISGNHDDATGEELLSPLDLLSVGALLNHFGRVTNN
                     DQITVYPLLFNKGTTNLALYGLQNIREERLKRTMASSNLEFLQPDTGTTDVQWFSLMC
                     IHQNHVQRPGIRVVEEINLPDFLDFIFWGHEHDCIPHTVENPSTGFNVLQAGSSIATS
                     LSEGELAEKHVFILNIKGKDFSLEPIALKSVRPFAMKSVVLAETGLSATSSNKAEVLN
                     FLIGQVEQLIKDAIHRWKENNKDEFDSEELTEADVPLPLVRLRVEYSGGYEVENPRYF
                     SNRFVGEVANVNDVLTLYRKKSPTKDLFTAMVKESRAFAKTSSNEQGSESQTGDSNIF
                     GMIENQLNDNDLILIRKDEFSNTLSDLISKDNKVVLDDFVKEEEDKSLELLKKLALTD
                     DEATSKDVSQVKKSFRRLAKRIRVEAEYAGADDITGSTIEPNRAASVEVPLEPMEISD
                     EESLRLTRTSRTTEIREQKAEPKQVKRTTKAKQSHLAPSLFSGLGRRK"
     gene            <264087..>265754
                     /locus_tag="FOA43_003338"
                     /db_xref="GeneID:62196738"
     mRNA            join(<264087..264095,264180..>265754)
                     /locus_tag="FOA43_003338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923589.1"
                     /db_xref="GeneID:62196738"
     CDS             join(264087..264095,264180..265754)
                     /locus_tag="FOA43_003338"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779517.1"
                     /db_xref="GeneID:62196738"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="InterPro:IPR037883"
                     /db_xref="PFAM:PF09346"
                     /translation="MGINSDPGSGPFSQSAVSMINNRSSTSLQTEQPQQQQQQQQQQQ
                     LQQSGKTSGTITSTKPVQYNPGMRSQLAMNQNASGSSIQLQEYVEGRAALPPISEIWD
                     RLDKWLEREFPELGDDMEDGVTSTDLNAFEKDMGVSLPLDVRDSYKIHDGQVSMGKAR
                     GFIYGYPLMDLESVAAEANIWRRVYNQLEKTDNMFLDSTIDASAFSQKQKNHHSQFLS
                     NQRSVPEGAIQELYCHPNWIPFVKDNAGNNIAIDLAPGPNGRWGQIILFGRDFDIKVV
                     VATSLTEFLFNLCEDLEDGKFDINDDEDLIYYDHRIPYEYFNVLKMRSYSKYKEDVRR
                     LQHAQHIQQKVQQSVKKPQEASSEQATKTAEESISLPKETLISPDSESKDVPKNDSFV
                     IDDKEREEDPKSKEEPKEELELEFKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKE
                     EPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPIEELKGKSKEESIEEVKEVPVEQL
                     KESIVVEEEEPKERVAIPN"
     gene            complement(<265890..>267532)
                     /gene="CKI2"
                     /locus_tag="FOA43_003339"
                     /db_xref="GeneID:62196739"
     mRNA            complement(join(<265890..265906,265951..>267532))
                     /gene="CKI2"
                     /locus_tag="FOA43_003339"
                     /product="Casein kinase I 2"
                     /transcript_id="XM_038923590.1"
                     /db_xref="GeneID:62196739"
     CDS             complement(join(265890..265906,265951..267532))
                     /gene="CKI2"
                     /locus_tag="FOA43_003339"
                     /codon_start=1
                     /product="Casein kinase I 2"
                     /protein_id="XP_038779518.1"
                     /db_xref="GeneID:62196739"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MDKSNSKPIQSPPAPRSPLLMPTAERTRSAPQPPSNRAQALGQA
                     IQESPQQLQQYQPQLQQSQSQSQSQSQAESQPPQAQAQDQGQSQPEQSDSSRRHHRHR
                     HGQSGSSSSSRNIIAGHYQIAQKIGEGSFGIIFKGYDLLRDNQPVAIKFESRKSEAPQ
                     LRDEFKAYKILSNAVNNYTKSGADIDPGHTKYLSLLGMPKVYYFGQEGYYNILIIQLL
                     GPSLEDLFEWCGRRFSIKTVAQCAKQMIARIQFVHENNLIYRDIKPDNFLVGATSDDN
                     TIYLVDFGMIKQYRNPITKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLESLGH
                     VFIYFLKGELPWQGLKAPTNKLKYEKIGEKKQATSIQQLCGRLPSQFGEYMAYVRSLK
                     FEEQPDYRYLVSLMDLALASVGETDDGIYDWMKLNDGRGWDWAKNKKINLNGYGSNNR
                     NKQHRSTRAIPPNHSQLQNSLSRDNSKSASKYNPDVYGKINENTALLTGQLHYDSYVN
                     SYSRQQQDQDNKDNAEGFGDLIIT"
     gene            complement(<267883..>269070)
                     /gene="MET2"
                     /locus_tag="FOA43_003340"
                     /db_xref="GeneID:62196740"
     mRNA            complement(<267883..>269070)
                     /gene="MET2"
                     /locus_tag="FOA43_003340"
                     /product="homoserine O- acetyltransferase"
                     /transcript_id="XM_038923591.1"
                     /db_xref="GeneID:62196740"
     CDS             complement(267883..269070)
                     /gene="MET2"
                     /locus_tag="FOA43_003340"
                     /codon_start=1
                     /product="homoserine O- acetyltransferase"
                     /protein_id="XP_038779519.1"
                     /db_xref="GeneID:62196740"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006238"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF01053"
                     /translation="MSAGGDHTRKYKLQTEVVKVSYDDSWHASCPPIYQTATFKNPDV
                     LHMGKYDYTRSGNPTRTILQEHLAKIIGCKQVWVVNSGMSCLDIITRLLKPGDEVVSG
                     DDLYGGTDRLLTYINNNGDIKVGHHDITNLDLMKSKITENTKMVILESPTNPLMKIVD
                     LKSIAEHAHKVNPQCIVVFDNTMMTPLMMKPLELGADIHYESATKYLNGHHDIMAGVL
                     ATDNEELADRLFFVINSIGSGLAPFESWLLMRGLKTLALRLERQQSNCIKLANWLESQ
                     GFKVRYPGLKSHPQYELHKSQTKGTGAVLSFETGDIDLSERIVRNVDIFGVTVSFGCV
                     NSLISLPCKMSHASIDPKVRAERGFPEDLIRVCVGIEDIDDLIFDLDHAIKQAKKEQK
                     ERN"
     gene            <269448..>270158
                     /locus_tag="FOA43_003341"
                     /db_xref="GeneID:62196741"
     mRNA            <269448..>270158
                     /locus_tag="FOA43_003341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923592.1"
                     /db_xref="GeneID:62196741"
     CDS             269448..270158
                     /locus_tag="FOA43_003341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779520.1"
                     /db_xref="GeneID:62196741"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF01257"
                     /translation="MTLKRMLVGRASLKPLVSCRYGHIISVHRETKGNNANIAFEFDK
                     ENLERAKSILAKYPPQYKKAAVMPLLDLGQRQLGYTSISVMNYVAKFLDIPPMRVYEV
                     ASFYTMYHRKPVGKYHVQVCTTTPCQLCNSDSVMQTIVDHLGIKPGQTTPDGLFSLEE
                     VECLGACVNAPMMQINDDYFEDLDSGEKVVKILDDLKAGKHPKVGTTKRGTCEPFSGP
                     RVLKSQPLDVKTVTRDDL"
     gene            <270299..>271888
                     /locus_tag="FOA43_003342"
                     /db_xref="GeneID:62196742"
     mRNA            <270299..>271888
                     /locus_tag="FOA43_003342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923593.1"
                     /db_xref="GeneID:62196742"
     CDS             270299..271888
                     /locus_tag="FOA43_003342"
                     /note="CAZy:GT8;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779521.1"
                     /db_xref="GeneID:62196742"
                     /db_xref="InterPro:IPR029044"
                     /translation="MSIRRYKRFLILVTIVLVCLIAGDLFKNSGHVVNIVGLRADQGN
                     IHKNKEDPVIEALLKKKTLTDDEEVEVIHHFGFNPYEIKSISAETLFQLHRTKEIDIG
                     EDYLDWGKVAYVQYATDLDHVCPAVINFNRLRQLGAKADFLFLYAGNQSEVNNESEKE
                     MLKKIESTGATIKYVKPIELPSESSYWEKSFTKLYSFSLTEYDRVVFFDSDSLVLKSM
                     DELFTLPDSVLAMPVNYINFRDFDKLKLKLEGAIETPYDRANELSDYYAEIIEPETGY
                     DDIEWLMKIVYASLPSLNLSIKLLKSYGLQYQLASYIMVIHPNKDVFNSLMEALNHRK
                     KNEYDMDVLNNVFNLEKIARTHKNYYSLGDQSYIPLIQVIPHNPYALLSGELRKFHRS
                     HDCYLADPINLPEIGYDYPELKNPGVKTSPIGYLQDEESESTTHLEIPYWSWYWDKQV
                     TTYGWSSNVVLGDAKLVHFSDAPLPKPWTPIPDIRNKLALDAQIQCEKVTGGNKLGCE
                     KEVNQWVALYDKYSQLAQQYC"
     gene            complement(<271912..>273045)
                     /locus_tag="FOA43_003343"
                     /db_xref="GeneID:62196743"
     mRNA            complement(<271912..>273045)
                     /locus_tag="FOA43_003343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923594.1"
                     /db_xref="GeneID:62196743"
     CDS             complement(271912..273045)
                     /locus_tag="FOA43_003343"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779522.1"
                     /db_xref="GeneID:62196743"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00389"
                     /db_xref="PFAM:PF02826"
                     /db_xref="PFAM:PF03446"
                     /translation="MCDTINTPVPSILFVVPVNAQLPEFQSFQSQFHPVFLRLSSKDE
                     LIKKLKQDPQLANICAIYAGFLGFQPIGGLISDGLIDALPSSVKIVTVCSAGFNGYDL
                     TKLRAHGIDFCNTPNFGAPQVAETALYHIINGFRKYHVFEDKLRQTGNTIDARTELQE
                     YYDFDSSDGKFKLIDRNSSASIHPWFAFGEKVSRNLFILSPRGKTITIVGLGNIGREL
                     AYRVHALGMNIRYVNRHRLSDEKNLGFPVRYYQSLLEAAPGTDCVALCLPSTPETAGM
                     FNCKVIERLNDGCCVVNVGRGNLIVDDDLLTGLKSGKIGHAGLDVLEAEPIVNEELVC
                     RDDVTITPHLGSCTKEVYNATEIFCLENITNRLLKGEAKNILN"
     gene            complement(<273369..>273839)
                     /gene="COX4"
                     /locus_tag="FOA43_003344"
                     /db_xref="GeneID:62196744"
     mRNA            complement(<273369..>273839)
                     /gene="COX4"
                     /locus_tag="FOA43_003344"
                     /product="Cytochrome c oxidase subunit 4"
                     /transcript_id="XM_038923595.1"
                     /db_xref="GeneID:62196744"
     CDS             complement(273369..273839)
                     /gene="COX4"
                     /locus_tag="FOA43_003344"
                     /note="BUSCO:EOG09344B8O"
                     /codon_start=1
                     /product="Cytochrome c oxidase subunit 4"
                     /protein_id="XP_038779523.1"
                     /db_xref="GeneID:62196744"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="InterPro:IPR020893"
                     /db_xref="InterPro:IPR036972"
                     /db_xref="PFAM:PF01215"
                     /translation="MLRQTLKLAKPARLFSTSVVARNAKTPTKEFKTAKNLSEVHDKY
                     DLVGPGAKKGEVPTDLEQATGLERFELLGKLEGVEVFENKPLDASRKGTLQHPIVVDS
                     YDPYRYIGCTGSPAGSHIVMWLKPSVDKVARCWECGSVYKLNYLGTEDPHKHDH"
     gene            <274845..>275204
                     /gene="RPS26A"
                     /locus_tag="FOA43_003345"
                     /db_xref="GeneID:62196745"
     mRNA            <274845..>275204
                     /gene="RPS26A"
                     /locus_tag="FOA43_003345"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_038923596.1"
                     /db_xref="GeneID:62196745"
     CDS             274845..275204
                     /gene="RPS26A"
                     /locus_tag="FOA43_003345"
                     /note="BUSCO:EOG09344F9F"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_038779524.1"
                     /db_xref="GeneID:62196745"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="InterPro:IPR038551"
                     /db_xref="PFAM:PF01283"
                     /translation="MPKKRASNGRNKKGRGHVNPVRCVNCSRCVPKDKAIKRMSIRNM
                     VEAAAVRDISEASVYDEYPIPKMYNKLHYCVSCAIHARIVRVRSKEGRKVRAPPVRKR
                     YNADKRVNPADAARKAN"
     gene            <276100..>277713
                     /locus_tag="FOA43_003346"
                     /db_xref="GeneID:62196746"
     mRNA            <276100..>277713
                     /locus_tag="FOA43_003346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923597.1"
                     /db_xref="GeneID:62196746"
     CDS             276100..277713
                     /locus_tag="FOA43_003346"
                     /note="BUSCO:EOG09341E06"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779525.1"
                     /db_xref="GeneID:62196746"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MEEQTWRFSQCFGDKGDIENITEADIISTVEFDRSGDYLATGDR
                     GGRVVLFERNENKKNCEYRFYTEFQSHDAEFDYLKSLEIEEKINKIKWLRRSNQSKFL
                     LSTNDKTIKLWKVFEKQIKIVQENNMIECNKTHSNNSSTSSSALNSSAAVADSTNTAS
                     ALSVASQISSFQTSSSFIGGTNNDNIEDEENIAYSNSNTGDLQTDTIESDSGETTMAT
                     VSSPSVLKVTDYFKSVANLKLPRLTVHDTITAAQPKKIYANAHAYHINSISVNSDEET
                     FISADDLRINLWNLGIADQSFNIVDIKPVNMEELTEVITSAEFHPIDCNLFMYASSKG
                     LIKLNDMRVNSLCDNHARVFEEYMDPSNHNFFTEITSSISDVRFSSNGRYIASRDYMT
                     VKIWDINMETEPVKTINIHEQLRDRLCDTYENDAIFDKFEVQFSGDSKSVMTGSYNNN
                     FMIYQNAVTPECNAEKETEKEVVLQADKSAFKTKRLGSNKRKNLTMMNKMDFDNIDFK
                     KAILHLSWHPHENIVAIAATNNLYIFSAY"
     gene            complement(<278148..>278552)
                     /locus_tag="FOA43_003347"
                     /db_xref="GeneID:62196747"
     mRNA            complement(<278148..>278552)
                     /locus_tag="FOA43_003347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923598.1"
                     /db_xref="GeneID:62196747"
     CDS             complement(278148..278552)
                     /locus_tag="FOA43_003347"
                     /note="BUSCO:EOG09344ADL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779526.1"
                     /db_xref="GeneID:62196747"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="InterPro:IPR036418"
                     /db_xref="PFAM:PF02046"
                     /translation="MFRLFATKQTARVFGRRMNSSASKLEKKVFVSQPAEGKKFTKNV
                     EDIVAHSKAGAATWKKITMLMALPAVGLAAFAVYGVEKEHAANRKRLVALPDDQWPKS
                     YPYQNVRKNDFFWGDGDKTLFWNEGVNRHIHD"
     gene            complement(<278937..>280613)
                     /locus_tag="FOA43_003348"
                     /db_xref="GeneID:62196748"
     mRNA            complement(<278937..>280613)
                     /locus_tag="FOA43_003348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923599.1"
                     /db_xref="GeneID:62196748"
     CDS             complement(278937..280613)
                     /locus_tag="FOA43_003348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779527.1"
                     /db_xref="GeneID:62196748"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF05063"
                     /translation="MDRKAVEITKFLLDWNYLLINAPVSGSITEIYFCFILSNYSKGK
                     DRVSWQQFIKYLNMLNKVAHGHVLDCTPHNALQLTYEDPFKCFNRINYINRLSLSLIL
                     KRSKQLTHSENWGMEEPVKRSSLSSDIPTDKAGQYKYLMTLIEGSDHSLKKKWRSTEV
                     TSERIVNNSKLVPLDGDDIYSMTSRSGRLIQLELLLRSECASHHLIRERARLQTSERE
                     FYDCCENPDHANQLSQMTEFDRQVNYCKLKKSAWFGRNSLLAKCVNERMHFIPVIQQQ
                     TDTKLGDCSYLDTCHKMESCRYVHYGLLMPQSLQGYPEKSPNDKLQKAGLKVKQFTRI
                     NNFTRGEPVCLSSMEELPPQWINCDVTKLNFDVLGNNWGVIIADPSWTIHMNLNYSSM
                     KDDDLLSLRMDKLQKEGIYLLWVTGRTIEMGRKFLKKWGYRVLNQITWIKTSQLVRTI
                     STGRTGHWLNHSKEHLLVGVKGEPKWMNCGVDPQILISSTRETSRKPEEIYGIVERMV
                     GLRVKKLEIFGRQHNTRPGWLTIGNQLQETHLVEKEISIKYSQWLKSNVK"
     gene            <281209..>283425
                     /locus_tag="FOA43_003349"
                     /db_xref="GeneID:62196749"
     mRNA            <281209..>283425
                     /locus_tag="FOA43_003349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923600.1"
                     /db_xref="GeneID:62196749"
     CDS             281209..283425
                     /locus_tag="FOA43_003349"
                     /note="BUSCO:EOG09340S2X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779528.1"
                     /db_xref="GeneID:62196749"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="PFAM:PF05786"
                     /translation="MTETSGGETAVTSENFELWIRMATDNKINSSNSWNFALIDYFHD
                     MSMFREGDGINFQKASTTLDGCVKIYSSRIDSAATETGRLLSGLSSSEPNEKKSHTKE
                     GETEEADGSDESDYEDEAARKRAKQRKSRRNRTKNTLADDFAQIKVKEVDKELLANPI
                     FKKALSDFDEGGCRSLLMNMLHMSRDGRVLFVVTEKSKDSILNSVGELEVENDPPNEQ
                     KLETIQEMNEGVHSIAQEGVDADADANGFTCSLAKLGQLVSNLESDCKVCPSLDPLES
                     INDGNVSATQILDQIGQIEYLNTNEANPDNVDMNNNGDYDDICDNYDNNERSTAEISK
                     QNRSQYSLYLDEGLDEQDSTFKSLNLTRLFDENTATTMENEEDEEGGLEMAKYFDALS
                     NRNWRGPEHWKISRIKSKFAEVQHKTVEEELKQKERSMSPTGQFTKKANQWAVLNFMS
                     DGEDLSEAEIFKPGVASRLMVPQKQMEVQQGFNCLPEDLQFTTKRLICLNMKPDQRIN
                     TILTKKKKKLAVISRDEPNMVADESFFADVYKENDSQRPGANDFFGEDGIPENNDYTG
                     EDVNGQAPETDYDDDVPANDIDQFEVPIQQPLRTILSQSRQHNNGGLNYARTSKRVDI
                     RLLKQELWSTLQENENLHKKRDASFLDENKENINEDSLERTIKQTPSGEVEQKEHEDD
                     DLKFSDVVSKMSVKYEGQAKKDLSTSFCFICMLHLANENGLTLEGTADNRDLIIKK"
     gene            complement(<283570..>285888)
                     /gene="LEU1"
                     /locus_tag="FOA43_003350"
                     /db_xref="GeneID:62196750"
     mRNA            complement(<283570..>285888)
                     /gene="LEU1"
                     /locus_tag="FOA43_003350"
                     /product="3-isopropylmalate dehydratase"
                     /transcript_id="XM_038923601.1"
                     /db_xref="GeneID:62196750"
     CDS             complement(283570..285888)
                     /gene="LEU1"
                     /locus_tag="FOA43_003350"
                     /note="BUSCO:EOG09340L2E"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="XP_038779529.1"
                     /db_xref="GeneID:62196750"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="InterPro:IPR033940"
                     /db_xref="InterPro:IPR033941"
                     /db_xref="InterPro:IPR036008"
                     /db_xref="PFAM:PF00330"
                     /db_xref="PFAM:PF00694"
                     /translation="MTVAKTSHPRTLYDKVFDDHIVKIDDSGSYLLYIDRHLVHEVTS
                     PQAFEGLRNAGRSVRRPDCTLVTVDHNIPTDSRKSFKSIATFIDQPDSRLQVETLEEN
                     VKRFRLPYFGMADSRQGIVHVVGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTS
                     EVEHVLATQTLIQTKSKNMRILIDGDLAPGVTSKDLVLHVIGVIGTAGGTGCVIEFAG
                     KAIRDLSIEARMSICNMSIEAGARAGMIQPDEKTFEYIKGRPLAPKGAEWGKAVSYWK
                     TLYSDDSAHFDRQVVIKAEDIIPTITWGNSPQDALPITGKVPDPEDFADPIVRDGVIA
                     ALDYMGLKPNTPLKDIYVDKVFIGSCTNSRIEDLRAAARVVRGYRVAKNIKRALVVPG
                     SGLVKKQAEAEGLDKIFTAAGFEWREAGCSMCLGMNPDILSPYERCASTSNRNFRGRQ
                     GALSRTHLMSPVMAAATAIIGHFTDIRDFKYKEGVDQPKINIDDVKESKLLEQAVHDE
                     EKKPIAALTESTSDAEIEEEIEKEQAADTGASMEKFTVLTSVAAPMTKANIDTDAIIP
                     KQFLKTIKRTGLGEGLFYEARFKKDESGKVVPTDFILNVEPYSHAKILIVTGNNFGCG
                     SSREHAPWALKDFGIRSIIAPSFGDIFYNNSFKNGLLPIRVPQAVIKEKLYPLAVAKK
                     EITINLDKQQICGSDGEVIVDHFDIEGFRKHCLLNGLDDIGITLQKVKYIDAYEQKRK
                     VQFSFLEGGSGSIIVPIKGTKKSAFGVTAHEW"
     gene            complement(<286142..>287503)
                     /locus_tag="FOA43_003351"
                     /db_xref="GeneID:62196751"
     mRNA            complement(<286142..>287503)
                     /locus_tag="FOA43_003351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923602.1"
                     /db_xref="GeneID:62196751"
     CDS             complement(286142..287503)
                     /locus_tag="FOA43_003351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779530.1"
                     /db_xref="GeneID:62196751"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR027545"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01494"
                     /translation="MASVAIIGAGPVGCLAGLGFAHKGYKVTLYDSRPDPRIIEDQSL
                     RSINLAVSDRGINAMKYIDSEMTGRVLEGIIPMYGRMIHHLDGGQESQKYGLFGEHIN
                     SIDRDKLNQCLITELERFNNLNPDNKVEFKFQCKFTTMHVEEDADNVVIEYYDLLKKK
                     QTGIYDFVVGADGCYSRVRSTLMKYIRMNYRQVYIDMCYLELTIPPGPEGSFRIDANH
                     LHIWPRRDFMLIALPNGDGSFTCTFFGPWKLTESLNTKELVEDFFKKHFSDAINLIGL
                     GKIVIAFLNHPKSALMHVTCSSYHYNDKCILIGDSAHSMVPFYGQGMNCGFEDVRVLL
                     ELLNKHDQSRKAAFDEYSASRHKDLVSILRLALDNYYEMSTKVQSPRYLFRKKLDNIL
                     GRFFPDHWIPLYSMVAFRADIPYSECIRVENRQKKLVKILESTVLTSGLALLVVYLSK
                     KSN"
     gene            complement(<287837..>289270)
                     /locus_tag="FOA43_003352"
                     /db_xref="GeneID:62196752"
     mRNA            complement(<287837..>289270)
                     /locus_tag="FOA43_003352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923603.1"
                     /db_xref="GeneID:62196752"
     CDS             complement(287837..289270)
                     /locus_tag="FOA43_003352"
                     /note="BUSCO:EOG09341XL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779531.1"
                     /db_xref="GeneID:62196752"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR037278"
                     /db_xref="InterPro:IPR038508"
                     /db_xref="PFAM:PF01412"
                     /translation="MSEEDFASKYEIKQIFSRLQKKSINRQCFDCGAKNATWTSIPFG
                     IFVCLNCSASHRKMGVHISFVKSSTLDQKWTYKQLRMMKCGGNDKLREFFQKNGGSVY
                     LTRPLQEKYTSNVAKNYKEKLAQHAELDGKRYANILEWEDGLLPEEKDERASSTDDFF
                     AKWESSSSSNTPSPLGSGSITPANKSKSSLVDTDTEKKVAGATRRSSGSVLKGSSLGG
                     RKKNILGSGSGHRSNAKLNVKKVSPDIDFDAFEKEAKEEEKEAKILGYNPSSDDNKTS
                     NSRTLSPSSSSSSNATARVSPLTLSKVGSGSGINKDRSDSFSASSSRASASFQAAPVE
                     DTRQSFAKLGFGMTSSLQPDTKQSSSGRRSQGPKYTGDVSKRFGGQKSISSDQFYGIN
                     SYDEEKAKEARTRLKAFSGSQSISSSQYYGDDEEAQMRAQAGNGDLEQKVTQFAEKYM
                     GDDMAVLKGALEEGAEKLSGYLRDVMR"
     gene            <289516..>291525
                     /locus_tag="FOA43_003353"
                     /db_xref="GeneID:62196753"
     mRNA            <289516..>291525
                     /locus_tag="FOA43_003353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923604.1"
                     /db_xref="GeneID:62196753"
     CDS             289516..291525
                     /locus_tag="FOA43_003353"
                     /note="BUSCO:EOG09340S2X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779532.1"
                     /db_xref="GeneID:62196753"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="PFAM:PF05786"
                     /translation="MNSSHKRRRLLDDPEQNGDGLDTSGDFILTDTNIGVHKMNFDEA
                     IRMATDNKINSSNSWKYALIDYFHDMNLLRSKDGLSINFQKAGATLDGCMKIFSHRID
                     SVASDTGRLLSGLAQKSNSAELGEETEGNISVEDEESTKEDVAKRRRRAKKPRTTLKD
                     DFETLKYKQYDRELAIDPLFKSALSEFDEGGAKSLLMNILKINSEGRIVFDETMTASK
                     LEGAGVNSTEKSKESINKEAVGEVSSCAASVNAFLGKSQFDTDDLTVCSNLDALERVL
                     GNIDLADDFVDSIIPTGKKDADDETMLNNDVPAYEPVGNNTSRAGLSPEDYVTDNGIS
                     EADADIDDGEEGFIGNVNEEVFGLLKKLDKQTNKTWTGRTNPSWKIDLFRKTMGQKLN
                     DEIIKQEKSKDCKVIESEEIKLKPSKNSYPINFLNTEEGELSEKKIFRKGRRTTLPES
                     SFNDYSSVTLPDDLQWSSKKLIQSFLKPDTHISIFRRVKWRSNDHSLLAEQELWADVY
                     SKPNSEKDNDNDGGQHFFADVPQDENLDEHEVDEDEGILGDIDFNMQLSSSQNPCKYS
                     SRPLNYARVSKKVDVRRLKDNMWQSAASNEKDDQIDVKLSDVMKDTLERYDGKQKKDM
                     STSFFFICMLHLANEHELEISSNTNHTDLKITGAIDNKSLLQNTT"
     gene            complement(<291628..>295086)
                     /locus_tag="FOA43_003354"
                     /db_xref="GeneID:62196754"
     mRNA            complement(<291628..>295086)
                     /locus_tag="FOA43_003354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923605.1"
                     /db_xref="GeneID:62196754"
     CDS             complement(291628..295086)
                     /locus_tag="FOA43_003354"
                     /note="BUSCO:EOG09340A7V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779533.1"
                     /db_xref="GeneID:62196754"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF12906"
                     /translation="MTEEVAVCRICRCEGTPDAPLFHPCKCRGSIKYIHQDCLLSWLE
                     HSHKDSCDICHASYHFKTVYDPNTPDILPAFIILRKVFSELRVLLYRLTQVALVAVLV
                     IFQVPVFVSSIDRLLNWQLGCHVPYSSYTYGFIYGEEIPGKTAESLISDWDKLTTFFE
                     NTWSRGLTLILKYAFVLGSMLLIQGSVVSDEGFSKIIHKKIGPEPRMNRLIELLHRRQ
                     LRRLNNEIQNQNENENVGGNADDDQANLEELRRVVEDANRVMHEERPRNHDLLDDGHA
                     IDGFDDLDANELNDIPNLPVLPDGAPPIDAIVPDEDAADNLNNRLFDMDKGITFIFQI
                     TIFMDVAVIGILMCLKTFPSLIGMATIDLVSSLVKSSFSSIYGLVHSTNVYTLAVRYI
                     DGFLTSDTVHHLLQYCRDNKLIFNVTNFFMQNWFLPIKDVYTNTVQWTPSANTFERDS
                     VVIVGFFIAGCAIMFIMRRMEHGCSQNNPLTGGYRSIYIVLLEIICILKVFALVMIEW
                     LAFPLFCGYQIEFSLVPFFNDDLYTYKIDPPLLGDAVPLGVAPRWLLGTFFMYFFAAF
                     VTMTRSYILRKGVLFFIRPSDDPDIRLLHDALMKPFSLKLYHIGLSAFVYSIYIMIEF
                     TMVVWGVRLLSPIQILPSTPRFFQLERLDYVMLFFVASMAQDKIKAYWKWAFQYSCSK
                     LRLSFFLLGNDVPSERGHVLYKNWNSRLTHFNALPDYSSPVLEHEAAHYFAEHPDTIC
                     CFVPDGNYVRAPDNDQVARTFVKELFVPVTKDDKLLAPIPTIDDDEDRYNPYGDEELL
                     NIVTYTIVYRPPGFRNRIFCLLGMMWAFSMFLTFTLYADSVLIGVIMIRFPSLGGVFH
                     LNDSWNSNPFKVDFVRIAAALLHLIFMSKLYDSFALQKDWIFQVLKGTATRNSHSCFS
                     KIRLTLKVARRVVSIPAHNALRYIRRKADHLKVGLLIITYGFAEFIILALGITLPQKC
                     LETYILSRPELLHSWIMSVYRVSVFAFIILSMNYLGGIVISLEPRFTVSFKIRYQIFY
                     VSLVIGLIWILQFGYYLTSHPDDDFSWLFQNELSSEKGLSLSLLEYWIDLSVDRLTVT
                     NFSCLGLWILFLMKEFSLQIKEFFGRVNGQLKEEYFSSGKVLTNASDDFNTDDVSVHS
                     TNEVNE"
     gene            complement(<295361..>297370)
                     /gene="HSA1"
                     /locus_tag="FOA43_003355"
                     /db_xref="GeneID:62196755"
     mRNA            complement(<295361..>297370)
                     /gene="HSA1"
                     /locus_tag="FOA43_003355"
                     /product="Heat shock protein 70 1"
                     /transcript_id="XM_038923606.1"
                     /db_xref="GeneID:62196755"
     CDS             complement(295361..297370)
                     /gene="HSA1"
                     /locus_tag="FOA43_003355"
                     /codon_start=1
                     /product="Heat shock protein 70 1"
                     /protein_id="XP_038779534.1"
                     /db_xref="GeneID:62196755"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="PFAM:PF00012"
                     /db_xref="PFAM:PF06723"
                     /translation="MTKAIGIDLGTTYSCVGHFANDRVDIIANDQGNRTTPSYVGFTD
                     TERLIGEAAKNQAAMNPTNTVFDAKRLIGRKFTDPEVQSDMKHWPFKVIDDAGKPKIQ
                     VEYKGETKVFTPEEISSMVLNKMRETAEAFLGEKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGMNVMRIINEPTAAAIAYGLDKKAESSGEKNVMIFDLGGGTFDVSLLSIDDGIFE
                     VKATAGDTHLGGEDFDNRLVTHFADEFKRKYHKDMTGNQRALRRLRTACERAKRSLSS
                     SAQTSVEIDSLYEGIDFYTSITRARFEELCSDMFRSTLEPVAKVLRDSKVDKSQIDEI
                     VLVGGSTRIPKVQKLVSDFFNGKELNKSINPDEAVAYGAAVQAAILSGDTSSKTQDLL
                     LLDVTPLSLGIETAGGVMTKLIPRNSTIPCKKSETFSTYSDNQPGVLIQVYEGERTRT
                     KDNNMLGKFELTGIPPAPRGIPQIEVTFDIDANGILNVSAVEKGTGKSQKITITNDKG
                     RLSKEEIDRMVSEAEKFKVEDEKEAERIGAKNGLESYAFSLKSTASESKFADKVGAED
                     KDKLLKKTDEVISWLDANQAATKDEYDDKKKELEEESNPIMQKLYAAGGAPGGAPGGA
                     AGGAPGGMPGGMPGGMPGGMPGGMPGGGSAPSGGDNNGPSVEEVD"
     gene            complement(<297717..>298535)
                     /locus_tag="FOA43_003356"
                     /db_xref="GeneID:62196756"
     mRNA            complement(<297717..>298535)
                     /locus_tag="FOA43_003356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923607.1"
                     /db_xref="GeneID:62196756"
     CDS             complement(297717..298535)
                     /locus_tag="FOA43_003356"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779535.1"
                     /db_xref="GeneID:62196756"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="PFAM:PF03798"
                     /translation="MQLHIEKDPFLKYRPFAGQTDNLLLQHWHELAATVVFYSVLMLV
                     APKVNKRIFGDYYSKMQNKKRRLDFDIHIVAMIQSLLAIGLCVPMFAHPLFNTDPIFG
                     TYDFAGFAASLTCGYFVWDLVYCCIFHYDIYGFQYLFHGFGALIVFTSTFAGYCQPLI
                     PAFLIYELSTPFVNLHWFYTRGPKGLVNEKTFLLNGLLLMTTFFLSRCVWGIYVSIKI
                     FRLCMQYKDRMPVLFIPVIFTLNIGFHILNLYWFSKMVLLATRRVGVDDRKKDY"
     gene            <298802..>299491
                     /locus_tag="FOA43_003357"
                     /db_xref="GeneID:62196757"
     mRNA            <298802..>299491
                     /locus_tag="FOA43_003357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923608.1"
                     /db_xref="GeneID:62196757"
     CDS             298802..299491
                     /locus_tag="FOA43_003357"
                     /note="MEROPS:MER0031431;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779536.1"
                     /db_xref="GeneID:62196757"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="PFAM:PF01965"
                     /translation="MAGKKILIVVTNVSKYPTLPRATGLWLGEAVHFVDKVTKAGYQV
                     DYVSPLGGYTPMDPMGLADTDELSFDYYQNRDFMNKLGTTLKPSQINPDDYLAIYFTG
                     GHGVVFDFVNNTELQKISAKIYENNGYVTAVCHGSVGLANIKLSSGENLIKNKQVTGF
                     SNDEERQVKLDKVLPVLTEDLLKSKGGIYVQTKKLWDSFAVTDGRLISGENPASAGAV
                     ADQLLTALKQK"
     gene            <299711..>300733
                     /locus_tag="FOA43_003358"
                     /db_xref="GeneID:62196758"
     mRNA            <299711..>300733
                     /locus_tag="FOA43_003358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923609.1"
                     /db_xref="GeneID:62196758"
     CDS             299711..300733
                     /locus_tag="FOA43_003358"
                     /note="BUSCO:EOG09342S36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779537.1"
                     /db_xref="GeneID:62196758"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PFAM:PF00294"
                     /translation="MGYDLVCLGNPLLDIQADVSKELLKKYDLKDNDAILAEEKHMPI
                     FKELLSMDSVKLVAGGAAQNTARGAQYVLPPKSVLYFGSVGKDLYSEKLTNANNAVGL
                     TTSYMYQDEFATGKCAALIYHTNRSLVTDLAAANHFKPSHLQKPENWAAVESAKVFYV
                     GGFHLTVSPEAIELLGKHAAENNKLLILNFSAPFIPEMFKDALDRVIKYVDIVVCNES
                     EISSYGKSHNAGTEDLDSIAKKIVAVPKANQKRERIVCFTQGTKPTHLVSKDSVKIYN
                     ITPLESEKITDTNGAGDAFGAGFVAGLVQGKELETAIDMGHWLARLSIQEVGPSYPVP
                     KQSYSN"
     gene            complement(<300944..>301882)
                     /locus_tag="FOA43_003359"
                     /db_xref="GeneID:62196759"
     mRNA            complement(<300944..>301882)
                     /locus_tag="FOA43_003359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923610.1"
                     /db_xref="GeneID:62196759"
     CDS             complement(300944..301882)
                     /locus_tag="FOA43_003359"
                     /note="BUSCO:EOG09343AIG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779538.1"
                     /db_xref="GeneID:62196759"
                     /db_xref="InterPro:IPR004728"
                     /db_xref="InterPro:IPR011553"
                     /db_xref="PFAM:PF03839"
                     /translation="MNYGSEIQPKNSRQPLVQGQKVALSQQTNPAAVSIATAVRYNKL
                     LKQRQGINSSNNSQHDFFRYKRFVRALESEDYKRQSDKRPDVLPAIEDDEGAQKIFVM
                     MIQNQLVLPVRKLKTKEAKDRGIKVTKTSPALEVIHKAVLQGDVYYMWNFTPANPYLW
                     IYSILGLVAVFGVILFPLWPIWMRKCVWYLSTGMLALIGVFFGIAIIRLIIYIVTWVA
                     LPQQFWLFPNLFADCGVIESFKPLYEWKDPSKGGKHKHKDDKTKGAITEVKTNTAETA
                     AGTTTSSSVSDATTGTSSVLSKKRIATVVDLDDSDN"
     gene            <302138..>305140
                     /locus_tag="FOA43_003360"
                     /db_xref="GeneID:62196760"
     mRNA            <302138..>305140
                     /locus_tag="FOA43_003360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923611.1"
                     /db_xref="GeneID:62196760"
     CDS             302138..305140
                     /locus_tag="FOA43_003360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779539.1"
                     /db_xref="GeneID:62196760"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MPPIGNKHISVRADNSETSVLNNAQSRRQSHSTQALNFDLFPQI
                     IIPNSRDTRSGPERYPHENSNYKNAPFDSSGECIDDEEQDSQSDGKISGYSSYERREV
                     LEGSSNDNKEDLQSSILNKILDEDLGNKGTELDDSRSKFHYKNLYDKYREPSMADTPS
                     VATTDLTDFEKYNLQMAKEQKIRDRLRQMKGLRVADRGHVKYLPTLGIGDLDSGYIKP
                     IYAQIEKPPSATKRSQAAYWYQRMFRKGGRRETAAVTATNTVEKYYSSGSSSHNIGNP
                     TYDLSVRNGSTGNGKMFDRSSVCTAPIDDDIDLDGSPVELQTYCNLKSTNFKSRSYHA
                     PSLTSVNGDDSIDMIVSNQENVDYNFQLIDSDDTEKDYLRRVTVRNGDGHRPFANVRS
                     DEFSIKDTLRRVNPVRIMREQKNQRYRIQRKLKLRHLHQIALGGTLGVGLLLSSGKAF
                     SIAGPLGCLLGFIIAGLIVLATMLSFCEMVTLIPLCGGVSGVSSRFVDDAFGFALGVG
                     YWLCYMVGLPTEITAASIMLSFYKSLDIPGPNTCGWIAFFLIFATCMNLCDIRVYGEF
                     EYFSTIIKLLIIIALMIYMIVLDCGGSAPLHHRMGFRYWDSSKSDWANSITFGAFRPT
                     FDVNDIGLGSLDGIGGAKGRICQVLIATVVASYAYVGTEIVIIAGSEARDPRKAIPSA
                     TRNIYWRIFIFYISSIFAVGLNIYSGDPRLLRYFSSSATNGSGYLANNNSIDKVISLV
                     GGDLCETNLLTWAGFSNGNQSPFVIAIQSSGMCTFAAVTNAFLLYFAVTAATSQLYAA
                     SRTLYFLSIQGKAPQLFSICSKNGVPYLSVLFTAAFGCLAFLSVNNNTALVFERLLSI
                     CASSGLIVWSGMCLSFIRFYYGLKLRPDIINRDDENYPYKSPFQPFLAYFGMISSFFT
                     VIISGFLVFLKAKWSPMHFISCYGSLFVFIFCYITYKIFRRTKIHRLDQLDLDSGRRE
                     IDRIIWEDEQNYVSNFKEIIHRFINFLL"
     gene            complement(<305181..>306047)
                     /locus_tag="FOA43_003361"
                     /db_xref="GeneID:62196761"
     mRNA            complement(<305181..>306047)
                     /locus_tag="FOA43_003361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923612.1"
                     /db_xref="GeneID:62196761"
     CDS             complement(305181..306047)
                     /locus_tag="FOA43_003361"
                     /note="BUSCO:EOG09343SRQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779540.1"
                     /db_xref="GeneID:62196761"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="InterPro:IPR029012"
                     /db_xref="InterPro:IPR037200"
                     /db_xref="PFAM:PF06246"
                     /translation="MLHRKKEANSGLNRYYSENAPQISRERPSRTQDVKNASDAEACR
                     KMCMKDINRDLIRINDALTEEYQIRELNDKLNKLMRELRSWEYRIKELGGPDYFQKGG
                     EQFYGNAAKINGYRYYGRAKELPDVQKLLNANLEQQKRDEQQKSKKRSDKTALKMMTA
                     HEFSPMYYGLDQELENRHLIPSENEIADEMSYILGTKNVKISTLITLDKLKESNEEYY
                     REKAGGSGDLISFERKRSRELQQEVDKKSDKPLVEFDESFDKELLTSDDVERFIVQRR
                     KEQLLAKLNQSL"
     gene            <306247..>307899
                     /gene="GDA1"
                     /locus_tag="FOA43_003362"
                     /db_xref="GeneID:62196762"
     mRNA            join(<306247..307718,307884..>307899)
                     /gene="GDA1"
                     /locus_tag="FOA43_003362"
                     /product="Guanosine-diphosphatase"
                     /transcript_id="XM_038923613.1"
                     /db_xref="GeneID:62196762"
     CDS             join(306247..307718,307884..307899)
                     /gene="GDA1"
                     /locus_tag="FOA43_003362"
                     /note="BUSCO:EOG0934183G"
                     /codon_start=1
                     /product="Guanosine-diphosphatase"
                     /protein_id="XP_038779541.1"
                     /db_xref="GeneID:62196762"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="PFAM:PF01150"
                     /translation="MSAIRKSRLFVVGASLIIGLIIFLSIPSQRVSAISSSDDQLQRA
                     DVGYGISLKPEKSLHENYDVNSKDSEHGTTSSGASSSGASSSCTEKKEYVVMIDAGST
                     GSRVHVYTFDTCFSPPKLLDEQFKMLKPGLSSFDKDTIGAAKSLDPLLQVALDTIPSE
                     ERGCSPVSVKATAGLRLLGQEKSDAILQEVRSHLENDFPFPVVSGDGISIMDGGDEGV
                     YAWITSNYLLGNIGSDEKLPTAAVFDLGGGSTQIVFEPVDGEKMIEGEHKYKIDFGGR
                     SFVLYQYSHLGYGLMQGRQKINALVLDLLIKRGKVSNLKPLTESQMENVKTLRSDITI
                     KHPCVPPGVTAENVKVEMEDGSAYLVNFVSPAENESDPLAATASTQCRFLAESVLNKD
                     ADCESKSCSFNGIYQPSLRHQFPVGSDMFVFSYFYDRLKPIGMPTSFSLQEMLDLTQL
                     VCSGSSIWNEFFLQKTTINELQDEPLWCLDLSFMTTLLHTGYTWM"
     gene            <308418..>310316
                     /locus_tag="FOA43_003363"
                     /db_xref="GeneID:62196763"
     mRNA            <308418..>310316
                     /locus_tag="FOA43_003363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923614.1"
                     /db_xref="GeneID:62196763"
     CDS             308418..310316
                     /locus_tag="FOA43_003363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779542.1"
                     /db_xref="GeneID:62196763"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="PFAM:PF01513"
                     /translation="MSSNNSWSTNSEVSNAPSSDLISSQDLKRSESMIPKEPVLHTCF
                     FDSDSPTVTVSVDSRNNQPFENQVGVQAKTQVQIKAKTQAQAQAQVSSPPGYNGMAMR
                     AGYSLQRQPNYSYQKATIPPSAPAPVPVPISLSPSHMNSAKECDSTDQLLDTLQYEGI
                     SGMKSHADLAKTAHSVRILAKRLDKATIHLQMNNVMIITKARDNSLIYLTRELAEWLL
                     KRYQKTTVYVDYHLEHSHRFNFEALIADVTNGKERLKCWTKKLALEKPDLFDFVITLG
                     GDGTVLYASTLFQKVVPPIISFSLGSLGFLTNFQFEDFRTTLDLGIKLGVKTNLRMRF
                     TCRVHDADGALICEQQVLNELTVDRGPSPFVTMLELYGDGSLITVAQADGLIIATPTG
                     STAYSLSAGGSLVHPSVSTICVTPICPHTLSFRPILLPDSMVLKIKVPLRARSHAWAS
                     FDGRERTEMSKGYYVTVSASQYPFPTVRSSKSEYFESVCSVLNWNKREEQKSFVHLLS
                     DKNKKSYNDYRESHERRCLDHDIDQDGEGYNYSHSDDPVSAYSSDVRDEHVMYNDKID
                     DVVSNGRYEIDYSDDLDDLELEDSLSNEVKGKLKIGMADSFTDGNKPQFYTGDSSVST
                     SSGSSSPL"
     gene            <310666..>314358
                     /locus_tag="FOA43_003364"
                     /db_xref="GeneID:62196764"
     mRNA            <310666..>314358
                     /locus_tag="FOA43_003364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923615.1"
                     /db_xref="GeneID:62196764"
     CDS             310666..314358
                     /locus_tag="FOA43_003364"
                     /note="BUSCO:EOG093405X1;
                     MEROPS:MER0002475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779543.1"
                     /db_xref="GeneID:62196764"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029346"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF12436"
                     /db_xref="PFAM:PF13423"
                     /db_xref="PFAM:PF14533"
                     /translation="MNGNGNEIDHVDLSAVDEELSSSRSSDFSMDENSKMIPHKQSSG
                     EKDIFDSSKVATNLEHALDDVPEYYHTEAEGFHTWEIDDITQLVGDEKVFGPKFEVGD
                     NFVFNPLITTAKRQSNLFFSVYLEGHPSDAKVAESDDWHCCVQFALDIWNPEDPSKHK
                     MNSTHFRYNSKVIDWGFISLLDGRFSADSALIENKRLNITAYVRIVNDFTGVLWHDFV
                     DYDSKKATGYVGINNQGATCYLNSLLQSYYFTKKFRKKVYQIPTQDEVSFDVPSFKDY
                     LEQPKSVSLSLQRIFYNLQTSDKPIDTMELTSSFGWTSADAFTQHDVQEMNRILMDKL
                     ERKMKHTDIEGCLNDIFVGNMKSFIRCIDVEYESSRTEDFWDIQLNVKGLKNIKQSFE
                     NYVELELLEGENKYDAAGYGLQAAEKGVVFESFPPVLHLQLKRFEYDFEYDQLVKIND
                     RYEFFDTLDLKPYMNKEAKHYDEDWEYKLHCVLVHQGDVSMGHYYAMIKPGEDDKWFR
                     FDDDKVWRVTPNEVFEGNFGADQSPEELRRMTRDEQQDFQLRRHTSAYMLVYLRKCKA
                     PEILNEVEKKDIPLHIPKQIEYESEQLEKIRKEQEEMHLYADFKVFYHNAFTKYQGFD
                     LGPNEDDRFNYCPELYDHDSFPLKFRLLRTDQFSKVYDTVIEKLGEKVDPKLIRFWIM
                     GSRKNYALRPVETIGFTYGDDENFGDVTIDSVIDEYEISTIDRRRSSVGQSVQLVLYL
                     EDSSKELKFVSNSIYEMKNKSEIPDDADSIEDTAERYNKYSMMALHSFHPKIEPVDKD
                     ASRHLLFLKFFDLPSQSVNGLTQIIVPSENTIEYLVPLINNILKFPMDTALKFYEELG
                     HDQILPLSATKTFYKSELGNGDIICFTKADWGTELLPDLEYQSAKELYAFLANRVHFK
                     VAPLQKVGEDEEEYVTKDSSTDSKISKSGLHDAPFELWFSIASNYNDLTKKIGEKVKV
                     DPKFLRLFIVGHANQTFPLKSTSSLKRLFERISKAQILRIRYEVLSVTLVDFEHMTLC
                     KVYWVGQGICREQRHEFFLPKSSTLENLLDRLQAKVHFNPEEKDSLLCWTMDARHKFG
                     SVCEEDTGIDQASEFIIGYYPAYKEVLKTKPPNVHLITGFQFFGQVQNSHSIPFMFDL
                     IEEELFKDTKVRLHKLLGISEKEFEGVRIAVTDLNVVDYLDSPERDDVQLFNFAQNSP
                     FYLAIDHPDRNLRRSSVYEPSIYIRD"
     gene            complement(<314374..>315267)
                     /locus_tag="FOA43_003365"
                     /db_xref="GeneID:62196765"
     mRNA            complement(<314374..>315267)
                     /locus_tag="FOA43_003365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923616.1"
                     /db_xref="GeneID:62196765"
     CDS             complement(314374..315267)
                     /locus_tag="FOA43_003365"
                     /note="BUSCO:EOG09342JP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779544.1"
                     /db_xref="GeneID:62196765"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PFAM:PF01467"
                     /translation="MAYRNPLLLITRKQIKNQQSLNVVISSALPQVEPGSNLYIQITA
                     DYTQLSILIDELVSVYDTARHYSEENKNISTYVLFGSNYLNLFNYCDWTIALYQSSDA
                     LSRFINKPGIPIKLLQESNTDLSEFKPDAHPMDNLTGSKDEYHTVAVGGTFDHLHDGH
                     KILLTASIFLASTILIIGVTGPKLLVNKKYAEYMESYDQRASIVGRFVKLIDFNQRTD
                     FYQINDVCGPTGHINEIDALVVSFETASGGDYVNNLRKEEGLKQLKIIAVCVIGGKDS
                     EQFKEKLSSTYLRKLEAEKQQ"
     gene            <315443..>317359
                     /locus_tag="FOA43_003366"
                     /db_xref="GeneID:62196766"
     mRNA            <315443..>317359
                     /locus_tag="FOA43_003366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923617.1"
                     /db_xref="GeneID:62196766"
     CDS             315443..317359
                     /locus_tag="FOA43_003366"
                     /note="BUSCO:EOG09341H8R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779545.1"
                     /db_xref="GeneID:62196766"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF02847"
                     /db_xref="PFAM:PF02854"
                     /translation="MSDSKEELKSPQKSGAYVPPAKLKEIQGNAQFAEGSEDYQKLQW
                     ETLKKSINGLVNRVTKENLKDVVINLFKLDIVRGKGLLVKSLMKSQRVSEDYSSVYAS
                     LVSVINSKIPEIGKLLITRLVLQFKKDYKIDNKQACTADLSFISQLTNFQVSHEILVL
                     QILYELLEKPINDSVELAVELMMQCGHHLHMHSKVACNAIFERLRAIRTESLMSSRVQ
                     YILDKLFELRRKGLEDEGQVDDDLDITEEEDKITHSIGLSDELNGEWMLDDFRCDEDY
                     DENEKKYEKLRKEILGESVDDEGEHESAEGSEESSEEEFSDSSDEDNDGDDVSHNNDN
                     EVKEEIKDLTEQELTNFQKSVYLNVMGSMGPEEAVHKLLKLDAIDHTKHEYMVVDMLV
                     KCCAQEKSYSKFYGLIGEGLILVGRKWEDAFNLVFEENWDACHRYETSLLRNIGTFWG
                     HMLSSDKMGWEVLRIIKLTQEDTSSAQRILLKFVFLRIRSELGVNELLTRLNEPYIKS
                     FIQGLFPETSAEHIRFSINYFTAIGLGRLTEDMRETLKNLPDSDGESGRSSSRSSSYS
                     SGKSSRSSSRSLSRSSSRSPSRSPSRSSTRAPFTDQPPHSRKKPRWTSSSRAPGSRDY
                     GTNANAIPLGPKRG"
     gene            complement(<317553..>318806)
                     /locus_tag="FOA43_003367"
                     /db_xref="GeneID:62196767"
     mRNA            complement(<317553..>318806)
                     /locus_tag="FOA43_003367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923618.1"
                     /db_xref="GeneID:62196767"
     CDS             complement(317553..318806)
                     /locus_tag="FOA43_003367"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779546.1"
                     /db_xref="GeneID:62196767"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="InterPro:IPR036273"
                     /db_xref="InterPro:IPR036865"
                     /db_xref="PFAM:PF00650"
                     /db_xref="PFAM:PF03765"
                     /translation="MFGFGRKNNEGDAEKKRLTEEDRVKHLIPREIPFECAPSYIVPP
                     RENPLTESQLEMYDTVLKHFQQKDLEISVKEKSDIDTERRVLTSDEQAWVTRECILRY
                     LRATKWIVKDAIERIERTIAWRREFGIDHQLDDSKNIVTPELVDPESETGKEVVLGYD
                     NDDRPCLYLKPGRQNTKNSFRQVQHLVFFLERVIDFMPSGQDSLALLIDFKQHPEIES
                     QVETSKIPPLSVGRQVLHILQTHYPERLGKALLTNIPFLGRAFLKLIYPFIDPLTRQK
                     LVFDADFAEFCPKEQLDKEFNGLVDFEYVHKVYYPALVKMAHQRRQHYMERFRKFGGV
                     VGLSEIDLRGDSYELKLPVGSHPWQTEKAPETTARSATIKSNDESSPLKRPIANETTG
                     KVTDSNDKEVERIIPQTEQVLLVKD"
     gene            complement(<319087..>321284)
                     /locus_tag="FOA43_003368"
                     /db_xref="GeneID:62196768"
     mRNA            complement(join(<319087..321233,321281..>321284))
                     /locus_tag="FOA43_003368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923619.1"
                     /db_xref="GeneID:62196768"
     CDS             complement(join(319087..321233,321281..321284))
                     /locus_tag="FOA43_003368"
                     /note="BUSCO:EOG09341P81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779547.1"
                     /db_xref="GeneID:62196768"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="InterPro:IPR036045"
                     /db_xref="PFAM:PF00995"
                     /translation="MMKGLFKDDILNYVYTFYKIDDEKRSRNRDRAIYILDPVSRYSI
                     ECLLADFSRGTRYKDTVVCFLPGLSPTNYKRLRQNKFLEEATVGGKFATIDYLSLQPV
                     EHRVYVTGCTYSVPVYYNFQHLGRDLVQYQLDKSVDSMISLCVLTNEYPIVRFYNSPL
                     SKQLAVTFQKKLDEYYRNHPQLAPVNSETVFLITERSMDIFGPFCHYKYYRSQLFDLM
                     DDQVKTVRGDYTYVYDYNIKTGQGVEEKHLVFDTDDPVYSELKDLTVEDYTHKIVHMV
                     NNLKKEDDRYNNLKFTSDLSHAALNQSEHMFNKQLVTGHFQLISKINDKFHEEQLLEA
                     IVFENQCASNLGESKQLHEPVSDDLIKLLANEHLFMGNKIRLLIIYAISRGGLIESDY
                     MKLLHFGMPEKVDSIMTLIKNLQKVGLNLLKPSLSEKRQQINTFFDIKNTQELTDRLI
                     PTFSNIILRLAQNRLPELYNIKLNDDYYYGRKSGSGLDSDLEEDDKTFPYVKGAPVDD
                     MESSMNNLSLGSSKSTLRSQPKWKSTRPSESKLTRQKLLIFCAGGLTQSELSAMISLE
                     PTINKNIFIGTDELYSTWDLLGDIRLINDERSNFSFPLDQKFLVRKPPAFLYENSESR
                     PSGSSSAVHSGSRDAGINRTDAVDASNGTAGINYGAGLNDSNLKTTDHHSHHRHLHNH
                     HQDESTDKDLTPHDEKGKRGKLLRRFKSFGKSSN"
     gene            complement(<321598..>325482)
                     /locus_tag="FOA43_003369"
                     /db_xref="GeneID:62196769"
     mRNA            complement(<321598..>325482)
                     /locus_tag="FOA43_003369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923620.1"
                     /db_xref="GeneID:62196769"
     CDS             complement(321598..325482)
                     /locus_tag="FOA43_003369"
                     /note="BUSCO:EOG093408J6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779548.1"
                     /db_xref="GeneID:62196769"
                     /translation="MIHLSGVYSETEQKQRFGTSLSATATTSSPQYTQDSASMSSVQD
                     ELDFRSVNRSSSFQTSTSSSIEEEAISNGKMNEPPPRTTRTPDISSLAFYSGPSLNSS
                     ILSSRKHAQYVRRSIVISPSLNSIHSLKNKDDQALVSEDQRSEIPTAQMNIVNSPSIQ
                     ALSDILNQKMGNGPINDNQENNVERFEPITEETYEDATSILDSQTQSKQQLIDDEVNS
                     SVATFHTAHSFDTLSASSFQTPVKSTQPASSVAAEQPDLISLNSTVKGTPKIIPDFPA
                     TPVRSSTESPLTSREIHLKLSPSHYGDLFEQYVSAPEHVRKSSFSKPAKIAETVKEGD
                     LMTPSLFSPALVFNEPIQSLQILNPDKGKSRNVFSDRKIGSSIYEIGYKDQKDVSFDF
                     EHSTDNEEALKSYEKFYKLHFSAYNGNPLPNKSESMQTTEKEDADESGDTFVEEPSIK
                     FLRKHEKRLSIRLVSDAYDDDNHIDGEGSARQPAIDSPVVADSPVNEDSGITLHDLYY
                     PPSPSLLQATPNMFKSPVFQGSNTVNSEHFNKISHSLGKMFDQSKSLPNTPKEDDVDP
                     LGTGEPEDPDGLEKLVSPLKLMEPPKNPKKLETVRSIQPVENSSKGGFSDTVHTEKKP
                     ASRRLRFRGLFKKSGSREPVKVALSPKPVPLSKPTTASTLNRLHAGGRRSEHQAKAKS
                     FAGFVQPEERKPQLEEKKNRRKSLFSGWKRKSFSFTHNTSQKKKNNGKSLSGRRRSEA
                     EGDNKKKDTYRSENESRYRGVVPETSIKEEKFDPFANTSSDFPKGLGITVKSHKGSVP
                     TTPKSLSSEFTTASSKIRAGDVLFPRVLDNAEIESIVSLERSRSLGSTTSGHRTFSFR
                     MSSGEHSFMKTLNEANDQTNFEPSTIDHIIAVKPPNVGNNIGSIGLKVQQRPLEKHID
                     HFSLNQPEYEPTKQPTVANQADSEDIEQEINEMINIIDFSDGESIDTSFKFGDTDATI
                     DEKSMDILEKKYSNENSPFSAENENENTPESRRIESEDDSRRKAENYRQLLRQQREEN
                     IEPEHQNDQILASTPRFHSMYSETEQGRPASMSFKGLNGPAFNSSLKPATRSAIIGSL
                     TSSHISYAMSKRDSTGSSYDSEQYSEPEFDFFADGVQINGKNGSLEDIHPPHRLSVMS
                     KFSLSKSGAENRTQQTSESPVLSIHSFNHHQSLQYDKPKTLVKSRVKRGTSMGNLIGN
                     TSSVKGYNEGRNSKGKSKKKSKKVRHRGVQFSSKILLYTTYAEDEYDRHPEDAACNNL
                     TPELALDIKNELNEFKAQMDVNEDSRCYTHFF"
     gene            <326123..>326863
                     /locus_tag="FOA43_003370"
                     /db_xref="GeneID:62196770"
     mRNA            <326123..>326863
                     /locus_tag="FOA43_003370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923621.1"
                     /db_xref="GeneID:62196770"
     CDS             326123..326863
                     /locus_tag="FOA43_003370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779549.1"
                     /db_xref="GeneID:62196770"
                     /translation="MTSSAGSSDPDIPYERISLEQVHEEIGLPLPADAFSEDYEKDET
                     LQDKPTQGQSLNQDDSKLQVPLCLAIDNANCMHRSHIRHMENLKTHLQSLLQMWGDNT
                     GVIRLENMVEVWMARMDKIADANVFDIESLLKKFQRQEENAKIETNEVRGQIEIYEKR
                     IRCLSAELEHKNEQIQSLRKERTLLKRWIRTTYKLVLNFGDAYCNDGKMTLRMKHIVE
                     SLKDPKNADVINIHRHLLTVLKSNNEIN"
     gene            complement(<326938..>328437)
                     /locus_tag="FOA43_003371"
                     /db_xref="GeneID:62196771"
     mRNA            complement(join(<326938..327886,328378..328384,
                     328431..>328437))
                     /locus_tag="FOA43_003371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923622.1"
                     /db_xref="GeneID:62196771"
     CDS             complement(join(326938..327886,328378..328384,
                     328431..328437))
                     /locus_tag="FOA43_003371"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779550.1"
                     /db_xref="GeneID:62196771"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="PFAM:PF00042"
                     /translation="MPNFTGEKCGSEIGKGSQETLSLIARSLSASSVISTSTSNTTFD
                     SKWLPNSEVVKPQTYRIDLKLSPKEIEMLRWSWQVVTSNDARAGDDTSSVISHGSSTF
                     NTADFSSFLFCVQFYNNLIAMDGTIEEMIPSIRHQASAFAGVLNYAISTLENLSKMRD
                     TLLNLGKLHSRILGIDSPYFKTMGEALMRTFRDWFGKDMSAFPLELEEAWIKLYCFLA
                     NSIIQGGIDPFIEYGADDSSSSIIHDKDGGSLVDASSLRSRPLPRDPSLLSFQQASSP
                     GEETKHGNLATSKKSTRKSGNSAKKSRKRGFRGKNSDDGDCIIM"
     gene            complement(<328478..>332089)
                     /locus_tag="FOA43_003372"
                     /db_xref="GeneID:62196772"
     mRNA            complement(<328478..>332089)
                     /locus_tag="FOA43_003372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923623.1"
                     /db_xref="GeneID:62196772"
     CDS             complement(328478..332089)
                     /locus_tag="FOA43_003372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779551.1"
                     /db_xref="GeneID:62196772"
                     /db_xref="InterPro:IPR021665"
                     /db_xref="PFAM:PF11635"
                     /translation="MTQQAISDTLVRRSQGGNQRRLISWSRQGHLAYSAKPKNGSANL
                     FITFLECVDGWTWQLAPPTPFRVENFVSDGPTDSGNLLFEGRRQDGNADVKFQQHQRQ
                     YEQLPDLDIVSFSNTGWDLFTADSNGNVSILVTGIKKLVHNKDFTPPLFNSQQSGGNG
                     GNTNVNSSSNVPSFPPIQYSRTSFNTAELFYSDSTNLPLPELSTTKQRRLNQLVTMKW
                     LNIEKPVIANAPAVKSKQTADSIVPSGCAAKMGAASQDAGGYYYVYNAHQYKPYGAMH
                     PLATKQACIGIRRNGKICLWHQEDHGIDYKRVCASLDLDCIDDEVLDSAIAFSREGRV
                     IVAVHTIASNSLKFYDVEIDWGYLIEAAKHLAKMPGYRVPDNERISPKLVIRKIFKYN
                     LGDLSANNQRLVSIDMISPNYHQSTELEVLLTFEKERRYSNDPVETTLVRYQLKELPY
                     LSTIHHTFKDIAKKTGVDTEQLKARKNYDMKFMQKLNFNESIVCVQAMNLDMIICITF
                     CNGMIKTLDRNTFEIADNLYQQKFSSESESPFLPSAINSLCDAGFEFPQMDFQPVYCC
                     ISPNICTYVALPFDESTLYIRSAEANIDDSFHKTKNTGLLLATAAAVALRHTSACYLG
                     FFTDDLIANIRTELEHVSRTVSEGYSYRLLVAILQEAQRAISLNIDISAEQTDKMSQN
                     QPLQRILTLQLSLGTGKNWKRNRSAKVALSLVNMRFVASSVMYAIHTIYSNIQRFSRK
                     GLNIPDTYVNSRVREDSIIYIIGVIRWCLDYVVLLSKELLELKNAFKRNNKQEIEKLI
                     STLFVVPLILGKVPRAFLLFSIANIRRLFSFVQKFVEKNYSGLTALITPENPMGAFKA
                     VEKQLLLTPSSSLADDINEAANLQNGNATADKNSNITHAITSHPTVEAYYRIGAMIEN
                     CPIPLQAFEKFLADADAPLRNLRLDPSTSLAVEQQIVCQGYVAKNFIEPLRRLCEVFN
                     KTIICSPLVDIPSVYFYDTQWLRLDGYNDEEELEEYFDERHLSGIDKLSELASDSVQV
                     KSEFAGMTPPLSKKSKSKVEDVLLERTDYDFSKRGARRLIYMNCYDGLVLDTLRKQLV
                     KSSEFVQYDKTMIDGITGAGGGTMATGVPGNGTTVGGSPQGTATVAGVDNNRSVIHSS
                     ASAESKKITLRFCIRCGAISSVHDEMLFVPGHPSLIENPVFQHYQRICFCGGSWANI"
     gene            <333712..>336540
                     /locus_tag="FOA43_003373"
                     /db_xref="GeneID:62196773"
     mRNA            <333712..>336540
                     /locus_tag="FOA43_003373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923624.1"
                     /db_xref="GeneID:62196773"
     CDS             333712..336540
                     /locus_tag="FOA43_003373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779552.1"
                     /db_xref="GeneID:62196773"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF17120"
                     /translation="MISPPNQTSMYDSANGRVRFQSSNEILALAKSNATPNLFAIGGP
                     KSLQLTRISETDIVLEYDLAMQIGHARSAKFGLISDLKFGHQNYGRNIAASTLSGSIH
                     LYNLDRGNRVRSTFTDHKRAVNSIDFSTVAPYGLVSGSQDGKMKIWDLRMRNTRAAIT
                     INGNADAVRCVQFNPHQENILCSIFDSGVIQKWDTRKPDVVERRINAHSGPGLTLDWH
                     PNLDYIVTGGRDKQLQVWNMGSDAEYRREPDHVIYTSGPIYKACWCRGRGNGSIMNTD
                     IATCFLNDDPCIQIWTLNRRFIPRNIIDCHSNQITGLLWKTPRHLISCSKDKGLIQHD
                     VVREPKVIDNLCPYATSWNPVGACNLLFIKQSKDDYDLHNEPVKVSSLFISGLGGSTA
                     GNSNGNGSSSKASPAGLSSIPTSDTLHHSLQSAVSLASYINNAAEKKIGRNHLALRNK
                     SFVTPQSKHIVNLQVSPFVMPVDVVLVRNESQVFEFLSASYLIEVPDGLDITQVCEYN
                     AALAASAGRFRDCQTWRTLRFGILWQYTDDTESADALFKSSLGEVSSPKETVAKGYTS
                     DTHSTINASQSDKFGTSLGSYTEGSVASTGNGNSKEKQNGDQVKSEQAIVESIPSSIA
                     DSNENVIVDDEEETVTFDGQQSIHPVAIRRSSKQLSNFSRNRYSFNGSSVDMDNEKSF
                     SPRSSMSLSRSPVISRLLKFSGLKTEDIEGGSDNMVEAIVSRKASSDALQRGGSGNKK
                     SQLTAILRKSSISTNGPLTVPWNPTDLIRQAANYSAKQGDLITCATFALLFKQLYPKS
                     MSDNQAQEWIWTYHDMLLRRCLFGTAAAVMKRASEFYDVFKTVGQTRTSVRLFCNSCH
                     SLVLNENSKIRATNADSGVEFGFWYCEKCSKRQGNCTYCDEPIKGICVVLLGCGHKGH
                     FGCFRSWFVEEKQTDCPICWLPAVVLST"
     gene            complement(<336590..>337516)
                     /locus_tag="FOA43_003374"
                     /db_xref="GeneID:62196774"
     mRNA            complement(<336590..>337516)
                     /locus_tag="FOA43_003374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923625.1"
                     /db_xref="GeneID:62196774"
     CDS             complement(336590..337516)
                     /locus_tag="FOA43_003374"
                     /note="BUSCO:EOG093439JD;
                     MEROPS:MER0017242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779553.1"
                     /db_xref="GeneID:62196774"
                     /db_xref="InterPro:IPR022742"
                     /db_xref="InterPro:IPR029058"
                     /translation="MPEAIASAHSSSPVFSTFLKFIKTSAIVGASAAVLALVALYAYQ
                     SKIVYPSGLNNARVKVSTPDEYGLPYRAVNLRTRDGETLQSFLLLHDKDDPGYSNKTV
                     LVLSPNAGNIGHFLPVVKYIYKSLNYNVFIYSYRGYGKSTGYPSEHGLKIDADTAMEF
                     ISHHPQLSQSSLVCYGRSIGGAVAIYMAYKFPTLVSGLILDNTFLNIRKLIPYIFPLL
                     KPVAFLCHEVWPSEEYMKQIPPQIPVLFLSAKNDEIVPPAHMKKLKELSKATQKVWKE
                     FDDAHHNDTITCSGYWEAFYDFMHDMVTPVGR"
     gene            complement(<337694..>338950)
                     /locus_tag="FOA43_003375"
                     /db_xref="GeneID:62196775"
     mRNA            complement(<337694..>338950)
                     /locus_tag="FOA43_003375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923626.1"
                     /db_xref="GeneID:62196775"
     CDS             complement(337694..338950)
                     /locus_tag="FOA43_003375"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779554.1"
                     /db_xref="GeneID:62196775"
                     /db_xref="InterPro:IPR009291"
                     /translation="MVSIAAGPASLLSEEDEAHLSNVLRSATRFKNLPQLKSRPPPSE
                     RTLKDGEIPSYVTEYSPVVHLYSEERYLPYDIAGFVKHFHGEYENGTRINHIGKKGHL
                     RIEDLEKLAPLSTKESKVYLTSNEDFDTDPEWLTGLANMPSYYNGEIKNAPATLIVVD
                     KGNGWIDAYWFYFYSFNLGPFVMGFGPFGDHVGDWEHSLVRFYNGEPVIVWMSAHGGG
                     GAYFYKNLEKWAGTKHPVIFSARGTHANYPSTGQHAHDTPYSILSDFTDRGPLWNPSL
                     NYLAYTYDGVEVTYANGSRPFREAQYGNWLLYKGTWGDKKLVPEDPRQHWSPFEWKYL
                     DGPAGPLTKNLERISPCQRHKWWNFWNGCNVRKYIKYGDGFFDKEGDNSCGSLYNMIR
                     PGILKTTIETITWGGWFCWIMDLIFG"
     gene            <340965..>341780
                     /locus_tag="FOA43_003376"
                     /db_xref="GeneID:62196776"
     mRNA            <340965..>341780
                     /locus_tag="FOA43_003376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923627.1"
                     /db_xref="GeneID:62196776"
     CDS             340965..341780
                     /locus_tag="FOA43_003376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779555.1"
                     /db_xref="GeneID:62196776"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF03807"
                     /db_xref="PFAM:PF14748"
                     /translation="MENYTVTILGCGVMGTAVLSSMLKSSFEPFPQKFICCTGSSRSA
                     EKLKTAYGDRIEVSYGSQNVEAVRKADIIILGCKPYMCEHIMDSVADGLNGKQLIISL
                     LAGWTIDQLKTFSPYIARVMTNTPAKYGCGMAIVSFSEEAMKYEDIVMKMVGTVGKAK
                     KLPESNMDAATSLVGSGPAFCLVMMEALAEGGVRMGIPYDVAKECAAKVMEGTARMVM
                     ETGEHPEVLKASVCTPGGTTIGGLMVMEDKAVRSGISRAVEEAAKIASALGKK"
     gene            <342828..>345317
                     /locus_tag="FOA43_003377"
                     /db_xref="GeneID:62196777"
     mRNA            <342828..>345317
                     /locus_tag="FOA43_003377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923628.1"
                     /db_xref="GeneID:62196777"
     CDS             342828..345317
                     /locus_tag="FOA43_003377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779556.1"
                     /db_xref="GeneID:62196777"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="PFAM:PF00628"
                     /db_xref="PFAM:PF02373"
                     /db_xref="PFAM:PF02375"
                     /translation="MFITLAAPTLHPSAEQFDNPIKYLSSPEIIAVGKKYGILKIRPP
                     QGWQPRFALDRKRFSFHTRLQDLKDLSLINRSRDFFFQGFNNYLKMRGKNPLKSSKNR
                     RRGRKQKHPLTTSDLPKDYDGFLTLIDGQRTHIFDIFNENDFKKYSYLIKDRELLKDL
                     IRYSKYLQNEKKEEPPKFENDLSLRELLENDIGSLADSKNGCVLCHLDSDPSRTLLCD
                     GCDRSFHMSCLDHPLKTIPKSKWFCKDCLDGTNGDYGFEEDYDNIFTLKEFEEDCKEV
                     KDDYCDSHFSENRNPSVDILEKEFWSLVSHPSNDKTSGVEVRYGADIHNEEKDQVSGF
                     PTTENFLVDTEKEAYYIRHPFNLTQLPFADGSLLNYIKSEDRKQISGMTVPWLYVGSM
                     FSTFCWHKEDHYTMSANYCHLGSTKKWYAIPACDCEKFESLCRKISPAYFDKQPGLLH
                     QLVTLVSPEEIEKEQSDKPESKKVHIFSVDQGPNEFVITFPKVYHAGFNCGFNVNEAV
                     NFTMPYWLEYGEQSIQEYRRVKKENVFNYYKLLRNIMDDNLASGGVQLTKSKEMFTEQ
                     VVSSMLKQSLRNYKNCVNKFGEVMKNDTLNKFLEGLPIEKYQNYVKEKLRREDERKTK
                     RYHGRGDVYRMNPSRASEDYPDEYICHDCKSFVNFQWVEVDLLKELEGIQNALEVIEI
                     KHEDNQQQLPTPNQTPEQVQKSKFGDFESEWTQIIRKAREESEEKDTRRRLRKHKSDV
                     TGHHSLLGETTSSCKRMKLVSRMKHKRIKHANYGKIIFCMDCLSKELSHLNPDYLNRL
                     KLSTTLYDDSNLMELQDYINNVLEPEINKTI"
     gene            <345662..>347649
                     /gene="ATP2"
                     /locus_tag="FOA43_003378"
                     /db_xref="GeneID:62196778"
     mRNA            join(<345662..345774,346254..>347649)
                     /gene="ATP2"
                     /locus_tag="FOA43_003378"
                     /product="atp2, beta subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /transcript_id="XM_038923629.1"
                     /db_xref="GeneID:62196778"
     CDS             join(345662..345774,346254..347649)
                     /gene="ATP2"
                     /locus_tag="FOA43_003378"
                     /codon_start=1
                     /product="atp2, beta subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /protein_id="XP_038779557.1"
                     /db_xref="GeneID:62196778"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036121"
                     /db_xref="PFAM:PF00006"
                     /db_xref="PFAM:PF02874"
                     /translation="MVARLFANTTRTALKAVKASSAFQRGLATAALAKGEVTAVIGAV
                     VDVKFQPGQLPPILNALRMDNQGNKLILEVSQHLGENTVRTIAMDGTEGLVRGQEVID
                     TGGPISVPVGRGTLGRILNVIGDPVDNRGPVDCKERKPIHADPPAFVEQSTEAQVLET
                     GIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNVAKAHGGFSVFTGVGERTREG
                     NDLYREMQETGVINLDGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVL
                     LFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAV
                     YVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDADVVGQEHY
                     DVATHVQETLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFHVAEVFTG
                     IPGKLVKLEETVQSFKAVLEGKYDNIPEAAFYMVGGIEDVIAKAEKLATEED"
     gene            <348121..>349473
                     /locus_tag="FOA43_003379"
                     /db_xref="GeneID:62196779"
     mRNA            <348121..>349473
                     /locus_tag="FOA43_003379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923630.1"
                     /db_xref="GeneID:62196779"
     CDS             348121..349473
                     /locus_tag="FOA43_003379"
                     /note="BUSCO:EOG09342EAB;
                     MEROPS:MER0002635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779558.1"
                     /db_xref="GeneID:62196779"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="InterPro:IPR032456"
                     /db_xref="PFAM:PF01435"
                     /db_xref="PFAM:PF16491"
                     /translation="MDTLIHSASDFLDRPGFNWKGLIIGFSTVNFLFESYLKLRQIQT
                     VRANGEKIPDELKGKIDTKTAIKSSNYSLSKLKFSIVGSLYGLVQNVIAYKFDLLPKL
                     WNATGGFMSTLLSKNMVPAFMSGIITHSLFFCGAMTLFSTFLSIPLSYYQNFILEEKY
                     GFNKLTPRMWVTDMVKGFSVGLVLGGPILAAFLRIIDYFGDKFMYYLSIFMGIVQIFL
                     IIVYPKFIQPLYNKLTPLEDGELKTSIEKLASENKFPLDKLYVIDGSKRSSHSNAYFM
                     GLPWGSKQIVLFDTLIDQCTVPQVVGVLGHEIGHWALSHTTKLLAINQFHMFWIFTFF
                     AAFVKNSSLYQSFGFFNEQPILIGFMLFGDILGPVDSLVGFAMSQLSRTYEYQADEYS
                     TKLGYGEDLKDSLVSLNKENLSSLVVDWLYSAYTYDHPHLVERLNHIDEVQEKIAKKE
                     "
     gene            <349701..>351536
                     /locus_tag="FOA43_003380"
                     /db_xref="GeneID:62196780"
     mRNA            <349701..>351536
                     /locus_tag="FOA43_003380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923631.1"
                     /db_xref="GeneID:62196780"
     CDS             349701..351536
                     /locus_tag="FOA43_003380"
                     /note="BUSCO:EOG09342RGS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779559.1"
                     /db_xref="GeneID:62196780"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /db_xref="PFAM:PF04768"
                     /translation="MFSVSKLLPLRKFVPRSPRSLWGYARGIRFSGTLKQHEGMTESP
                     VITKTAEKRDLILTILNSTATKREARYYLQRYPLMEENDIYKNKNEVIYDSLPNRQAS
                     NNKKYEAYIDDLLNTGTSQSDAKFESGYGGSLDDTVGDEMQLTDTIRVMLVRIRNLDG
                     LSDSIVKGIGATLSKCMKLGASPIIVLDTPAESDCSSGEPIAMVIKSMNERCSRLIAL
                     LESSCDLQMRAIPGLFQLDSQGNAKFVMQELAMVPLFQGMIPVLTTWVVDKRTSTERK
                     VTSLDIMKYAIQSFGLIDHRYKAEHNNNTTDFVSVEKIVFIDELGGIPSLERYESSHV
                     LINLLQEHDSVKRELEQCLLTDSQREIHRGNFDEMNELLSMVPHATGIITTPKIATLR
                     RLRRTTNPIILNILTDRPTISSSLPVDLKKTPLLNTTIIKRGIPIQIHISKGSDQGLD
                     LLELDSKGIIDLGKLKRLIDDSFGRTLDMTHYLNRINNHVAGLIIAGDYEGGAILSWE
                     KCPTDPSRTVVYLDKFAVLKRLQGLPGLADIVFKAMLVNFKDELIWRSRTNNPVNKWY
                     FDRSRVNYCIPGTHWRMFYSGNKAPNEKDFRDYTSICAGIKPSFK"
     gene            complement(<351553..>353205)
                     /gene="ELP3"
                     /locus_tag="FOA43_003381"
                     /db_xref="GeneID:62196781"
     mRNA            complement(<351553..>353205)
                     /gene="ELP3"
                     /locus_tag="FOA43_003381"
                     /product="Elongator subunit"
                     /transcript_id="XM_038923632.1"
                     /db_xref="GeneID:62196781"
     CDS             complement(351553..353205)
                     /gene="ELP3"
                     /locus_tag="FOA43_003381"
                     /note="BUSCO:EOG093417QT"
                     /codon_start=1
                     /product="Elongator subunit"
                     /protein_id="XP_038779560.1"
                     /db_xref="GeneID:62196781"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="InterPro:IPR032432"
                     /db_xref="InterPro:IPR034687"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF04055"
                     /db_xref="PFAM:PF16199"
                     /translation="MKGPKGKQILAPERERFLQCCGDISVELVSDLKEGREIKLNGII
                     TRNSKKYKLKQQPRLTDVISSIPDQYKKYLLPKLKAKPVRTASGVAVVAVMCKPHRCP
                     HIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLRQL
                     GHPVDKVEYIVMGGTFMSLPKDYRENFIVQLHNALTGYNGTDLDEAIRFSQQSQTKCI
                     GITIETRPDYCTPTHLDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVCETFCYA
                     KDAGYKVVSHMMPDLPNVGMERDLEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELW
                     KNGLYKSYNANMLIDLVARILALVPPWTRVYRVQRDIPMPLVTSGVENGNLRELALAR
                     MKDFGTACRDVRTREVGIRDIHSKVKPDQVELIRRDYYANGGWETFLSYEDPKQDILI
                     GMLRLRKASKKYTYRKEFRAQPTSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEE
                     AEKIAKEEHGSTKISVISGVGVRNYYKRLGYVLDGPYMSKMI"
     gene            <353598..>360335
                     /locus_tag="FOA43_003382"
                     /db_xref="GeneID:62196782"
     mRNA            <353598..>360335
                     /locus_tag="FOA43_003382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923633.1"
                     /db_xref="GeneID:62196782"
     CDS             353598..360335
                     /locus_tag="FOA43_003382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779561.1"
                     /db_xref="GeneID:62196782"
                     /db_xref="InterPro:IPR024298"
                     /db_xref="InterPro:IPR024340"
                     /db_xref="InterPro:IPR024880"
                     /db_xref="PFAM:PF12931"
                     /db_xref="PFAM:PF12932"
                     /translation="MVRKHRKPKKSNKKERKSSNTETKPKPEEQSEVISGVSSDLITG
                     PSLGTPADREVTGTSEPSEAFEITISEPEKEEAMSEVKVKSDNSEKKSIVASDSLNRK
                     VYTEEIIGGPEESLEESTAEDSELNILQQTGQVELKPTHFDARSAEVEVNPKVATTYV
                     SQFGTDGLENTKNNESIPEHATSIDNGKNIPPDSSANTESMWGDAPKKSHEELKQSED
                     IQPIVTATSVNPSDALSWNNGDSNEKMPWEEPKRDESAPNVPSPVKMPVPSAASTFET
                     SAPAGYTADVIDTEDKTMPWGTNETVEEMRWEKGHAGEVVKPVKAFQPSQSIQPLEPA
                     QSVEAGSEADHPDNTLDHDSFLQDLAEDVTSAQQNFSNNAQESYKGETLERKLSFLAE
                     DDELLLDDVMDDDLLEEESELPISSQAQPIYGSRAGAYAPSISSIASSNISRPKSPSL
                     QKYAPPSTESPMKASLKHQTSRASLIPSRTGSVVSAGGVGVAPIFTQPVRPFGIRASA
                     NASPVPAAQTASQQLASQGSRIHKKLVLKLEEEKHKSDAYDFPADLLIKHSPVLRAKS
                     PHNNIYAQMEATQKLQKQIQVEIPPFGAYGTSAADRPVIRSPQSSPVVVTSAIPSVSL
                     DPPPQSAAKNAYALPGSQEPQAPRAPPAVGGGVGTASANIKQLPYQSGSFFAELPVSP
                     NLTRPAPQVRNPYGRIEKAASLAGSDLAVSQRSHMIPSPYTSNVQPVQLSQSQQHQQQ
                     AHNIRASTTSISQASRRSNNPYAPADVGGHARTLSTSSNPKPINPRVVPVPRKASIGE
                     VMSPVRAGNSSQPQFIGSPTNRYGPSFQRLGASQTSQSQVLSRSPGFSQPQGFPQQGF
                     QQQGFPQQGFPQQSFSQQGYPQHNMRNLPKLMVQGKQPAVSVDTVYGGPHPDSSVQSS
                     AHRKSRSRSNLPPPPLSPSLSRHMLQKVPGIASAPAPVVVNPENLVRRQWPLFSFSGA
                     VDVATMIPNSDGYGHPILNIKVTDFISVCKDDGITSNFPGPLIKNRTKRKDLEKWLTD
                     KLASFGSKSNDGPYLSADQMIWALLRAMVTEIEEPGDFSKRSYLDKAINVLNSSFSHE
                     SDDQNRIDPISLVRVIQNSTSDSKQFNCRQLDRQKLSRVFSLLENGQTRQALEFVVGE
                     GDWSLAIVFAGLLGPETISEVVRLYSSVRFGTDDLLDQTMAFFVDASISQNAASNSAP
                     VLKGKESWIIDNYTSIVPLVLSNTAHPGSILYQLGSILMDYGARDYATLSFLLSGLPM
                     LPTNISSLPKDIDSMIISEIYEYVLLSSHNVAPNLSAGLPHMLSVKINHAGFLADFGH
                     FMEAKRYGDVTGSIIAGKQVPYEPVTVLAQKQLAERLEQASVDASGWFGGKLGKSHIN
                     KVWDHLDKSFNKFVSGEELPVSSAKPKSELFSNFSTPAPSRSPSVIDIVGMQQQVRHS
                     PQHQSSLPYTGNVYGNPILGDNSGSPYSPFQSGKSVAKASYPNKAALAPKGAPYIPRA
                     SYNAQSSGIGINAMGMAPALPRSISSESNSYSPYKVKALSVSKLGSLSAIPHPKPVLA
                     GVGSSLVPNSRAFQPEMQSKMKPSLSVSTPLPKPLSPKLLASSSAPPIPRKHPEHLKI
                     ENTYLPTHQESSMAPSVDLYAESNLPKVAASSVAVPSNSVSVLSESTIHAAAPAAPQI
                     SDPVSLFLETDKSLAPVSKVAGRALEKSPECEAQKELSITAEVQSHPISKKSGVEVNN
                     DSAPIEENNEISSEFTLSTSSERDEFEQQDADTGPETEPKEEDFVPESAEELKMSPKS
                     MRLSESQSSHPEKSEQPKPVDQNTSVNEVRKDSDNDMFLTSPPIKESTPAPVMLPASS
                     VPVAAASPVTSSTTILAKEKFNPYEPHLSHRPSRRLINPYAAMYSRSNTDVSTEGATK
                     YAPEPASRESSPNVEMPQNLNEMGIPKDMNNFDMYSFGGYHVPPADQKPAGFEGTEEN
                     KNEVGDRSLNHESGEGKGSFDESDLPPPTDNILNPAEHLRRLFSPPPQSPSISMSGDE
                     TVSSDIKKSAIYTITEEKRLYANEADECYDDDVVDEEEDDDDSDDVKKKRQEEERKKK
                     RDAERKKRQEEDRKKDDEDKRKRHQQHKGGWFSWLSKKDDGPKPIKAKLGEENQFYYD
                     EKLKRWINKNAPVEEQIVDTLPPPPMRKPGGTPPVGGAFDVPPKIPMNASSSSLSPSA
                     LSAPPNGIGPNKGKKGDGIDELLNLSAVRSGGSRRGKSSRRGPRRGYVDVMALKK"
     gene            <360898..>362988
                     /locus_tag="FOA43_003383"
                     /db_xref="GeneID:62196783"
     mRNA            <360898..>362988
                     /locus_tag="FOA43_003383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923634.1"
                     /db_xref="GeneID:62196783"
     CDS             360898..362988
                     /locus_tag="FOA43_003383"
                     /note="BUSCO:EOG093418LO;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779562.1"
                     /db_xref="GeneID:62196783"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="PFAM:PF01663"
                     /translation="MVSEGFAVDVPVTNLDVDDDDDEFRIDDDIASTSVDLENLGIFS
                     SDQRSVLSKIGQGFRKMFSRGQNGAGFKYMDNIELFDHGRSRSSSSFADLGDLTTDSR
                     IKKRRLLWKHLFGFMIAAFLATLIGLATLASKSKFSQPSDSKVLKKPLLSNGTTQFYP
                     TTLVISLDGFHPHYISGEVTPFLHQLLTEETSYSAPYMTPTNPSVTFTNHYTLVTGLK
                     PIYHGIISNNFYDSAQNEEFIDTDDSIALNPKWWGGEPVWSTAARHGVSSAVHMWPGS
                     EVKRYDDLNPMYVDKFNKTELLSRKLERICTWLDLPIGKRPELLMSYVPNVDTAGHKY
                     GISGEALKQELKYVDEYLKGIYVNLSERNLLDVVNVIILSDHGMAPTSNGRIIYLDDI
                     VGKENLAKVEYTDGWPMYGIRLYNDSDVERVFKDMKRNYLIDIHKNHYSIHLREEITD
                     EMFGGSDGKYASRIAPIWILPKVGYSIITRAEMNQKGGKYTPLGVHGYSRTEVLMRAL
                     FMGTGPFFQTRLGKKNIKLKPFSNTEVYNIICDSLNIEPASNNGTYTSPSYIQLDNIL
                     EEGWKDPHQYPDVPFPVEILDVKSTYDLLYSGDVDTDGKWKGTEETEESEDENDSEES
                     ETDMEDVNPPETEPVKDGSDESQGSDDDRHGSDDDHHGSESTVWSKLGDIVDDLVDGI
                     GNMIGDVEEAIEPR"
     gene            <364177..>364716
                     /locus_tag="FOA43_003384"
                     /db_xref="GeneID:62196784"
     mRNA            join(<364177..364183,364238..>364716)
                     /locus_tag="FOA43_003384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923635.1"
                     /db_xref="GeneID:62196784"
     CDS             join(364177..364183,364238..364716)
                     /locus_tag="FOA43_003384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779563.1"
                     /db_xref="GeneID:62196784"
                     /translation="MSAGRSQMVLRSEPDSPSLGPTSASGSPSCFYLTDHSPPSSLQS
                     NASYLNLYASQLQGNTPRMMRANSTLFREPHISRTNSLSNSIGGKSPEFSPVSSTMPS
                     MTPLNLSISTSGTISPELEDKNGNFRDDLGTDEPKFSGGSDGNDDDDDVFGENISNPR
                     P"
     gene            complement(<364835..>366064)
                     /locus_tag="FOA43_003385"
                     /db_xref="GeneID:62196785"
     mRNA            complement(<364835..>366064)
                     /locus_tag="FOA43_003385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923636.1"
                     /db_xref="GeneID:62196785"
     CDS             complement(364835..366064)
                     /locus_tag="FOA43_003385"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779564.1"
                     /db_xref="GeneID:62196785"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF01764"
                     /translation="MLLSICLATFISFSHCAPVYNSSGSVQSLAWNMPYINYKPSGVL
                     LESDAVYDYLDSLAVFIQLANCNTDEFQQVYKNCYFFPANLSSSECGSVELVRFLRPR
                     ARDSILDIEKIPFLRTSSQAGIFLDHNAKRIVIAIRSDVNMIDHLPFMADDKAVYSPL
                     IYNSKFWKSVFVNSTIISALGKQTAEQFYDSKKNKAKLRTKTSWGKPIFKVHAGFQDL
                     SNRYFEDLFAEVVLLTKQYKNYHLVLTGHSVGGAVASMLSLTLLDIGFNNTLVTFNSP
                     KPWSQKLADHYDSISFTKRLHSRVILREQDALVDTERGHLRVWNSHDGFTGFPANTVI
                     DGIGMFNGYKHSGLSIVTPQRKLVVNHEHPTFYLESEWRVSSILRNSRVDIGITASFE
                     PHNFILRDLLACTKLHK"
     gene            <366988..>369048
                     /locus_tag="FOA43_003386"
                     /db_xref="GeneID:62196786"
     mRNA            <366988..>369048
                     /locus_tag="FOA43_003386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923637.1"
                     /db_xref="GeneID:62196786"
     CDS             366988..369048
                     /locus_tag="FOA43_003386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779565.1"
                     /db_xref="GeneID:62196786"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="InterPro:IPR033896"
                     /db_xref="InterPro:IPR036879"
                     /db_xref="PFAM:PF00319"
                     /translation="MGRRKIEIQPINDERNRTVTFVKRKAGLLKKAHELSILCKVDVA
                     VIIVGNNRKIYQYSSDDTKNILDKYYHASTIYESKSPSDYGNYDRKSRVASEADINLR
                     SNHRRTASSKINPLHNATHPLSKPPAVTTPFANHGYARTRSSMVANSTITSAMSLDDR
                     SSDGDTSSVRKKRKLDTLSPASNSVYPPQNSSSPSFASTTPSPSHYQSSRVGPMPSFG
                     RSNSSSSPSYNNHIPSQLVRSKPPANSKVSKRPTLSLQIPNSDRPIEVTGNMGRPSNA
                     EQLANMTDASNIANVGASRGAGNNFLSNIGLTGNSGLGTATFRNQSFSLTPLGSSTRD
                     HKFKFPATTPITNTFLPGLGVPLSAGGQQGQPGQPHPIELTASNPGNAADRSNLSTPV
                     SATMPMFNFPQLSPTQLLPTPVFPQQPPLGQQQSQPQSQQQQSLSQLQEQTSSSTSAM
                     RISPQHTPSQQQPLYQTLNSASSLYFAGFGSRMGQKSAQGNPNVVNRGNTNGPNGPNG
                     SNGSNVPNGLSGPGGPSGPLGPSGSTKSKKHSTNNGATSTYSQYGQFSQPGDTPILPS
                     GLPSKYVDLFPSPNVYYSQEWSLPMGSGNTPLPTTGPHLLPLIGSQKSTGNTNSTNTA
                     AAQNANVIGKGSSTNTLTNSAVSAHTSKIGKTTTDSRKPRMKVEPGDGMVSKLSKAAT
                     ESGS"
     gene            <369447..>370336
                     /gene="RPS6"
                     /locus_tag="FOA43_003387"
                     /db_xref="GeneID:62196787"
     mRNA            join(<369447..369452,369632..>370336)
                     /gene="RPS6"
                     /locus_tag="FOA43_003387"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_038923638.1"
                     /db_xref="GeneID:62196787"
     CDS             join(369447..369452,369632..370336)
                     /gene="RPS6"
                     /locus_tag="FOA43_003387"
                     /note="BUSCO:EOG09343QKQ"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_038779566.1"
                     /db_xref="GeneID:62196787"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /db_xref="PFAM:PF01092"
                     /translation="MKLNIAYPVNGTQKSIEIDDDLKLRNFYDKRIGQEVEGDNLGDE
                     FKGYVFKVTGGNDKQGFPMKQGVVAPSRVRLLFAKGYTGYRPRRVGVRKRKSIRGCIV
                     GSDLAALNLTVTKQGEKDIEGLTDAQAPKRLGPKRANHIRKFFGLTKEDDVRQFVIRR
                     EVVKGDKKYTKAPKIQRLVTPQRLQRKRAVKAHKIKNAQAQRDAAAEYAQLLAKRLHE
                     RKAEKAEIRKRRASSLKA"
     gene            complement(<370529..>372670)
                     /locus_tag="FOA43_003388"
                     /db_xref="GeneID:62196788"
     mRNA            complement(<370529..>372670)
                     /locus_tag="FOA43_003388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923639.1"
                     /db_xref="GeneID:62196788"
     CDS             complement(370529..372670)
                     /locus_tag="FOA43_003388"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779567.1"
                     /db_xref="GeneID:62196788"
                     /translation="MSNTRSTSKSKKKTTSVTSSTATSGPKKFKGYRSFGNIKCYLSF
                     ALLLYSILHIVFNCPLSQPYVKEGNRDLICQTSHHAYGYVSCYVDPVIDKVSTRYDNS
                     RIKPFVDSTSESTLHLYQLYCKPIVDKYGPVVKSKADATTLFVKEKGVVITHRTFQIT
                     KHIGTECYEKSKQASLTVCKYIRTVAFPATVSAIKWTEDKFRYIIQKMAVWFYVNFNV
                     YVHPKLEYLYSKFESSTAGQYWLQFQQSRFCKTVAYFINTVLSAISEAYISAREVICE
                     FKKKELMYKLSIHYKKVEQKKDFLKSELGKFFSPGFKIPQYKDLQIFKNMSRRMKGIA
                     ETSDVADTDHSTTSVVSTTAVPEDEKVSILSSSMFIVDTMQIAQEVISEQIATSVSSS
                     LFSSSVEQAASAAASASKVPDDIITSKKYEKLVDTVINGAVDDFAEQVAALSVVTAEK
                     LKEAIKPSLALLSNKVTGGYSDIHTMLAGINGKKKEEEGYVSRQDYRDVLAKCASNMN
                     SLADNVFFTLKEEESAYTDEVLRIRSNILETLAEFSDSTLAAYSTEIVNDGDDWEEWK
                     RYNAIKKELLKARDEILEAKPPGEVKMFNDAARTVNILLKEGQSYLAIMRAKGNLEFQ
                     SREKGEREAAAVAQEQEQEQEGEEDGEEEGEEEEEIRIASTIIVYETMKDTGNSRIKN
                     DNSKIEGTEASKATQETVRGGNDDEKITLNI"
     gene            complement(<372904..>373575)
                     /locus_tag="FOA43_003389"
                     /db_xref="GeneID:62196789"
     mRNA            complement(<372904..>373575)
                     /locus_tag="FOA43_003389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923640.1"
                     /db_xref="GeneID:62196789"
     CDS             complement(372904..373575)
                     /locus_tag="FOA43_003389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779568.1"
                     /db_xref="GeneID:62196789"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MEQKLSEYDPDKDPQVTGDPYRTVFVGRLDYSINEINLTQQFSA
                     YGEIDHVRVVRERGNGKSRGYGFVVYQDEEGAKMAFDHANGIEIKGRKMVVDIERGRV
                     VKNWKPKRLGGGLGGRNYDKKKTKGNTKFEASGRRDATRGNSSMLAPPTSSYHHQRLE
                     YKSRGNEHGYESNYDSRRPHEEPKRDYIGTRAGNVQAGHRDQADHRDRTGYGDREDYR
                     RYPRY"
     gene            <374072..>376603
                     /locus_tag="FOA43_003390"
                     /db_xref="GeneID:62196790"
     mRNA            <374072..>376603
                     /locus_tag="FOA43_003390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923641.1"
                     /db_xref="GeneID:62196790"
     CDS             374072..376603
                     /locus_tag="FOA43_003390"
                     /note="BUSCO:EOG09340RPL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779569.1"
                     /db_xref="GeneID:62196790"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF01728"
                     /db_xref="PFAM:PF07780"
                     /db_xref="PFAM:PF11861"
                     /translation="MGRVQKKNAKGRLDRYYFLAKEKGYRARSSFKILQINEKYGHFL
                     EKSKVVVDLCAAPGSWCQVASKLCPVNSMIVGVDIVSMKPLPKCITFQSDITTEDCRS
                     KLRGYLKTWKADTVMHDGAPNVGLNWIQDAYTQSQLVLQALRLAVEHLVPGGTFVTKV
                     FRSKDYNNLIWVFKQLFDKVEATKPPASRNVSAEIFVVCKGFKAPQKLDPRFLDPKEV
                     FEELPEGPVNNESKVYNPEIKKRRRQGYEEDDWTQFHPMNILEWVHQEEEVINTLGTV
                     SKLEIDEKSAEWTILKKMKQTTIEFYECCKDLKVLGKKDFRMLIRWRKHAREELGLLD
                     KKDMEKPAVEMEELTEDQKIDKELAELKEKEKLNTRRTKRRKNEQKQKEMQRLQMNML
                     TDMQIGMEAAENGVESLFSLKLAENTGQLKDLAKGKKSFIFNNNDKGADKDENNTKVL
                     EFDSKEEEIDTLEDQLSTMYDQYKDDKMERDARLRASTARGDEEDEPWEGMKEAKTES
                     SEGEFESDEDDETDSDDDEAINKLIESIREHKKKGQLGSKASNFFSDSIFQDIDLNVA
                     PADGKKQNQHDELHLPKKIIDKKDRKKGSEATKKDETFEDDDSEESEDNEDNKGGFQT
                     VPNSYHEKFNEDEMDYETDSDDEKSREHHKAEIDISSVEAMTLAHDLAIGKKSKSDIV
                     SEGYNKYSFRDKDGLPDWFLEDEGKHNKINRPITKEAVTAMKEKMKLLNARPIKKVLE
                     AKGRKRMRAARRLRQIKRKSESILEDGTKTESDKASEIQRVMKKMTKKQDKPNVTMVV
                     ARGQNRGLQGRPHGIRGKYKMVDGVMKHEMRAQKRIEKKNRKHKH"
     gene            <376797..>378344
                     /locus_tag="FOA43_003391"
                     /db_xref="GeneID:62196791"
     mRNA            <376797..>378344
                     /locus_tag="FOA43_003391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923642.1"
                     /db_xref="GeneID:62196791"
     CDS             376797..378344
                     /locus_tag="FOA43_003391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779570.1"
                     /db_xref="GeneID:62196791"
                     /db_xref="InterPro:IPR013233"
                     /db_xref="PFAM:PF08320"
                     /translation="MTPIKQRSIIFLQDPSYIELFVKSIEQDDRDITIPASTKFKVSR
                     QEKITIPYSEIDDRMADLFEKVQLMDVRFSENLRGCKDSPGETGQTIFNDFENMNELG
                     LSIEVAPQTADSFEQYKYLSELTIDQVMRMLRIQDDNSLIFFQEWFKKNVFRIEDQGC
                     SNIAQMIALRLWNALLKRNVELPVRLPDLETLSGVELVLGGKDKQEASLFLYWQTVNR
                     PTIISKKYVRQETAELESELAIFYSTSKESWDYNPPLSGLRMKIDKEKYTDDNKMLKF
                     VPTMVYASPTHNTLYGYQSKHELLHPIGMHPTYKISILNGDAKFPFEPLQSHGEGSCS
                     LMFQLDVPKQIILDKYQLEHLKGKSFIDFHVHNGGMNLELPDYRIEEWGGSLTAELDE
                     SYITSHNESFEIPLHLRYGKPLGSYEEFSMPKGELYWQCQMKDANQIVEAEESFYNEK
                     NRLGIDKFGQNMMFYHVQDMESSCSNSLQLKIPTADLKDAYSNELWTLIFVIAGTLYI
                     IVATVRK"
     gene            <380020..>381872
                     /locus_tag="FOA43_003392"
                     /db_xref="GeneID:62196792"
     mRNA            join(<380020..380023,380347..>381872)
                     /locus_tag="FOA43_003392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923643.1"
                     /db_xref="GeneID:62196792"
     CDS             join(380020..380023,380347..381872)
                     /locus_tag="FOA43_003392"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779571.1"
                     /db_xref="GeneID:62196792"
                     /translation="MDVRVHVREESGESVTASQQSSSTVNTNTNSLSSSGTASSSSAF
                     STSVPNRSSGSPVSSMDTTISPGSVETDRPKNPVIAQMPLLPSKSGLKVTNEKVTSGP
                     VANGKVPAKREKKRSTNVFKKLFRRIFGSSSSSHASTPSTTNQKQKEKSFSKKSSSVL
                     DFSKSRLVKDSSSKEKNSVQPCGRAQIRHESEEEEEEEDSSSIGPLTVDLSSENSSFN
                     GLLSIDLLPKDDEDHQSLVHSLKLQSTTDIEKNADNHPSISSSNIDVEVYEPLGDLGT
                     DVELDYLSTIIGLGETSFFKSDNLNVGGDESVKSADGTMISRRKSMRIKSMNKKRSLS
                     YHSVQGAKVQKEVRDLSEVPRSFDSYYKHYKSRHFCNDGSDFEILTEGKPKEPLVGAK
                     PLRSCLNPSSAHYKQSQYDPRFNNGYISGRRLRPGRSMDPINRKKTRSVKFSHKISLN
                     ETHAPGDYERYNIRMKQMYSFLATHPQKVRSIRHRLNDYKKYEMHVHELSKRYTHFFH
                     N"
     gene            <382540..>384099
                     /locus_tag="FOA43_003393"
                     /db_xref="GeneID:62196793"
     mRNA            <382540..>384099
                     /locus_tag="FOA43_003393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923644.1"
                     /db_xref="GeneID:62196793"
     CDS             382540..384099
                     /locus_tag="FOA43_003393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779572.1"
                     /db_xref="GeneID:62196793"
                     /db_xref="InterPro:IPR018856"
                     /db_xref="PFAM:PF10451"
                     /translation="MPGNGRASEERAIKRAEEKLKVNCHRDFAPGNNRIKFRQDGVNY
                     YVPNIFHTANTLRYKESGGYMPIFIKDILKIKDTREIYHTDGYEAAAKGITLYGNHPL
                     KNICIMGRIVSEKFRESEFMDKTGDMKQKITYFMEMTDSSTDETIQVKVDRMQYLLNH
                     LRLDHNYDILLKVRGNAAFYYNFSNPGPSNLRSIELHADTVQVVGDKCDIRVELEWWD
                     IVMTVRKGYLLKPWIFDEEDLVRVAREEAEVETQNETQEEQSQEEHSAVKKTKGSSAD
                     ACKSTRTTLSEAITAAETESKPCLNEGSNKSRLLGIELEFLSFLIRNAGDRDACIPIR
                     HIYQDKQLIYGFEQILSLTDSSDLQIIYDWLLAKFCNTRIIRMAESNEKIEIINFQRI
                     FRYVKNLIGFLTNNQEKGIKRLLARAGTSQKSDDVYKMIEYGLSQEIRLTIDLKSLEI
                     EICHRFNLKHIKVEYLNKLVDSLIRGNYIVKGGIGMRQFTCKTGFRIILRWVYDANGL
                     VWSYISRLKSS"
     gene            <384238..>386715
                     /locus_tag="FOA43_003394"
                     /db_xref="GeneID:62196794"
     mRNA            join(<384238..384241,384281..>386715)
                     /locus_tag="FOA43_003394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923645.1"
                     /db_xref="GeneID:62196794"
     CDS             join(384238..384241,384281..386715)
                     /locus_tag="FOA43_003394"
                     /note="BUSCO:EOG093419HT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779573.1"
                     /db_xref="GeneID:62196794"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="PFAM:PF04136"
                     /translation="MRRLRRRGSTVQGIAMSIPLLDAPLQLERGVEDAKSGASIKHRR
                     TKSDGCLEVKSADKVSLPSHLLYPFTELEKVTLWNKEINKFESDLTIDLDDQLLLEDL
                     SMATAIEFQEYLKFTLHENLRFETEAEAIIEKLDELLTINDQVTQRTEEFQSKSNILV
                     TKVDKLTSLQHNLSDKLSFFEALDPIIQTLNTTSSGSIVLKASFQEDILAKLDKCIQF
                     LDDPTSKDFKELSIYKFRFKQCMVRALTLMRNYIISNLREEEQRAQTKINVQKNDDNE
                     TSSRVLIDATLYSQFAKDLSKTSILFKRLYQRSSSKLEESEEYFGLLNDCYNQYFKSR
                     GALLHSVIGSTSKDDKDAKSSTSQKIQASLSKFSKLLNRESAVFKRIFFIPESEIIEN
                     RDNEVNIGAMNTFFESLVDPLYESLRDQIIRETSIDELCETLGIIEGYFDYDYEDGNT
                     ASGISTLDSQTSGMDFIKGGIDYQRLFRPLLEDTESRLVFRVRRYIDTNVLNYQRTGK
                     ELSIESRRTRPSDGDTVEPDLDMTLSNTSNVTPLSPRTSFIYPPVLKTVKLLSRIYQL
                     VGQNIFDDMANSIVHLAITSLKSNFDDDVSLESKLYEIKNLMFLKDYMSSFDVEGSSR
                     ETTFDFSGLTDLYHTIMGRRKASKHRKDILSLPNTRNPLFAAVPRVVTDFFNCKAEIV
                     TTLRETVHSFIDISKDVFIEPLNSYPGTLDLAHAMDKFMDTLHNELPRLGPQIRDYID
                     DQQTLYFLVDGLQNEVMEEYQKFYNKAIEFEKSQMVEKLLDEESVLSVWGAIVEDMLG
                     DLDNQDDQNTSAID"
     gene            complement(<386797..>387012)
                     /gene="TFB5"
                     /locus_tag="FOA43_003395"
                     /db_xref="GeneID:62196795"
     mRNA            complement(<386797..>387012)
                     /gene="TFB5"
                     /locus_tag="FOA43_003395"
                     /product="TFIIH complex subunit tfb5"
                     /transcript_id="XM_038923646.1"
                     /db_xref="GeneID:62196795"
     CDS             complement(386797..387012)
                     /gene="TFB5"
                     /locus_tag="FOA43_003395"
                     /codon_start=1
                     /product="TFIIH complex subunit tfb5"
                     /protein_id="XP_038779574.1"
                     /db_xref="GeneID:62196795"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="InterPro:IPR035935"
                     /db_xref="PFAM:PF06331"
                     /translation="MARAIKGSLVECDPSIKALIVKIDSDYRDIVIEELDDTHLLVDP
                     SKIPFIKRELSKLLSENMYNLNEDNQA"
     gene            <387193..>390126
                     /locus_tag="FOA43_003396"
                     /db_xref="GeneID:62196796"
     mRNA            <387193..>390126
                     /locus_tag="FOA43_003396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923647.1"
                     /db_xref="GeneID:62196796"
     CDS             387193..390126
                     /locus_tag="FOA43_003396"
                     /note="BUSCO:EOG093408YT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779575.1"
                     /db_xref="GeneID:62196796"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF00637"
                     /translation="MGQSEEQVGLEVTAKSETSNADAHFADVADAADDLEDLSVKYDS
                     TPEKNEENEKNEPEDEEGKVSDITSVESGEDSPPRLKYTRLTKLPPRFFDKDPVSACI
                     FNEKVFIFASHSGLIHLCRPDFKPIRTFKGHMTSILSVDTDGTYFASGSMDGTVLIGS
                     IEDETDITRFDFKRPIYSVALHRSYKSTKAFLSGGTGGKLVYSMRSWLGQRQDTVLGE
                     GNGPITMIKAVDDIVFWSNDAGLHVTQLNTQKSLIDVTLPPDFPRAEMYWPRFHLIDS
                     TRVLIGWVNHIWLFIIQNPHSMHNATSKILSSAASSFISGGMEEKQVEIERHAILDDD
                     MLISGISEFNDNLLILNYIAPEPTKDPKTGRKVLSSHPPELIIINRVTLEEESVDVVA
                     LNSYSGLGFNDYHLHQYISPSKEARWYLISANDGVVVQEFGLQDKLAWYKAKGWYLEA
                     WSMSAQWLDKTDRLNIAMKQVNKFVSHDQWREAAEFMGNALKTEVELDTKEYCGHVSE
                     EWNNWLQNFVDAGHLEVISDQLPSEAMNVTDSGISSKYYNLSLNHFLDSGDYATVSEL
                     ILKWDHKLFDLDDITYRIGEKLKEYDDAGPIDDDDNSSDALRQLRRLYVDLCVEQDRP
                     EICIDHLIRLEDPDLLQFLDEHHLIGQNLEKLPTIMRISGEKRDMTCKDIEKLRKELA
                     VNISILVENSHELLPADIIKVMDDAGMDYISYLYLERLSKVESLLVECLEDEMVELYA
                     SYNKAMLSGFLNKHKNYSIEKAIAVCERMHCIPELAFLLSKVGENKKALTLIIDELDN
                     PQMAIQFTESVNDKDLWDYLLDYSMDRPDFVRALMENAGDTIDPLPVVNRIPEGVEIK
                     GLKEALVNITRNMELDDSIYKLILQIIWKEVVDASHEYRGLRLEGYSHEPLNNRIRAS
                     METLIKIPLNSNAKASLVTERELLGENYVWKGESKAPTEKIKHVSYIKGWLMRRKNEG
                     KSFGV"
     gene            <390215..>390880
                     /locus_tag="FOA43_003397"
                     /db_xref="GeneID:62196797"
     mRNA            <390215..>390880
                     /locus_tag="FOA43_003397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923648.1"
                     /db_xref="GeneID:62196797"
     CDS             390215..390880
                     /locus_tag="FOA43_003397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779576.1"
                     /db_xref="GeneID:62196797"
                     /translation="MEGKLEYHIGSFQVSDILSAGFFENHSEFEDDALADTPIEANTT
                     IMNIHEANCVSKSSSKGWKREKLRLLCDNFWNGLFGWDTRDCPLLDQGGSNVQSCRLQ
                     QLQILPDKLGTIALPGGHQNCNMSSSSQLYDDCGNVYSSQTETTNKQLTNRHMDVEAR
                     IIVVANDPLVKKVSESTEEVRDWIKQDLIKVIEEGEVRVLKREDGRRYIVVDVSNSIP
                     LGI"
     gene            complement(<390914..>391831)
                     /locus_tag="FOA43_003398"
                     /db_xref="GeneID:62196798"
     mRNA            complement(join(<390914..391612,391811..>391831))
                     /locus_tag="FOA43_003398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923649.1"
                     /db_xref="GeneID:62196798"
     CDS             complement(join(390914..391612,391811..391831))
                     /locus_tag="FOA43_003398"
                     /note="BUSCO:EOG093444O2;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779577.1"
                     /db_xref="GeneID:62196798"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="PFAM:PF05832"
                     /translation="MSPFTGVSDTYLQPDVIKANTPVPTTDTPILADTSIQGSMPTAT
                     NSQSQNESMTTTLYRKLAESAHPVALLFYLILRVFPVVIYLCGLWFTSNYILFFIVVI
                     LLLAADFWNLKNISGRLLVGLRWWNETNDVGQSVLVFETADPNRHINPIDSKVFWMLL
                     YLCPVIWMTLGFMALVKLEFVSLILVGIAIALSATNTMAYTKCDKFGKANSIANDVFG
                     SVTGSLFERLNPLKLFTRAGN"
     gene            <394222..>396569
                     /locus_tag="FOA43_003399"
                     /db_xref="GeneID:62196799"
     mRNA            join(<394222..394241,394328..>396569)
                     /locus_tag="FOA43_003399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923650.1"
                     /db_xref="GeneID:62196799"
     CDS             join(394222..394241,394328..396569)
                     /locus_tag="FOA43_003399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779578.1"
                     /db_xref="GeneID:62196799"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="InterPro:IPR035543"
                     /db_xref="PFAM:PF00132"
                     /db_xref="PFAM:PF00483"
                     /db_xref="PFAM:PF02020"
                     /translation="MSQVIHPKLVASHRMKKINPETELDYQALVLTDSFQTRFMPLTH
                     AEPRCLLPLANVPLIEYTLEFLAQTDVVSEVFLLCSAHAEQIQEYIDHSKWVFPSSPF
                     TKIHTILSMESRSVGDSIRDIDGRGVISGDFILVSGDVITNMDLNKALSAHRQHKQED
                     RDYVSTMVLKQASPLHRSRSLIEPACFILEEHTNRCIYYQDIPPVNGKKTSVNIDPEL
                     LGDIGEFVVKNDLIDCRVDICTPQVLTTFQENFDYQFLRADWVKGVLSSDLLRKHIYA
                     YITREDYAARVESWQTYDGISQDVLERWCYPIVPERNLLEDQTYTCESTHIYKEESIR
                     LSQSCKIDSCVEIGSGTFVGDGSRIGASVIGRNCHIGNNVIVDNSYIWSGSRIEDNAV
                     VRHSIVASDAVIRKNVVVNAGSVIGFGVVIGENVVIPSYTKIVKTPFKERKRTHEVPS
                     DLNSEFDDETEGSSSQITTTTEEGLDVSGEIEASDEDDEQEPGAPASKNHSIVGQDGV
                     GFLYVDDERYNGMVSQMMSLDLSDVSIASSTIVHHGSSRRKKRTLSSATSQFLSEEEE
                     EDFEKEAIATVDRSMENNHDIDTALLELNTLRMSMNVTYHEVRQATCKAMLARVDSFI
                     ETETLGVKDAVEKIFWKWTALFQRQVFDDVDQVDLMLIIQKICHNMDQEYGPMVLLYT
                     LLILYEEEVIQEDNINKWWTSDESKAMGLVRDKTAKWIEWLKQAESESEKEEEGEEEE
                     EEEDEEEEEEEEE"
     gene            <397045..>397635
                     /gene="CDC42"
                     /locus_tag="FOA43_003400"
                     /db_xref="GeneID:62196800"
     mRNA            <397045..>397635
                     /gene="CDC42"
                     /locus_tag="FOA43_003400"
                     /product="Rho GTPase"
                     /transcript_id="XM_038923651.1"
                     /db_xref="GeneID:62196800"
     CDS             397045..397635
                     /gene="CDC42"
                     /locus_tag="FOA43_003400"
                     /codon_start=1
                     /product="Rho GTPase"
                     /protein_id="XP_038779579.1"
                     /db_xref="GeneID:62196800"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR037874"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MGSYNNNTIKCVVVGDGAVGKTCLLISYTSNQFPEDYVPTVFDN
                     YAVTVMIGDEPYTFGLFDTAGQEDYDRLRPLSYPQTDIFLICFSVVVPSSFDNVKEKW
                     YPEISHHAPHVPCIIVGTQIDLRDDPTALANLSRQHQKPITYQQGEKLAKELKAVKYD
                     ECSALTQVGLKSLFDDAIVAALEPPVIKKNKKCTIL"
     gene            <397981..>399645
                     /gene="TCP1"
                     /locus_tag="FOA43_003401"
                     /db_xref="GeneID:62196801"
     mRNA            <397981..>399645
                     /gene="TCP1"
                     /locus_tag="FOA43_003401"
                     /product="Alpha subunit of chaperonin-containing
                     T-complex"
                     /transcript_id="XM_038923652.1"
                     /db_xref="GeneID:62196801"
     CDS             397981..399645
                     /gene="TCP1"
                     /locus_tag="FOA43_003401"
                     /codon_start=1
                     /product="Alpha subunit of chaperonin-containing
                     T-complex"
                     /protein_id="XP_038779580.1"
                     /db_xref="GeneID:62196801"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012715"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PFAM:PF00118"
                     /translation="MFSASRSDTLFLGGEKLSGDDVRTQNVLATQAVANVVKSSLGPV
                     GLDKMLVDDIGDVTVTNDGATILSLLDVQHPAGKILVELAQQQDREVGDGTTSVVIIA
                     SELLKRANELVKNRIHPTTIITGYRLALREATKFINDVMSRPVDSLGKETLINIAKTS
                     MSSKIIGPDSDFFGKMVVEAMLAVKTTDSKGEIKYPVSAVNILKAHGKSATESVLVNG
                     YAMNCTVASQAMVKEVKDARIAVLDFGLLKAKMALGVQINLENPDQVEQVKQREQEMI
                     LDKVRKIISAGANVVLTTKGIDDLCLKEFVEHKVMAVRRCKKEDLRRIARATGANFIS
                     SMTNLEGEEGFEASDLGLADEVIQERFSDDECILIKNPKNHSASSIVLRGANEYSLDE
                     MERSIHDSLSVVKRTLESGNVVPGGGAVETALNIYLENFATTVGSREQLAIAEFAAAL
                     LTIPKTLAVNAAKDASDLIAKLRSYHAASQQVSDADIKRKNYKNYGLDLIKGKVVDEI
                     HSGVLEPTVSKIKSMKSALEACIAILRIDTLITVDPEPPKKDPHAE"
     gene            <400271..>402565
                     /locus_tag="FOA43_003402"
                     /db_xref="GeneID:62196802"
     mRNA            <400271..>402565
                     /locus_tag="FOA43_003402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923653.1"
                     /db_xref="GeneID:62196802"
     CDS             400271..402565
                     /locus_tag="FOA43_003402"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779581.1"
                     /db_xref="GeneID:62196802"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MTTTITGTINLKREHESDAIQLKHSSGKRSSSSRVNKKSTGKRR
                     FHRKSRKGCAACKRRRVKCDETKPGCQNCQRLGLDCVYLYPYATLTDKEKAMHAQKER
                     ELEVSSSERENSDSSQSQANQSIRLQQMEMFQQKQLQLQEEQQQRQQQRIQQQRYQQL
                     HQTHQLQQQSQIRQSSDNFQGSQIQISQMAQMSQLSQISQMSQNSPVSSASQAPLSAC
                     SQGLPTPQSSISILPQSPQFVATSQFSMQRIPSYGLSSLLNQPSFNMASPLGVNDMSS
                     LPPMPTLTVKPSTPSPVSSATPTPQQLAVKQQHQRDSVNASFGQADSPNSTSSGLGQE
                     STPSEHLSRKGPALSPDIINAPALSLTSPISDLNLVDLRLMYHYTTKVWPTITDAGIS
                     DSKIWSDDIPMLAFKYPFLMHSLLAFSATHLSRTERGLDQCVTAHRAEALRLLREAVL
                     EMSPENTDALVAAALILIMDSLANASSPTSTSLKSLPPSAWIFHVKGAATILTAVWPL
                     SERSRFYKFISVDLGDLGDIGYDMISGELSNTSDNNVSNPNNSGNTDSGDEDDLNHLR
                     PPVTMKRAMGGQNGSRYSTIECFDREMADLFPIPLNSPYFPTLAYMAKLHKERYKSDF
                     ILRIFAFPALLDKRFLALLVNCDLTSMRIMRCYYKLLRSFTEEMKDKVWFLEGVSSVL
                     PVDVDQYSGGGGMHMMLDFLGGPSIIDDDGRGINDVAQRAQQSGLLDTNNLPSSSIGD
                     SLKLDGNLNDDDTEGTGFIGIDDN"
     gene            complement(<402690..>404405)
                     /locus_tag="FOA43_003403"
                     /db_xref="GeneID:62196803"
     mRNA            complement(<402690..>404405)
                     /locus_tag="FOA43_003403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923654.1"
                     /db_xref="GeneID:62196803"
     CDS             complement(402690..404405)
                     /locus_tag="FOA43_003403"
                     /note="CAZy:AA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779582.1"
                     /db_xref="GeneID:62196803"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019793"
                     /db_xref="PFAM:PF00141"
                     /translation="MAAYRVYQQSLSYSVYSLLAYIYTAISQSYQQVFLVHNEVQNKD
                     ANSHFRDAQFKRREALLNRRSRSVSNDIKDFFDIPSSFTDSFAKIWFRSAYYYDKYVV
                     HFLDIITSSPYIYTPNGYIAEDMESHIQEQRGMQATLTPILGVDPTYEDPQELPTTKE
                     FYPKPYILSQRSAGKIHPTDHLVSQNVFGELSKPSSPIKPALTELFDIPDKSVVVSAI
                     PIKAPEVISDSSKPVVKHSASAEHSASAKHSASASTSVSRAVTQHKSATPSQEEPPVS
                     KSIFYKIKIRRKNKQTSHPTYGNYDLVRRRIKDCLIQPSYQPDGNIGPNMVRFTWHCC
                     AHYDQQSGTGGCSGGTLRFAQEFNDIGNTGLNTAKSYLDQIHEEFPWMSFADLYTLGG
                     VVAIEGLAGPKIEWKPGRTDCPDSKKVPPMGRLPFATLGSDHVREVFTNRLGFTDKET
                     VALIGGGHTLGGCHARFSGFHGIWTKNPFKFDNEFFKVLLEDKWSIGTVPQSGVDQYY
                     NEDKSLMMLNTDMEMMRDPEFKKWTLIFAEDEQFFFAQFAIAYAKLIELGVIRDEDGI
                     QRVKL"
     gene            complement(<404661..>405422)
                     /locus_tag="FOA43_003404"
                     /db_xref="GeneID:62196804"
     mRNA            complement(<404661..>405422)
                     /locus_tag="FOA43_003404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923655.1"
                     /db_xref="GeneID:62196804"
     CDS             complement(404661..405422)
                     /locus_tag="FOA43_003404"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779583.1"
                     /db_xref="GeneID:62196804"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="InterPro:IPR036935"
                     /db_xref="PFAM:PF01281"
                     /translation="MFSRSPSFVYSCIKSETPKIGVRYTAQSKKKRIVVQLLKDFAGV
                     GVKGQVVHVKASTMINRLHPFNGAAYLNYSGAEPVIPVVQPKKSEPPKADANLSTEEA
                     NATKATSEIESNKRHSSEELLSLDQLVSIDLTELVGTDKDVILSKIPKKLIFYRDTVD
                     DELRKPLSPDKIIDTLKNVATKELKEQRLKSSAIQFFQNHSILFLIKAVGEDGKPTEK
                     VIDQIKALGTYHISLQENGEELASTIISVGSRNEK"
     gene            complement(<405598..>406413)
                     /gene="BUD23"
                     /locus_tag="FOA43_003405"
                     /db_xref="GeneID:62196805"
     mRNA            complement(<405598..>406413)
                     /gene="BUD23"
                     /locus_tag="FOA43_003405"
                     /product="18S rRNA (guanine1575-N7)-methyltransferase"
                     /transcript_id="XM_038923656.1"
                     /db_xref="GeneID:62196805"
     CDS             complement(405598..406413)
                     /gene="BUD23"
                     /locus_tag="FOA43_003405"
                     /note="BUSCO:EOG093436ZH"
                     /codon_start=1
                     /product="18S rRNA (guanine1575-N7)-methyltransferase"
                     /protein_id="XP_038779584.1"
                     /db_xref="GeneID:62196805"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF12589"
                     /db_xref="PFAM:PF13649"
                     /translation="MSRPEEIAPPEIFYNDQEARKYTASTRVQHIQAKMTLRALEILN
                     LDPSIPQFILDIGCGSGLSGEILTEEGHIWIGMDISLDMLATALDRDVDGDLFLADMG
                     SGVPFRAGTFDAAISISAIQWLCNADTNTNEPKVRLARFFNTLYGSLRRGAKFVGQFY
                     PANEEQIVQITGAAKVAGFQCGVVIDDPESKKNKKHYLVLQAGASDRPLNLGNMDVET
                     AVPKKEHKMSKKRLKKMETKKQYIKRKKVLMKRRGKRVANDSKFTGRSRRPHF"
     gene            <407137..>408849
                     /locus_tag="FOA43_003406"
                     /db_xref="GeneID:62196806"
     mRNA            <407137..>408849
                     /locus_tag="FOA43_003406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923657.1"
                     /db_xref="GeneID:62196806"
     CDS             407137..408849
                     /locus_tag="FOA43_003406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779585.1"
                     /db_xref="GeneID:62196806"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="PFAM:PF03062"
                     /db_xref="PFAM:PF13813"
                     /translation="MTKSVSEEGEIPDRKHLRSSSLAQLDKMKILERNSGAARKSIFM
                     NDEYNSGDMNMIEETETGSVTSGSSSSSRDDSTTEHKLGKYEKRKKILQKHGDKEPVV
                     DLKMSRFMTDAYGKHRYKPDGTFRAKFADLNFQARTSILDRDVVYGSDYFGLFVAAWF
                     IVAMFSLNIVVKHYLEEGSLLRSKVFGIMMKDLWKIGLTDLAMYLVAYLPVILHMLIK
                     NGWIRWRNTGRIIESLFETVFVFFFVAFADQRCYPWIGKIFLMLHSVVILMKTHSYAF
                     YNGYMWDIKNELDVSSAYVKKHENMEESVKKALDKSISFCNFEMSTQAARTAAFPGNI
                     TFKNYFEYSMFPACVYEVSYPRNKSIRWRYVFSKAAGIFGIIFVLVAIAQNNMYPLVM
                     KCLEMQKHDTLMSRIAAYPLLIIEMIPPFLTIYLLIFFLIWELILNAIAELSRFADRE
                     FYRYWWNSTDWNQYSRDWNVPVHKFLLRHVYHSSISGFHVSKSTATFITFLLSSLMHE
                     VAMYVLFHKVRFYLLGLQMCQLPLVQFSKTKFMMQFPVLSNAIFWLGIVLGPSLLCTM
                     YLVF"
     gene            complement(<408896..>409531)
                     /locus_tag="FOA43_003407"
                     /db_xref="GeneID:62196807"
     mRNA            complement(<408896..>409531)
                     /locus_tag="FOA43_003407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923658.1"
                     /db_xref="GeneID:62196807"
     CDS             complement(408896..409531)
                     /locus_tag="FOA43_003407"
                     /note="BUSCO:EOG09343UJ5;
                     MEROPS:MER0127117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779586.1"
                     /db_xref="GeneID:62196807"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="PFAM:PF09768"
                     /translation="MIESGDQKEPINGSAKREGDDHQMESKKLKDAKQCSKCEEWRDW
                     MVKYSPNVVFMLQQIEKAGDHKVPLDMINCEICKDPKYGGFHPELGIQLCANYITDKW
                     VLNDTLSHELIHWYDNVRFKVDWLNLRHHACSEIRAASLSGECAIMTEFWKHSGFMRV
                     AKGHQRCVKRKAILSVMGHPACKSKEQAEQVVDEVFRSCFNDTRPYESIYR"
     gene            <409689..>410348
                     /locus_tag="FOA43_003408"
                     /db_xref="GeneID:62196808"
     mRNA            <409689..>410348
                     /locus_tag="FOA43_003408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923659.1"
                     /db_xref="GeneID:62196808"
     CDS             409689..410348
                     /locus_tag="FOA43_003408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779587.1"
                     /db_xref="GeneID:62196808"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /db_xref="PFAM:PF13857"
                     /translation="MSTNIWIATADDKRDVVKSLIETGRFTANSKDANGYTPMHAAAS
                     YGNNDLLEYLILKGGDVNIQDNDGDTPLHHTESLATAKLLIEKNNADYTVRNSDGQTA
                     LEALLDDNDSPELIQYLQSLQTNTSARGSLPLPLNENMSLPNGEEVKMYLSGLREEDS
                     PELTKRRQELEQIMTQADISESEKDEQLKMYVMNALSQNIQGIKGEEDASTDHMSKKR
                     R"
     gene            complement(<410417..>412376)
                     /locus_tag="FOA43_003409"
                     /db_xref="GeneID:62196809"
     mRNA            complement(join(<410417..412060,412162..412168,
                     412372..>412376))
                     /locus_tag="FOA43_003409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923660.1"
                     /db_xref="GeneID:62196809"
     CDS             complement(join(410417..412060,412162..412168,
                     412372..412376))
                     /locus_tag="FOA43_003409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779588.1"
                     /db_xref="GeneID:62196809"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF00789"
                     /db_xref="PFAM:PF14555"
                     /translation="MGVWEEEKLQQFKEVTNYDESTEQEKVLKLLRVCNWNLDSACVR
                     YFDNDFPTLLDDETLNHEVNASINERPPMRDPFNGAGIGGSASAGVFDNRFLDLIPKL
                     PKAVTISNNWKFQIGILHGQNINRGHVSMLAPVVFILMLFPRLLWALGWGLDKLLGST
                     FPNVFRFLGYRTGPTDFPRRPLYLTKEEISHYDIKNYIDETLGETSDLPVFRGGFNDA
                     FNRSKSELKWLVCVLLNSQSDTSRKFVKTYLNDERFIEFVKRDQMILYIGDVSYPEPH
                     EVGQVYCAYSVPFISLISNVSATGTTMPMMSVVSKHQSFEGDKRFTPEERRKLMRRLT
                     RIVQRYEPQLIVQRTDKQEADLSRVLREQQDSAYQESLIKDMKKQEQKKRKQIIQQQQ
                     LEEEERQRESSERRKRLRKAAIYHYYIQKYNRDTSSWIRGEYTTIQLRNNKGQRVIRK
                     FNKEDTTFDVFMFVECRDYLLAHGDQSENCAIKVLKADSKDEQTDGPFEYKFKFDLIS
                     PMPRLRLNPDREQFLAEVGELWPNGSLLIEKVDEEETDSESDV"
     gene            complement(<412906..>413955)
                     /locus_tag="FOA43_003410"
                     /db_xref="GeneID:62196810"
     mRNA            complement(<412906..>413955)
                     /locus_tag="FOA43_003410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923661.1"
                     /db_xref="GeneID:62196810"
     CDS             complement(412906..413955)
                     /locus_tag="FOA43_003410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779589.1"
                     /db_xref="GeneID:62196810"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MSEYSDVQLFVRPIGPDAKHEEVEEFFAEAGAIRELRLMPGYAF
                     VEYETAETAQKAFSQFIDKPFQGETLQIEYAKRKPEYAKKGEFRAKVTDLPEGTAWQD
                     FKDFIREEIRVRPTFVRIPMDEPTVCYLEFSSKEDLDSAITQLNEVKYKDAQMAAEID
                     TSPYIASASRQFNPRRRRRGGFRGGRGSFRGGYERPSGGYDRPSGGYDRPSGGYDRPS
                     GGYDRPSSGYDRPSRGYGYRNGPPQRAYRGGPPPMDNGPSSSNYDDAPSGYRDYPPSG
                     PRGGSGYAPRGGRGGYLPKSPGSYPPQRGGYRDDYPPPEREGGRGSDYRSSREGEPNL
                     PEEREYNRDRSPTRY"
     gene            <414614..>415108
                     /locus_tag="FOA43_003411"
                     /db_xref="GeneID:62196811"
     mRNA            <414614..>415108
                     /locus_tag="FOA43_003411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923662.1"
                     /db_xref="GeneID:62196811"
     CDS             414614..415108
                     /locus_tag="FOA43_003411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779590.1"
                     /db_xref="GeneID:62196811"
                     /db_xref="InterPro:IPR029058"
                     /translation="MQITLCGHSAGCTLITQILEREHTLSQFGVREIGPIPSIQRAIF
                     LDGIYNVTSLVEQYPDYCGFIHEAFGDNMERCNIISSGKQDKDLVKHIYGQLDKITVI
                     HSIWDELISLKQPEEFINWLLECGVDERLVTEGCYFDSFGKHNDVYQSKKVAHILVTD
                     MFTR"
     gene            complement(<415169..>416026)
                     /locus_tag="FOA43_003412"
                     /db_xref="GeneID:62196812"
     mRNA            complement(<415169..>416026)
                     /locus_tag="FOA43_003412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923663.1"
                     /db_xref="GeneID:62196812"
     CDS             complement(415169..416026)
                     /locus_tag="FOA43_003412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779591.1"
                     /db_xref="GeneID:62196812"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF12353"
                     /translation="MAPSTSWADAENDLPSTEVVENSDGTKTVISYKFDDKHRKVKVT
                     QTIKLIKVTENVNPAIAARKKWARFGDEMNNSTVGPDARTTQFGEEVKLLLSTSWKQD
                     AEKEKTEKKKETKEKVQTIKCRTCGGDHFTSKCPFKDTLGVDLKKEAEAKMAEPSSAT
                     VAAAAVAAGLGGMGASSYVPPHMRRRLNGEAPLPSETEKEDTTTLRVTNLNSMVDEGM
                     LNTLFSRFGYIHRLTILRNRETRESRGIAFVEMDSISNAKRAIEGVNGRGFMNLIVNV
                     DFAKPRGER"
     gene            <416520..>419162
                     /locus_tag="FOA43_003413"
                     /db_xref="GeneID:62196813"
     mRNA            <416520..>419162
                     /locus_tag="FOA43_003413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923664.1"
                     /db_xref="GeneID:62196813"
     CDS             416520..419162
                     /locus_tag="FOA43_003413"
                     /note="BUSCO:EOG09340IIN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779592.1"
                     /db_xref="GeneID:62196813"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MNNMAHMSTSLSPLPQGPSHNQVISPSSNLDHISRRPGVELEEH
                     HLKTLSKNLKYREFFRRSQKFSSKKFNHFFLSQELRIEPDCDDDDHLNVPSVNADNAS
                     VFSDEVPLFDQSMSLSESQRTVKGNNKSRPVPKTSKRFQKKAKEQPCHGKSHANFILE
                     FSHDGKYLASAGDDGTVRIWEVISSVFDRRKRGYDGFSDTDTTTKLSSTALNQSSSLI
                     TTATSLGSLAKLTNRSRSCSRSSMNSSSLASFSFDDTGSLSNDDSPKKVRNSDKYADS
                     AFAPVFKSLPLRQFHHNDTVLAISWSKNNFLLTSSEDKTVKLWHVDRNECLRTFKLSS
                     FATALSFHEKDDRFFVCCQWDGTVVFYSILEKEVVYRTKVGKRIACMSFSPDLENIYI
                     GCEHGYFYILSLVGLKEVSAFQIRHKNKCPRITGIDAFVKNGDTKVLVTTNDSRVRLF
                     SFEKKCLQVRYSGYDNDYSMIRARASEDDSFIISGSEDGWAYMWEIYDGKDQSVDPPS
                     GALKNLPKEIASFFKDESCQLKNKHYGAFHIHHTRCNAAIFAPRTTSKLLELSDDPIF
                     DLRNKYGALAETLEDEDLSSAIIVSTDNKGTIRVLRRDFAYSVRKMSLSKKAGVSKAD
                     LRGALQRMEHQASTGSDRYISSPLKAPTLTINDTTNYIEGTPENETPIDGNEDRGRRD
                     FYHESRRATKSSVEEHVKPQNASRTNLLIKHKSSGELSPTLSLSTTSQSSAVVSAGGT
                     VYKPVTEGDKDALGSESFKEIDDQIRQLMTDADDDELSTRSGTPVDGQPPKSANHHIF
                     NDSISTITFPKSMNMSDSSTWVDSKKKPNASHIDSTVYGGTSPPTLKCAYCGEKKFTA
                     TPVTNTNGSGIRFVCNRCGQETSS"
     gene            <419333..>420484
                     /locus_tag="FOA43_003414"
                     /db_xref="GeneID:62196814"
     mRNA            <419333..>420484
                     /locus_tag="FOA43_003414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923665.1"
                     /db_xref="GeneID:62196814"
     CDS             419333..420484
                     /locus_tag="FOA43_003414"
                     /note="BUSCO:EOG09342ZOS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779593.1"
                     /db_xref="GeneID:62196814"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR021538"
                     /db_xref="PFAM:PF05739"
                     /db_xref="PFAM:PF11416"
                     /translation="MDYYTSSNIQDRTLEFQQCVGTFAKQKGLSGGRGVNKYLPVVQP
                     ENEKKKGLSRSEFSRNASVIAKDIARVTGSLAKLAQLARRKQLFNDRPTDIIELTYII
                     KQDIFRIEKSLKSLQQQAKTSKSSSDNQVALYNKNVVQLLNTKTKNISETFKEVLQVR
                     QRNELAQRSRQEQLLAAVKPDSDGLSSGRASGRPSMDSSSMHAGDSLGSASNSIPYAL
                     RSRRLAGKDNAGTSGSPGNSENPFLTSLATGNRDDSDPAVSSISQLEKNDYGNDDLLA
                     LPNQSQQMMLLEEQDSRYLQERNHAVETIESTINEVGGLFQQLATMVQEQGEVIQRID
                     NNVEDVSLNIGGAHRQLLKYYNNISSNRWLMIKVFGILIVFFLLWVLVS"
     gene            <420682..>421182
                     /locus_tag="FOA43_003415"
                     /db_xref="GeneID:62196815"
     mRNA            <420682..>421182
                     /locus_tag="FOA43_003415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923666.1"
                     /db_xref="GeneID:62196815"
     CDS             420682..421182
                     /locus_tag="FOA43_003415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779594.1"
                     /db_xref="GeneID:62196815"
                     /db_xref="InterPro:IPR006885"
                     /db_xref="InterPro:IPR038532"
                     /db_xref="PFAM:PF04800"
                     /translation="MFLRALRPSMQKAAAKNFEVTLRSNSSASTPVKIREIVDATTTS
                     KEIVSGAPSELAASDNRVVRIYKEAQYATQSSARNSFFWKLEFDILPKGNRWENDLIG
                     YQGTTDYVQATRLDFITKEDAVRFAEGQGWDYYVQHPKEKKFKVKQYANNFVHCKGPL
                     KIIRTK"
     gene            complement(<421440..>423227)
                     /locus_tag="FOA43_003416"
                     /db_xref="GeneID:62196816"
     mRNA            complement(<421440..>423227)
                     /locus_tag="FOA43_003416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923667.1"
                     /db_xref="GeneID:62196816"
     CDS             complement(421440..423227)
                     /locus_tag="FOA43_003416"
                     /note="BUSCO:EOG09341GFY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779595.1"
                     /db_xref="GeneID:62196816"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF13174"
                     /db_xref="PFAM:PF13176"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13414"
                     /db_xref="PFAM:PF13432"
                     /db_xref="PFAM:PF14559"
                     /translation="MPAETSFVVQHKLALAVTAVVGIGSIAGLVYHYKQLQNQIESND
                     KDDTSSDAKKSKKKKTRKSKKSKKKKTVEPKNVPYPVNEKGDPEVTEEVVKKLSAAEK
                     DKWASALKEKGNEYFKGEEYSAAIDFYSKALICKEDPVYFSNRSACYSALGDNENTIL
                     DTTRALKINPGYTKCLLRRARAYENQEKYPEAMFDLTALTIYGGMNDVSNESMLERIL
                     KKHSAKINKEKYSNLPKVLPSASSLSSFFGAFSAEDIDLDVSHYAEGSGERFLVDALN
                     EMKLDTEESYKKADVLINQSVSIFDKSTEGVDKKIIALAYEYAGAFTFLKADADKSLE
                     YMEKALETSPRPRTYVIMGLIKADKGDYVGADTEFGKGIKLNPEDPDIYYHYGQIFYL
                     VGDLTKGEANFEKAKKYNPHNVYSYIQLACLAYRKGDSSKCDKLFKEAKSKFPTSPEV
                     PNYYGEILFDRQDFDGALKQFEIAARLQEVHNTFNIGALPLINVSGIYQKKGDIEQCV
                     KVLKKACDLDPKSEVARLNLGQIYLSQQKVDEAIKIFEEACLLARSADDRAQAISLME
                     ASKMQQKIRQDPVLSKKVQEILSSIPPQV"
     gene            <424075..>425352
                     /locus_tag="FOA43_003417"
                     /db_xref="GeneID:62196817"
     mRNA            <424075..>425352
                     /locus_tag="FOA43_003417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923668.1"
                     /db_xref="GeneID:62196817"
     CDS             424075..425352
                     /locus_tag="FOA43_003417"
                     /note="MEROPS:MER0011785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779596.1"
                     /db_xref="GeneID:62196817"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PFAM:PF00561"
                     /db_xref="PFAM:PF12146"
                     /db_xref="PFAM:PF12697"
                     /translation="MLSSRHFPCLVPKRILGTRRFSRRQPYSTLNNTSSSPGGYRISK
                     PPAGLPVSKLITKGIIFPVSVRESFKDFSKRHQLGQLQYDLLSILPFYPEPSRLHSSE
                     IVQTIIDESTGDYINEFHISPRSSIKAGHTDKHVVFIHGYGAGLGFFVKNLQYIAEMR
                     PDWHIHAIDLPGYGCSSRPDFPHNIQFSHYQEIEQWFIDRLSMWFKKRKLDSSNTMVV
                     AHSMGAYLSCVLNFQHPDFFNHMLLVSPAGIYHSRKEEVLAAIPSWFQKLWNRNISPF
                     SLVRNSGPFGSTLVSGWTSRRFSKNNTILTPHEQKLMHMYTYGIFNAKGSGEYMLNYF
                     LAPGGVPRHSLLNRIQNLKCHTTWLYGSHDWMDKLGGFEACRIIRESSKLSGHPLEAI
                     CKIVQDAGHHIYLDNFEEFNQLVTQEMDRFGKC"
     gene            complement(<425479..>427587)
                     /locus_tag="FOA43_003418"
                     /db_xref="GeneID:62196818"
     mRNA            complement(<425479..>427587)
                     /locus_tag="FOA43_003418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923669.1"
                     /db_xref="GeneID:62196818"
     CDS             complement(425479..427587)
                     /locus_tag="FOA43_003418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779597.1"
                     /db_xref="GeneID:62196818"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="PFAM:PF00501"
                     /translation="MVFQLNVAVGDAKPGETAPYRCYRVKNGAVSRPLGFKCTTMYEY
                     FNECVAVNGKAEKCQGWRDLIDVHYEKKMVKKLIDGEITQVEKEWMYYEKSDYKYVTF
                     GELQEIVNAYGRGLIKLGIKPKNEERILLFASTSHKWMRTYLATQTQAIAIVTAYDSL
                     GRKGLTHCMKDTDSVAIFTDNDLLSKLVNPLKECKSVRYIIHSDPLDPNDKRGNGRLY
                     SESKKYHDEILKVRPDIKFISYDDIVKLGMENMDIKPCPPTPSDITCIMYTSGSTGEP
                     KGVVLSHANLVAGVGGVGTTANRDIINSKDRVISFLPLAHIFELLFELLGFYWGSVGG
                     YASVKTLSDASCRNCKGDMRAFEPTIMVGVAAVWETIKKGILHQIQQLPTFKQKMFWG
                     AYNTKAACKKYSIPFLPALIDSIVFKKIKQATGGHLRWILNGGSPISGATQRFVSYTV
                     APMLIGYGLTETCANTCVTDPDHFEFDVAGPLVGSITVKLIDVPEAGYYAKNGQGEVL
                     IRGASVMQRYFNNPKETDLAFNYDKNWFSTGDIGQWTESGSLKLVDRKKNLVKTQNGE
                     YIALEKLESVYRSNSLINNICCYADETKVKPIGIVLPEDKALKQLIVELGLAKEGDEI
                     QLADFVNNKKVTHAVTKSLLDTAKKAGFTRIEMILGVVIVDDDWTPESGFVTSAQKLQ
                     RRKILQSVKDRVNTLYSENL"
     gene            complement(<428715..>429410)
                     /locus_tag="FOA43_003419"
                     /db_xref="GeneID:62196819"
     mRNA            complement(<428715..>429410)
                     /locus_tag="FOA43_003419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923670.1"
                     /db_xref="GeneID:62196819"
     CDS             complement(428715..429410)
                     /locus_tag="FOA43_003419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779598.1"
                     /db_xref="GeneID:62196819"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PFAM:PF00300"
                     /translation="MTISGKWMNSSDEVIRIFIVRHGQTQWNIERKLQGHKNIPLNET
                     GKKQAALLGRELEDYQFDFVISSDLTRCLQTLRQILGDKMDDEKLNFKKTENLRERFM
                     GDVEGMYIKDAREKYGSKFKDRGETKGNMIGRLNKEWEQILEDSVKNGYKNVLLCAHG
                     GVITNFFNYLYQEEHYKLGEGLGSDDLKVPYNTSLTIVDLKRDDLKDGTIRIWANTDH
                     LGGVKNVADQQLV"
     gene            <429687..>434023
                     /locus_tag="FOA43_003420"
                     /db_xref="GeneID:62196820"
     mRNA            join(<429687..430461,431268..>434023)
                     /locus_tag="FOA43_003420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923671.1"
                     /db_xref="GeneID:62196820"
     CDS             join(429687..430461,431268..434023)
                     /locus_tag="FOA43_003420"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779599.1"
                     /db_xref="GeneID:62196820"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PFAM:PF04082"
                     /translation="MMFLRFVRVQVPRVRQFSSSLTTRSILDYFKFYKKKDHENVPKQ
                     RPTEEVIKEVESGSKAIDAKNDVEILGRRDPRQFDKEVILEHLKGFSIPTWLPTKSGS
                     EYAIKLNELTKSNEGVSISKLYTRAISEILKQVAGYDSGITELNDLSQRASILKQVQQ
                     KFRLEIPDPQIGKLNSFAKIEQYLTQKLDPSRPEEDELVPDKVYFDPAVLEGTNISVG
                     SFVFEKQKAKTLKKLLKKAKKMEKRAIEEHQKIGNDTIPISYAEKPNFSQKRILENVP
                     FEIDGKNLGDMKSIKKPRISINGSSISTTISNGNNQVDDSANDSSVSTSGRDIQTRLD
                     HLENMIGILVSKLAPEASTESQYSQNSSFPATCISLPLVDTKQSSVPSSFSTVLESPK
                     RTGFLSKEVVEKSIIAAAEDLERGPPTNAKVSERYERFFGGNTSISIFSSKGMKWMEG
                     KVRDRKTTLPLRRLLSWVVHMEHGMLSVWVDPIEKSQIRPFPSRIVIEKLISEPVLPT
                     ILSRLMDIDTVRRLLKLYCDYRDGLIPEPRYTYSELLLMNCSLLVASSFYYERGHLCD
                     GVDSKLNLTDLADMKKYLLDNSLFYYHRVSVVFDGLTGISGILLLSMYADFVSLSQSA
                     YLMSTTAIRQAQDMGLHQGATYRGLPTKERNKRLFVWWMCYGYDRDLCVRSGKPPIIN
                     DDDVSAPSVPGFEAYWGFPSNQLRMSTELQYDLRTKLESMLSEGSICEVELYLGTQHF
                     RLVARSYSGLLAANAFVSKSPSQLYECAENLLIDLELWRQIIPASLRPTRKLNPEFAD
                     IMERSAQDRSTSSIYRMYVFVCICFKYYHLKMTINKAIVKIKFSYEKSTIPKNMLSKV
                     SIAEEEGMGTAMVILQMAGCMKSTEYANFALFYPFSSFIVVAAYCLQNPDRLTTKENV
                     DCLIKASRNFFSAVPSRLSVDKWWVVDKIVRCVLYIVITTIVEHNPSWHFDCDDLLVD
                     IKGLTVENDHACSATKTKSAFNSSVNDHPNTSRGKGMFCNVPVASLIAPPALDYSHSS
                     SVSESAVQGRQQQVPLPKFSPRPEMTSPFNKAGLIYDPSTEVASPGNSFPLGDGNGDV
                     VSDNILPDLELGSLRFDDSNDPKNINGLLELFSRNENNTPTNESEVSNSDTFQAEGVS
                     LFQNMFNIPTMMLDMDGSSHTTLNSPQDIF"
     gene            <434996..>436453
                     /locus_tag="FOA43_003421"
                     /db_xref="GeneID:62196821"
     mRNA            <434996..>436453
                     /locus_tag="FOA43_003421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923672.1"
                     /db_xref="GeneID:62196821"
     CDS             434996..436453
                     /locus_tag="FOA43_003421"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779600.1"
                     /db_xref="GeneID:62196821"
                     /translation="MANATYPLEYLRDFQFLVGNYSFLRIVRDSSDYSLYQSSRLLFE
                     NDDFDDYYPTIEKQMSQMAVPVMDSYQILGLEEINLLPSESPFSLQVSLDTKQQMNLQ
                     SISDSGLSSKLQQLPISSLEFDNAKSADYFISALGTGFQEIKRSLPVLKKLSLSVSSL
                     RSLQAFSNVIDFPLLEHFELKLSRSTFNIEDEHLNLASLPFWNTALSENILSLSLVNL
                     NYTNLLTNFSIGSTSVFKEVNLFYTLLLHCKIFNDPDASRNVTYVNFCLNSFAALPEF
                     SMNPADYKSAFIVDDYYLKSKSRIFKKLFNFYNCETLIIPDYFFNWKPFIKLQTSSPD
                     KGEFCVANSILDNTDYLFGYCNCPSCVSARKILLRKTEEEGAMGQTQTFYNFIVLLLF
                     GRIPNMECRSQLNFFSNTLQDSVEILGSGYMKSDLAQVFHLILDNLVPDLRVFITRLP
                     RLHELCLGGFLFDIDRSGTNSVSISAPQENWSVRI"
     gene            <437015..>438246
                     /locus_tag="FOA43_003422"
                     /db_xref="GeneID:62196822"
     mRNA            join(<437015..437020,437059..>438246)
                     /locus_tag="FOA43_003422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923673.1"
                     /db_xref="GeneID:62196822"
     CDS             join(437015..437020,437059..438246)
                     /locus_tag="FOA43_003422"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779601.1"
                     /db_xref="GeneID:62196822"
                     /translation="MRSFVSEMEHLQQKMFSSKLTTNVLSEFNDRYQKVRDENIVHIQ
                     KMNNNTTNAELNRRASNRFSKAHRSRFDRMDSIASHYATIRTKQQEQKKTEMQDQSQQ
                     QRHKQKQQSKPSPGQLKRYAPSSINRMLIEKDVSYPSMKGTTPGEKRSGLQAISSASK
                     RQKMFDGDFVEIVESPTKEQAEKERIKKVHILQLKRSEAKMLTASNTLSNESIPQLHF
                     SDTHVNENQLFQRFDCSPVGFSSSTPQRSVHASTPKDARRTKPTPPISKKHRIPSYLL
                     PTKASLQKIRFNKDLSREDEEKEIRPASRKSTLPSCSGISPSRACSNLHSLLHNTRST
                     KIPSSQTYKDSAGLSSSPSLLFPPHNMPKSRTSSNIPRLAQPKISTIHRSPTSASLSK
                     HRWKC"
     gene            complement(<438283..>439671)
                     /locus_tag="FOA43_003423"
                     /db_xref="GeneID:62196823"
     mRNA            complement(<438283..>439671)
                     /locus_tag="FOA43_003423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923674.1"
                     /db_xref="GeneID:62196823"
     CDS             complement(438283..439671)
                     /locus_tag="FOA43_003423"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779602.1"
                     /db_xref="GeneID:62196823"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="PFAM:PF07247"
                     /translation="MPSRTLGGLEKYCFYRNYYNYYTCVISVASYSSDVDPSDLCEAL
                     KGLLVEETGFALTIKLDRKENPEFILLNRILYTDLVEYRDEDSFDLDGETTKLLDTKF
                     SLIEGTQPLWKVIVFNRRHIVFVADHTVCDGTGIINFQRLLLKHINTARNIQNKIVPS
                     PSSIVFTGGDDVNFMDHTESYFDSKPSISFVIRKFAERLLPGRLWNIGGRRRLGKYKL
                     LGTNLPIPQEIRPSLHTKSRSISIDRGTLSKLLCLTKKHRVKLTSLLTYLLAKSFVNV
                     LPQEMKRYDLPIHIPVNCRQFIDFSAIQIEQPWFTALAGTYAGDIQTTLPAVMSTKDD
                     SIDWEYVQAVQSRISEVILDETPQYSVGMFNMINMRNYVKAFSGNFNGIALGISNVGY
                     FDFNATYENMYYKVEDIWFTQCSGVSGALITANVVGFSGGLRITLSYDQVIPYADKVD
                     EIIEQMRKYLVS"
     gene            <441082..>442779
                     /locus_tag="FOA43_003424"
                     /db_xref="GeneID:62196824"
     mRNA            <441082..>442779
                     /locus_tag="FOA43_003424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923675.1"
                     /db_xref="GeneID:62196824"
     CDS             441082..442779
                     /locus_tag="FOA43_003424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779603.1"
                     /db_xref="GeneID:62196824"
                     /db_xref="InterPro:IPR018791"
                     /db_xref="PFAM:PF10186"
                     /translation="MNISIPHDERQVYVCEICHDNDVSKSLSSRKKKYYCASCINFSL
                     LKLKLKTLTTVYYNSRAGHEVGQVLEDCLDNNASVSLKKYLNGSEDRRNDKDQLLGKL
                     VPSIDSVARLAYVLLNVENIEQKKRLDRLKEMVEEQTTSNKLMRDKISDLRRQLEEKR
                     QCINEKTKQLNAEHKESLSQVASSFEETNHMVFRQRALVDSAKLDLMADIIKLWNIQL
                     LRASSGISVSILGLPVLSIDKLIYCSVPLINACMERLMWFVLLGAKYLSLQLPFCLIL
                     EDGWPKIVWNGTTYSVSLPLTSKRIGEPLGSLMEVNQGQLKRFALSLAMVIADLIRVV
                     NTVDPSFSLQSSSGLRMSNFMHTDEMVAVILKQLEWLKDRRRLIREEKHAQSRQLLLL
                     KRMLGDRLSPKPSIWLFWRKHGAMNAAQDTAQNHSTLAPIKTVYDPLCDMLMRTQKVS
                     LIDRLSKTAWNDDLANSMKSIASLVYLQEDIRVLGNSLYNYIVSEIVKAVESYSMINT
                     TTLMDSSTSSGYQQISIPQLRHSDSSAVMRKHALQTNRKVANKASNDNWEMIGDNNI"
     gene            <442994..>444526
                     /gene="VMA2"
                     /locus_tag="FOA43_003425"
                     /db_xref="GeneID:62196825"
     mRNA            <442994..>444526
                     /gene="VMA2"
                     /locus_tag="FOA43_003425"
                     /product="Vacuolar ATP synthase subunit B"
                     /transcript_id="XM_038923676.1"
                     /db_xref="GeneID:62196825"
     CDS             442994..444526
                     /gene="VMA2"
                     /locus_tag="FOA43_003425"
                     /note="BUSCO:EOG09341HJ8"
                     /codon_start=1
                     /product="Vacuolar ATP synthase subunit B"
                     /protein_id="XP_038779604.1"
                     /db_xref="GeneID:62196825"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005723"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022879"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00006"
                     /db_xref="PFAM:PF02874"
                     /translation="MLSDKELFELNKKAVTKGFKIHPRLEYNTVGGVNGPLVILEHVK
                     FPKYNEIVNLTLPDGTSRQGQVLEVKGDKAVVQVFEGTSGIDVKKTKVELTGESLKLP
                     VSEEMLGRVFDGSGRPIDNGPRVFAEDYLDINGSPINPYARIYPEEMISTGISAIDTM
                     NSIARGQKIPIFSGSGLPHNEIAAQICRQAGLVRPTKDVQDGHEENFSIVFAAMGVNL
                     ETSRFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTI
                     LTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVQGRNGSITQIPIL
                     TMPNDDITHPIPDLTGYITEGQIFVDRQLHNRGIYPPINVLPSLSRLMKSAIGEGMTR
                     KDHGDVSNQLYAKYAIGKDAAAMKAVVGEDALSTEDKLSLEFLDKFEKTFISQGAYEN
                     RTVFESLDLAWSLLRIYPKEMLNRISPKILDEFYDRERTDGSTVAATNTAKDDDAEDA
                     KA"
     gene            <444755..>446032
                     /locus_tag="FOA43_003426"
                     /db_xref="GeneID:62196826"
     mRNA            <444755..>446032
                     /locus_tag="FOA43_003426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923677.1"
                     /db_xref="GeneID:62196826"
     CDS             444755..446032
                     /locus_tag="FOA43_003426"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779605.1"
                     /db_xref="GeneID:62196826"
                     /translation="MRSLIDLPPEIVDTIFKLVPSYLNCTCKFFYVMYNNMYEERFLK
                     EFGSEILNVIAFCDLPYLVDYIKSFDQWPRYRVARRIVSDYYHLPEHHSVDSDNDATS
                     ILNCQYIKDSWKFIYGIYKNRCVFIELGDFKVDEFGSQYENGSLKLTGSHLLNYKKTI
                     QLTTGRYRVGYGIVIDGGRPNGLDATCFSLQVHATQEKLITYFPPNMLPELFPKDKFV
                     MLNLGTFYLKPQDDESTFNRLIDVDIKVEESGLYPKTNFALCYMEIRPIPSTNDRISS
                     LPSWLSWWIANDGPEAKHITNVLLMKLYHTINQSLSHMRHDKSANPYQVLGSYRRRQE
                     IGTEKKISGIQDYGHPSGLVYGMTEKEIDRYIKRFFCPYNSHHDRIYRNFKFETHIDE
                     MDWKSRISKDDALWCDDDPLVWKVPHFRDYACE"
     gene            <446487..>447524
                     /locus_tag="FOA43_003427"
                     /db_xref="GeneID:62196827"
     mRNA            <446487..>447524
                     /locus_tag="FOA43_003427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923678.1"
                     /db_xref="GeneID:62196827"
     CDS             446487..447524
                     /locus_tag="FOA43_003427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779606.1"
                     /db_xref="GeneID:62196827"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR036612"
                     /db_xref="PFAM:PF00013"
                     /translation="MASSESLFGNSFTGASTANATAGNDDDLTANNNIDIDVDLGKTL
                     ITYRVLVSRREAGAIIGRNGDNITEIRNNNNVKAGVSKVVDGCIDRILTISGMVDNIP
                     DTMVAIARSVTIANAETVKQADEKGTDPTNLITYDFFPLKPLTQRPLPNEPAYANTLF
                     LRLLIPNSQIGTLIGKGGSRIKNIQETYNVKMVASKGFLENSTERLVELQGTEENMRP
                     AIAAISKCLLRDYQGTATTTYYLPSAAMPAYRRRREGRGTGKEVIKKITFPNEYIGAL
                     IGKRGSRIQEVRRLSSCAIAIESDSENGVSNHGEREITIIGTRANIDHAVEMLNDYYQ
                     RERQRREEMEE"
     gene            complement(<447664..>448425)
                     /gene="RPS3"
                     /locus_tag="FOA43_003428"
                     /db_xref="GeneID:62196828"
     mRNA            complement(<447664..>448425)
                     /gene="RPS3"
                     /locus_tag="FOA43_003428"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_038923679.1"
                     /db_xref="GeneID:62196828"
     CDS             complement(447664..448425)
                     /gene="RPS3"
                     /locus_tag="FOA43_003428"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_038779607.1"
                     /db_xref="GeneID:62196828"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR036419"
                     /db_xref="PFAM:PF00189"
                     /db_xref="PFAM:PF07650"
                     /translation="MAATIISKKRKLVADGVFYAELNEFFTRELPEEGYAGVEVRITP
                     TKTEVIIRASSTQRVLGEKGRRIKELTMLIQKRFHFAPGSIVLYAERVENKGLSAATQ
                     CESLRFKLLNGLAVRRAAYGVIRFVMESGAKGVEVIIAGKAKGARAKAMKFADGFMIH
                     TGQPSKDFIDIACRHVLMRQGVLGLKVKIMLDPSAAKKGPRTLPDAVVIHEPKEEEPI
                     AAPYVHVYKEIPENKVAAAPAPGEDAPVEAAPIEA"
     gene            <449470..>450534
                     /gene="CEK1"
                     /locus_tag="FOA43_003429"
                     /db_xref="GeneID:62196829"
     mRNA            <449470..>450534
                     /gene="CEK1"
                     /locus_tag="FOA43_003429"
                     /product="mitogen-activated serine/threonine-protein
                     kinase"
                     /transcript_id="XM_038923680.1"
                     /db_xref="GeneID:62196829"
     CDS             449470..450534
                     /gene="CEK1"
                     /locus_tag="FOA43_003429"
                     /codon_start=1
                     /product="mitogen-activated serine/threonine-protein
                     kinase"
                     /protein_id="XP_038779608.1"
                     /db_xref="GeneID:62196829"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSQVAQSKIQVTFNVSEYYEIKEIIGEGAYGIVCSAIYKPTNQR
                     VAIKKIRPFERTMFCLRTLRELKLLKHFSHENIIGILDIQIPYDFEHFNEVYIIQELM
                     ETDLSRVIRTQKLSDNHCQYFIYQTLRALKALHSADVLHRDLKPSNLLINSNCDLKIC
                     DFGLARSIASKEDNYGFMTEYVATRWYRAPEIMLTFQEYTTGIDVWSVGCILAEMLSG
                     RPLFPGTDYHNQLQLIIEVLGTPCADDYNGIKSWRAKEYIRMLPFRKKREFSELFPDA
                     NPLAADLLEKLLTFNPKKRITVTQALEHPYLAFYHEPEDEPDAERIPDDFFDFDKRKD
                     ELTMSELKRMMYDEILKPLR"
     gene            <450810..>452474
                     /locus_tag="FOA43_003430"
                     /db_xref="GeneID:62196830"
     mRNA            join(<450810..450814,450848..>452474)
                     /locus_tag="FOA43_003430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923681.1"
                     /db_xref="GeneID:62196830"
     CDS             join(450810..450814,450848..452474)
                     /locus_tag="FOA43_003430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779609.1"
                     /db_xref="GeneID:62196830"
                     /translation="MSDITWKDAVLRRWYYQDFSPICISSLPGRGYYELARVRCLKDK
                     EINYLIDTIIRKAKTKMTLKLIEAMFDESEDSWMYIPELIRIRNHLQVGNLNLHRSDC
                     LYARTFRKAKEDNLRVRLASLNRVYVASVLLEAIQLKALFKLFVRVLYMKIPSSEVER
                     LLVHLNLLDSNYFELLHCREVVLERAVQYYCCREKEHLTQNENTKLITEALMDTLHNG
                     QNVSFARDTEDTKLDFEDLLILRNYGCDSKLASFNAYAMVQEIGRRLEVSIPINHMCI
                     NPTSDADHLLMVYSDHQFNAKPISRFPAIYRQIEKPCKYLEYVLNFMFGADFDRTIFR
                     SRGIWHPQSTSCEGECGHGVTENVVGTSFVRDSTQRIVQLFLQFITLKRIAALQSLVE
                     YISKKRTPILLMMLRSVLRGFQGKENYHEEIAYIDEKLNDTCQLALDVDIKFAFGTTY
                     DRSLWDDNVPHGLHVGDVIFSYKQEAGVIVAYREENKSKSFLCLMSKSFLQVVNARDI
                     CVREFTDELVLEFAEYDQLGEFFSGFDWIARRFVV"
     gene            complement(<452544..>453473)
                     /locus_tag="FOA43_003431"
                     /db_xref="GeneID:62196831"
     mRNA            complement(<452544..>453473)
                     /locus_tag="FOA43_003431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923682.1"
                     /db_xref="GeneID:62196831"
     CDS             complement(452544..453473)
                     /locus_tag="FOA43_003431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779610.1"
                     /db_xref="GeneID:62196831"
                     /db_xref="InterPro:IPR001708"
                     /translation="MRSHQQLRHFSIDPILEVLNQGTTYIEALHALSGIPWWGFIPIL
                     TVALRSTVTLPIAIYQRKGFQKQNSLRPIANAMSPVLKIKLAAEGQSEQMRTRKGENS
                     PVKSEKQQLTADKIMIIASKERFKRQRKLFKDNSCQSWKFMMLPAVQIPLWVSVSYML
                     RVLTGWSQIGSKPLDSTLTTEGVGYLHDLALNDPYFVLPITLGILALANAEWNFATAD
                     MMKLTTRGVRNSLRPTAFDTIITLTRGSIIFLMAMATQAPAALVLYWISSNGFSLCQN
                     LLMDRFLPIRYTPYKRFYSAKKLSKGAVPLIKY"
     gene            <453829..>454245
                     /locus_tag="FOA43_003432"
                     /db_xref="GeneID:62196832"
     mRNA            join(<453829..453906,453970..>454245)
                     /locus_tag="FOA43_003432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923683.1"
                     /db_xref="GeneID:62196832"
     CDS             join(453829..453906,453970..454245)
                     /locus_tag="FOA43_003432"
                     /note="BUSCO:EOG09344M40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779611.1"
                     /db_xref="GeneID:62196832"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="InterPro:IPR038510"
                     /db_xref="PFAM:PF06093"
                     /translation="MAIKRTRPAPKLNRACMLCGVVQSMSQFRNEGCPNCESVLHFTD
                     NDDLIRECTSPSFEGLVAYKGDEASWVARWLRVENFVPGVYAVRVGGKLPEDVRSDLY
                     SQGVEYRPRDGSVRD"
     gene            <454555..>455910
                     /gene="SAH1"
                     /locus_tag="FOA43_003433"
                     /db_xref="GeneID:62196833"
     mRNA            <454555..>455910
                     /gene="SAH1"
                     /locus_tag="FOA43_003433"
                     /product="S-adenosyl-L-homocysteine hydrolase"
                     /transcript_id="XM_038923684.1"
                     /db_xref="GeneID:62196833"
     CDS             454555..455910
                     /gene="SAH1"
                     /locus_tag="FOA43_003433"
                     /note="BUSCO:EOG09341QBF"
                     /codon_start=1
                     /product="S-adenosyl-L-homocysteine hydrolase"
                     /protein_id="XP_038779612.1"
                     /db_xref="GeneID:62196833"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="InterPro:IPR034373"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00670"
                     /db_xref="PFAM:PF02826"
                     /translation="MSSPPTQPYKVADISLAAFGRKDIELSENEMPGLMYIRKRYGDS
                     QPLKGARVAGCLHMTIQTAVLIETLVALGAEVAWSSCNIYSTQDHAAAAIAASGVPVF
                     AWKGETEEEYIWCIKQELFAFKDNKPFNLILDDGGDLTKYVHDHHPELLKQCYGLSEE
                     TTTGVHNLYRMVKNNTLKVPAINVNDSVTKSKFDNLYGIRESLIDGIKRATDVMISGK
                     TAVVCGFGDVGKGCAAAFRGMGAKVIVTEVDPINALQAAMEGYPVETMDDVASIGQIF
                     VTTTGCRDIIIGRHFDKMREDAIVCNIGHFDVEIDVAWLKANAKDVVNIKPQVDRYLL
                     SSGKHIILLADGRLVNLGCATGHASFVMSCSFSNQVLAQIALFNTDNKEFKLKFPEFK
                     ETGSFKVGQVDILPKILDETVARCHLDHLDVHLTTLTNDQSEYLGVPKSGPYKADFYR
                     Y"
     gene            <456390..>458252
                     /locus_tag="FOA43_003434"
                     /db_xref="GeneID:62196834"
     mRNA            <456390..>458252
                     /locus_tag="FOA43_003434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923685.1"
                     /db_xref="GeneID:62196834"
     CDS             456390..458252
                     /locus_tag="FOA43_003434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779613.1"
                     /db_xref="GeneID:62196834"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="PFAM:PF00622"
                     /translation="MTSTNMFYRQESLLGEVVNAECSTRITKTQKFTALPSYVLKLEY
                     GYILNKELKYLKMYHQAGLPKESARLETITRLSSMGILGCNPSLYIENHDDAYLNQII
                     NMFESRGERLRKAKSLEDEGSIADNEGDAEALNLDDIIHDDGTTTSTTADNVKKADDD
                     STVKPLIRGSDIGCVELPLPTRWKASADSPFDVSGDGLEVSTRNLVNPADDNTEHSNS
                     SGPSGTIGFNSGSRAGFFSVTSDEYVRSDMGIYYYEVEVVFGLNSRSDISVGFVNVAN
                     NSGVVDLRGITDGTWGYNGKDGKLTHHKFGKVNSQACCEFGNGDTVGCGINFGRKKIF
                     ITKNGVFLGEAFDISDNYRKLFPSISLSQWNSVRTNFGVDPQRAFMFDIDGYVQCFKN
                     EEAKMIEDSPLKSFSLEKGRGRREDQDLKVVVNRGIGLYLKNMGYLDSLKAFNEDLGD
                     QRDLVDGIDSDLKACEVKKHFRALLINDQIYEAERFLSERDSETMMACSKQFSCLKLA
                     RLIMDQKINEAVEMSRQLKKSFSNCDTNLEMIKNVMNYIYYTDPQSSRALKEFYTTER
                     MKLGDDVCFLMKIGSHPGKYTPLEHLLLHTGENLEKIMRDKRARLINLNDYLEL"
     gene            complement(<458282..>458797)
                     /locus_tag="FOA43_003435"
                     /db_xref="GeneID:62196835"
     mRNA            complement(<458282..>458797)
                     /locus_tag="FOA43_003435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923686.1"
                     /db_xref="GeneID:62196835"
     CDS             complement(458282..458797)
                     /locus_tag="FOA43_003435"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779614.1"
                     /db_xref="GeneID:62196835"
                     /translation="MSFVNRGLIRSFKYGKQPQLYIHEISKDLVKASFSSNPSKLEVG
                     TFSGIPPLPNMESQLAISTKNFVPNKDFFNLLQGVFNKHVYEDEAYKLDALNFTSSYL
                     PIGDYKVVLQFMNQRPEYENTLGFVRVNGDGIMIKDSYQANDIYELCNSDGIVTLSDF
                     MLKELQKQLKE"
     gene            complement(<458927..>459679)
                     /locus_tag="FOA43_003436"
                     /db_xref="GeneID:62196836"
     mRNA            complement(<458927..>459679)
                     /locus_tag="FOA43_003436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923687.1"
                     /db_xref="GeneID:62196836"
     CDS             complement(458927..459679)
                     /locus_tag="FOA43_003436"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779615.1"
                     /db_xref="GeneID:62196836"
                     /translation="MNNQVLIVGSRKTKKLTIAKKIFHASKLDHYASHSGIIITGLPV
                     ETRYYKAEVRLFIDEVSESKFAGYQEWFEQFQDTDMKELRDSIGGLIITVDMKCLDND
                     LSKFSEQLEQITGQMDDEFLEGSEDDKKFQWEGFKVVIGVKNGEYAIAEAQMSDIEYS
                     ILAAGFLFISVNENNEGLEQLVSVIENNQWPSMERKSITKPQIKIEDNSQELGILLER
                     IRRAKLLASSIDDKERKETYAKTAMEELMKDL"
     gene            <459889..>462429
                     /locus_tag="FOA43_003437"
                     /db_xref="GeneID:62196837"
     mRNA            <459889..>462429
                     /locus_tag="FOA43_003437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923688.1"
                     /db_xref="GeneID:62196837"
     CDS             459889..462429
                     /locus_tag="FOA43_003437"
                     /note="BUSCO:EOG09340KI9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779616.1"
                     /db_xref="GeneID:62196837"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="PFAM:PF04091"
                     /translation="MAATTAKIDGPLPGNSDGIAVSPQKPSNSLMQYSVTSDDYLDQF
                     IPFIKAELREKDSLDDLVTNLEKTSQEKQSTLEGLSFDSVDDLTTSMDKIKTIVQTSS
                     QLSTDLSSINRELNNTGQAFAREKKMALHYKKIYSKINETSLTINSCLDMLEKTNKIL
                     ELIQNKEFYKALINLESLARVDFEEIEQFDFSVRIYNSIPTFKKMIIEETFNQLIKWM
                     NLSVEKKLPQVGEVLYETCRAVNESWLSRQSNDPELLKFKVNSPIEISLREDQLKYFN
                     PFEKGQVQIELGPLFHSILVAESVNELDKLREDFLNEILRRRDRLIYPIREAITNNNF
                     EMLSNLESLKILMYSMIAFLVTDRYISGKTRYKVRSKKQAEDLFDSIMTKLVPLLELC
                     LVKFTTTLDNAVEICDIVGCFLQISEYWGYDCRKLYDVMLSLFKLYIRLSVAQFLDDY
                     MGLSLEDDSQPLTVDSRKQFETVTNNCFYKFEDKDFTFPKTLPYSVIYPGGCLRLRNF
                     IHDLYKFLEKYYGKRLDSVSQIISSAVDQVLIDIILKDLDNKVHSSYKEEMSQNLINL
                     EFFSNSVYEIEKYLNFSSEPVIIKSRTASTMIKLKAENAFKATRRRAEDGMFEMVDSK
                     VDMLFDMVNFEWNSTTINEEPSISIKDMGLYLENMFKLDFSHLPYSMRTLLLIRSFDK
                     ITTHLKRSIFEADSITKEGVQNFEIDIDYIESLIQSLKGWGGHVTEVVGYEGDKANEA
                     LATMFVGLKQIVDLFKDGNLENYKDKSMRTTRFSSIKPEQAQTLVNKLEDYQIAQQKM
                     LMMDRATPYSRSASGTPSSPTLEGGDQTHSMFSGLKRQATINGISFKK"
     gene            complement(<462474..>462994)
                     /locus_tag="FOA43_003438"
                     /db_xref="GeneID:62196838"
     mRNA            complement(join(<462474..462894,462987..>462994))
                     /locus_tag="FOA43_003438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923689.1"
                     /db_xref="GeneID:62196838"
     CDS             complement(join(462474..462894,462987..462994))
                     /locus_tag="FOA43_003438"
                     /note="BUSCO:EOG09344428;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779617.1"
                     /db_xref="GeneID:62196838"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="PFAM:PF06417"
                     /translation="MKMVSTDNRRTNKKHKQKDEALESLKMKKLWEMAIQPSKNIPMN
                     AIMMYMTPNSIQIISIMMMVMLFVGSLKDIFAVQKKFKNAQVNSRYDFFVLKGIYVLC
                     CSGNLLVGLWKLNAMGLIPNQSSDWLTWETKLGNDQTVVL"
     gene            <463156..>463572
                     /locus_tag="FOA43_003439"
                     /db_xref="GeneID:62196839"
     mRNA            <463156..>463572
                     /locus_tag="FOA43_003439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923690.1"
                     /db_xref="GeneID:62196839"
     CDS             463156..463572
                     /locus_tag="FOA43_003439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779618.1"
                     /db_xref="GeneID:62196839"
                     /db_xref="InterPro:IPR014612"
                     /db_xref="InterPro:IPR020241"
                     /db_xref="InterPro:IPR036882"
                     /db_xref="PFAM:PF12328"
                     /translation="MGVQSKLPRVKDKRLVKHAPPRVYHQNEGSHVVYVKSSTPFVSA
                     IKRIERCLDGFRPVPNRRGKYVAKSGKHIKYIEVKGMGWAMSKVMNLGLHFKYEKQLK
                     VEVYTKTIGVFDEFVGSDDETFQKRNVSSVELHIMI"
     gene            complement(<464271..>464705)
                     /locus_tag="FOA43_003440"
                     /db_xref="GeneID:62196840"
     mRNA            complement(<464271..>464705)
                     /locus_tag="FOA43_003440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923691.1"
                     /db_xref="GeneID:62196840"
     CDS             complement(464271..464705)
                     /locus_tag="FOA43_003440"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779619.1"
                     /db_xref="GeneID:62196840"
                     /db_xref="InterPro:IPR001602"
                     /db_xref="InterPro:IPR035917"
                     /db_xref="PFAM:PF01894"
                     /translation="MSSWEQVKFSFSPRARGCYLVTEEVVRSLPQLRDYNVGMVNLFL
                     QHTSAGISLNENCDPDVRSDMTTALNNVVPDDNGRIFDHVDEGPDDMSGHAKASIIGV
                     SLNIPIKDGRLALGTWQGIWLMEFRNYRHTRYCLATIQGLKD"
     gene            complement(<465843..>466976)
                     /gene="ADH4_2"
                     /locus_tag="FOA43_003441"
                     /db_xref="GeneID:62196841"
     mRNA            complement(<465843..>466976)
                     /gene="ADH4_2"
                     /locus_tag="FOA43_003441"
                     /product="Alcohol dehydrogenase adh4"
                     /transcript_id="XM_038923692.1"
                     /db_xref="GeneID:62196841"
     CDS             complement(465843..466976)
                     /gene="ADH4_2"
                     /locus_tag="FOA43_003441"
                     /codon_start=1
                     /product="Alcohol dehydrogenase adh4"
                     /protein_id="XP_038779620.1"
                     /db_xref="GeneID:62196841"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF13602"
                     /translation="MFSTFTRTATKSRLPSLLRLQSTFKIPEKQMGVIFYKHGGPLEY
                     KELPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPAKLPLVGGHEGAGVVVAKGSA
                     VTNFELGDLAGIKWLNGSCMSCEYCENGDEPNCAKADLSGYTHDGSFQQYATADALQA
                     AHISEGTDLAQVAPILCAGVTVYKALKTADLKAGQWVAISGAAGGLGSLAVQYAKAMG
                     LRVLGIDGGDAKKELFRSVGGDVFIDFKNYSKNETEKMNEDIRKATNGMGPHGVINVS
                     VSESAITQSTQYVRPTGKVVLVGMPSGAVCKSDVFNHVVKSIQIRGSYVGNRADTREA
                     LQFFSAGQVKSPIKIVGLSEIAKVYELMEQGKILGRYVVDNSY"
     gene            complement(<469295..>470800)
                     /locus_tag="FOA43_003442"
                     /db_xref="GeneID:62196842"
     mRNA            complement(<469295..>470800)
                     /locus_tag="FOA43_003442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923693.1"
                     /db_xref="GeneID:62196842"
     CDS             complement(469295..470800)
                     /locus_tag="FOA43_003442"
                     /note="MEROPS:MER0014430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779621.1"
                     /db_xref="GeneID:62196842"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="PFAM:PF04258"
                     /translation="MDSVLNLISEYSPFPVNSSLNTTREYARGLSKEIAFILLDNETL
                     RSVIHPVVIFYVSMSIVAATLIAIGSYATIEKPANAIDPNPNHPLFDQSDKDRTLVPD
                     ASISTSTAAFMPLIAGIGLVSLYFLIQHIDKDKLAEFLSNYLLVAGYSADSFTLSFVY
                     KVICRKLAYWTGKSSLTFNPRYNMTFSKDSMVHPAGLEPGMLLPETSEEEKIIKEEAL
                     LSARNSVAKEDQLFNVYFTKGDIYSNALSCLLTLILLLLDYNSNWVLRNIASSLLAIY
                     GIAKCRLTSFKVAITVLVLFFAYDIYFVFGSDIMMSVATNIDIPVKLMIPNSASRTEG
                     TVQLSLLGLGDIILPGCVIALCLRFDLYIFHEKNPNTEFHHLQSYPKPYFYDALIFYS
                     LGLAATCSAMYVFEQGQPALLYLSPSLLIAIFVTAGVKGELRTLWDYQEDTDTDIFKK
                     DKDIEIDILCSKETLYLAGKIDDKEEEEEEEEDEDYEPEEVDDDEEEAYDI"
     gene            <471489..>472979
                     /locus_tag="FOA43_003443"
                     /db_xref="GeneID:62196843"
     mRNA            <471489..>472979
                     /locus_tag="FOA43_003443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923694.1"
                     /db_xref="GeneID:62196843"
     CDS             471489..472979
                     /locus_tag="FOA43_003443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779622.1"
                     /db_xref="GeneID:62196843"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF02353"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /translation="MSNLAELKTFDCGCRTTSYPAIKNAPLPADGGGAKNFSNKMLFA
                     IMLIVPFYVTRRLGLGFKSFIFFGLLFALPILLTYWTVLSTYSPRLNEKVKFPNRGVE
                     FYLDFHDPSLAAKYHGSHKIPMETFHQLYFAGQVSFKGDALDVMEYRHDWAQFSFTLS
                     LFKFFLFGFIPEVIMHTRSQDEEQVRDHYDRGDDFYEWFLGPRMIYTSGIIHDIHSEE
                     SLEQLQDNKLKVVCEKIDLKKGETVLDLGCGWGTFACFASTQYGAKVTGITLGRNQTK
                     FGNAKLASYHVPASQSKVICCDYRDTPLPKPNPDGSAAKYDKIVCLEMAEHVGVRKFA
                     AFLQQVYDMLDDDGIFFLQYAGLRKSWQYEDLIWGLFMNKYIFPGADASTPLDFVVSS
                     LEATSFETVSIDNIGVHYSATLYRWYKNWNANKEKIVAKYGTKWFRIWEFFLSYSTII
                     SRQGSAACYQIVLRKNLNSYHRIEYVPRQEGLQACASRFQSWAKED"
     gene            complement(<473062..>473874)
                     /locus_tag="FOA43_003444"
                     /db_xref="GeneID:62196844"
     mRNA            complement(join(<473062..473579,473871..>473874))
                     /locus_tag="FOA43_003444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923695.1"
                     /db_xref="GeneID:62196844"
     CDS             complement(join(473062..473579,473871..473874))
                     /locus_tag="FOA43_003444"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779623.1"
                     /db_xref="GeneID:62196844"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR036908"
                     /db_xref="PFAM:PF03330"
                     /translation="MQSYGTYIANSTSFDNGTATTTSDITASSSSIQFSLTEEEATPS
                     ATSSEASSIPNSPVSTTSSTLASQATGDAKTGRGTFYEVGNDNCGTSSTDEDLVCAIA
                     KSLYDSSASSDSISTYCGEYITANYDGKSVRVKVVDSCESCAETDLDFSPSAFQQLAD
                     LDIGVIEITWNWD"
     gene            <476564..>477667
                     /locus_tag="FOA43_003445"
                     /db_xref="GeneID:62196845"
     mRNA            <476564..>477667
                     /locus_tag="FOA43_003445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923696.1"
                     /db_xref="GeneID:62196845"
     CDS             476564..477667
                     /locus_tag="FOA43_003445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779624.1"
                     /db_xref="GeneID:62196845"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="PFAM:PF05063"
                     /translation="MAPINRNPGVGNSSKPYQLSSISPLMFSPHGYSMKSGDGHKLVA
                     IKRAASHQSSYANNKMTMNPKMPMYHMNPTTISCYKNDYSNHYIHSGVLPVGYIRNAK
                     QQVDGYPKLQKLYRLKDQQVRKYATLPFGARVKTEDLIPTLNSWVYDYHLQFDVIMIG
                     ALSENQLLYPVVSQLPIDKLCAKPGFLFIWASTQKISELSRLLSDTNSWARRFRRSEE
                     LIFVPIDKNSPYYPGDANIPEKQVLEEIQWHCWMCITGTVRRSTDRELIHCNINTDLA
                     IENEDTDNSCVPSQIYKVAENFSNSTRRLHIIPAATGLNHPVKVRPGWVILSPDVILD
                     NFDPIRYQKELGKVGLRVPLDSDIEQLRPKTPN"
     gene            <478111..>478630
                     /locus_tag="FOA43_003446"
                     /db_xref="GeneID:62196846"
     mRNA            join(<478111..478180,478263..>478630)
                     /locus_tag="FOA43_003446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923697.1"
                     /db_xref="GeneID:62196846"
     CDS             join(478111..478180,478263..478630)
                     /locus_tag="FOA43_003446"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779625.1"
                     /db_xref="GeneID:62196846"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR036020"
                     /db_xref="PFAM:PF00397"
                     /translation="MSSKDKKPLVPHGWVAIWDDKYQEWYYVNEKTENSQWEPPEGTK
                     LPKVPPPPSHPPSSAKNVDATTAQQQYHPQQQLQQQPQYTQQQPQQQVQQETTTSSGP
                     GYGGVAAGAMGGMLVGSVMARNRMRRTAMIGAAARRPAMRRRR"
     gene            complement(<478792..>480653)
                     /locus_tag="FOA43_003447"
                     /db_xref="GeneID:62196847"
     mRNA            complement(join(<478792..479970,480648..>480653))
                     /locus_tag="FOA43_003447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923698.1"
                     /db_xref="GeneID:62196847"
     CDS             complement(join(478792..479970,480648..480653))
                     /locus_tag="FOA43_003447"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779626.1"
                     /db_xref="GeneID:62196847"
                     /translation="MMTDLSHSRGHETSSVKRSCFRKSQFLIQRNNIPVTKSLNISSE
                     NDDKDEGDNGIEGFSDYKADSRRPLIKSLSVISAPLDDYQVSRAVAQYSDSEIDDDEC
                     FSKGDQCTSKRRKSSIGVTRMHCHRDISTSRVTRVSTSFSTADPTLRCSSVSSSIATP
                     PFAKYSLLSSDLISSLPKSSKEMDRYSLSPSPCCRSRNSLPDLDFTARSRCFDYLVGA
                     IDEAWARYCNATSHDEEVAYGYEQDDGDSQHANANRVRSILSCQSCKCGGESNSLASS
                     DEDDYGTEFSASTSITDYDSDVCNDTRKVPPKQQHYRVSEVPENMRLQKLKDRLIKAK
                     YYLQDYVDSEEVDDSLLFWKKWDLIKYSAIELVEDDDEDDIVETTIEELEYGRFAASI
                     CA"
     gene            complement(<481497..>482639)
                     /gene="BAT1"
                     /locus_tag="FOA43_003448"
                     /db_xref="GeneID:62196848"
     mRNA            complement(<481497..>482639)
                     /gene="BAT1"
                     /locus_tag="FOA43_003448"
                     /product="Mitochondrial branched-chain amino acid (BCAA)
                     aminotransferase"
                     /transcript_id="XM_038923699.1"
                     /db_xref="GeneID:62196848"
     CDS             complement(481497..482639)
                     /gene="BAT1"
                     /locus_tag="FOA43_003448"
                     /codon_start=1
                     /product="Mitochondrial branched-chain amino acid (BCAA)
                     aminotransferase"
                     /protein_id="XP_038779627.1"
                     /db_xref="GeneID:62196848"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="InterPro:IPR033939"
                     /db_xref="InterPro:IPR036038"
                     /db_xref="PFAM:PF01063"
                     /translation="MSSTTTAPAALDASKLVIHKTSTPKEKLPNEKLVFGRSFTDHML
                     TIPWNRTAGWGTPVIKPYAPLTLDPSAVVFHYAFELFEGLKAYRDPKGQIRMFRPDKN
                     MIRMNKSADRICLPTFENEELITLIGELLKVDSSFIPSERGYSLYIRPTMIGTTPGLG
                     VHTPDDALLYVICSPVGPYYSTGFKAVRLEATDYAVRAWPGGVGDKKLGANYAPSVKP
                     QLEAAKRGYQQNLWLFGPEKHVTEVGTMNFFIAFKDSNGVKELVTAPLDGMILEGVTR
                     DSILALCREKLDKKEWKVNERYCSISEIEERAKKGEVVEAFGSGTAAVVSPVKEIGYN
                     SEHISIPILPGEEAGALTKQIAEWIAQRQYGIVESDWSRIVKEQTS"
     gene            complement(<483197..>484561)
                     /locus_tag="FOA43_003449"
                     /db_xref="GeneID:62196849"
     mRNA            complement(<483197..>484561)
                     /locus_tag="FOA43_003449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923700.1"
                     /db_xref="GeneID:62196849"
     CDS             complement(483197..484561)
                     /locus_tag="FOA43_003449"
                     /note="BUSCO:EOG093428PK;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779628.1"
                     /db_xref="GeneID:62196849"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /translation="MPLNYLGTLLVDGTDKTPGWFYIKNYGTPLLAAVLAKMYLNGSS
                     NTWQRDLHGKVYIVTGGTSGIGAPLVRELALRGAQLVLLTSQLKSDNSGAVWVTDYVD
                     DLRNSTDNPLIYVEECNLSSLYSVRKFATKWLDNRTARRLDGVICLASERMPIGKSRQ
                     VSVDGVEMQMAINYLGQYHLLTLLEPCLKAQPPDRDVRVILATCMSQSIGTLDLDDLL
                     WEVKRYPSGRPWKMYGSSKLMLHMFAKEYQKRLENAGRKDKQPCNIRVNVVNPGITRT
                     PSTRRAISMGSVLGLLVYLLLYPFFWIVLKPCEYGMQSFLYALCCPDLIDISGGQYIR
                     ECSVVKTKLRKELQDDELQKNLYDLTARKISELEKKSAIERNRGKPDGNKKKDKRQKK
                     DEMQKKDKKGLTEEDKRGIFMSAFDTEDELQNYKARNANTDDAHSTQLRRLDEKYEAT
                     HKKS"
     gene            <484753..>486174
                     /locus_tag="FOA43_003450"
                     /db_xref="GeneID:62196850"
     mRNA            <484753..>486174
                     /locus_tag="FOA43_003450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923701.1"
                     /db_xref="GeneID:62196850"
     CDS             484753..486174
                     /locus_tag="FOA43_003450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779629.1"
                     /db_xref="GeneID:62196850"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /translation="MDEIAFYCCSGDATDKHDANSFAYLSSLHSSKQYLQYRQCYSGR
                     NGSVLTGIGQETKLISACNDRAIIQVYLYGKESPEQKIPIPEPLSCLEICDDWLLVGG
                     GQSGRIYVWELDSGLLLAVKECHYQAVNVIRYNKGFLVSGGADSRVVIWRILDLANDS
                     INPAKPYSILTDNTLPVTDLVITNGLVSDLKVYTASRDCTVRCYSIASKRLITTFVLP
                     TKVESLAADPAYRALYAGQDDGFIRMIPLYRGNVKTHVLEAVGGMGSIVTLKPDLDLQ
                     ETFVCHKDDGNGQTIVTKLQVTLDGTYLVSGDSKGNVFVVDIATKQIQRKFKPLAGAV
                     SQILLAYTKADNKQLDRHYNDKNMVRVIPTLKRVVVDANAIEKHEIQKKLGELQPPYF
                     GEQKFDMNRFLEDVKTQQMWFTNLSDIDSTVIRQGSENLFANGKAAGELTVLKTQLEQ
                     KNAAYTTLKEKYEQLYKEHINGL"
     gene            <486594..>488396
                     /locus_tag="FOA43_003451"
                     /db_xref="GeneID:62196851"
     mRNA            <486594..>488396
                     /locus_tag="FOA43_003451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923702.1"
                     /db_xref="GeneID:62196851"
     CDS             486594..488396
                     /locus_tag="FOA43_003451"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779630.1"
                     /db_xref="GeneID:62196851"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MTSGYGKEVTLKESSAGESTSEESTHLETGLGERDLLASFRDVS
                     VARSLASTTSDIGRVPTNKSILYLDPEQRPPIFKSTFQEYICVALFTFAPAAASMGSA
                     CFQTSLSVTSQYFGIDGGVLTWCVNSIMLANGGCMLLMGGIADALGRRNSLIIGFFSY
                     ALFSLIAGFMKNFAVLCILRALMGAAVACATPAAAGFLGSTYKDSKRKNMAMSIFALG
                     SPVGGASGYIIAGVCIIAFNWRAVQYFLAILFGFCSIGVVLFMPDDETRMQGIHASQI
                     FRHLDYGGSFISLAAFTLICFSLTQVDAATDGWGTPYIIALLVVGIVLIPVFVLYEMH
                     IPSQPIMPMALFKSWNFDLCMIISTFSWINFQGVLNYYSIVYFEMIRGYSAILTACCL
                     LPQPICGIFANIFAGLTMHKIPGRIFIFVGCLGFLIASIIWATFPIDRNYFLGPFWAF
                     IVCVLGADFIYNVANRCSLGLVEKEVQSRAAGTFNTIIQLASSVGLGLSSTIVSSKYS
                     LYGTSEQNDHKQEFWNAIRYAFYFGIALSGISLILSLFLRIGVIGAISGPDKDDYEEQ
                     HKQDRVADFVPALYSGKNASEEGAASQNMLNDTI"
     gene            <489116..>490894
                     /locus_tag="FOA43_003452"
                     /db_xref="GeneID:62196852"
     mRNA            <489116..>490894
                     /locus_tag="FOA43_003452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923703.1"
                     /db_xref="GeneID:62196852"
     CDS             489116..490894
                     /locus_tag="FOA43_003452"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779631.1"
                     /db_xref="GeneID:62196852"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MVYPELEELSDLDEFGSEVDLGNPCVLAESPQTSDAESFTSDIF
                     DIGRVPTNKSVLYSDPEQRPPIFKSTFQEYICVAVLTFAPAAATMASSSFRTSLQATS
                     QFFNVDGGILSWCVNSVMLANGACLLLTGGMADALGRRNSLIIGYFSYAVFSLIAGFM
                     NNFVVLCILRALMGAAVACATPAAAGFLGSTYRDSKRKNMVMSIFSLGAPVGGASGFF
                     IAGVCIEAFNWRAVQYFIAILFCLLSIFVVFFMPDDETRMQWDRAGQIFRHLDYGGAL
                     ISLTAFTLICFSLSQVDATADGWRTPYIIALLVVGLALIPLFVIYEIHVPKESLMPMI
                     LYESKNFDLCMIISAFSWMNFQGILNYYSIIYFEMIRGYSAIITACCMLPQPFCGVLF
                     NIFAGLNMHRIPGRILVFVGCLGFLASSIIWATLPIDRNYFLGPFWAFLISVLGADFI
                     YNVANRCSLGLVEKEAQSRAAGTFNTIIQLASSVGLGLSSTIVSSKYSLYGTAQEYDH
                     KEELWNAIGYAFYFGVALSGVSLILSLFLQIGVVGAITGSDKDDDEKRKEQQHKQVEV
                     TDSVPALCTENAINENVPNHTNHTAP"
     gene            <491733..>493496
                     /locus_tag="FOA43_003453"
                     /db_xref="GeneID:62196853"
     mRNA            <491733..>493496
                     /locus_tag="FOA43_003453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923704.1"
                     /db_xref="GeneID:62196853"
     CDS             491733..493496
                     /locus_tag="FOA43_003453"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779632.1"
                     /db_xref="GeneID:62196853"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MALEQREQASSEEYTSSETVLGERDLSPTVAGSIASVESDIGRV
                     PTNKSILYPDPEQRPPIFKSTFQEFMCVALVTFAPAAASMGSSAFQTALSATSLYFNV
                     DGGVLTWCVNSITLANGGCLLLMGGVADALGRRNSLIIGFFSYALFSLIAGFMKNFAV
                     LCILRALMGAAVACATPAAAGFLGSTYKDSKRKNMAMSIFALGAPVGGASGFFIAGVC
                     IAAFNWRAVHYFLAIIFCLFSVGVVFFMPDDETRMQWGRAGQIFRHLDYGGSFISLTA
                     FTLICFSLTQVDAATDGWGTPYIIALLVVGIALIPVFVLYEMHIPSQPIMPMALFKSW
                     NFDLCMIISAFCWINFQGVLNYYSIVYFEMIRGYSAIITACCVLPQPIAGVCVNIFAG
                     LTMHKIPGRILVFVGCLGFLTASIIWATFPIDRNYFLGPFWAFIVCVLGADFIYNVAN
                     RCSLGLVEKEVQSRAAGTFNTIIQLASSVGLGLSSTIVSSKYSLYGTSEQNDHKQEFW
                     HAIRYAFYFGIALSGISLILSLFLQIGVVGAITGSDKDDDEKRKEQQHKQVEVTDSVP
                     ALYAENAIIENAPNHNDLSVP"
     gene            complement(<493553..>493963)
                     /locus_tag="FOA43_003454"
                     /db_xref="GeneID:62196854"
     mRNA            complement(<493553..>493963)
                     /locus_tag="FOA43_003454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923705.1"
                     /db_xref="GeneID:62196854"
     CDS             complement(493553..493963)
                     /locus_tag="FOA43_003454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779633.1"
                     /db_xref="GeneID:62196854"
                     /db_xref="InterPro:IPR013957"
                     /db_xref="PFAM:PF08648"
                     /translation="MGKIRINLKPSEKDEVDKKLERTPIKYRERETRGRGRVKETNLE
                     KRGRKPPGEDKDRDLIDDTSKIDEIKKLMGFSGFGTTKNKKVEGTDCYGVKKIQRAEY
                     RQYMNREKGFNRPLSPTREDIKGRKLHEKKKNKD"
     gene            <494134..>494784
                     /locus_tag="FOA43_003455"
                     /db_xref="GeneID:62196855"
     mRNA            <494134..>494784
                     /locus_tag="FOA43_003455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923706.1"
                     /db_xref="GeneID:62196855"
     CDS             494134..494784
                     /locus_tag="FOA43_003455"
                     /note="BUSCO:EOG09344HLO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779634.1"
                     /db_xref="GeneID:62196855"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MPQITKLSKKQLKALKFKSKTSEKAASQLEEIEVKKKQAEEASL
                     KPKKKRKTRRGHHGKGKNGSNSGSRFLLFVGNIPYDIGEKELREHFKAGKPDIVRVRK
                     DKGIAFLEFLGENGHIQGRIDACLALHHSLLEKRKINVELTAGGGGNSVNRVDKIKTK
                     NDKLMKERIDKIQKERAKQQKSNEKGDDEDEEATKAALEANNGIHPSRLAMIEKDN"
     gene            complement(<494926..>495618)
                     /locus_tag="FOA43_003456"
                     /db_xref="GeneID:62196856"
     mRNA            complement(<494926..>495618)
                     /locus_tag="FOA43_003456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923707.1"
                     /db_xref="GeneID:62196856"
     CDS             complement(494926..495618)
                     /locus_tag="FOA43_003456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779635.1"
                     /db_xref="GeneID:62196856"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /translation="MKSIKCVVVGDGAVGKTSLLISYTTNQFPEDYVPTVFDNYSANV
                     MVDNEKVTINLWDTAGQEEYDRLRPLSYTQTDVFLICFSVVEPSSFSNVKNKWIPEIR
                     HHTPKDTLVILIGTKSDLREDPHVLDQLEENGEQPINAQGAEAEAKELGCAGYMECSA
                     ASQQGVREVFDFAIKAVISPETVKGADKVAEKTVDSAAKPGRATGNERTLGHKKRSRL
                     SRVAHSKKCLIL"
     gene            complement(<496018..>497343)
                     /locus_tag="FOA43_003457"
                     /db_xref="GeneID:62196857"
     mRNA            complement(<496018..>497343)
                     /locus_tag="FOA43_003457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923708.1"
                     /db_xref="GeneID:62196857"
     CDS             complement(496018..497343)
                     /locus_tag="FOA43_003457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779636.1"
                     /db_xref="GeneID:62196857"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01266"
                     /translation="MSLFPEEPKLDPETTRIVVVGCGVFGLSTILALTNKGYREIIGL
                     DVSKVPSPRSAATDYNKMLRVEYANILYAKLSVEALRSWENDPLFKPYYKKVGRLVLS
                     PYKEENKARLIYDKIGAENVKKLGVDQRIVELRSSSEIGRLIPGFKDNQLSNPLVARY
                     KIDSALGESGKSLAGVYHECAKRGVKFIFGDGGHAIKIEEGKVIAKNGDVYLADKIIV
                     SSGANTSALVDLNASVTAVGHFVSHVQLNDAQYDKYKKIPIFFSSEYGYFFPPDPKDH
                     VIKIGHTFADARNFIKNPFNKAQTTSIPSYIHDAPTIVEEATKRLMNLVIPELAYNPV
                     VNCTIGWTSLSYDENFIIDYATQSKSIIMCTGDSAHGYKFLPNIGKYIVKRMEGTLDH
                     EHASAWRFRQATWSAMTVSERTERTSYDVRNVRHWIRGQPEPLPASAKL"
     gene            <497693..>498553
                     /locus_tag="FOA43_003458"
                     /db_xref="GeneID:62196858"
     mRNA            <497693..>498553
                     /locus_tag="FOA43_003458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923709.1"
                     /db_xref="GeneID:62196858"
     CDS             497693..498553
                     /locus_tag="FOA43_003458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779637.1"
                     /db_xref="GeneID:62196858"
                     /translation="MAYGFRVISDLPTIENTQPVESYRATSPRFYRDKDQTLLHYGSD
                     VWYLSAECRAVSKNGSITSVKLPFTDHLEISYQSLQKDGTVIVSRQSDDAVLMTFPIW
                     IFVLNESLLLHFDFHSIPSGLTLSVSYDSVVSCELNDKMTKLCLSVDNGPLGTCEFIC
                     YPRADGQVKYSLFLPFSDMPTRQALELAYAGISECIAQEYRSKRADDEDDNEDVRVTS
                     GSEMRMLPEEVMLDDSGQADDETNDILIDAGSPEGNSAMDVELDGGHVAGIKRGRGNT
                     TLDHKYRRLT"
     gene            complement(<498615..>500195)
                     /locus_tag="FOA43_003459"
                     /db_xref="GeneID:62196859"
     mRNA            complement(<498615..>500195)
                     /locus_tag="FOA43_003459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923710.1"
                     /db_xref="GeneID:62196859"
     CDS             complement(498615..500195)
                     /locus_tag="FOA43_003459"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779638.1"
                     /db_xref="GeneID:62196859"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="PFAM:PF00320"
                     /translation="MTKPRFLDSESVASAATALQDMKSKKRSFEESQFFDKTTTSPEN
                     FCYSRSLKLCSHQSKRAKTAPSSPIAYAPPTKVLFPVTPNMKCPELPITPPSIINQGS
                     TIAFNSFKTNPITAQAPTTGASNSFSELSAASSASQSPATPPPSVDSSPRGFPKIMKL
                     GRKPLTTIPESAYFYPDTCYSFSLLNTSANIPDRNRRASFLEHQNQEWRDYYKNEISH
                     SNARLYKKYRSYCEGLKMTESAVTKMKNTGSSNYRSLLPTASKLTTFVDSQYNRYDGL
                     VNYPYASNYRYQSTGYLHDAEVLTRSPELYGQHSAKGYFASGDYQSQEPRGYKLPPLS
                     QVLKMPHETIPPLAYSPENMPMAVRPRINISSQASSPTRHVSKFINTSLTSPKSSGSM
                     PTDTTTTTTIITSPTGSSTSRRSSSSHRRHSHSTYSHRIQRRCISCHSTQSPCWRPSW
                     DPEKGQLCNSCGLRYKKTKARCMNPNCLRIPAKGEWTLMKNRGKILLPVYNDDGDEIN
                     KHHTYKCLHCDGEVAVEE"
     gene            <501436..>501967
                     /locus_tag="FOA43_003460"
                     /db_xref="GeneID:62196860"
     mRNA            join(<501436..501856,501948..>501967)
                     /locus_tag="FOA43_003460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923711.1"
                     /db_xref="GeneID:62196860"
     CDS             join(501436..501856,501948..501967)
                     /locus_tag="FOA43_003460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779639.1"
                     /db_xref="GeneID:62196860"
                     /db_xref="InterPro:IPR019488"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="PFAM:PF10429"
                     /translation="MQNLRMTPQYPTGPQSQAQDPDMKVEEFLRTITETLDSPYRNEA
                     ADYYKSMILPQLLPQSRIIINGQPFGSKAQFQELWSTLPATQHQITSFDAHLLPTPEE
                     RQYIVLAHFKVRFDESGKNRFGQTADVLPIPDNNLNRPTRLTTG"
     gene            complement(<502086..>503450)
                     /locus_tag="FOA43_003461"
                     /db_xref="GeneID:62196861"
     mRNA            complement(<502086..>503450)
                     /locus_tag="FOA43_003461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923712.1"
                     /db_xref="GeneID:62196861"
     CDS             complement(502086..503450)
                     /locus_tag="FOA43_003461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779640.1"
                     /db_xref="GeneID:62196861"
                     /translation="MEEQANNGDTYRKEDSENLGGDGSECSDAINSKIGFSTDTTSTF
                     VSKAFQTAVSPFSWQRTHGQAEELFNNTGSYQKSQPSSVKETMNRLPEKAFSPKKSTS
                     SSLKNNKSSSSTGVSSISELKSIEHARKQLRERSSYTTFKILSIIALLLFLPPILSLF
                     VDLSCMGSSDYCVSHMEMHMDNIAARPEFGRLLVKIAKGIEIISDNAYGGPLKAENIG
                     QFLGSSLNKTGTVYKLNHFGYCRLEKGNPTIEENPEDWFEECHTLFDATDVPSVLLKD
                     IAFEVEYSEGLDFTTSERVSSDMVSLFRKQLFKSHTSESKLVRYASMGLSFSIAFVIL
                     KIVALVFDTAALFLVFGIAVHIKKRTGQISNSKVKGWLILSTGCIIFSTLVQLLTMIF
                     ERAYHEDLSQHLIESSLPIVHHFNYFTSGTVLHIIGLSFQGMIIISMWLLISEKPWIV
                     NVVL"
     gene            complement(<503941..>505215)
                     /locus_tag="FOA43_003462"
                     /db_xref="GeneID:62196862"
     mRNA            complement(<503941..>505215)
                     /locus_tag="FOA43_003462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923713.1"
                     /db_xref="GeneID:62196862"
     CDS             complement(503941..505215)
                     /locus_tag="FOA43_003462"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779641.1"
                     /db_xref="GeneID:62196862"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="PFAM:PF06687"
                     /translation="MKLKALWFKLESPFLNLTPRARLLQIGRFCSSLFVVISIYLLVS
                     VPRSGNHYYMGRLDCSHVDVSNGIFASLQSSLNHPHNSNGDDTFTTTSEISILAQYIG
                     KEVSTAAQFINTNILGWCSGTYSSVEMYNPATSTFELVSEDSANMRCSPLSANYVFDY
                     RGQLSDIGLNIVLSYAYSSNDYSPEAKYVPDKQYRADLKERRQKNQAVIYMLLIAMAV
                     HILIFVLGIIYYGRRGVKKNDKSLPALPKHIFGVAAIVAFLLMFVAFLIDVSVLEEIK
                     KEIKGDLGDFGLSFHLNPAWISVFCIAMLLSFISIFVWGGPIWCAAAPINALDDDNVE
                     EMLVHSYSPDAELCRSSDSEESILNPFADTVSEDYMDMSKNSPMEMTTLTDTDSLSSE
                     DSSTRRVLCGQQTQSDLLLNSKRYRRPTLPPI"
     gene            <505390..>507756
                     /locus_tag="FOA43_003463"
                     /db_xref="GeneID:62196863"
     mRNA            <505390..>507756
                     /locus_tag="FOA43_003463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923714.1"
                     /db_xref="GeneID:62196863"
     CDS             505390..507756
                     /locus_tag="FOA43_003463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779642.1"
                     /db_xref="GeneID:62196863"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF01426"
                     /db_xref="PFAM:PF13191"
                     /db_xref="PFAM:PF13401"
                     /translation="MRQMKGWQYSLEDLDDEGSRVEDTIGPRTTRNTRGRGRRSQRGE
                     SRIILRREMDNMEVKAGDILLIEDKDEDREDDDNEQPSIGLVKDIIFGTDSFLEVRVF
                     WFYRMSEIDSSVLPGGEERFTKNDVFLSPVVDRIMLGTILDSCAVISEKSLATIVIDE
                     STTDTTFVCRRFCDSDGEYFTEAFDWDEMYQRFKENSDDFYQLVKNLTVKPTMKQFTK
                     TLQQKGIDPRSIKNEEKKLKQKQRQQTRKKKANYTESEDDEYDDDDEFYIYDLDAEED
                     DAFDETEEGDDDDFLYSSKPAKGRKKGRPRRKARSSRRGKRSDRLPKLPSVARRLDIN
                     EDGRVLDIDAIFSDEDSREVDISSTKTSKAFRRAKKVLHTSAKIHSLPCREDEFHQLF
                     FSLESAVQSQVGRCIYVSGTPGVGKTATIREVIKQLSASFIAETHHKMFSYVEINGLK
                     VVSPQASYEALWEKVSGKRATASNSLTQLEEYFNKDDTKRKPLVVLLDEMDQIVTKNQ
                     SVMYNFFNWPSYPHSKLIVIAVANTMDLPERMLTNKISSRLGLTRIQFSSYTYTQLSE
                     IIKSRLEKLGRLNEERMVISNDAIAFASRKVASVSGDARRALMICIRAVEIAEMEFLA
                     KPIEERNKLDSRYTVTIMHIMKAVNETASSPIANYLNSLPFMSKMLLAAVLLRTKRTG
                     VAEVTVGDVIDELNNQFHVVLFTELNRRLSEEQLEMARVLYESNNRSQLRPTGIIFIL
                     KDLEENGILIVQHLKLERSRLLRLNVSQAEILSSFKKDSLLKEMVQST"
     gene            complement(<507784..>508590)
                     /gene="SPG1"
                     /locus_tag="FOA43_003464"
                     /db_xref="GeneID:62196864"
     mRNA            complement(<507784..>508590)
                     /gene="SPG1"
                     /locus_tag="FOA43_003464"
                     /product="septum-promoting GTP-binding protein 1"
                     /transcript_id="XM_038923715.1"
                     /db_xref="GeneID:62196864"
     CDS             complement(507784..508590)
                     /gene="SPG1"
                     /locus_tag="FOA43_003464"
                     /note="BUSCO:EOG09343VIS"
                     /codon_start=1
                     /product="septum-promoting GTP-binding protein 1"
                     /protein_id="XP_038779643.1"
                     /db_xref="GeneID:62196864"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR017231"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /translation="MDAYRSVSTRIPRSHSTSEALSEGVGGGRSISSAVDGHSHYDHQ
                     RHHQHNHRDQTSQLQQSQSQQQIHSRTRSAEKNTVTLKVGLIGDAQVGKTSLMVKYVE
                     NCFDEIYTQTLGVNFMERTIRIKNTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMF
                     DLSRKSTLNSIKDWYRQARGFNRTAIPFLVGTKYDLFVDLPEPDQEEITRQAKKYAKA
                     MNAPLIFSSTCASINIQKIFKIVISKTFDLRLKIPEIVNTGEPILLYQNI"
     gene            complement(<509954..>511621)
                     /gene="MUP1"
                     /locus_tag="FOA43_003465"
                     /db_xref="GeneID:62196865"
     mRNA            complement(<509954..>511621)
                     /gene="MUP1"
                     /locus_tag="FOA43_003465"
                     /product="methionine permease"
                     /transcript_id="XM_038923716.1"
                     /db_xref="GeneID:62196865"
     CDS             complement(509954..511621)
                     /gene="MUP1"
                     /locus_tag="FOA43_003465"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="methionine permease"
                     /protein_id="XP_038779644.1"
                     /db_xref="GeneID:62196865"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MVDKSGSKNEVETSEWEVASGQVAPLDRNKKEIGTISAIGLIFN
                     RMVGTGIFATTSTIFVLSGSVGLSLILWFVGSLISLAGLYVYMEFGSAITKNGGEKNY
                     VEYVYRKPKFLASAMYASYVFFLGWASGNSIVFGEYILTAAGVTVTRWNERGIGIACV
                     TFAFLVHSINVKAGVYLQNVLGLFKLVIILIITVTGWVALGGGISGAPGKANFHDSFS
                     GTPVTGYGVVTALYNIIWSFIGYSNANYALGEVKNPIKTLRIAGPSAVICLAVIYMLV
                     NIAYFAVVPLDELAGSGQIVASNFFRIAFGRKSEKALSVFVALSALGNVMSVIFSQGR
                     IVQQLGREGILPFSKFFATQKPFNTPMVGLFEHWVVCVITIVAPPPGDAYNFILNLIS
                     YPLNIVNMFVAAGLLWLHYRNKKGKESWNPPIKATIPVTMFFLLSSIYLVVAPYVPPS
                     AGQSVYNSLPYYLHCVVGIGIFAFGALYWVVWAWVLPAIGGYRLDSKEELGDDGFWRH
                     RIVKVKNGQDIEEAVEEEQSKEVIPSVGSSSQTEGFETKESTNSVAF"
     gene            complement(<512195..>513766)
                     /gene="IMH3"
                     /locus_tag="FOA43_003466"
                     /db_xref="GeneID:62196866"
     mRNA            complement(<512195..>513766)
                     /gene="IMH3"
                     /locus_tag="FOA43_003466"
                     /product="IMP dehydrogenase"
                     /transcript_id="XM_038923717.1"
                     /db_xref="GeneID:62196866"
     CDS             complement(512195..513766)
                     /gene="IMH3"
                     /locus_tag="FOA43_003466"
                     /note="BUSCO:EOG093418SW"
                     /codon_start=1
                     /product="IMP dehydrogenase"
                     /protein_id="XP_038779645.1"
                     /db_xref="GeneID:62196866"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="PFAM:PF00478"
                     /db_xref="PFAM:PF00571"
                     /translation="MSSPLDCSKALSYLSEYEHMDGLSVTELMDSKINGGLTYNDFLI
                     LPSKIDFGSHEVSLDSKLTKRISLKTPFVSSPMDTVTEADMAIKMALSGGIGFIHNNC
                     SSDEQAEMVRKVKKYENGFINDPVVISQDRTVGEVKVLGKELGFSSFPVTSNGKLGGK
                     LIGIVTSRDTQFHEADQDPISEIMTTELITARNGISLKEGNRILQKSKKGKLPIVDDK
                     FNFVSMLSLTDLQKNHDYPYASKSPHAKQLLCGAAISTLRSDRERLTKLVAAGLDVVV
                     LDSSQGNSTFQLEMLKWAKETYPELEVVAGNVVCREQAAELIAAGADALRIGMGSGSI
                     CITQEVMACGRPQATAVYNVCEFAKKFGVPCMADGGIQNIGHIIKAIALGATTVMMGG
                     LLAGTTEAPGNYFYRDGKRLKVYRGMGSIDAMQQTDSNANASTSRYFSQDDKVLVAQG
                     VSGSVEDKGSIVKFIPYLFNGMQHSCQDVGVKSLTALIDETANGKVRFEFRTPSAQFE
                     GGVHNLYSYEKRLHN"
     gene            <515271..>517712
                     /locus_tag="FOA43_003467"
                     /db_xref="GeneID:62196867"
     mRNA            <515271..>517712
                     /locus_tag="FOA43_003467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923718.1"
                     /db_xref="GeneID:62196867"
     CDS             515271..517712
                     /locus_tag="FOA43_003467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779646.1"
                     /db_xref="GeneID:62196867"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="PFAM:PF00780"
                     /translation="MSRHGTRTTGSSISASSVVADPELPMDIQIIVESRPESIHHDFD
                     GFDSQTYKGFWLLSDEEALALESWNKLEFERQNRLFEYFINLQRIRFNMKRMVFHYGP
                     AFEGYKDRTPNQSDDYQKTFTPIKALYEYIDKLVLKKLKPAYEGHMFVNDQYILEVST
                     KWFSNVAAKYDYISRGVVYLARLSASDTVREWIADVEKTDELAISNRFAPSAKELFCS
                     YFIKLFTPLALIFKDLIKLYAKMNKTELEELAKKLDEILGKINTTSDYTADLDNKISL
                     NEQLVCADYLYLEMVNLFDKERRLNPANLEMETKYGVTWIKCKLVLCDNYLLPLLEKK
                     HKDTNLFLSKPPIPLQYLSYKVLEPEEKSDTLQLVIIDSGNKITHTFRALRSQKMASI
                     MLKTFTRDLNRNRNALFVKLTDATPYHLELINGCSFVSHIQQDEYALPSDSDGHDLVK
                     RSLDKSNEASDIKSKSARPLSTTEPSCADIFSYGGQSFIAVGAYDGIYIGQENNPASW
                     RRVCEVARVRKLDVLDNQMMLCHCGEKLYECPVTEMMTAYTGLNLCDKLLIEIQKHCK
                     GYELGPQKLRNGPVVASSRYLFCWKDRKIRYSPMARENKWLPIFKSMRATFNVVGMSV
                     LYPDNFSILHFTEDMPIFYLSNLNAFTNTQMPKVDGDTEMLIRQKNQKPVGVFKFGGV
                     TPKDYEMILVYTSYFIIVSYDSNSRTFLRSRNEIMRFNFECQEAAFDPQENALFACGS
                     RSLEIWRIPPRKEIRSDGDARPELVTIVLGHNVKLLNKTPEKVIVSLMRGENNDSTNR
                     LIFRVRRDGRKKAPS"
     gene            <517915..>519921
                     /locus_tag="FOA43_003468"
                     /db_xref="GeneID:62196868"
     mRNA            <517915..>519921
                     /locus_tag="FOA43_003468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923719.1"
                     /db_xref="GeneID:62196868"
     CDS             517915..519921
                     /locus_tag="FOA43_003468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779647.1"
                     /db_xref="GeneID:62196868"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PFAM:PF03847"
                     /translation="MDQGQRSNQGNMSQQSSPQTSNTPMNLSTPTLSAATPVSTSPQP
                     QQGQGQFPHITRQQAQQLLIQFNIEKEGAHSAGTQSPEGREHVRKAERIKAILISYNR
                     RQKMLAAQRQQQRDAAAAGTTAVTGGMPPQSMGTAQPLQGDTQLNRIASQNQIHPVGS
                     QVGSTMRSPMVQMQGSSDNLFQNSQGSQQGHPDISSMTLVQQMLIQKQQQLAKYRQVM
                     KLAEQFRNQLRAIESKKSEPNIAPNVMGQLDQKEHEIKTRMDQCRHYSQQISSRLRLL
                     QQKIQQQQSQQPQQSQQQSQSQPSNSSPQSQQQSSSQQFQSQLTPQQKLALQQQVLFQ
                     RKRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQQQQQQQAIQSNAQSQSPVQN
                     STGGQTPIGTPSSVQTPGSTLSSAASKMAKFKTQRKNQIKKSQGSKTKMDKTPSILDQ
                     KQNDTQSANTTSTTITNVNAAASKPITTPAASTGMTASPSGSYSTRPRFQNISIPEEL
                     KVPTPEPASVKLNNRPSLIGGNAIDAPALTNPTIVRPQHFDIEGERVLNKRKLRELVR
                     YVASEEGDTEVTIDGDVEDLLLDLADEFVTSVTSFACRLAKHRKSDTLDVRDVQLHLE
                     RNWNIRIPGYAADEIRSTRKFVSNSAHHSKVNGLSINKSVNRGK"
     gene            <520323..>521135
                     /locus_tag="FOA43_003469"
                     /db_xref="GeneID:62196869"
     mRNA            join(<520323..520327,520343..>521135)
                     /locus_tag="FOA43_003469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923720.1"
                     /db_xref="GeneID:62196869"
     CDS             join(520323..520327,520343..521135)
                     /locus_tag="FOA43_003469"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779648.1"
                     /db_xref="GeneID:62196869"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MNCEFADPEHLVVMITGGSKGLGLELVSQWMKRDNCKHIVVLDV
                     FKSKDLEQLESENGTKLHFYCCDMADSQSVDKTYDEIFAKYKRIDVLICNSGVRQRER
                     FLNTKEGEMRSIFEINYFSHVKLVRKAIHTSCEAAYRLHIVVVASVLGFIAPKTLCYY
                     SGTKSCLIDLIDSIRHELRRSIALSVVAPGQLSTSMFQDVKIDNPFLAPLVNHKKLAM
                     RIMSIIDEGYNGLFMYPFYCRLVPALRCMPFGIYEALRKYSKMDDII"
     gene            complement(<521136..>522506)
                     /locus_tag="FOA43_003470"
                     /db_xref="GeneID:62196870"
     mRNA            complement(<521136..>522506)
                     /locus_tag="FOA43_003470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923721.1"
                     /db_xref="GeneID:62196870"
     CDS             complement(521136..522506)
                     /locus_tag="FOA43_003470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779649.1"
                     /db_xref="GeneID:62196870"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MATATASLIKLRNAFWGRPPEDPKERKLLLKIDWFVLSFVCLNY
                     WTNYLDRSNYANAYVSGMKEDLGMKGFQYNVINTAFTCGYVVGMIPNNIALLKISPRY
                     WLTFCSAAWGLLTLSMFKVTNYKQLCVIRFFQAVFESSTFSGTQFILGNWYKETELTK
                     RTAIFTSSGLMGSIFSGFMQTSIHRSMNGRCGLEGWRWLFIIDFLITVPVCIYGFVCF
                     PDISGRSSSLFFSDEEKKLAIDRLPPKPQTKFDLSVIKRVLGRWHWWLFSLLWVFGGE
                     NESYVTNTLFAIWLQDQGYSISQRNNYPMGIYGIGVLSTLFTAIYVDLTGAKYHWHVA
                     IWITVALLVSTVLLLCKPLTPAYVFAAQYLAGISFSGQAAFFAWANVVCYNDLEERAI
                     VLASMNMWSSVVNSFWSILFYKASSAPKFAEGCYAMLGTIFSGLFVAGAIRFLQIKEE
                     RQDKEI"
     gene            complement(<522769..>523429)
                     /locus_tag="FOA43_003471"
                     /db_xref="GeneID:62196871"
     mRNA            complement(join(<522769..523326,523421..>523429))
                     /locus_tag="FOA43_003471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923722.1"
                     /db_xref="GeneID:62196871"
     CDS             complement(join(522769..523326,523421..523429))
                     /locus_tag="FOA43_003471"
                     /note="BUSCO:EOG093448ZQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779650.1"
                     /db_xref="GeneID:62196871"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="PFAM:PF06703"
                     /translation="MEHSYFFYHYFVNFQKAMVKKVNLNSAVALRNECDEHLSGALSK
                     VGYEQSFSLVDTKLVIGYSCVILAGLMYYVEKKYKNDFNNPDYVMYTELFVVLFFVLE
                     FVWYLFSKFVEKSIKFVGTKGHKTLKVSSHLKSKEDPVYYLEFDLDGTVDEEQVEFTR
                     LFTADGFLDFAVFSKLLVDVVNKIEKDI"
     gene            complement(<523449..>525158)
                     /locus_tag="FOA43_003472"
                     /db_xref="GeneID:62196872"
     mRNA            complement(<523449..>525158)
                     /locus_tag="FOA43_003472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923723.1"
                     /db_xref="GeneID:62196872"
     CDS             complement(523449..525158)
                     /locus_tag="FOA43_003472"
                     /note="CAZy:GH125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779651.1"
                     /db_xref="GeneID:62196872"
                     /db_xref="InterPro:IPR008313"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="PFAM:PF06824"
                     /translation="MEYTDDYDEKDHDKPSGVTTPVGDRIALQMKTHRKKIGICVVFL
                     CFIALVRRIFLSDGNNYVSRLGMQQSSLCPNYSDYSKVPHRPKSTGRLHLPYMRPRRE
                     CRTFGSKVVEQVIEDLQARIEDPDLFRLFENAFPNTLDTTVWWYEPSDKKTGTPRAFI
                     ATGDIAAEWLRDSAHQLSVYIPLIPYDENLQKLVKGAIVQQALYIRTAAYCNAFQPPK
                     ESRIESQPSAIDFVGPRPNWDTVFECKWEIDSLASFLSLTNQYIESSGDTSILTQEAW
                     VSAFKSIIYVLRRQIMSSFDKVSQLEPPYYVFQRDTSSGTETLPLGGRGNPVARDIGL
                     IRSAFRPSDDACIFQFFIPGNAHLAVELVKLSPLMDAVGLDALASKALYFGTKIKKAI
                     MEHAVVESKKYGKVFAYEIDGFGGINMMDDANIPSLLSLPDLGFIKKDDEIYKNTRKM
                     ILSEEGNPYYLKGNYFEGIGGPHIGLRSAWPLSLLVQIRTSDDDDEILKLLDTVLTTT
                     GGLGLMHESIHINSPSHAFTRSWFSWCNSEFAKTILDLAERKPKLIFRKDYADKPYKF
                     AGL"
     gene            <526628..>528515
                     /locus_tag="FOA43_003473"
                     /db_xref="GeneID:62196873"
     mRNA            join(<526628..527353,527698..527710,527986..>528515)
                     /locus_tag="FOA43_003473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923724.1"
                     /db_xref="GeneID:62196873"
     CDS             join(526628..527353,527698..527710,527986..528515)
                     /locus_tag="FOA43_003473"
                     /note="BUSCO:EOG09344B8Q"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779652.1"
                     /db_xref="GeneID:62196873"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="PFAM:PF04752"
                     /translation="MTVEKYVEPLWLVGYGSLLFKRPLHDQEFSQNFTKFSGYLTGFA
                     RKFWQSSLDNRGTPQHKGRVVTIIPADDIVKNDELKPDILKYELRNYECTERIINDLQ
                     LLSKALTVWGCIYYIPSKYSKQASEYLDFREKDGYITRKVDFNVVLSNEEKKNQHISS
                     IVSKLPRNDLGEPVIKSIVYIGTTENESFVGPENVKDTAKIIQISRGDSGRNIDYLAA
                     MNDSLQNLDPTGQQRSRDPYLEDLVPFFALELGFSIPLKKVYRDGTHWPMLVFGILAS
                     ILLVAGLVPPYFELAKRKGRVVGINFVFLAMDSSGAIFSMASNCVDKIDIMAMILYIL
                     VVIMEAGIFLSQFIWWLRFRVIKREADEADENPNPNGDNNSVGNSSTQGDQTDDLARD
                     SSIAATSMREKRSSANQLTYADDKGVESIV"
     gene            complement(<528578..>531070)
                     /locus_tag="FOA43_003474"
                     /db_xref="GeneID:62196874"
     mRNA            complement(<528578..>531070)
                     /locus_tag="FOA43_003474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923725.1"
                     /db_xref="GeneID:62196874"
     CDS             complement(528578..531070)
                     /locus_tag="FOA43_003474"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779653.1"
                     /db_xref="GeneID:62196874"
                     /translation="MTSSGDLQDLLMCIPSLFSGITRTTHSQLDILDHVKFKKLEGLK
                     DVESVFVLVLQTALMATVPSYSNHDVDLCLQKFGEGIEPSPLLISQEVADASPFPIET
                     IVNDKRFQISIQLLKYKLDDEKGWQSNVECRDDNVISWISSILEPTISASIRHLTKTS
                     AIPETVLFDLLLRKPSNELEYMSLFEIYCKWSEGVNLKDQEKLYYLKQFENFSGETYK
                     NRNLIIPPAFANLFDYALRYKLETLPRLVQSFLDENNTKSPQILDQVSELIWKLCYDH
                     SGKNTSRPSRFYKISQSRIIKVINRLISENENFDINVTTLLGVSNLTFYTDFRKSFTL
                     FKEAKKRFDRWQLESFDIDGFEKIVSTVGGDIFPKSGTWSFEEVRIIRKDYNIKFLCN
                     SILLLAVNSKNRNLVYREFFNVLKNSDAELLCQYPELWNFVLIKLNHHSMLNDVTCKE
                     LFELYLQKYDGHIRNHVALDLILNNIDHPKLFFDIIRKLDFREFDDLNLSRCISKLYK
                     MAKIIGESDEGDVSLRSHEDPLTYPLGTDYDSSFYQLIDHYTDVVKPSKSKKKRVCDN
                     YRLEKFDIMGFKTPIDLARYLYDSAKFKSSKLNSSYLLGESIVTPADTYERYMKMDAC
                     TKLTPVTISSLFVSVLRLREMSSYSSTKWISPVEERVAKHQIMSKMAKGEEDDNDEIE
                     LSSKPIDVALREFDRHVSRSYGDFVNGKVYPDDNLLAVYLKSVSEFRKMSRIYEFLDK
                     MVDIRYPMKLLVFRLYLGIIPEADKQELLNCLNGYHKRFETLRKCRSEYELKMVKKNL
                     EPITARGRFKDFVSKFEFTWDVIRNWEWPGKF"
     gene            <531692..>534829
                     /locus_tag="FOA43_003475"
                     /db_xref="GeneID:62196875"
     mRNA            <531692..>534829
                     /locus_tag="FOA43_003475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923726.1"
                     /db_xref="GeneID:62196875"
     CDS             531692..534829
                     /locus_tag="FOA43_003475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779654.1"
                     /db_xref="GeneID:62196875"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="InterPro:IPR036985"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF03835"
                     /db_xref="PFAM:PF10403"
                     /db_xref="PFAM:PF10404"
                     /db_xref="PFAM:PF10405"
                     /translation="MNDHRIPSQYRELLHEAFENGTVPPVSARPLKKRRRHRSESPTT
                     DDISDDADKLGKGVESREHCISSALNKGSSNITAIVLSSDEDTVGDAYRDLKKKESKI
                     GPETEAKVEIDIDDDSDEEDGDEDEDEDFDSDDFEDVDLEHVPTPDLQLHDYEEDSKQ
                     IKIPLKTNKILAQKRKKKTVVPREERMFRKDLHMMYIFTMVAHGVARNSWCSDRNLLN
                     SLKRDVPARILDEYATYLQHRKKTNVTTASKTRKLLDLLKDLMVYWYTSWTIDKNAPV
                     IYKKGWDELDVHIPRQRMSKKKFSESVEQRSGSRDIAAQGFISLLRSIGIQARLVFSL
                     QPPDFTNLSQLSSIAEKHEADERRKTEQMTLPMGRRKSRRALTQHDRLLNSLRGNRPT
                     YTNFRASDFEDIEDKYGHFPIFWSEVWDKDAKRFITIDPIVKKTIEVIRLKSQLEPPT
                     SETRNNVYYVIGFDRLGGVRDITRRYAETYNAKVRKKRITRDPKGEEWYENVLLGATT
                     VNRIRPNKIDKFEELEFEELSLKEGMPNSIQDFRNHPIYVLESQLKANEILKPKLSCG
                     TIRKKSKTNKQGKLIPVYKRANVYTVRSAKAWYMRGRVLKLGERPMKIKNKPKVPRKA
                     RDEDDFELSDKDEEDDVRLYADFQTERFTPPQVMNGEIPRNAFGNIDVYQPWMVPEGC
                     VHIMDDNAVNAARLMQIEYAPAAVGFNFDGDRRSHSVSATVKIQGIVTFKQYQEAVNV
                     VCKGLEEFEAEKSRRRQDLIALRAWKILLAKLRIANRLNEEHGKVINMIEENYDEGGD
                     EEEEEEEDDDGEEIVHTEDGGFMRADAQNVNEDIYYGRVDDEVGDVDASDFHEEQDDR
                     LVVTEENEVGTPKIKADSPVIEVENDNNNEFEDFMNEVGFGDEHDREPENESDEAGGF
                     VVENFPANQTSSEKEKVISEGSVTKSNSPEDFSSPERIPHDVNSTFVEGMIPPKHVDP
                     ISIRDHPAQAVSMDVGEKELGNTSIRADNHPKQPISSVVGGVDAPIEIPSDSDVINLD
                     EEYADDEGYEFEYSD"
     gene            complement(<534936..>536048)
                     /locus_tag="FOA43_003476"
                     /db_xref="GeneID:62196876"
     mRNA            complement(<534936..>536048)
                     /locus_tag="FOA43_003476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923727.1"
                     /db_xref="GeneID:62196876"
     CDS             complement(534936..536048)
                     /locus_tag="FOA43_003476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779655.1"
                     /db_xref="GeneID:62196876"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="PFAM:PF08243"
                     /translation="MNFTSLLAQITKDKKLEERAKQPPRNTKAVDRLSRPKPKNIVKH
                     SKRESPNHLLHGQRGHFISDNKDDIAAVRRLKEARRKERERLQTLKDARKGTKISRRG
                     RKPSIRGSAGVGHSYSGSQGRILFRSDPGATNFGFVRSAPIKVSAAGPKMSFKELMKR
                     AESIDKSQLAFNPIKAVSSQGFLKSKGLMKNRMRHASAPPEKRPLTVSFRAKPTTGAG
                     QDLRRRQERQSPIYTGTSNEKKNDKFGIDVDEGDEEEDTDDYGYDNGYDYEDDDGFIV
                     DNYDKDGDEKLRSIVKDKGYDRDEIWSIFNRRNPKRNRFDDYDVDDMEATGGEVLEEE
                     DRALRQAKIDDRREAELLEQKRVEKLRRHKHMKSQR"
     gene            complement(<536446..>536646)
                     /gene="SSS1"
                     /locus_tag="FOA43_003477"
                     /db_xref="GeneID:62196877"
     mRNA            complement(<536446..>536646)
                     /gene="SSS1"
                     /locus_tag="FOA43_003477"
                     /product="Sec61p translocation complex subunit"
                     /transcript_id="XM_038923728.1"
                     /db_xref="GeneID:62196877"
     CDS             complement(536446..536646)
                     /gene="SSS1"
                     /locus_tag="FOA43_003477"
                     /note="BUSCO:EOG09344QUK"
                     /codon_start=1
                     /product="Sec61p translocation complex subunit"
                     /protein_id="XP_038779656.1"
                     /db_xref="GeneID:62196877"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="PFAM:PF00584"
                     /translation="MAGKGKLTDAPVEFVKEGVQFVRKCRKPTQKEYAQLIRAVGMGF
                     VMMGIVGYLIKLIHIPIRYLIV"
     gene            complement(<536886..>537762)
                     /locus_tag="FOA43_003478"
                     /db_xref="GeneID:62196878"
     mRNA            complement(join(<536886..537387,537440..>537762))
                     /locus_tag="FOA43_003478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923729.1"
                     /db_xref="GeneID:62196878"
     CDS             complement(join(536886..537387,537440..537762))
                     /locus_tag="FOA43_003478"
                     /note="BUSCO:EOG09343IU2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779657.1"
                     /db_xref="GeneID:62196878"
                     /db_xref="InterPro:IPR010301"
                     /translation="MKTNTFVRKLASNDRKTRVRAFETLTQYISSRSHTRKLSLLELQ
                     KLWKGLYYAMWFSDKALPQKRLATQMSSLFSECVSDEQFALFVTAFWSIMAREWTEID
                     KWRTDKDSKFDKKLVDAYISALEEGILSGELKLPSYIVMHIVDVWLDELERVIFELDD
                     DEDTPENDDVKDEEEEEKVLQEKKDLVSKIPIDKLLEPFAILLKKTPQKALKNRIREN
                     IFEDQRLKDWGVDTDGYVDKKTTSAEDSKEEINDQDEGQKQADGDADEAWSGFGDN"
     gene            <537989..>539116
                     /locus_tag="FOA43_003479"
                     /db_xref="GeneID:62196879"
     mRNA            <537989..>539116
                     /locus_tag="FOA43_003479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923730.1"
                     /db_xref="GeneID:62196879"
     CDS             537989..539116
                     /locus_tag="FOA43_003479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779658.1"
                     /db_xref="GeneID:62196879"
                     /db_xref="InterPro:IPR021715"
                     /db_xref="PFAM:PF11708"
                     /translation="MSFEDHSKKPRYDASGNKINDYIPYYISKKPWYYESEALKNNSN
                     IRKRNAEEERIAMTTEERFKHQRKDMEADLAPNDEPRKGEGIKEEFEKVEVKRSIRSV
                     RQKSVCGNCGSSNHATKDCLDRPRRVKYRYRTHSKSEDTSNRHDGYLVRKETNNYDEK
                     RDRWHGFDVDSEYDEQVKKMKQKEKNMRNKMTTDVDLEELDNDELEEMKELGLIDDIK
                     KAKKDATLKAVIENNPLAAEKNTRASVRSLDEKPRYLEVIDSGEELRFNPKSRVYKDL
                     KEGYLNSRGQFIPYLNGEAADFEKMKQFTHGIQQQRKEKWENGEKDVTSMADLTYTEE
                     ASPTAVMLATKKKKLELDEVREAKRRQLLAKYGALGIEKKD"
     gene            complement(<539121..>541040)
                     /locus_tag="FOA43_003480"
                     /db_xref="GeneID:62196880"
     mRNA            complement(<539121..>541040)
                     /locus_tag="FOA43_003480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923731.1"
                     /db_xref="GeneID:62196880"
     CDS             complement(539121..541040)
                     /locus_tag="FOA43_003480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779659.1"
                     /db_xref="GeneID:62196880"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="InterPro:IPR036047"
                     /db_xref="PFAM:PF00646"
                     /db_xref="PFAM:PF12937"
                     /translation="MANENLINKAVEIGTREFQVQNYSRALKIYTRGIEECKIYYTES
                     EEHGRRRTNRYHSKYKALLDCRAACFGKLDRLDKSLEDSETLISLDHYSIKGYLRKGK
                     ILCKTNREREAFESINDGINVLRHGIFKYKSKLKINKRLYTKMRNERARLAEHLGYEI
                     VRDADGKETKKRKQSSSDPVVKLPVEIIMEVMSLLDQSDVLSAMAVSRQWHLLLTSIT
                     EIVECPTLKKRLTREQFEKFLDFCHDRIHIKKLCLDCKPVDEIYILTRLANSGIVTEN
                     LEITLRNVTDENLAKLLGQNVHARELFQSLRQLKLALEVYDVENGINNIMAYLTRLET
                     LSITVLNVRKSLTIRQGASINAVARNYANKFHKLSELQLHFHLGDPKGQTNTSLYNNF
                     FRMNHFSRLTDLELNCSSYDRASIKELLERNYSLKRLALYSISPNEISWIFRAISEAR
                     IRLETFEIQEVCTKRRQQEEPIEGQDEMDLSFLSELKNLTLIKTSITVRSLVQILEAT
                     NMQLQVLKLVENDFIAFGPGPIHQFAPYVIFPLEQLVRNCPNLKSLSLMRCSNLDNAS
                     IRMLSKLIEKYSQPRKLERLDLSYNNIDGLALVALFGPNSLLRLRTLLVTGCDISLET
                     LTYVKRKGFVEHIVM"
     gene            complement(<541224..>542819)
                     /locus_tag="FOA43_003481"
                     /db_xref="GeneID:62196881"
     mRNA            complement(<541224..>542819)
                     /locus_tag="FOA43_003481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923732.1"
                     /db_xref="GeneID:62196881"
     CDS             complement(541224..542819)
                     /locus_tag="FOA43_003481"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779660.1"
                     /db_xref="GeneID:62196881"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="PFAM:PF00012"
                     /translation="MTTIGIAFGNSTTSIAFVREDGKVEVIADPDGDRFIASALSYIG
                     DDQYHGSQAIGQLLRNSEDTIVNFRDFIGVPFDKINAKYSQHSAKPINIDGKVGYEIG
                     GEKITVDEIAKRHLIQIVKDAEDYLGEKVEGGVMTVPFNFTSEQKTLLIKIAGDAGLH
                     VLQLIYEPSSALLAHLNAKKELLEDKVYVVADFGGIRSDAAVIAVRGGIFTVLSSAQT
                     YEIGGEKLDESLMEFFGKDFQKKYNADAVKTEKSWAKLNSASIITKKTLSNVESARVS
                     VDSLAEGFDYNASINRMRFEVVARNVFSKMAAFIEEVIQKADLESLDIDGVLLSGGSS
                     NIPKIARNMEFIFPETTTIIAPSLDSKLQNPNELNCRGAALQASLISSFDAENIEKSQ
                     EPDVVGTKQLSVPIGIKGSKGEFITILPKNTVYPIKKTISLIASADDVLIELYEGKRT
                     IKETLEEPEEEDEEEEEDEDEEDEPEVIRSVVYEPSELLAQLALKAAGKGKKVEVVVN
                     IRKEGKVQIMARSGSTAAKGVIA"
     gene            complement(<543591..>544412)
                     /locus_tag="FOA43_003482"
                     /db_xref="GeneID:62196882"
     mRNA            complement(<543591..>544412)
                     /locus_tag="FOA43_003482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923733.1"
                     /db_xref="GeneID:62196882"
     CDS             complement(543591..544412)
                     /locus_tag="FOA43_003482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779661.1"
                     /db_xref="GeneID:62196882"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="PFAM:PF01184"
                     /translation="MSNFVQPSYIETQQRADSPDAKYFNNHSEPTLNKVYSEGQYQFG
                     NVLPPRTGYLRVNYYRRAGDNRRFPTSCAAGIALLGVALFPLGLILLGAKGVQSTGIL
                     TSTYLFTSGFTEIVLGMWAIVDNNLWGSTFMICYGSFFMALGGINTNILGVQDQYDSE
                     QDFNNAYGLLLLGWTIFTFVMWTATLKSTISIFALMTMLTIFFSVYSAYIFLDVKACK
                     IISGVLAILMGLGCFSGVYDGLNEAPNAYMESAEKYMIMPGNRAVPKDDKYIEVI"
     gene            complement(<545562..>546461)
                     /locus_tag="FOA43_003483"
                     /db_xref="GeneID:62196883"
     mRNA            complement(join(<545562..545960,546012..>546461))
                     /locus_tag="FOA43_003483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923734.1"
                     /db_xref="GeneID:62196883"
     CDS             complement(join(545562..545960,546012..546461))
                     /locus_tag="FOA43_003483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779662.1"
                     /db_xref="GeneID:62196883"
                     /translation="MKHFLIWCIGFFYIAILLRHGKGTEVKEFRKSDLLLNANDSKDI
                     EKGESKVVIGTNNFWFSKEKKKKVNNAERDGKKIKDIGSSIVLRSVPPNSSSMLFASR
                     VGCQSDDCNEEVHHHHKKTIIETTTEIDCDMDTVTETEIAEETTTVYEEQYTTREVDY
                     VTDTEYDVITETDHEFVLSTKTILEVSMETITIAKKTVTKKKTKTETETETETEYEPT
                     TRTKTSIEYSTTTKSYTTTLTTTLPTTTTATITNAGATTTIYGVSRRGSRFCAIASRF
                     GFMCVT"
     gene            complement(<546675..>548453)
                     /locus_tag="FOA43_003484"
                     /db_xref="GeneID:62196884"
     mRNA            complement(<546675..>548453)
                     /locus_tag="FOA43_003484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923735.1"
                     /db_xref="GeneID:62196884"
     CDS             complement(546675..548453)
                     /locus_tag="FOA43_003484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779663.1"
                     /db_xref="GeneID:62196884"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MEGRRYQDERSTGMNRPRGPRGPRGPRGPKRGPDMDSDRPESDH
                     RGAGSSRGSGRRYERENQRTSGRDSRRNGDRDSSTRSRYHERSMHFDEDRDSRYYENK
                     GARSYDDERYYESNRSNAEFQEGGQTDKSRNRNRKKRPRERDSRDRGEDESLAGPRKL
                     PTGPKAMSGKRTMNEVNLGRSNGPPFKRMAKGVMNRSAMRDADDVEDEEEFLQHSQRP
                     MDLGDAGKGIFFMQKSNISGPVYERIQQVGEGTYGKVYKARNKITGALVALKRLRLET
                     EREGFPITANREIGLLQSFDHRNIVGLSEMMVERNQVFMVFPYMSHDLSGILQQHEIK
                     ISDGEKKNIFRQLLEGMNYLHRKRVIHRDVKGSNILISNDGVLKITDFGLARAMKNIN
                     TEVESPNYTNRVITLWYRPPEILLGSTDYGREIDIWGIGCLLLELFTRHAVFQGTNEV
                     DQLWKVYDIMGTIKTSEWADADQLPWFEMLRPNFHTVSKFKDKFGKLLSPECFNLAEL
                     LLKMNPSQRITAEEALKHSYFREDPKECGLEFLKHINGEWHEFEAKKKRKEIRDATKL
                     KKQQQHQPNDTLDREHDHEQAVVEPL"
     gene            complement(<549055..>551194)
                     /locus_tag="FOA43_003485"
                     /db_xref="GeneID:62196885"
     mRNA            complement(join(<549055..550397,550420..>551194))
                     /locus_tag="FOA43_003485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923736.1"
                     /db_xref="GeneID:62196885"
     CDS             complement(join(549055..550397,550420..551194))
                     /locus_tag="FOA43_003485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779664.1"
                     /db_xref="GeneID:62196885"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="PFAM:PF00249"
                     /db_xref="PFAM:PF13921"
                     /translation="MATSSPNKEKINASVPKPTHSILRKTNGGVIDHLALSESLGYHI
                     FRKSKRRTWSITEDNILKDAVIDSFLENEHLEKYNKEDIKVEKINWSRISSKLPSRKP
                     KECRKRWTSSLNPCLRKGKWTSGEDAQLITAYKQYGSSWQKVASEIHGRNEDQCAKRY
                     TEVLNTSTEDRLKQWNMDEDLKLIHGVRKYGTKWRMISKTISGRPSLTCRNRWRRIMT
                     DVGRNSASKDIMKAVGVLDSKGNPLFTFVSGDGNTDSDKREIKKRKADQDQSEVAFEE
                     KSDHTVGSTSGFTHGVSVSGSPSYNSPTSTSSSSSTPAMNFMGHRITQPSRSYTEWRF
                     ALMNPRTNEEVSQFSGPIATQDLAHRLIELAKYNGVSLTIHQHIHHHYSPSSPVLDPQ
                     ASVTRFSHFNYLPPLTEVPKLTSSSPENVGSPNSSHRTPGSAAGESSLLRLLNTDKAE
                     YQGTVHDGSMTEDDPESSDLVPERQQLASSQQQQQQQQQQKQGREQDQVSSVLPVLHP
                     ALSSSRQISKDLPDVGFHHTRSNSANEKVNPIKFGRINGLKGYIDGVDSANGDDVDEE
                     VDFWETLQSIAHPKPQSGRPVSQHHPLHYFEAAESGPFSPNGVNNQAVTSGNANEGTD
                     ASNGSTNQGRDNNTRAKVGTIENKFGDLYSNEVEEEEEMESYANQYGMYYNVFANKGG
                     AASSKGPGTDNSSFGYVMPFNPS"
     gene            complement(<551662..>553581)
                     /locus_tag="FOA43_003486"
                     /db_xref="GeneID:62196886"
     mRNA            complement(join(<551662..553508,553575..>553581))
                     /locus_tag="FOA43_003486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923737.1"
                     /db_xref="GeneID:62196886"
     CDS             complement(join(551662..553508,553575..553581))
                     /locus_tag="FOA43_003486"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779665.1"
                     /db_xref="GeneID:62196886"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR035451"
                     /db_xref="PFAM:PF02805"
                     /translation="MYICCIPKGICCRPNCDLGITDYRKQDLRFFQTLEEARHHSFIP
                     CKYCFPDMQPEAPNLSNGSHVAIDLDLLAATVTSVNKAINFIPPLLTEDSKKTDLLRQ
                     FIWQSSNRKLKRKLLTGIPYKTSSASASLELSFQPPSPDSINLTKNEFDRLKLIDLAF
                     RHIALAASSTVAEVSNSLNSQSPDNSGAHDTSASTSPSTISPNESGSKKRRRRGGVLG
                     FKELAAKSNLSPWHFHRVFKSVTGLTPKNYGDRCCECIKEQAKKPRSSRVILINTRVA
                     NPTLANEEEHHQQQQRQQQQQRQQQHCDNKSLQNSRASYESNLPRSLSTLSTSSSSIK
                     SSPISVAASAISTSPTTITTVRSPVYHLDDVELPAKKRRNLDTFSPADDSLSLSGSGM
                     YMPLQFTDNTSSISGFLDESNNSLKNLISLIHQVDVPELPANTDLLDQQQLQSGNHQQ
                     RQLQDVDFVNQELMPSSSFPGPLSHQITTDVNIWDTRADTPDFDILQRSDSRFMDDSM
                     SHYTTLPSFGEDAVASGILDQLQQQSQYKQQRSIDGSSNGFYFAPSQNDKSSSFISPL
                     QLDSINGSSNFAELLAVAPQADIAGALPSERVYPLISQQSQWQQPQQYQQQ"
     gene            complement(<555914..>557485)
                     /locus_tag="FOA43_003487"
                     /db_xref="GeneID:62196887"
     mRNA            complement(<555914..>557485)
                     /locus_tag="FOA43_003487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923738.1"
                     /db_xref="GeneID:62196887"
     CDS             complement(555914..557485)
                     /locus_tag="FOA43_003487"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779666.1"
                     /db_xref="GeneID:62196887"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08030"
                     /translation="MDTAASSADYNIAEKRHSGHDHFANVKYGYIVLFLSFAYIVYRE
                     LALVYYGRAWRRSGRSTSKIGLVDVPMVYYVTFLSLAVVILSFFNLNLDNFVIHIKRW
                     GRIAYSLTPLDIFLSIRPSPFRLDNYLSTLKLHIWTSRVILILCLAHSVGFLWLWGSA
                     ELYKALRLVNFVGVVISVLVLGLFIINWGHIRRRVYRWFYFFHNVTAYALIVAIAYHA
                     RPKVWPIAFIDAVLIVYQLVVKFRSMQTIQISDVLCREGSDLKLVKIPGPLSPEVYLS
                     GSHCRLGESRTSAYFWMFPSHPYTLTGVVDTGDGSMNLVVKEQKFQIVPLKEYTLQPY
                     FPSALGPNFFHTAENINIVCGGSGISYGIPIFEYFKKKKQDGSSDIKLKFVWITPKRN
                     DIFVLEELGITGVDVYVTDPADSEEGENYELESLQNVGGGEEQEQEEREGKIDPFADP
                     NTDQSSTNTEFLTNTIHSSGRPNLVNSLANNMGATIDYANNWVIACGPEGLIEECRVL
                     AKAHNSRFFSEEYDV"
     gene            <557758..>558807
                     /locus_tag="FOA43_003488"
                     /db_xref="GeneID:62196888"
     mRNA            <557758..>558807
                     /locus_tag="FOA43_003488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923739.1"
                     /db_xref="GeneID:62196888"
     CDS             557758..558807
                     /locus_tag="FOA43_003488"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779667.1"
                     /db_xref="GeneID:62196888"
                     /translation="MKIPFILLVTVAIVSATTAGNSHFSVPGALLGCVNQVAHATASS
                     HRDFQSICAKRDQVLKCLVDNCAFGNFLQARDHYLGTCLCMVSELQNNTRYTFFKQPH
                     ENDPKTIARGSTADYWKAESMARKVAIKEYNQSRKYSNATITPAIKPPKNELREHQIQ
                     NNEHNKDINDTTTILASSRKIRQKDAIPLEEKTFDEVSEFRQFAPKKVENYYDDFTTI
                     TTERVLSTPLPVQDVHLASTNIALSLKFDKELLQEQTEKQLDDFDDDSDSPENSENND
                     DLDDLFGGTKISNDNRRRRRRKKGHERKIKGRKKKVYKADRERKWRAKDRNKWEKAKS
                     FFTGYEDIGEKEEEE"
     gene            <560411..>561166
                     /locus_tag="FOA43_003489"
                     /db_xref="GeneID:62196889"
     mRNA            <560411..>561166
                     /locus_tag="FOA43_003489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923740.1"
                     /db_xref="GeneID:62196889"
     CDS             560411..561166
                     /locus_tag="FOA43_003489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779668.1"
                     /db_xref="GeneID:62196889"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR036412"
                     /translation="MSLPYKKVVLDIEGTICPISFVKEQLYPYFLENISSYLSIYQYP
                     LTDESGSPEDQQILDVLLKFPEQYRTAEITLLEYIKHLVSSDIKDTTLKTLQGYIWER
                     GYNSGEILAPLYEDAIEAMKYWSAFLPNGIFIYSSGSVRAQKLLFSNVKIVSSSKEVS
                     RADLNGLISGYFDTVNIGNKKETESYKKIIQRLEYQDDPSSILFLSDDPNEVKSAINA
                     GLSSYIVTRPGNSQPSADERARYNVVSDFQKLF"
     gene            complement(<561211..>562512)
                     /locus_tag="FOA43_003490"
                     /db_xref="GeneID:62196890"
     mRNA            complement(<561211..>562512)
                     /locus_tag="FOA43_003490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923741.1"
                     /db_xref="GeneID:62196890"
     CDS             complement(561211..562512)
                     /locus_tag="FOA43_003490"
                     /note="BUSCO:EOG09343GB6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779669.1"
                     /db_xref="GeneID:62196890"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR036353"
                     /db_xref="PFAM:PF00240"
                     /db_xref="PFAM:PF00627"
                     /db_xref="PFAM:PF09280"
                     /translation="MKVIFKDFKKEKIPIDIDSEDTIFSGKEKLASVKQCEPEQLKFV
                     YSGKILKDDKTFDSFKVKEDDQIIFMISKAKKVKKEDSREGNEAEQTSKSKEGMATSA
                     TEGTPIAAAAAAETPAATEVSVTSDAPIATGSTDTAEVNTSTEEFDASTFAVGRAREA
                     ALQNIVAMGFEREQVERALTAAFNNPDRAVEYLLNGLPEIHSQSNPTAVPAAESTVTE
                     IGNSEGVQKATDDSKSSEAAALSVAPSASGVASNTTAAPAATAAITTAATTAATTAAI
                     SLPTSTPNPNNLFEQAAAQQSGETQQSGDYISSLRELLQQQPEMAEAVLQQLAASNPQ
                     LAQVIRTNPEAFMRYLTDGDQSALGEALGIPREYLEGAEGAEDESGDNATRIEITPEE
                     NEAISRLCELGFDRNLVVQVYFACDKNEEMAANLLFSEHAD"
     gene            <562761..>564716
                     /locus_tag="FOA43_003491"
                     /db_xref="GeneID:62196891"
     mRNA            <562761..>564716
                     /locus_tag="FOA43_003491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923742.1"
                     /db_xref="GeneID:62196891"
     CDS             562761..564716
                     /locus_tag="FOA43_003491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779670.1"
                     /db_xref="GeneID:62196891"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /translation="MALSTEKVKYPEWLQIRSESLADPDNLVISSRLLDYIEDIVDIN
                     TDEIKQSEPLQQRAHFDFDRILNKFPYLTSYWKRYVTVEYALNGLESSALILERAVLS
                     FPQCIDLWIDYINIVVANKLKIDSEVKKLFEEASHHVGRQYMSDPFWDLYLEWEEKHS
                     GKNSNAYIDLYLTIIRIPLHQYARYFEAFSSLRDSFTIKDLIPEQHLISHEDTTLISS
                     MQSLKLKSIENWDQLNDKSASLLLQDYFYRVFVETEKGTNSRWEYESKIDRIEFDATP
                     VTDEDLDAWNTYLDYEETQGDVAQIISLYERCLIPTCSYQSIWIRYLKFLIAETHDND
                     RIVYLFNRACDTFVPKEFTNIRYMFAKFYEETLHDFDGAKEVYFSLVSEYPYECRPVT
                     ETFQFLYRQNKDKDSVVKDALTTVKIYIQDHYDIVRNPRKITSLGGSIIKSTHFQALY
                     RLLNFKNVSQLIVEAGKVFWLERHLIKKTRQLLISLFKEDLVKSSIPYWYFFFKFELC
                     QRNKKNLSNIVNYIKYFAQMPIAEVNYLISAYNDFAFKNSSKAELIGTSREIVRHYLE
                     TDVESSTAMKHFLKSRLSTDRNEELTNKRLQVENGHPSGKRDGRPRINNTIDYTLRLS
                     EIGVPALPEFSNVERANTPVEYIHPVE"
     gene            complement(<564724..>566520)
                     /locus_tag="FOA43_003492"
                     /db_xref="GeneID:62196892"
     mRNA            complement(<564724..>566520)
                     /locus_tag="FOA43_003492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923743.1"
                     /db_xref="GeneID:62196892"
     CDS             complement(564724..566520)
                     /locus_tag="FOA43_003492"
                     /note="BUSCO:EOG09342VUH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779671.1"
                     /db_xref="GeneID:62196892"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR032675"
                     /translation="MAYGRRRRQNQAQGSEDVQGPSSALSAFLREQGINADSVRLRYE
                     DNVRREQEMIERQQQLEQEQQEQEQQGQEEQGQSGNILNDNLTDIGEASGLDSDEEVY
                     EGDDKNDTEVALIKERARAKRRRVDGNDAAGFNADHGVGKNYCIECDKEFAISVYSKK
                     MEKYGRVGYLCPSCTKIAIRRERLAKRNEIEARKKRKKIAAALLDKQAFRLPSLQDFC
                     IKIITENINDVDLLGDIGVNNRKKISRILAKKRSLDSKTMRLFLEPSLRELEFWDCSK
                     IDKAALGQIPAICPKLESLTLNMCGHLHKDNMLYYGEKLTNLRYLDLNGPFLINDQIW
                     QDFFDSKVGKNLTAFHLRNTHRFTSDSLVTLLDNIGDQLEELTLSRLDGLDSKGVYDL
                     LPHYLHSIKYLEISYPHKEELIDDDMIVNLMANNGEHLETLILEGCSYLTDQFLVSGL
                     KPFCPNLTKLSLKLLDQITDNGVTQLFTDWNINGGLMDLDLTRCISLTDNSIYKALEH
                     CSQTLVQLKLNSVKGLTKKVFLRLSRNIRFPLLTSMDLGFVRSVDDSVLAILSRIAPK
                     LSILEIYGNSRCSDKAIVRGDLRIIGRETDSI"
     gene            complement(<566624..>568075)
                     /locus_tag="FOA43_003493"
                     /db_xref="GeneID:62196893"
     mRNA            complement(<566624..>568075)
                     /locus_tag="FOA43_003493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923744.1"
                     /db_xref="GeneID:62196893"
     CDS             complement(566624..568075)
                     /locus_tag="FOA43_003493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779672.1"
                     /db_xref="GeneID:62196893"
                     /db_xref="InterPro:IPR014752"
                     /translation="MGLLSSSKRDIAVSFAYSIPEYRCFGPFDPNVKGTVEVKFLRKV
                     KKILNIRVGLSGTVDGTFIHAYKTDANSDYGSGNTKRETFKDSTMLFDIGKYLSGHDS
                     SESTIAGDFETGAVIKNEFDFRFPFEGTYLPSSCVNIGGSNDNQGIVSVIYKLYVTVT
                     HRKEYRKMNYVQEFPEVVAYQADSMLPVTGSVTYKEYNICNIFRAKVKKFVFDPRLNM
                     LVPSSLEKAHRRTRIIRSIWNDNYRKDIYSSLTKDISIFCVLHIPDAINIMHTFNQII
                     KLKIRVKLDVPMEPNFCFNNQSTGLGVFDIEQIGLYQIYDVNMKIQQYTDSHRDKLPL
                     MLMTFKPGTLRFDIKDFIHNGTLDVWEHEISLDSFSRATASPVLYNFPIPTMMYGSVG
                     DHFKCASTAEFEVVIGNANEREPKRKTFTALTHSMFHMGYQLAHHNAVEVEPVHNIEE
                     PPPSYFKHDFTDLSGEVATSSGPASVPSRDYPK"
     gene            <570876..>571573
                     /locus_tag="FOA43_003494"
                     /db_xref="GeneID:62196894"
     mRNA            join(<570876..570880,571009..>571573)
                     /locus_tag="FOA43_003494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923745.1"
                     /db_xref="GeneID:62196894"
     CDS             join(570876..570880,571009..571573)
                     /locus_tag="FOA43_003494"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779673.1"
                     /db_xref="GeneID:62196894"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF13639"
                     /translation="MSSGGIIGGNLDGEESNNDIDDSIKISPELVTTVEISNTSSRMT
                     VNDDIDGDHNEHRKIRQHRKFKYKSADDDDENLCPVCGKDIKALQDIDRVDHVNECLE
                     SQEFSGSPDQVRKRNRMLVYTIPKDADVLKLKLNEDSECVICFEEFKPGNKIGRLECL
                     CCFHYECIKDWINHKGRCECPVHMIHYDI"
     gene            <572596..>574095
                     /locus_tag="FOA43_003495"
                     /db_xref="GeneID:62196895"
     mRNA            <572596..>574095
                     /locus_tag="FOA43_003495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923746.1"
                     /db_xref="GeneID:62196895"
     CDS             572596..574095
                     /locus_tag="FOA43_003495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779674.1"
                     /db_xref="GeneID:62196895"
                     /db_xref="InterPro:IPR000095"
                     /translation="MPKSPKLESLWIDEAENYKKQARRQTKRKVLSKKKSMHFLRLFD
                     QSADEIQFAKSKQFDKLISTPFGFDHVAHIDSKGSFGLENSFHTVDLSVLPQFMENTA
                     SHEKNVMASFAESSRARSFGAKEPSEKTPRTQQNNVPFKVYSSFRTSSILTSSQTVAS
                     SVPGVPIPATPSVGHSPYSIKHMRSASVISSLSNKAISRSDSVFTRATTVSTMTSLNS
                     SPAQSVQLRRKSNGVAFRSIYEGGIMLSPKEFLPLIRQEGDNKHHHMNSSMHSNSSAS
                     GSASGSQSRSGSSSLRYSRLSRDSTASTSLCSNLLKTDKNVGQRTESHVNQHVEDSES
                     DDDIKLEKFELSDLSNRLAKSKSTPALMETLSGETETKPQRSATKEYTVRFKTSEIVQ
                     APIPHSISSGSIGSSPLCKRTDPCVNDAEEEEPDDDKNVEDFFGDLGLDNVDFGHQKD
                     LDKAFLSLILDDDDSSQEDESEAIIAKTESALRSLQAVAVATSRRSMRH"
     gene            <574450..>575070
                     /locus_tag="FOA43_003496"
                     /db_xref="GeneID:62196896"
     mRNA            <574450..>575070
                     /locus_tag="FOA43_003496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923747.1"
                     /db_xref="GeneID:62196896"
     CDS             574450..575070
                     /locus_tag="FOA43_003496"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779675.1"
                     /db_xref="GeneID:62196896"
                     /translation="MSIDCGDILPEFVGDITLTDKDKKSIDLLELLDKYHRKYEDICN
                     NIKRTILSIKRADYVSGNINMKFGKDFWDLRPSLASKTISFDEGFKLNNLTPKRLSQK
                     ERIEKTSGSHNIAKQDRSDFQGSITNVTNRKRKPTIQDEIHDENKATELFVRDPLKMF
                     SGGFVSSEIREAKKSMDLALREIVELCTERQILLRIVKQLEDRIIA"
     gene            complement(<575125..>576999)
                     /locus_tag="FOA43_003497"
                     /db_xref="GeneID:62196897"
     mRNA            complement(<575125..>576999)
                     /locus_tag="FOA43_003497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923748.1"
                     /db_xref="GeneID:62196897"
     CDS             complement(575125..576999)
                     /locus_tag="FOA43_003497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779676.1"
                     /db_xref="GeneID:62196897"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="PFAM:PF01554"
                     /translation="MTPQFNYTTSERRASTSIVGSLGRSGLYIPQDFIQQTPEEVENA
                     LDQMDTDDENDTNTDNYAIADDEESAFMPAASHSMSVSSSIGQSMARHPSRKQSIRIL
                     SDEAKLLEQNRVPIRIHPSTPILASQRTSNLPSDYDSVSNLEVTPGGVDAITESWDEA
                     VKSGNIQTTSSFELKSITLSSIPLVITFLLQSSLGVCSVFAVGHISPKALAGVSLGIM
                     SSNMTAIAVIAGLASSLDTFLPQAYGAGKFTLVGLIFQRCAALILCVMIVVCSFWWLY
                     AEQILLKILPDAQSAHYASQYLKASSFGIPGYVFFETGKRFLQSQGIFDASTYVLFVC
                     APLNAAMNYAFVWKLGFGYIGAPIAVAINYNLMALGLFAYTVNTKNEINPRKCWNGFH
                     PRRVFRNWGELIRLSIPNLIMIVSEFLSFEIMTFLASYLGTSALAAQSVISTMASLTY
                     QVPYGVSIAASTRIANFLGAQLPKAAHTTSRMVFVTTVFVSIFNLSFLYFGKYRIANW
                     FSDDTDVIAVIVNVMPLISCIQVFDALNATSAGCLRGQGMQKIGGYVNLISYYCIGIP
                     LGYLLAFRVPHNHPLGLLGLWCGVGLALAIIGSIQSYFVLHADYDRLVEDAIRRNNTD
                     "
     gene            <578246..>579523
                     /gene="PRS1_2"
                     /locus_tag="FOA43_003498"
                     /db_xref="GeneID:62196898"
     mRNA            <578246..>579523
                     /gene="PRS1_2"
                     /locus_tag="FOA43_003498"
                     /product="ribose-phosphate pyrophosphokinase 1"
                     /transcript_id="XM_038923749.1"
                     /db_xref="GeneID:62196898"
     CDS             578246..579523
                     /gene="PRS1_2"
                     /locus_tag="FOA43_003498"
                     /note="BUSCO:EOG093421B6"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase 1"
                     /protein_id="XP_038779677.1"
                     /db_xref="GeneID:62196898"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="PFAM:PF13793"
                     /translation="MRKCKVFVGNSHPKLGKLVCERLGIEPAPVSLKNFANGETSVQI
                     GVSVRDEDVYIIQSGSSETNDHIMELLILISACKGGSAAKITAVIPSFPYAKQSKMKK
                     HRGAITARMLANLLIMAGADHVVSMDLHASQMQGFFSKPVDNLYAGPTLAKWIRHNIE
                     NYQDAVVVSKNPGGAKRVTSLADNLKINFAMIHTDRERNKESYGHSTQHQQSVVSTRE
                     EDGLAEEEDVICSTDVQTARIVKGHVLDEEASAEAAEAFARTPSKSRKSSMASKAIRP
                     IIAHRESEINYDNNNSDDEDEPEFNASEKVITLVGNVQDRAAIIVDDMIDKHAAFIAA
                     AEHLRKNCGAKQCYIVATHGIFSNDCLERLNGCPYIDGIIVTNTYPIPEEKIQKCKKL
                     TVIDVSPIFAECIRRDHFGESISVLFDSLASVV"
     gene            complement(<579872..>583258)
                     /gene="VIP1"
                     /locus_tag="FOA43_003499"
                     /db_xref="GeneID:62196899"
     mRNA            complement(<579872..>583258)
                     /gene="VIP1"
                     /locus_tag="FOA43_003499"
                     /product="inositol hexakisphosphate and
                     diphosphoinositol-pentakisphosphate kinase"
                     /transcript_id="XM_038923750.1"
                     /db_xref="GeneID:62196899"
     CDS             complement(579872..583258)
                     /gene="VIP1"
                     /locus_tag="FOA43_003499"
                     /note="BUSCO:EOG09340DYO;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="inositol hexakisphosphate and
                     diphosphoinositol-pentakisphosphate kinase"
                     /protein_id="XP_038779678.1"
                     /db_xref="GeneID:62196899"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="PFAM:PF00328"
                     /db_xref="PFAM:PF08443"
                     /db_xref="PFAM:PF18086"
                     /translation="MSSADKDTRSQSSQEYTGRQAIPITGTSGAASRKQSSRAMSTNS
                     ASSIDSLRERTAMISVDENMEDTGDPLTIDSLEQHRKAAASIAPILEGFSPVLSKSEV
                     VSPAQNPLSRTASNISSLSISHTRSGTSAIPQMITTGTTGAHTAVAEASHLMDTSTSP
                     LTSSPSSVEGGSNSGSFINVQQQSEAKFGKKSRSFSASLPEHRFPRKQKVGTIGVCAM
                     DNKVLSKPCRQILNRLINHGEFDTVIFGDKVILDESIENWPTCDFLISFFSTGFPLEK
                     AIAYAKLRKPFLLNDLILQKALWDRRLCLEILKAAKVPTPYRLVISRDGGPQVDEDLR
                     NKLLEIGVPCNEVPEPKWRMIDDDTLEVDGQIMKKPFVEKPVDGEDHNIYVYYPKKNG
                     GGGRRLFRKIGNKSSVFDPTLNQIRDSGSFIYERFIDTDNFEDVKAYTVGPTYCHVET
                     RKSPVVDGIVRRNTYGKEIRYVTRFSEEEEEMARRVSTYFQQTICGFDLLRTCGKSYV
                     IDVNGFSFVKDNNEYYDKCADILRNMFITAKRRRALESPVGHSEERKQKWVFKGFVSV
                     VRHADRTPKQKFKYSFRSPIFISLLKGYKEEVIIREVRDLKVVLETVRVALEEHLENA
                     KKLEQLGTALEKKMYFPGTKVQLKPALSENGEIEKVQLILKWGGEPTHSVQYQASDLG
                     EQFRQDIQLLNQKALEDVQVFTSSERRVVASAQLFSKSFLSVDRLPDAFLQVRKDLLD
                     DSNAAKDLMDKVKKKLKPLLRQGKEAPPQFAWPPKMPEPFVVIKRVVELMNYHHQIME
                     KNFATKDINNFQTYWCCGEDPYLFKERWDKLFQEFVSVDKVHPSKISELYDTMKYDAL
                     HNREFLQRVFDDEDYRGKETLSHSLVKEYPINVLAMNDFKVKDSVLDPAQNPAGSIGW
                     VLSSSHKPSSREDGNSPFDDPKYDLLRELYRLSKVLFDFICPQEYGIEDNEKLDIGLL
                     TSLPLAKQILRDITGIKETDKAATRIYFTKESHIYTLLNVIYESDIPMKIARNALPEL
                     DYLSQIVFELYESEDSGYKKHSIRLSLSPGCHTQDPLDVQLDDRHYISCIRKINLTRH
                     LDMDMVLQKLRSRFSRVSLPKKFTPVNITSPLVGASPSPR"
     gene            <583963..>586595
                     /locus_tag="FOA43_003500"
                     /db_xref="GeneID:62196900"
     mRNA            join(<583963..584019,584073..>586595)
                     /locus_tag="FOA43_003500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923751.1"
                     /db_xref="GeneID:62196900"
     CDS             join(583963..584019,584073..586595)
                     /locus_tag="FOA43_003500"
                     /note="BUSCO:EOG093408C9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779679.1"
                     /db_xref="GeneID:62196900"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF04192"
                     /db_xref="PFAM:PF12894"
                     /translation="MYKHRNALPPLKLISNMFSLSLPESATESILKITVFGSYLVAST
                     MSTLYVFEKETSESKYATDYYSSIPLNSGYGSIMDTAHLPTHVNKILVATSSCLVVVN
                     VRTTKILYTTEKEMFGAITCIEPTPALDVIAVGNDVGEFTVYNIRKNKILQHASTGSC
                     SQITSLSFRTDGTPHCVCSLRSGQLFFYDLARKCRVHILRNAHQEAYGGATKSLFLNG
                     QSIVVSTGPDNTIKEFVFDPVLSTTNSSVVSPPRHLRSRGGHSAPPTCLLFADDDSHY
                     IQSASQDKSLWMFSLRKDAQSQEMSQKQSREKNGKRVAGVVSQYKDKFPPILMIAQEN
                     SREGEWDNVLTAHQEETFARTWSSRNRKIGKHQLATIDGGVVKCVAMTQCGNFGLVGS
                     SKGGIGVYNMQSGILRKLYRLHKKAVTGVAVDGMNRKMVSCGIDGIVGFYDFSKSRFL
                     GKMQLEAPITQLVYHRSSDLVALALDDMSIVVIDVSMQRIVRRLYGHRNRITAMDFTP
                     NGRWLVSASLDGTIRTWDLPTGGCIDGIKLDNVATCLKISPHGDYMATSHVNGVGISL
                     WTNKAQFHPVSTKNIEDESEFANMMLPNISGDGGSSVLEGAFVENDASDGSQGGIYIS
                     ADQIDSTLVTLSHCSRGKFSTLLHLDNIKLRNKPVEPPKKPESVPFFMGLGGDVVGDK
                     AKVAEENGNGSQRADENVQNVQMESSKLLDLRSNEGVKFESKFTNLLRTAGQASDGNY
                     SAFIEYLVDSSPASTDLEVRSLSTSAPYDEIFWFFQALSFGFHQNTNFEILTVIMTMF
                     LRFHGDTLHNIRSLAVDGKNSDSLRVVAAIDELTLVSSTENDKMDQLVKYSSGVVNFI
                     TTA"
     gene            complement(<586636..>589758)
                     /locus_tag="FOA43_003501"
                     /db_xref="GeneID:62196901"
     mRNA            complement(<586636..>589758)
                     /locus_tag="FOA43_003501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923752.1"
                     /db_xref="GeneID:62196901"
     CDS             complement(586636..589758)
                     /locus_tag="FOA43_003501"
                     /note="BUSCO:EOG09340C0O"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779680.1"
                     /db_xref="GeneID:62196901"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF10366"
                     /db_xref="PFAM:PF10367"
                     /translation="MIEAAIPASSFKISELSDNPSLRITASSLSSNNQLFLGLSDGKL
                     LLFQLPTKQDVVNEKSQESGTGTLDFSKIEEEEPTLINSLQLENPVTQIEYLEYLNYL
                     VLLSNKTVQIYSINSKHQLKLVDSFQEFNFNLIKTWSDTDSNAILANSSFSGIDMGGD
                     INEEDSEYDNQDEDSISLATVKFQNRPKTGTEKKFIETHSNCHYLCMVSKRNLVVLRW
                     GLKDFETKLEFKLSDKICLLQFLNYETLLIALESGDFVKMNINTGITNPIQFQFLSGN
                     GNLSSISKSSFFFGATNNSITEAFKTVNDKQLVVLKDGNLIKMNNSLEPITFHRSCHS
                     IDFKNPMPVSQYSTAAARSGSQNKLKAVKYWFPYIVVVYGNSIEIHNLEDFSLVQRLG
                     VWNPKKLGNVLRVEINSKNMLLITTNGVFKFLRTNYNYQLSQFEEIKDFNNAICLLEK
                     LNPIILDEGVEDNIIQTVEHSHSARQLKFMKLRKFQLLKAQELLETGKFDQAMRLFIE
                     FIASPSYVLQHLPERIKEFLKEKNFELLLAEATNDINGTKDVKPEISTMTSDAQSVTR
                     RQISGLHIKRKDEKMLNELITYLTDSRRKLTRLLDPDQPKFQWHGYTISLSLYEELQT
                     DSDLSATDNLRLIDDHLLVCYIITNPRMIGPFFRIPNYCSFEAVEDKCLKLKLHSELI
                     DFYYVRGAHEKALQLLERLCFENQGIDNLDDRNSSLSLIFNAEYMVRYLQKLTNKNLA
                     LILKYSRKLIELDSGYFKMIFMNNSSESVGLDRLNVLSYAQRHNWTDVRIPYLEYAIF
                     GLDDHDERLVNALLGFYFDQDLSRIYNSVYKLYKLGNYNTGKTLKRLNDLEKSSLDDK
                     QKKLILRLKIDPLRRLARHEDALHIFLDDLNDNRGAVTYCLDVRDENPEKGVSLIYKL
                     LTIYLDGGDTASILSFLNDVRLSFLDPASITERLPDTIPLKIITPFLEMNLRNINSDM
                     KSTTLESELLKSRMINSKYNKLRLQNEHFTLTAHSTCPVCQKTFGATSILNLLPDGTV
                     IHYGCSRNMK"
     gene            complement(<590550..>591699)
                     /locus_tag="FOA43_003502"
                     /db_xref="GeneID:62196902"
     mRNA            complement(join(<590550..591404,591694..>591699))
                     /locus_tag="FOA43_003502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923753.1"
                     /db_xref="GeneID:62196902"
     CDS             complement(join(590550..591404,591694..591699))
                     /locus_tag="FOA43_003502"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779681.1"
                     /db_xref="GeneID:62196902"
                     /db_xref="InterPro:IPR025124"
                     /db_xref="PFAM:PF13259"
                     /translation="MFRQADLACEMPSPGSSTIVGGGLENSGKGDKTAVDSNIPSGVR
                     KFVLSIWIRWSKLINRIRYISEACMDSDEITDELFDDSTVTVTGSQYNGQNNDNCNCK
                     VCRCRGSTSKCQNKVTTGDASNTRSLPSTVRAHKMITLEDRLSFGDTTGTTSDNRHAI
                     SLTSESETTSEPRSKEILMLHENSSQPFIGGEKLWDAQNRAWLTPSTENATIQGQMRL
                     LKKQQAQELRNHVVSRDYPIVYRNLVVQNRALKHPLNLRDLMKVLEVGWNWSRTFDTG
                     SVSQRPNHVN"
     gene            complement(<591923..>593566)
                     /locus_tag="FOA43_003503"
                     /db_xref="GeneID:62196903"
     mRNA            complement(<591923..>593566)
                     /locus_tag="FOA43_003503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923754.1"
                     /db_xref="GeneID:62196903"
     CDS             complement(591923..593566)
                     /locus_tag="FOA43_003503"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09344CBT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779682.1"
                     /db_xref="GeneID:62196903"
                     /db_xref="InterPro:IPR013951"
                     /db_xref="PFAM:PF08642"
                     /translation="MAPVRSSRDNNTASTNDQLADGNSSTSMRLPSMTYPQGTVRTTP
                     PTSNESEYGNNGQQQNATSSKPDLESEYHRRAHHSRHRHHHRVEDGLGEKIKEAQSQL
                     KDGGHIHIVHEPHGDHHHHKVYVHNPLSSATNEEMAGFTSSQQQQQEQQEQQEQRERQ
                     EQQEQQEQQEQQQQPHESQQEEHTFTKPSANNESTILQGDSTIADNSTTLNQTTILDQ
                     STIAAQIAAQPFEKGRMTVTSWNVLEEVSKIPRKHLGSIVYDEYPTYHTAIRYLRNMS
                     VVDLKLLEDDEKRYFEVEKKRKEFGIHQNKRIELLPDTIRNYINCTIDVYVPYGALFD
                     NPNVFDNRVWGTDIYTDDSDIVAILYHCGVLHSQDPTRKRSKKVPRREQQQQKKDLIY
                     SSTTHEYQFTNFTGAITPGNQNNLHNIVNATSNEDDAADLIVTLLILPTLRKYQRCYR
                     NNYNSRSWINHDGCSIALFGVRWCQVGEGIYYGGISQHGSFRKRLLNERLEIAEKARR
                     QKDPEPFKGNVERKETKETIGRWAADKRFWRQNIGDSSE"
     gene            complement(<594814..>595404)
                     /locus_tag="FOA43_003504"
                     /db_xref="GeneID:62196904"
     mRNA            complement(<594814..>595404)
                     /locus_tag="FOA43_003504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923755.1"
                     /db_xref="GeneID:62196904"
     CDS             complement(594814..595404)
                     /locus_tag="FOA43_003504"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779683.1"
                     /db_xref="GeneID:62196904"
                     /db_xref="InterPro:IPR024388"
                     /db_xref="PFAM:PF12824"
                     /translation="MFAKSAKRVCSSVGRFAAVRAKSSLPEKLPEKLSAVPNKYNSKS
                     SAFNLKPNMSDGLFYQPAPSPLDPKITPKAFLPDTDPRKVSDLYYPEEDRLIKDNVKY
                     MPIIYKASRAKNYSMTKDDVIELQKMRDAGATRKQMKEKFKVSDFFISIATESNPEKI
                     IREKKLLKKQVKRWSAKTSVARKLKEKQKLMWEADL"
     gene            <600753..>603011
                     /locus_tag="FOA43_003505"
                     /db_xref="GeneID:62196905"
     mRNA            <600753..>603011
                     /locus_tag="FOA43_003505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923756.1"
                     /db_xref="GeneID:62196905"
     CDS             600753..603011
                     /locus_tag="FOA43_003505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779684.1"
                     /db_xref="GeneID:62196905"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="PFAM:PF00515"
                     /db_xref="PFAM:PF07719"
                     /db_xref="PFAM:PF12895"
                     /db_xref="PFAM:PF13176"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13432"
                     /translation="MNIPDQSIQQLRPTVIYCLDHELLPSAEFTAERLLAQDSENPDS
                     IFLYALTIYKEHRFKAAYNAASRCCTTHVGCSYIFAKSCLQLEQEPDGISSLTKTMPL
                     WSQITSQEVKQYEPDNIACYMLLAKLYYVVGDTTRSALNYGLVLKLNPYIFEAFEQLC
                     KLGARIKVNSIYKSSNPMGDLPGELFHTSRVSNDVKNSLRSSRSSVGDTTNSMTALAG
                     LTRKIQATPALGYMEGKNMPEPKANLFKTPIAKSKMATHVLESVTSPDDKQSSNSSSY
                     VPTNFAITPRTTHVTHSILEAPSGRYASDTMPRKKGRSAASSITSRLLNHSLSTLSGT
                     VGGNNAASGVSTISSAASQSLNTSSYGHTSPIGTRDTASGIKRVIASTFGGSGVDSRG
                     SSATIVTGSTGKNYGTDQYASDDRVDSILKNINDDYLVSVYSKMAKGYRAMCSYDCFK
                     AIRIFNSLPENERNTPWVLAKLGRLHFEIVNYEGAEKYFVKLRKMDRTRVDDMEYYST
                     LLWHLHKEIDLSFLSHELYEINQQAPQTWIAIGNLYSLKREPDEAIKCFQKAIKLDKK
                     FVYAYTLQGHEYLANDAIENAMECFRHAIALDKRHYNAFYGIGMVYLKLGDFRKAEFH
                     FRKASEINPVNVILVCCVGMVLEKLDKREEALRQYVFASKLQPLSMLALFKKAQALFS
                     LKRYELALKDFQKLEDMAPDEASVHFLLGKLYKFYGRKNDAIKQFTVALNLDPKGSHL
                     IKEALENLQTWN"
     gene            complement(<604581..>605090)
                     /locus_tag="FOA43_003506"
                     /db_xref="GeneID:62196906"
     mRNA            complement(<604581..>605090)
                     /locus_tag="FOA43_003506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923757.1"
                     /db_xref="GeneID:62196906"
     CDS             complement(604581..605090)
                     /locus_tag="FOA43_003506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779685.1"
                     /db_xref="GeneID:62196906"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="PFAM:PF01165"
                     /translation="MFRPGQRQVTLISVKCLARFGSSATSSSSKNDPLSILSSMTRQD
                     AQKTAKKTASNSESLFSFLGDSALSSSGGNAKINAFEFAKNLPLQDNLAGRSMLVRRS
                     SSIGRSISQFDTLVRSNNLRDLSYDQRFYTKPNKRRLAKRIANKKKRFDAGVADLFQI
                     VKDAVRKGY"
     gene            <605620..>606852
                     /gene="MAP2"
                     /locus_tag="FOA43_003507"
                     /db_xref="GeneID:62196907"
     mRNA            <605620..>606852
                     /gene="MAP2"
                     /locus_tag="FOA43_003507"
                     /product="Methionine aminopeptidase 2"
                     /transcript_id="XM_038923758.1"
                     /db_xref="GeneID:62196907"
     CDS             605620..606852
                     /gene="MAP2"
                     /locus_tag="FOA43_003507"
                     /note="MEROPS:MER0001728"
                     /codon_start=1
                     /product="Methionine aminopeptidase 2"
                     /protein_id="XP_038779686.1"
                     /db_xref="GeneID:62196907"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR036005"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF00557"
                     /translation="MSEQAVEKKLKQLDLEENKAEEVKEAGAVANPKEGDADGEKKKK
                     KKKEVKGISTFYPEKIYPEGEWQDYTGSEENLKRSTDEEKRYNDLKENNKWNDFRKAA
                     EIHRRVRKYARKHIQPGMTMIEVCETIENAVRTFCETKQSLKAGMGFPCGVSLNNCAA
                     HYTPNGGDKTVLDYNDVMKCDFGVHVNGCIVDCAFTHTFNPRYDPFLEAVKEATNAGI
                     SACGIDVRLTDIGEAVEEVMESHEVELDGITHAVKCIRNLNGHNILPYRIHGGISIPI
                     VKNGDNTKLEEGQTIAIETFGSTGKGYVDYTGGEVSHYMKNANPPPRAAIRLSRAKHL
                     LRTIDRNFGTIPFCRRYLDRLGEDKYLLALRQLVKVGLVTEHPPLFDAKGSYSAQFEH
                     TILLHSTRKEVVSRGDDY"
     gene            complement(<606987..>607937)
                     /locus_tag="FOA43_003508"
                     /db_xref="GeneID:62196908"
     mRNA            complement(<606987..>607937)
                     /locus_tag="FOA43_003508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923759.1"
                     /db_xref="GeneID:62196908"
     CDS             complement(606987..607937)
                     /locus_tag="FOA43_003508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779687.1"
                     /db_xref="GeneID:62196908"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="PFAM:PF03908"
                     /translation="MTDIVTLFDRFHDLLREIETINYKLAVTKPSTFNGTLTKAVDFR
                     SEMYDKMMELYDHTRDIIACLEYDVFSQRFQQYDDYQYEYFKLKERYQDLKVDFRKIQ
                     LESKMHELDHTEDSKEGEESEINGAESPGNFLDDEKLKDLTEQEQIFEKNKQITDKLE
                     NITTIMHGNLIAGESNLQDLGASTSVLTDLANKYGYFADILLKTNGLVKMVNESSNAE
                     RRQIYRSLYFFIFVCAYILYKRIFKRPIKLFLWLLYSFFRYTLLGGQKLVGRQEDTAK
                     SILESVTRGLIASMDVSPTTSVPSTVSTESIVISGLRDEL"
     gene            <608158..>609351
                     /locus_tag="FOA43_003509"
                     /db_xref="GeneID:62196909"
     mRNA            <608158..>609351
                     /locus_tag="FOA43_003509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923760.1"
                     /db_xref="GeneID:62196909"
     CDS             608158..609351
                     /locus_tag="FOA43_003509"
                     /note="BUSCO:EOG09341WI6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779688.1"
                     /db_xref="GeneID:62196909"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019585"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF01399"
                     /db_xref="PFAM:PF10602"
                     /translation="MILEEAITIARIPDSEIGQKSFLIQQGEAALLPEVVSKIKDNDM
                     APYYHYLYYDMKLVGLKWDQSLFDSLKANNDVRVKELQEEIAKLDKEDEGEIDILKKW
                     IELAEYYASIGDKEKTVSTIEKTIELAPSTGSKIDLYLTVSRIGFFYDDKIFTKHYLD
                     EANSLIEKGGDWERRNRYKTYMGIYLMSTRKFDEAAKLLIDCLSTFTCTELASYDEVA
                     QYSLICGSLSLTRPDLKKKLLESPEILSINSNSDKLKPVYELIQALYLCQYKNFFPKL
                     LQTSDQILTKNKYLYPHANYYKRELRCRAYAQLLESYKSISLKSMADSFGVSVDFLDT
                     DLCKFIPSKKLSCVVDRVNGVIETNRADNKNTQYHLLIRNGDALLTKLQKYGAAVRLS
                     GAEKV"
     gene            complement(<609394..>610818)
                     /locus_tag="FOA43_003510"
                     /db_xref="GeneID:62196910"
     mRNA            complement(<609394..>610818)
                     /locus_tag="FOA43_003510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923761.1"
                     /db_xref="GeneID:62196910"
     CDS             complement(609394..610818)
                     /locus_tag="FOA43_003510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779689.1"
                     /db_xref="GeneID:62196910"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF12265"
                     /translation="MPINLDLTQNDNVPSKSDIILQPFASSPLEVLEDTDTDDSSPAI
                     DDEIQLKYKIWKKNTPLLYDYIQTSTLLWPSMSVEWFPDVESHGNVNIQRLLLGSYSN
                     GYNSFENLQLCTIKVPKSVEGLTLKDCEFDSDKHEFTTSNYPIANNDGNCKGALHMVQ
                     QIPHQGDINKARLMPQNPDLLATISNNGSVNVFDRTKKPNGCDSRELSKSRKVFDDEE
                     EESTCLSDIKLQFHTGDGWGLDWNKFKEGELVTGASDGSIALWDIRDGFKKPQRSSNA
                     VTATSHRKFKTCILSPISTLFCHDYGVNTVQYVWFHDSLIGTAGEDHKFKMFDTRSLD
                     GNPVIQITLQHPINTLDFNKQDQYGLVLGDDKGNLLIEDIRYPERPQIVISNAHSDSI
                     TAVAWNHEYGNILGSSSTDGLVKLWKFGSGESSTIEHKLIFTHGGHMLGVSDIAWNPN
                     DPKMLASCSDDNSVHVWKPSQAVF"
     gene            <611987..>613474
                     /gene="UGP1"
                     /locus_tag="FOA43_003511"
                     /db_xref="GeneID:62196911"
     mRNA            <611987..>613474
                     /gene="UGP1"
                     /locus_tag="FOA43_003511"
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_038923762.1"
                     /db_xref="GeneID:62196911"
     CDS             611987..613474
                     /gene="UGP1"
                     /locus_tag="FOA43_003511"
                     /note="BUSCO:EOG09341N7Q"
                     /codon_start=1
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="XP_038779690.1"
                     /db_xref="GeneID:62196911"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01704"
                     /translation="MSSKHAKSQSMYAFENQSSSIAASQMRNALNKMIDGVTDKDRRE
                     KFEKDMDSFFGLFRRYLTDKAKGTTLDWDHIRSPNPDEVVAYKSLDVEGSENLSKLAV
                     LKLNGGLGTSMGCVGPKSVIEVREGQSFLDLAVRQIEFLNKKYDTDVPLLLMDSFNTD
                     ADTQLIVKKYQSHRIRIRTFNQSCYPRITKDSLLPVPQSCDDDLSFWYPPGHGDLFEA
                     IVQSGELDHLIEEGKEVLFVSNCDNLGATVDMKILNHMVETNSEYIMELTDKTRADVK
                     GGTLINYEGQVRLLEIAQVPKEHVEEFKSIKKFTNFNTNNLWINLKAIKRLVEADSLR
                     MEIIPNGKSISVGNSEMGVLQLETACGAAIRHFKGAHGVVVPRSRFLPVKTSSDLLLV
                     KSDMFNLRHGTLVLDPARFGGSPLVKLGSKFKKVSDFQKRIPHMPKVIELDHLTVTGD
                     VYFGRDVQLKGTVIIVCSDGQKIDIPNGSILENVVITGNLQILEH"
     gene            complement(<613653..>614050)
                     /locus_tag="FOA43_003512"
                     /db_xref="GeneID:62196912"
     mRNA            complement(join(<613653..614032,614044..>614050))
                     /locus_tag="FOA43_003512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923763.1"
                     /db_xref="GeneID:62196912"
     CDS             complement(join(613653..614032,614044..614050))
                     /locus_tag="FOA43_003512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779691.1"
                     /db_xref="GeneID:62196912"
                     /db_xref="InterPro:IPR009292"
                     /db_xref="PFAM:PF06102"
                     /translation="MLLNYERIRNDYNFLDEYREKEVLEMDKALKDNKLLGRMSEEEV
                     EGLRYKDQSIKSRLGHLKEQKFEKNALSNYKEETGRKWIKRGDRRKVVRVAKFESMSG
                     KQRLKSMERKRKRKMGKEMRTFAFSK"
     gene            complement(<614497..>616074)
                     /locus_tag="FOA43_003513"
                     /db_xref="GeneID:62196913"
     mRNA            complement(<614497..>616074)
                     /locus_tag="FOA43_003513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923764.1"
                     /db_xref="GeneID:62196913"
     CDS             complement(614497..616074)
                     /locus_tag="FOA43_003513"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779692.1"
                     /db_xref="GeneID:62196913"
                     /translation="MATFAPSQQDVAELFDGEDKPVSRNDNLKLTDDEQNESRLIPFS
                     IELLDKIFEYSYYLEDEAKKQQKRMRNIDNLSSVNSVFYCLSLKYRYRYCVFIRSNMF
                     YRFLLTLMSGPQNGLGRFVQTLDFQEFTSVGLGRSSAMMLEIQDLTERTILQCLRLTP
                     NLRQFLASESIEDDISTDIVDYLFNSMPLLECLDFCGSSGFKFANAFDSLPCVNLNDS
                     LQRLSFHDCTDLSPATFRKILPGLHNLQRLDLTHTRVSAKDLMQALSNDCRLTHLSLS
                     KCSNIGATHEFIRLLVNHRAINHDGLLWLNLQNEYSVAILKAETITYLLQSLKCHNLK
                     YLNLNGYSEVCQSHLNIITRKFLQLKSLSISHLEHGSDLSALKQLLYLKYADLSSYMA
                     TKGELYNALLSLPEGLQTAEIKVSVSDVLPDVFVVGNKYWRCHNAGGQSRRVWVHRVD
                     SYEEAELYDNFYDNKIFFNIETGERYDGEFKRPSFLKYASRKINCSKFQHHRPDEEIF
                     PNGMSERGLYRYYSLHK"
     gene            <617008..>618633
                     /locus_tag="FOA43_003514"
                     /db_xref="GeneID:62196914"
     mRNA            <617008..>618633
                     /locus_tag="FOA43_003514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923765.1"
                     /db_xref="GeneID:62196914"
     CDS             617008..618633
                     /locus_tag="FOA43_003514"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779693.1"
                     /db_xref="GeneID:62196914"
                     /db_xref="InterPro:IPR007300"
                     /db_xref="PFAM:PF04172"
                     /translation="MSETSTPISDSTTYRKPNMSRCIKFLLQYILQKYILVAIGVVMT
                     LVILYGINEIIKLTTIDFPASVCLMLIVFFLLSLSSWLKGEDFTEKYFLKYIDIPFGF
                     NLRWMNLYFTPPFVTLVLADKVTVQEAFIIAAVFIFGYIIGFAFVGYLVWGLQVVLGT
                     YDHQKEPSTAGNDSEKEGSTNNQSHQEHLSPSLGDSGDSIVSYEIDPDEFSDVDQGNQ
                     LNEGYALSAVSTRLSTATAMAASITNQESQLDPRYLEKFTLTFDFAVYLLLFIVGLPI
                     YFCTGYEMIVQLAVAVLLFKACLLPPPKIKKYLHPILVSFSLSLLVYYILSLIKKQNF
                     KQTISNYESGRKYTQLFNNEQFSKWPGAGDILLSLMDISIVALSLAMYRYRKDLRRYF
                     FALMPVIIVFSFMSLLIYPPLCYHLSISPERSLGFTGRSVTMALGIPLVHSLGGSEQL
                     MAVTTILSGILGVFLGDWISFTLLRIRKADFVSRGVTLGVNCGAVSTAHLLSVDPRAA
                     AMSSLSFTLFGTLMVILAAITPLVKVVRDLVGL"
     gene            <619945..>623184
                     /locus_tag="FOA43_003515"
                     /db_xref="GeneID:62196915"
     mRNA            <619945..>623184
                     /locus_tag="FOA43_003515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923766.1"
                     /db_xref="GeneID:62196915"
     CDS             619945..623184
                     /locus_tag="FOA43_003515"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779694.1"
                     /db_xref="GeneID:62196915"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MSAKAVTKYSSGYSPDEHKQKSVSENSVSVTPFVSASSSSSSSA
                     SSASSAWNIIKNPSSGRTRIGQACDRCRARKIKCSGKSETNPRCTNCEKDGFQCIVSD
                     KLTRNSFPKGYTKNLEKKLLEVELDRNKLSLKLKDARKMLFELQDKVSSCNHQDNYDE
                     KKKLSDVGGSVKNFDDQPKDMQLLEPKARDTHITSCSALLDTFQTDCNGLLVLDQFMV
                     LPFDKFLTKLQIHCFNGYEMSSESQSESSKVGRSIDSVQIRGHEDATSDFTSLSKTSY
                     SSPQKSVDKPYGDENDPEMNVLMNYHMNLNRYLNLILYKLILPSFSAGTSEGKGKFSS
                     NKNGEKNLDHLIWLFFNVYNKLIPILDFELFYNDYLTFINKYTLKNSTYVENGETKKR
                     YYDFSSKEQDLLVKLILILKFTIAQPKGSGLSSIPDGKSFNQLDESLKLINLKNLKLM
                     FRNMNFTLDLTMDRLEVGLMLFYYLIKFENYNVCPMSKMHTSEQRFKSNFLRDVALLC
                     LSLKDSLHFNRDVSHLSLARKNGVNHQIIKIQRLKIYWDFRILIGLAEVYFNIDFDSI
                     TPERESVEMRPQSLESIRFVSPDIEVTLQLVNLLDITPKNILELCVKNEEAALESYDQ
                     RLKDWISEVNSLQEDENVSVFNKLKTYYYYFKIVIHLNKGGDALVDACSGFIDTAYEL
                     IYTGKNTEVSVENAEGLSQHSFNFHLMCMVSIIMLGKGNSKSRDLSIKLLRISQLYQL
                     LISIKDVEPIICDLTKYVSDNVALNTSSDTISHDMLGLFSYSMTPSSSSSSSLFAKNT
                     PVPPGNSHFSDSNKDMDSEMAFDLSAFKMSSDSRFMPAKENPYKRTKRSQSPTSSISA
                     VSSGNSSGSSKRLSVCSNDTTVTPVPLLFPSLAPRVPKSLSSVSSESNAAQKRRRPYF
                     DDAPASGRLTHSEELSHATKVRSMSIDSGILPSSKAAPADVTMAAFSRSASECGTNNH
                     EPGLSIPHSFSNLFNEFNLSMASDEDMDFIQKSTSNERSTLPTIPSESNLEESIVQGS
                     GSLFPSDMDANTFGGQSDLGKKQGMAFKDNEDLNRLRRRVLNMRASMTS"
     gene            complement(<623311..>626355)
                     /locus_tag="FOA43_003516"
                     /db_xref="GeneID:62196916"
     mRNA            complement(<623311..>626355)
                     /locus_tag="FOA43_003516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923767.1"
                     /db_xref="GeneID:62196916"
     CDS             complement(623311..626355)
                     /locus_tag="FOA43_003516"
                     /note="CAZy:GT2_Chitin_synth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779695.1"
                     /db_xref="GeneID:62196916"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01644"
                     /db_xref="PFAM:PF08407"
                     /db_xref="PFAM:PF13632"
                     /translation="MPSFNPFRDDDSESPIRRPAEAYTPRASPRHSPSKAALKYSPAK
                     HLLPSNQSGSFLNSSDMAKNFVNDAEDQTARKRFTLHESPKRQRPVSALIHDAAINSD
                     MNSLDDNSIADEDDIFSHYSSNIFNSPSKKRSGRSDDFVKSIGSDRTALERAKPIFSA
                     STYAAANSDVDNPFTDVPSLSASRRNLSRGSRSTLHESVDLTKKETMESSYLDTQSTL
                     NDEYDLDSDNNESKTKKDQTFQSSLDGHFFNQVSGDFQPRRYGATQKIFRSRNGNLIL
                     DNPVPSILHSFLPAKGQDEFDYMKYSAVTSDPNDFINDGFTLRTNELGRETEIVICIT
                     MFNENESSLTRTLHAVFKNIAYLSKRKNSNTWGPNAWKKVVVLIVADGRNKINPGVLQ
                     VLAAMGIYQEGIAKSFVNQKEVQAHLFEYTTQVSIDENLKFVGHETGLVPVQVVFCLK
                     EKNAKKINSHRWLFNAICPILQPNVCVLLDVGTRPHEQAVYNLWKAFDVDSNVGGAAG
                     EIIAMKGKYWRRLINPLVASQNFEYKMSNILDKPCESAFGYISVLPGALSAYRWSALK
                     YDEEGNGPLQKYFDGEKSDEAIGRDIFSANMYLAEDRILAWELVSRKNAKWVLKYVKS
                     AKGETDVPETLSEFISQRRRWLNGAFFAALYSQLHFYNIWYTDHSFLRKLFFHIEIIY
                     MALTLFVNFFSVANFYISFYYLAGALITIAGTGGEVCFQVMNYLCICTLLAVLVISMG
                     NRPQGAPKLFITAVIILTICGGYAIVSGFYFLGMMIYEKELGASNGSSFDSICISLAS
                     TYGLYIITSFIYLDPWHILTSSIQYFLMLPAYTCLLQIYAYCNTHDVTWGTKGDNIPP
                     STLGKATIERDEKGQEVIKLEIIGEQRDIDSMYSENLYKLKERRKQPEEMREGSPVKQ
                     KISATDYYRDIRSRVVLFWVIMNVILVMTIKQIWSADSIQDNKYLSFLLWTVFGFSLF
                     RFLGSLSYLLHLCIRKIVVTKNKLDIHRRGKSDAVDMVMAPN"
     gene            complement(<627677..>628393)
                     /locus_tag="FOA43_003517"
                     /db_xref="GeneID:62196917"
     mRNA            complement(<627677..>628393)
                     /locus_tag="FOA43_003517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923768.1"
                     /db_xref="GeneID:62196917"
     CDS             complement(627677..628393)
                     /locus_tag="FOA43_003517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779696.1"
                     /db_xref="GeneID:62196917"
                     /translation="MSSKFETVPFKKLSKYDSSKNWIHLPYRSNLSITFNMPIANDCN
                     PGCLLIKITWKAEDLERLTFEHNEACKVYKKYPLIAIKYTPISGIRKKFQMGFSSRKD
                     FERSLQCFNSWGIIVKDLENRDINLLEMSQFSTDPDLGFSQQFDMSFLQEVSGSQQIM
                     DTSNSFCDDNTQRTSNFHENINLTPSTLFLDYEAQRNSSGEVADSVIKQINIRLEDSN
                     FIKMVRNAAERIKKKLEKKY"
     gene            <628751..>630385
                     /locus_tag="FOA43_003518"
                     /db_xref="GeneID:62196918"
     mRNA            <628751..>630385
                     /locus_tag="FOA43_003518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923769.1"
                     /db_xref="GeneID:62196918"
     CDS             628751..630385
                     /locus_tag="FOA43_003518"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779697.1"
                     /db_xref="GeneID:62196918"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF13520"
                     /translation="MASDSCDKRSYTADEQIIVESAFDETATDLSLTHLKSFDEVAHL
                     ENMEETPLGRHIGSFGVVMMLVQRIIGSGIFAVSGSIYRDVGGSPFLFFFVWLCAGYM
                     SFAGIFCFLELGSIVPRSGGMKVFLEYVYYKPRMMITVSFGIYSILFGFVITNAIIFG
                     EYTLYAFGYEDMGSQSPKHLGLLFVVFMCVVNGTSAHLAVKLQNIVGVLKLSMLFLMA
                     LSGLWVLLLPHSITHIDNNVHFSDIFAIKREVTLGSFSSALLKGIFSLGGWQTAHVVT
                     NEIQNPVKTMNFAAPLALTIINVCYFFINLSYLVVIPDGDLNDLQEMVGSVLMEKLFG
                     YTLGRQILTSTVAVSAAGNIMVVLYHISRMNQEIFREGFLPFSRFFASNQPFGSPMRC
                     LLFPLVISAVFLLISTPDNVYNYVIDLEGYSLQIFVGLVCFGIFVIHHRRPGFQPKFK
                     ANPVHVIFVTLFSLFMFIAPLNPFSKSTEFKGFPNYAYVALGVIVVCCVYWLVMFKVL
                     PAVGHYQLEQETVLLSDGLTMKKWSKVGDYGNLDVV"
     gene            complement(<630488..>635644)
                     /locus_tag="FOA43_003519"
                     /db_xref="GeneID:62196919"
     mRNA            complement(<630488..>635644)
                     /locus_tag="FOA43_003519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923770.1"
                     /db_xref="GeneID:62196919"
     CDS             complement(630488..635644)
                     /locus_tag="FOA43_003519"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779698.1"
                     /db_xref="GeneID:62196919"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MAANCTNFWSVDDFTSCAKHVYLEEYLYIILVTLSVALLLCQTV
                     SGAKTKDRFKLNDSKGSTEEDPLLPDDTPYSGYLTMEDIESNEEEESTSTSSISADSI
                     GISDHSGSPATVASSNMPKLLKSRHSKLSPSQKHFDVTRIRPVNPDGSPLGYVRVVFR
                     DKGEKTKVALEEILLLCHVGLQILPFYIAGFAQEWKHYQASLYINLTYWVFLLLVCTI
                     RLTHVSTGLSYKLPDLWWYTFTLYLLNWLPSVFLFRSALLNHVETSQAKLFYIVQFIL
                     DSSLAVLSGSCRFSDRPAILLEQDGIKPSPEMLTPFFSSISYAWIDKMIFQARKKSIN
                     MLDIWGLRFDDYAYPVLMKYHKSKYFSRFTYNLFYQFKFYLFLQACLTTVEGLTVFIP
                     SILLKQILEYIDSPDTGSSSLAWLFVTIMFCSSGITSIFSGRGLFLGRRVCTRMKAII
                     IGEIYAKALRRRMTADGEEDTKGKEDEKLVVIDPLADISDENSPKPSKEKDPAFIKSK
                     DLGFIINLMAVDAFKVSEICGYLHYFVNSVVMTIFAIYLLYKLLGWPALAGSFTILLL
                     LPLNYKLSMLIGSYQKAMLKITDKRIQKLNETFQSIRIIKFFSWENKFEDDIMDIRRA
                     ELACLKKRCIASVIASFVWMVTPTIVCLVAFYCYSVVLGKPLTTPIAFTALSLFNLLR
                     TPLDQFADMLSDVVQSKVSLDRIESFLNEPECSKYEQLSLKRSPNSPLVGFENATFSW
                     SQHSKNNFRLRDINVSFKVGKLNVIIGHTGSGKSSLLLALLGEMELDSGKVFLPGGIP
                     RDELVANPVTGLTESVAYCAQTPWLLNGTIKDNILFASAYDRERYHGVIEACGLKRDL
                     DILNGGDATEVGEKGVTLSGGQKQRVSLARALYSTASYVLLDDCLSAVDSHTAVHIYE
                     ECITGCLMKNRTCILVSHNISLTVRQAAWVVIMENGRIKIQGDVDQLMDENEFDDETV
                     SSVLASRSNSSANLTKLDLFDSKVSNTVHPQLLSTSVAALVSNGKTEGIVSRSNNDED
                     EMGDVAAGKLIKDETKSEGAVTLSVYKAYFRFFGTKKTWALLAFAFIGSQFIYVAQSW
                     WLRVWSMAENEKMKPVLASVLETNLRGTMDSALRVLQSISWNEPILSLSFAASVYEKD
                     RIHSTMYYIFIYTLIGVLYSLLGSLRIIITFFCNLRVSREIFQLLLDRVLRAKLRFFD
                     STPIGRMMNRFSRDIEGVDQELASYAESAVVTFIACIATVIVITLITPVFILFAIIIM
                     LLYVQIGIMYLDLSRDLKRYESITRSPIHQHFAETLVGVTTIRAYCDEGRFLIQNMQK
                     IDDNNKPFFYVWLNNRWLAFRADFIGSLVTFLSAALAVIAARNIDSGMAGISLSFAIS
                     FNNSALWLLRTYAIVEINMNSVERIQEYIDQTEQEPPAETKQDPPSSWPERGEIDVQD
                     FSIRYAPGLPRVIDKISFHVNAAEKIGVVGRTGAGKSTIIQSFFRFVDPDTGCIKIDG
                     VNICEIGLSPLRRGLTIIPQDPTLFTGTLRSNLDIYGEYSDLAMYESLKRVNLISNEG
                     YSELVNGEHRLVGLPTVGKPGNGSDEQGENTNKFLDLDSEVSEGGGNLSQGERQLVCL
                     ARSLLKAPKILMLDEATASIDYESDTKLQKTIRDEFSTSTIITIAHRLKTIIDYDRIL
                     VLDGGKIREFDHPYKLIQDKNSQFRSMCIDTGEFDDLAKLARLAYLRSKH"
     gene            complement(<636077..>636844)
                     /gene="RPL2_2"
                     /locus_tag="FOA43_003520"
                     /db_xref="GeneID:62196920"
     mRNA            complement(<636077..>636844)
                     /gene="RPL2_2"
                     /locus_tag="FOA43_003520"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_038923771.1"
                     /db_xref="GeneID:62196920"
     CDS             complement(636077..636844)
                     /gene="RPL2_2"
                     /locus_tag="FOA43_003520"
                     /note="BUSCO:EOG09343GJT"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_038779699.1"
                     /db_xref="GeneID:62196920"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="PFAM:PF00181"
                     /db_xref="PFAM:PF03947"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRKGAAKLRTLDFAERHGYIRGV
                     VKQIIHDPGRGAPLAKVVFRDPYRFRLREEMFIANEGVYTGQFVYCGKKASLNVGNVL
                     PLGAMPEGTIASNVEERTGDRGALGRTSGNYVIVIGHNIEDNKTRVKLPSGAKKVISS
                     DARGVIGIVAGGGRIDKPMLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGAPSTISRGAVPGQKIGLIAARRTGLLRGSKDKVEE"
     gene            complement(<637318..>638931)
                     /locus_tag="FOA43_003521"
                     /db_xref="GeneID:62196921"
     mRNA            complement(<637318..>638931)
                     /locus_tag="FOA43_003521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923772.1"
                     /db_xref="GeneID:62196921"
     CDS             complement(637318..638931)
                     /locus_tag="FOA43_003521"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779700.1"
                     /db_xref="GeneID:62196921"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF16367"
                     /translation="MTEMETTETMERTEATEVTGTAEAPKTLSSSQSIKVHSSKELGD
                     DSEATESSEESPDSTISVGSAESNPNIIPDRVFVGNLPYEVTEEEVRGLTPDLKIVSV
                     EIPKKQFFNKSMSQPIIQSKGYGFITFTSADDATKALKSIAGKKIGEREIYAKAAVPQ
                     SANRQRYGYYNNGYNGYNNYNYNYNYNYGGYGNGGGQIQPDFDAGLDVTKSVNGNSNV
                     NGNYRYYNRMYYPRGGYYYAPAAAAAAAAVAGYYRPQYMRRGGEYPNSGYPTNPMVGE
                     SNDGEGQGVLSSTEADNHMNGTIPTLDAPLIMDTGAIPLTRGYRQPFHHPQKTKEEKL
                     KKLEEGTPSRTTVFVGNLDRNVTVNDLREFFKELEPQWIRVPRKILPKFLYQKFKAQN
                     IPIQNKGIAFIRFANEDNQKAAIERFNGNEFRGKPLNVTVAIDSAPEKDREAKEVLGE
                     EPEAEPTALPEEPPEEEPKEEPNEASEEEPKKEPKEELKEEPKEPPEEKPKEESKNEV
                     EKEVEKEVEKEAEKKVEHLNGSIDAGLSD"
     gene            <639952..>640365
                     /locus_tag="FOA43_003522"
                     /db_xref="GeneID:62196922"
     mRNA            <639952..>640365
                     /locus_tag="FOA43_003522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923773.1"
                     /db_xref="GeneID:62196922"
     CDS             639952..640365
                     /locus_tag="FOA43_003522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779701.1"
                     /db_xref="GeneID:62196922"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="InterPro:IPR036811"
                     /db_xref="PFAM:PF02320"
                     /translation="MSFVRDLIDTLAPTTAYAEEPKEAIEVAEETVIKKDGEDDDDDD
                     DDDDDDDDDDDDDDDDDDEPVDPMETLRDECSKTASCVPRVQAYQACVDRVTKEQEDP
                     GYEKETYKEDCIEEFFHLQECINECSAPKLFYKLK"
     gene            complement(<640553..>641335)
                     /gene="RPL8B_2"
                     /locus_tag="FOA43_003523"
                     /db_xref="GeneID:62196923"
     mRNA            complement(<640553..>641335)
                     /gene="RPL8B_2"
                     /locus_tag="FOA43_003523"
                     /product="60S ribosomal protein L8B"
                     /transcript_id="XM_038923774.1"
                     /db_xref="GeneID:62196923"
     CDS             complement(640553..641335)
                     /gene="RPL8B_2"
                     /locus_tag="FOA43_003523"
                     /codon_start=1
                     /product="60S ribosomal protein L8B"
                     /protein_id="XP_038779702.1"
                     /db_xref="GeneID:62196923"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="InterPro:IPR038524"
                     /db_xref="PFAM:PF01248"
                     /translation="MGKKVAPSPFATKQSKSTKTKNPLIEATPKNFGIGQAIQPKRNL
                     SRFVKWPEYVRLQRQKKVLSLRLKVPPAIAQFSHVLDRNTAAEAFKLLNKYRPETGAE
                     KKERLTKEAAAIAEGKKREDVSEKPYVVKYGLNHVVSLIENKKPKLVLIANDVEPIEL
                     VVYLPALCRKMGVPYAIVKGKARLGTLVHKKTSTVAALVDVKSGDEPDLAKLISSINA
                     NFIDSFDNNRRHWGGGIMGVKHIAKQAKKEKAIASEVAASKA"
     gene            complement(<641602..>643983)
                     /locus_tag="FOA43_003524"
                     /db_xref="GeneID:62196924"
     mRNA            complement(<641602..>643983)
                     /locus_tag="FOA43_003524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923775.1"
                     /db_xref="GeneID:62196924"
     CDS             complement(641602..643983)
                     /locus_tag="FOA43_003524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779703.1"
                     /db_xref="GeneID:62196924"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR031335"
                     /db_xref="InterPro:IPR031631"
                     /db_xref="InterPro:IPR038518"
                     /db_xref="PFAM:PF03200"
                     /db_xref="PFAM:PF16923"
                     /translation="MFWMAFIWLEFSILISLIWALEYETSLKDMFDEANDKSLLWGPY
                     RSNLYLGIRPRVPESLLTGLIWFRADDYRSVGNARHQCDSGDDMDTFGWMEYDPRSVG
                     REIIRDTQLQLSLEADFVKSGDGENWALRIRGTSKDKNAITSLVFYAGMEGEDNALLL
                     KSPKDTPELVKGHEVSMFGFSQPLGGAFLLNITEGNDSRHPKVRKLKDKSLDPSRTHH
                     VSMFVPEDNVWKAKDILLVLLRENMNFGGDVEQLKKIPPVEMLQLKNPSFKDGNVHFI
                     QKTFKGPIEMTVTFNVIESGDQLNDQNFDDKFNKALTGFKDKFNRKFQLERPFANATY
                     TKFARELLSQLLGGIGYFHGNQLVDREANLDQDNVKLEGKPEGPYSLFSCVPSRTFFP
                     RGFYWDEGFQLMPILNYDSDLALDIIKSWFSLIDSDGWIAREQILGEESRSRVPEDFV
                     VQNPNIANPPTMMMIFSQLLHLANLRKEGSIEVTTEGQTVLKELGDVHLTNPDVLNSY
                     AEEIYPKLRLHYEWFRTTQRGDMDAIGRHCRHPEEIYRWKGRDEEHCLPSGLDDYPRC
                     SADASELDVDLLSWMGVMTRSMAKIARLLDKRDDAKLYMQRLGYIQENMEELHWSENN
                     SSYCDITVNDDEEDIFECHLGYASLMPFVHRLISTGSSHLLQILRDIRDPEKLWTEYG
                     VRSLSKQDEFFHQGEDYWRGHIWINMNYLILDALSYYGKHQDTTPEIKELAGQIYKDL
                     RTNVVENVYREYQRTGYAWEQYNEATGEGQRTKNFLGWTSLVVLMMKMPETIQ"
     gene            complement(<644319..>646682)
                     /locus_tag="FOA43_003525"
                     /db_xref="GeneID:62196925"
     mRNA            complement(<644319..>646682)
                     /locus_tag="FOA43_003525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923776.1"
                     /db_xref="GeneID:62196925"
     CDS             complement(644319..646682)
                     /locus_tag="FOA43_003525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779704.1"
                     /db_xref="GeneID:62196925"
                     /db_xref="InterPro:IPR019350"
                     /translation="MLPHDDHIGIQLAYGLYGPAVFNVKEAIGQISGDEPRLFDMARE
                     RRLQKTQIQVVAKSFKVEVPSQKGNTSLGSSRPGLSQHVSTSLAIPSDVICSHKIFEE
                     SKMDISTVGSDSYDPTFGDLMSICSISTVSTRKASVHELKLVATAAGEFGNVVTFGLM
                     DLAKREPRFGRTYTVGVNEVVKQIEVQRVSRRGVVAAIRTDGSIYLLRLLMVGGNSLD
                     VSRIDEIRCELIANNHFAFMSLDAATTRSIAVIDIAGNFALFRISVNHRPFYYNCTLV
                     PLQINTINDPVEFSNFKKIVFNRSRNKLYLLNRTSLHEYNLTKGTMKCKVVAGSWSKI
                     LDFVPLDGLRAIFVMLTSKELIVVDASVGFKRLLAWKHFLSEADSSWKLTVLPLKNSV
                     NYLCLIRSMITNFIYVVELKIGESGPKVIDDPYYIITHPSAPVNSMIVLPLQNDHHYL
                     CQQISPDLEISSCLLNFTTTRNTFPLPLRRLASYSNPPLIGNMPSYSTRLFLELLGEQ
                     QYIQCSVIEQLASSFKDLMTHGSQFGKSFANYCKFPTRGMDPEYSSLEAEVMRLIDKT
                     HSVEEEEELKFTISSNIWVSPENVRKTLIHDIDSFDEFREITTFFERLYSSNDDTRRF
                     ILQYLPLSLLSFCDVDSSKDKLSKELEELQKQLSDDFRDILSSFETDMDLASRFDDVD
                     ESSMGLSQLEVGDSQEMSVPQVSQTRSHSQLLQRHRHRMPSRIEKPQLAASQPHLEGP
                     PGGFGSQSNVNINISSSQTSSLESQTFSLSQNRKSLKKRKKRRTGFM"
     gene            complement(<646860..>648965)
                     /gene="TRP5"
                     /locus_tag="FOA43_003526"
                     /db_xref="GeneID:62196926"
     mRNA            complement(<646860..>648965)
                     /gene="TRP5"
                     /locus_tag="FOA43_003526"
                     /product="tryptophan synthetase"
                     /transcript_id="XM_038923777.1"
                     /db_xref="GeneID:62196926"
     CDS             complement(646860..648965)
                     /gene="TRP5"
                     /locus_tag="FOA43_003526"
                     /codon_start=1
                     /product="tryptophan synthetase"
                     /protein_id="XP_038779705.1"
                     /db_xref="GeneID:62196926"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018204"
                     /db_xref="InterPro:IPR023026"
                     /db_xref="InterPro:IPR036052"
                     /db_xref="PFAM:PF00290"
                     /db_xref="PFAM:PF00291"
                     /translation="MSTELRQAFINAKKEGRAALVTFITAGFPTVEDTVPVLKGLQDG
                     GVDIIELGVPFSDPIADGPTIQAANVVALENGMSVPKTIDLVRNARAAGVTVPIILMG
                     YYNPILIYGEKKMIHDTKEAGANGFIVVDLPPEEAVKFRNSCSLEGLSYVPLVAPSTT
                     DERLELLGEIADSFIYVVSRMGVTGSGISITKDAGSLCERVRKSTGGRTPLAVGFGVS
                     TREHYLQVGKDADGVVIGSKLVNLIKDSKQSDRAAVAEKFAHSILNGKGKNCIPDDVI
                     PEKAVTIEHPDFVEKHKHNPRFGAYGGQYVPEALHSCLRELEGAFEDAIADPKFWDEF
                     HGLYDYMGRPSSLHRAERLTEYAGGAQIWLKREDLNHTGSHKINNALGQVLIARRLGK
                     KNVIAETGAGQHGVATATAAAKFGLGCTIFMGAKDIRRQALNVFRMRILGAKVVSVTN
                     GTKTLRDATSEAFRYWVSHVEDTHYIVGSAIGPHPYPTMVRTFQSVIGKEIKEQFAKQ
                     NDGKLPDLLVACVGGGSNSSGTFSPFEKDTSVKLLGIEAGGDGIETGRHSATLTAGQP
                     GVFHGVKTYVLENEDGQIHDTYSVSAGLDYPGVGPELAGWKDSGRVQFSAVTDAQALE
                     GFRLLSQYEGIIPALESSHAVYGALQAAKKMSKDKNVVITVSGRGDKDVRSVSEILPE
                     LGPKIGWDLRFGSLDDASK"
     gene            complement(<649288..>649803)
                     /locus_tag="FOA43_003527"
                     /db_xref="GeneID:62196927"
     mRNA            complement(<649288..>649803)
                     /locus_tag="FOA43_003527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923778.1"
                     /db_xref="GeneID:62196927"
     CDS             complement(649288..649803)
                     /locus_tag="FOA43_003527"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779706.1"
                     /db_xref="GeneID:62196927"
                     /translation="MSLSTLPNNLVMPLVSNGVSLQAPESISIQDLESGKLNLDALII
                     EVQQLKTKISDLRYEMTQYLRILSSVDENTVPLTVYQEAVNQVATLKASGDAYFNSYK
                     RLLPIIRYSKLKNRINPDDTIRITKHDVPIERLQDSSPGKIKGSGSTPNPTTGRKSGA
                     RGARRRNSRKQ"
     gene            complement(<649952..>650920)
                     /locus_tag="FOA43_003528"
                     /db_xref="GeneID:62196928"
     mRNA            complement(<649952..>650920)
                     /locus_tag="FOA43_003528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923779.1"
                     /db_xref="GeneID:62196928"
     CDS             complement(649952..650920)
                     /locus_tag="FOA43_003528"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779707.1"
                     /db_xref="GeneID:62196928"
                     /translation="MSDMKHGSNRGGRRHIQRNAWSDRVGSGKQIIVYGGAEGSDLDA
                     KLARRKARFAKEDTQFQRDKEKNFGLTSRGEDLRLQTDENARTKLYENTIKRSRQFIR
                     EGGEGRNRDDILMNFRKLRESILRLGATESSKKILLGSMRFSAWIGHYQSYIPTINEL
                     LDNQHLDSTFLDHKELEEAWSYLCLHVVHFGMEYEKGFRIFFDHVKGNETVYRLLVSY
                     TTKDYYTWMKIYSLLSKEKKDWQKINYFKILQSAAYDVVLKSVIKQLQCSYFVLDRKL
                     IEEFTGLQYEILVKRFDLNWTLDLVSSLVKLRERGSREKGDIAQIN"
     gene            <651051..>652091
                     /locus_tag="FOA43_003529"
                     /db_xref="GeneID:62196929"
     mRNA            <651051..>652091
                     /locus_tag="FOA43_003529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923780.1"
                     /db_xref="GeneID:62196929"
     CDS             651051..652091
                     /locus_tag="FOA43_003529"
                     /note="BUSCO:EOG09342L6F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779708.1"
                     /db_xref="GeneID:62196929"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR036477"
                     /db_xref="PFAM:PF00551"
                     /translation="MTASKLLRIGYFGSDYFSINCLKQILPLRFGQPQIISRLDVITR
                     DPKPSGKGLRHLKDVPVARFAEENQLRVLRAEKEVDFDALLANQYDLCIAVSYGLLIP
                     ASFINSLPFGGLNIHPSLLPKYSGAAPLQRALLNEDSTTGVTIQTLHPTEFDKGDILS
                     RQEYEVRPDETFESLTKVLSQAGGLLLKNIIEKQMYDRLSPDYHALKSELLFSYAKKI
                     QSHERHIDWAHYSSFNLKRRSNTLGPLYTFKRIHLGKAREETGYRRVVLNDFKESPQQ
                     QLPSLLVPGCYDLDLTNPNRLLVKTVDGTLSVGHLNVEGLGSLTGEKMVRSSKKMFGN
                     IEKRFLRNQNIT"
     gene            complement(<652106..>661675)
                     /locus_tag="FOA43_003530"
                     /db_xref="GeneID:62196930"
     mRNA            complement(<652106..>661675)
                     /locus_tag="FOA43_003530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923781.1"
                     /db_xref="GeneID:62196930"
     CDS             complement(652106..661675)
                     /locus_tag="FOA43_003530"
                     /note="BUSCO:EOG093400H8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779709.1"
                     /db_xref="GeneID:62196930"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="InterPro:IPR031642"
                     /db_xref="InterPro:IPR031645"
                     /db_xref="InterPro:IPR031646"
                     /db_xref="PFAM:PF06650"
                     /db_xref="PFAM:PF12624"
                     /db_xref="PFAM:PF16908"
                     /db_xref="PFAM:PF16909"
                     /db_xref="PFAM:PF16910"
                     /translation="MLESLVATILNRTLGTYVENFDPAQLNIGIWSGDVKLRNLKLKE
                     ESLDRLGLPIALRFGHLGELTLQIPWSNLKSKPVKVIIENAYILARAKLPTDFDLNKE
                     EAKEQRVKQSKLDELELIDSAEPQSTSVEEQAQNESFLESLTTKIVDNLQVTIRNIHF
                     RYEDDDAFTSIPYSVGITLDELSAVSTDEGWLPGFIVGVASMARKLMTLKSLSVYWDT
                     SSVSIYNEDQDQMIQSFQNIIERTLSSDDVPYLLLPVSGYGHLTVNMKGSTDSAPHYA
                     LELFFDEFGLSLDENQYRDILWTVSQVTWYRKTYKFRCQRPKVSVETDPRQWLRYAFK
                     CVYDEIHERNYKWTWGYFKNRRVQRKEYTSLWKAHLEGEETPDKKLRLDELESVLSFE
                     DIKFYREITRMQYKKQYHALPAPKAPVPSSAPSQSRFSIFSWWNGGQSSLTGDAEGEN
                     NDNDDNNLALSDDQRKELYDAIEFDESKRLADSLDVPRERVMISVGWNLKKGSLAIKK
                     GESIRPLAAIVFEGMHADLFQRKDSYYLGFKLREFKVEDGSENTLYRHIVSVKPFSGA
                     AKSSGEDDDNNSDTEKVEERLDQKEPFFQISYEKHPLDDSADSELLAKMNSMTIFHNP
                     KFLQEVVSFFSSPKTHVDTIGALMNVAESRIHDFTQQTRIGLQYAFEEHKTVNCKMDL
                     QAPLIIMPLDFKSWSSPVCVLDVGHLSVKSDLANKEMIKKISGNDKRSYTEKDWDEMT
                     TFLYDKFNLQLQDAQVLIGPNIKSAIEQLHCKDEKPSLILDHLTISILLELSIVPSYT
                     HLPLIKLSADIPRIKAVLNDYQHRIFMQALSTMIPDFADDSVPSNNSSDNDALRQLVS
                     NDEDDKHALFQKDLEVSDGQKGSPTVDTMQKSDPLVDLQHKLEVDIRVGLIILSISRC
                     SNPETFEADKLADFVGEDFKLNFYNTTKEMHVKVLLANLSVNDFMETTGQEEFRKLIS
                     SKGDSTDDIGSSRQDLFEVEYTRSQRLADFKGELIQAFDQNIDMNISDFKLVVTRKSV
                     LTLMNFMINAFVDPEAPLMPADKLRHNDEADESAPEHIKLNVNMKSITLVLNDDGYKI
                     ATMKLEKADIDMFLLPEKMKVDVTLGGISVKDEINDSFPSLKQLIRIRGSELAKLHYE
                     SFDPATNRLPYSSVLNFETGSVVVTFVESAFTRLYSFMNQFSRMKDIYDGARVAALNQ
                     ASSIESPNKMKFKILVRAPIFVFPDVKSPATGLIDAVTVNLGEIDASNAFTERNGHVF
                     NICTANLKNTKISSNFALSGGLKQKLDIIDRLDLALHVDYYDGVDLDRTSTLIEGSIT
                     GDDMKLTEWQAYYILQIMQSIPRAFTDYSISEKSIEDIEKDANNANMILGKDRSSETG
                     GQGATLGSVGVSSQKEQETAFTSTGAPNKITVEMSFDVPVLALTLYSGTKHVVNIDGK
                     ALSKITLNDVGIEYRLLASGDYALDVHVKSLVVTDVRENRENKFSDIIPASANAEYQF
                     MASVKSSGAANNHHMDLDLAIDSPRLILAMDYLLALKLFVDHVTTTSSTDDLDTRLAV
                     IAEDSSSKNLIEKVPEESEDLKSVGDEESKISYTVNVVDPSIILLANPEKINSEAIVF
                     KISQMVVSSCDTTDLKLEGIGMFLCKMDTYETNRLRVIDDFSLDFSMDSKGSSSTSFL
                     TTITAKIEPLLVRVSLRDIKLALGVFNRANAMYNDASTGAEHKKRSSFGPRSRRASIS
                     SEIGRTLSKYAPSVLSSFTHASGGKTSNKKATVLVKAEKFKANLGGVRLVMIGDVHEL
                     PVIDMQIKPFEILAKNWSTDLQADTSIKPLIRIYNYSTSAWEPLLDPWSFNIHIEKAT
                     HPKPHLAMNIISRRSAEITVTSRSISTLSYFASLIGDNTDIKPRGKDAPYTIINQTGY
                     DLNIWIDEKGSSLEHRKQLTLLKNQEETSWAFEDWRKNRENLSMFTSPNYIGVEFLDS
                     GYHPVRRISLTREGEDVFMLEPSCEDQYHNRLACQIILAPDKVKRVILKSTVTFHNHT
                     STGIYVGVGNYHEEFVVDREIYIPSNEKTALPIDYVYRGKLAVRPETTSEQFGWSKAK
                     TTQDSKSSSFDWKSIMKSELVLECDELGKSMSRNHYYFHANAKYNSEEALNQVYPHMV
                     INITSPLILQNLLPFDIEWQLFQKGGYKWSDELEHGKSCSVHVVNMSYSAVLKVRVLG
                     SSYSMSAAAIVNSCGDDTTVDKRITLKSADGQRLYLNLFYTRGEDSGSKITIYTPYLI
                     VNRTGRDVYVSDSYSTLISRSRYLSVQDKDKALPDMFSFENDSSDGFMHGGFEENHAT
                     IQVGDSKPSRGFGIDKVGQSFEVKVPLKSRALENDVGIYITEGQGIFKLTKVVTLSPR
                     FIVRNNLELPVSIRCVGASNVTQLLSSKVEPIYDVPKTEPKQLVVGFGDNSSWSAPFN
                     INDVGELYVRVKRLDSVAHRLLRVVISTENASIFINIMDAKDLWPYSIRNFSDFEFLV
                     YQSDPNMSIDGTRSSRDPFKPTFYKVPPKSAMPYAWDYPAAEVKELVLRCGNRERFVQ
                     LAEIGTLYPMKLSQNISTSTERPSIVDLNVVAEGPVQSLVISNYDAKTSLYQLKSNPS
                     SRNVGGLGGGSSSSSTEDFETNIKDENYYTSIIFNFEGMGISLINAECKEISYVTVRG
                     AELHYNESDIYQNLAMKIKWIQADNQLYPAIFPIIVYPTVVPKSRKEMDKHPAFSVGI
                     SRVKDNAHGVTYIKLATVLLQEMSIEIDEDMLTALLEFSRLPEASWNSPKIDNLWSEN
                     VEIPEPPEVRTRDDFYFELLHLQPLQFNFSFVRSENAEEGDASASGNPITLAVNALTM
                     AIGNVKDAPIRLSALILENLRTPLPYLQQNIEEHYKQAFLYQWYKVLGSADVIGNPVG
                     LFNNISSGVMDIFYEPYQGYIMTDRPQELGIGLAKGGLSFLKKSVFGFSDSVSRFTNS
                     MAKGLTAASMDKSFQEKRRQTRQKNKPNHPFGGFATGTSSLFEGITSGVAGLAMAPIE
                     GASKEGAAGFFKGLGRGLIGLPTKTATGVLDFANDVSEGIKKTTTAFDTEGLDRVRLP
                     RSVCYDGCVTRYSEREAQGQFWLKTCEGGKYAREKYLAHVMLHGNEHACIVSMSRILI
                     VAVADLTVDWQILYEKIGNITLESTGLRITQIKKSEPERFISIPDQVDQKFLYRNIAI
                     AVNEYNKHCIVCL"
     gene            complement(<661945..>663063)
                     /locus_tag="FOA43_003531"
                     /db_xref="GeneID:62196931"
     mRNA            complement(<661945..>663063)
                     /locus_tag="FOA43_003531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923782.1"
                     /db_xref="GeneID:62196931"
     CDS             complement(661945..663063)
                     /locus_tag="FOA43_003531"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779710.1"
                     /db_xref="GeneID:62196931"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="PFAM:PF14610"
                     /translation="MRFSGSIVLVLGLYSGFAQAEPDNLFKRDNDQNVLSDKIWTSTS
                     SGKNFLITPTAIDGVTISASPVTDSATQWVSLDSSGIPYKVTPVKTDGSTVSVSPTPT
                     ASDYPDPTGGAPPVLRCMNDRVPSDDTTGYPFCIANGTELVVGETYWITWDPTYWGGN
                     VARVRLQTVQYPMKDNDEVLFNSDYISNNNGFYPWYIKSSYKKGKGFFWLTITPLVTS
                     KSDVEHVGTKSGPLLRIVDSTSDASTKISRVPSDNGVTSSSSHSNSSKVKVIVPAVIV
                     PVVVIALVVVLFFLYFNRAKKQGNDPSIGGFFSSIRMKGSKTIEPVTDAERVAVTTDA
                     TSVTSEDLESRLSSVDASTLQTQSISGDPFADNPPESL"
     gene            <665138..>666953
                     /locus_tag="FOA43_003532"
                     /db_xref="GeneID:62196932"
     mRNA            join(<665138..665144,665767..>666953)
                     /locus_tag="FOA43_003532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923783.1"
                     /db_xref="GeneID:62196932"
     CDS             join(665138..665144,665767..666953)
                     /locus_tag="FOA43_003532"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779711.1"
                     /db_xref="GeneID:62196932"
                     /translation="MIYATLTSTTSVNVASGCSFSKTYTATAQADLDSLASCDAIKGD
                     VYITGDLGTGSIANVKAIYGDLIISNATELASFAADSIAAISGELKLESLTILSELSM
                     GSLNSVGAINWVTLPALIDTGLTQVTDCNSIYISDTQLSSLDGLNPINVETYNINNNL
                     NLASIDSEIQTISQALSISHNGDETELVFDELQWANNLTFYSVSSISMSSLQSINESA
                     GFFESSVEALKFPLVTKVGGDLTIENNEDLQELDFGNLTSIGGGLVIENNTELKSIEN
                     FDDLKSVTGAVVLVGEFDNCTMSDLKTVRGAFEVDTTGDFDCTDFNKLAKQGNIQGDF
                     ECKASTSSSSISGSKTSSSTSSEGSDSSSSTASSSSSKGDAANIAVNCAPIWGTFAAF
                     VVALL"
     gene            complement(<667167..>667775)
                     /locus_tag="FOA43_003533"
                     /db_xref="GeneID:62196933"
     mRNA            complement(<667167..>667775)
                     /locus_tag="FOA43_003533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923784.1"
                     /db_xref="GeneID:62196933"
     CDS             complement(667167..667775)
                     /locus_tag="FOA43_003533"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779712.1"
                     /db_xref="GeneID:62196933"
                     /db_xref="InterPro:IPR014830"
                     /db_xref="InterPro:IPR036497"
                     /db_xref="PFAM:PF08718"
                     /translation="MTDSQTFFEKMKRSFTDVPIAGDEQISTEEFLEASESLVKLFDL
                     LGSSAFQVVEADMNGNITKLRKRLVQDGEHSKTLQGMILEEVKEGKKKTGTQALLWLS
                     RGLQFTEAAMRETLDHPDKEMTITFTDAYKKTLIKYHSMFVRPIFKLAMKACPYRKDF
                     FAKLGNDQKKVLEQLKEWLDALIKIVDIIFGFYLSGNYGKGF"
     gene            complement(<668034..>670778)
                     /locus_tag="FOA43_003534"
                     /db_xref="GeneID:62196934"
     mRNA            complement(<668034..>670778)
                     /locus_tag="FOA43_003534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923785.1"
                     /db_xref="GeneID:62196934"
     CDS             complement(668034..670778)
                     /locus_tag="FOA43_003534"
                     /note="BUSCO:EOG093412AG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779713.1"
                     /db_xref="GeneID:62196934"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="PFAM:PF01399"
                     /translation="MRGGNRFFHPENVLRRGEDLIAVGQKEDALQTIYEFLTSRRIRG
                     SEVSELEPITLLFIELGTELRNGKVVKDGLHQYKKAVQNTDEGLESLQQVCKHFLEQS
                     EFQLTKAEGKAGAAAEAAVEKSVAAAAAAQKVLDTYDDVEEEGDDDDEDVQFAISPED
                     ILLSAVSTDDTTDRSNRQLVVPWLRFLWESYRTVLDILRNNSKLEVGYCFVSAHAFKF
                     CVKYERKNEFRRLCEMLRAHLQTVSQKPNDRYQVTNPIDLGNSNTLQRYLESRFAQLN
                     AAVKLELWQEAFRSVEDVHTLMTLSKRQPKPAMLMSYYDDLAQIFAVSGDNLFHAAAR
                     QKYFSLLLQSPIATEDEKKHYASLELISALAVADNASSERDDFSRRKLHRLASLLSMG
                     STPTRDSLIEQATGPQVLRYTDDLLKQLKEVLEDDFHPLSFAKDSQSILTGIESHGDY
                     KQFVTPLLNVIVGKIFSEVAQVYQTIKVDFLVKLCTLQGKFKLSALDIERRLLDAASD
                     NVVSVKIDQDSGVVTFRSDPFSESLENGTSSTLAEKANAALQLTPAEFVRFQLSNLAK
                     SLSQSVRLIDVTQTESVDRELKERALTEANAEFYEEKEEILQRFGVLEERKTKLAELK
                     KLETEKASKEKVTQQLASKQAEKERAEQETVRRREEKMRREIEAAKEKEKKQLIQEVN
                     SKGIIQIDEKEAENLDIDKLRVMQLEKLEKDQKETETKMEGLARRDDYLERAERKYQL
                     ALLEKEAKEQSLNDEKEYDAIRERHIEQARKEHEHDIKIRDRLQRMVSAYEKYAEVAR
                     SEQNNLYAKLKIHANRKLEEAKEVRIREFIVKKKVEFEEELQRKKEEKLRQQKLEEEE
                     SRRAVAEEERRKKMEESQLSRDPERRIYNELLAKEKNGSLAKFSDKMTLKKLRRKYAN
                     "
     gene            <671144..>671779
                     /locus_tag="FOA43_003535"
                     /db_xref="GeneID:62196935"
     mRNA            join(<671144..671147,671277..>671779)
                     /locus_tag="FOA43_003535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923786.1"
                     /db_xref="GeneID:62196935"
     CDS             join(671144..671147,671277..671779)
                     /locus_tag="FOA43_003535"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779714.1"
                     /db_xref="GeneID:62196935"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="PFAM:PF13430"
                     /translation="MMGKLDEDPYMEVIPEDQLKFWQLQGSKRTRGIPSSIPQEKKEP
                     LRRIQNMAYRMDACFKRIGIRVGLGGLIGLIPAIGDIVVLILNAYIFSQIVRVDNFPY
                     SVTSKMVYNLVLDFVLGLIPIVGDIFSIGYRANTRNFTLARDYMVSKYSVKQPSTGVS
                     HQVELQAN"
     gene            <672324..>673018
                     /gene="ERG25_2"
                     /locus_tag="FOA43_003536"
                     /db_xref="GeneID:62196936"
     mRNA            join(<672324..672329,672344..>673018)
                     /gene="ERG25_2"
                     /locus_tag="FOA43_003536"
                     /product="C-4 sterol methyl oxidase"
                     /transcript_id="XM_038923787.1"
                     /db_xref="GeneID:62196936"
     CDS             join(672324..672329,672344..673018)
                     /gene="ERG25_2"
                     /locus_tag="FOA43_003536"
                     /codon_start=1
                     /product="C-4 sterol methyl oxidase"
                     /protein_id="XP_038779715.1"
                     /db_xref="GeneID:62196936"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="PFAM:PF04116"
                     /translation="MSYKIQAGKIPSDQEQWECLKSVLISHFLVEAFPIWFFHPICEK
                     IGLSFQVPFPSWKTIIYQNIMFFFLEDAWHYWFHRGLHYGNFYRYIHKQHHRFAAPFG
                     LAAEYAHPIEVMLLGFGTVGIPIIWCYFTRNLHLFTISIWITLRLFQAVDAHSGYEFP
                     VSLHHFLFIWAGADHHDEHHHHFIGNYASSFRIWDYFLNTEAGETARKSRERKSKIAG
                     EKKAIIKN"
     gene            complement(<673609..>674211)
                     /gene="RPS8A"
                     /locus_tag="FOA43_003537"
                     /db_xref="GeneID:62196937"
     mRNA            complement(<673609..>674211)
                     /gene="RPS8A"
                     /locus_tag="FOA43_003537"
                     /product="ribosomal protein S8A"
                     /transcript_id="XM_038923788.1"
                     /db_xref="GeneID:62196937"
     CDS             complement(673609..674211)
                     /gene="RPS8A"
                     /locus_tag="FOA43_003537"
                     /note="BUSCO:EOG09343X9S"
                     /codon_start=1
                     /product="ribosomal protein S8A"
                     /protein_id="XP_038779716.1"
                     /db_xref="GeneID:62196937"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="PFAM:PF01201"
                     /translation="MGISRDSRHKRSATGAKRAQYRKKRKFELGRQPASTKIGTKRIH
                     AVRVRGGHLKFRALRLESGNFSWPSEGVSRKTRINAVVYHPSNNELVRTNTLTKSSVV
                     QIDATPFKQYYESHYGLVMGKKGTAVVDEETKKSKHLQKKLAARAKDAKLESAVSSQF
                     GSGRLYAVVSSRPGQSGRCDGYVLEGDELAFYLRRLTAKK"
     gene            <674934..>675161
                     /gene="DPH3"
                     /locus_tag="FOA43_003538"
                     /db_xref="GeneID:62196938"
     mRNA            <674934..>675161
                     /gene="DPH3"
                     /locus_tag="FOA43_003538"
                     /product="Diphthamide biosynthesis protein 3"
                     /transcript_id="XM_038923789.1"
                     /db_xref="GeneID:62196938"
     CDS             674934..675161
                     /gene="DPH3"
                     /locus_tag="FOA43_003538"
                     /note="BUSCO:EOG09344OZE"
                     /codon_start=1
                     /product="Diphthamide biosynthesis protein 3"
                     /protein_id="XP_038779717.1"
                     /db_xref="GeneID:62196938"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="InterPro:IPR036671"
                     /db_xref="PFAM:PF05207"
                     /translation="MSEQISVYDQIEIEDFTFDPDLQVFSYPCPCGDRFQISLGDMED
                     GENIAVCPSCSLMVEVIFEKEDLGEYIDEVA"
     gene            complement(<675269..>676036)
                     /locus_tag="FOA43_003539"
                     /db_xref="GeneID:62196939"
     mRNA            complement(<675269..>676036)
                     /locus_tag="FOA43_003539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923790.1"
                     /db_xref="GeneID:62196939"
     CDS             complement(675269..676036)
                     /locus_tag="FOA43_003539"
                     /note="BUSCO:EOG09343R61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779718.1"
                     /db_xref="GeneID:62196939"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="PFAM:PF00179"
                     /translation="MTQQAYRRLVKEYKQINENPPPYIIARPSESNILDWHYVITGPP
                     GTPYEGGQYHGRLTFPSEYPFKPPRIKMCTPSGRFEINQRICLSMSDFHEELWNPSWS
                     VATIINGLLSFMTSEERTTGSIVTPESTKRELAKRSKYYNLYSNPAFKDNFSDLCKQN
                     LRDIKREEEEEAQRKLDQVDQEAIKKLEQDEKRKVTTSIDTIEDPEDRIRAKQIQEVN
                     EKKKQPIPDSFGGGLIKISVVLLAIFVGLALKFNGAV"
     gene            <676331..>677314
                     /gene="PRS4"
                     /locus_tag="FOA43_003540"
                     /db_xref="GeneID:62196940"
     mRNA            <676331..>677314
                     /gene="PRS4"
                     /locus_tag="FOA43_003540"
                     /product="ribose phosphate diphosphokinase subunit prs4"
                     /transcript_id="XM_038923791.1"
                     /db_xref="GeneID:62196940"
     CDS             676331..677314
                     /gene="PRS4"
                     /locus_tag="FOA43_003540"
                     /codon_start=1
                     /product="ribose phosphate diphosphokinase subunit prs4"
                     /protein_id="XP_038779719.1"
                     /db_xref="GeneID:62196940"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="PFAM:PF00156"
                     /db_xref="PFAM:PF13793"
                     /db_xref="PFAM:PF14572"
                     /translation="MSLRHPKNSIKILSANSHPDLSNMICERLGLPLSNVKALELANN
                     EDAILVGESLRDEDVYIIQTGCGGFEKLNDYVMELLLMIHACRTASARKITAVIPNFP
                     YARQDRKDKSRVPISAKLVANLLTTAGCDHVITLDLHASQIQGFFSIPVDNLYAEPNV
                     LKYIQSHFDNKDDIILVSPDVGGAKRVASLADKLDTMFALIHKERAKANVVSKMVLVG
                     DVTDKVCILVDDMADTCGTLCKASDLLLEKGAKEVMAIVTHGIFSGNAICKLNQSNLK
                     RVVCTNSMPLNNLQELCPKLEVIDISGTLSEAIRRLHNGESVSYLFNTAVF"
     gene            complement(<677679..>679016)
                     /locus_tag="FOA43_003541"
                     /db_xref="GeneID:62196941"
     mRNA            complement(<677679..>679016)
                     /locus_tag="FOA43_003541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923792.1"
                     /db_xref="GeneID:62196941"
     CDS             complement(677679..679016)
                     /locus_tag="FOA43_003541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779720.1"
                     /db_xref="GeneID:62196941"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MQANSVNSVAASEPSRKKHSSESGKQINSRQRSLSTTFSIGDLD
                     NISAFAGLAEIATGHSGSLPAVSDIASLKLPSRRATDPTGFSTQPLRDAHAYSHSYGK
                     NQAFATLADTQTLSISSALSSASSSSAEQLQYSLYTPHTSMDFVYPQTATTPGVSPSQ
                     SLQTSSKLSGSSYSSSPFQYSHPILSNPSTDLLSGLSPDSLADPTFSASTQQQNTNKH
                     IYESFNNYHGFSHFYSNDVTSSPAVSASPQPPVASSSRAPMMYSYSLGSIGDSSGPMN
                     ALYNSSLSKSSNIITKKERTREMSLSDSGIDYNDPVIMKLLKSKRRKKYGDYKCTHCN
                     QIFATIEVFVQHLDRFRLIRFQQPVYDDELNSVGSVPSYVSTSTKVISSGKVTSVAGQ
                     KLNVCDYKGCGRMFKRKDSLRRHERLVHENKNSRFNQRLRLQHIILGDDLEGK"
     gene            complement(<680155..>682011)
                     /locus_tag="FOA43_003542"
                     /db_xref="GeneID:62196942"
     mRNA            complement(join(<680155..681957,682006..>682011))
                     /locus_tag="FOA43_003542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923793.1"
                     /db_xref="GeneID:62196942"
     CDS             complement(join(680155..681957,682006..682011))
                     /locus_tag="FOA43_003542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779721.1"
                     /db_xref="GeneID:62196942"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="PFAM:PF08238"
                     /translation="MKSPIKESSASSQSLSVSALKSKSKEYSSQAIVNLAITPPSLSP
                     SHPPQSPKYYYSLANYYTKSMDAGYRPSQDRSSNNSLASRPSSKSPNSLSSTSSSTNH
                     SPHAQQREKCLPKGQGGSQAPAHLSPKSRRIASLSAAAELDIVNFLEMDYSSDSDEDE
                     DEINAVPYCSPVVSVPGLPDGLGTTVFDDVSSLSMSSVGQSEHPRPSASGVFSEDVVS
                     STISSAITSTAPSVKGTTAFYKSNYGSDSTVNMLPTETSVEMYRKNAHKTSDSEVLFS
                     FAKMLIKTAMVRSKGKKSPISEETREEYLLEAHSSLKKVCRTGYLEAQHFLGDAYSIG
                     LFSKGKPDTRKALNYFETAGKGRHAESAYRTAVCYRKGWGCTPDSRKVVKFVEIAAMK
                     SHPVAMMEYGIYLFHGLMGLPEDVTTKKKGISWLKRATEAATQLSCGAPYELAMIYMY
                     GYKDIVIKDVNYAVKLLFQAANLGHAKSAALLGKFYEMGEIVESNADLSIHFYNMAAE
                     LGNSEGMMGLCSWYFVGSEKLPKDYGEAFTWAQKAAEKGDLRAMLSLRRFYELGIGCK
                     KDLEKASHWAKQAGQIESLKETKAKRRNFRKRKNGR"
     gene            <682513..>684660
                     /locus_tag="FOA43_003543"
                     /db_xref="GeneID:62196943"
     mRNA            <682513..>684660
                     /locus_tag="FOA43_003543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923794.1"
                     /db_xref="GeneID:62196943"
     CDS             682513..684660
                     /locus_tag="FOA43_003543"
                     /note="MEROPS:MER0002895;
                     BUSCO:EOG09340QOM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779722.1"
                     /db_xref="GeneID:62196943"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF13423"
                     /translation="MFKKWRSDKSSKSKPQKKASAKSQTRVRAKDKPRSSSHSSIAHS
                     LGSSSFDHTTTNTNVSTTTTDGTEIPASQSLDKTSSGTGLADSVDPKAEVSHLEFSAY
                     KDEPYDPSLEYKVINKDDSNMPYGDGSDKVFGMENFGYTCYIASILQALYFTEPLRKE
                     VLSFPKRDPENLRKRKLRVKGIRPHGFMAAISLQQEKHEKDKDKDKDKEKEKVKQIEK
                     PLLFAVADDLSKKSSNSSVSGSSRMKNLFSRSSSNEKINNADGSSAEDTGTSDGTNDA
                     NGNSPSIADEIPVENIQLERTLISRYPSYKDLDIRYFLNHQSNVTIVGATNNSADGSE
                     QRKRRALFKGPIINLDISFSEEYGMKSSLFTSLKDAFEAVTENSSKVGILSPYYFVEV
                     VKQLNEMFRSSMHQDAHEFLNFLINSLIEVVSDYTASHSDESSKLSQIFEGLLTSETK
                     CLSCESISTRDEKFLDLSIDLQQNTSIANCLKMFSQSEMLKGSDKFFCETCHSLQEAA
                     KMIKLKKLPQILAFHLKRFKYSEELGRMVKLFYRVEYTKTLRIFNTTDDTKEPDKLYE
                     LYSVVVHIGGGPYHGHYVSLIKTNRYGWLLFDDETVESIDENYVYRFFGDGPGLSTAY
                     LLFYREVLEEEKLREKQLFNGLDDEEDSENFGTAPTMMKNSNNTSSRSENANESTNNS
                     SDTKSSNTVINGSEENSKQSKKKNRLTLNFMKL"
     gene            <684795..>686257
                     /locus_tag="FOA43_003544"
                     /db_xref="GeneID:62196944"
     mRNA            join(<684795..684798,684915..>686257)
                     /locus_tag="FOA43_003544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923795.1"
                     /db_xref="GeneID:62196944"
     CDS             join(684795..684798,684915..686257)
                     /locus_tag="FOA43_003544"
                     /note="BUSCO:EOG09341N4H;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779723.1"
                     /db_xref="GeneID:62196944"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="PFAM:PF10355"
                     /translation="MTLATGSAMDMGMDDKSPDADDRLASLRDRLAVKMVHWYFSLLI
                     LTILPAIAACYAIANRFRVSVSLQIVSGIYSVLEALVLRFPDPDGHENKTSRGTAWFL
                     MFFYGLVLLNGTVTEGTNIFLAKFRDSSMGKYSSRLAPTTYKVISVLIAECGFVKSAM
                     NMVAILGFCYDDHIGQCNAHGIMGMSFIAYGWFMATMLVIPWLRVSRHKHSQEWYDSL
                     MITAWGIVNTFTEHRPWEPWSHHDYQHTSMGIIFWACGMLGIYLSRGNRRSLMPALTL
                     IFTGYAMGQHPQKLILSEKVHTFFGLVLMFGGAIRIMEISFLLHDKRSDPSGQVLSFQ
                     YLAPFALVLAGTLFMGANEEQVQLVVDMGADHSAYILIVASTACLVQLFYLLLLDLYL
                     HLCGCSISGTSPYQSLEGGQNLEDTTNSISENTARQSDDHFELDDLSSLDNDATRL"
     gene            <686447..>688018
                     /locus_tag="FOA43_003545"
                     /db_xref="GeneID:62196945"
     mRNA            <686447..>688018
                     /locus_tag="FOA43_003545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923796.1"
                     /db_xref="GeneID:62196945"
     CDS             686447..688018
                     /locus_tag="FOA43_003545"
                     /note="BUSCO:EOG09341GDD;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779724.1"
                     /db_xref="GeneID:62196945"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="PFAM:PF02906"
                     /translation="MSAILSADDLNDFITPGVACIKPTDEQNRGDRPNQELEIEIDGS
                     GQPMEVTKEGNTTRLQKAQISLADCLACSGCITSAEEVLMAQHSHKEFLNALKEHKDD
                     MIFVASISHQTRASLANALGISWEYVDKLLIKLFTERLGFAKIVGTGLGRKISLKQMS
                     QSIIERKYGSEALNKPVLSSICPGWVMYVEKTHPFLLPYMDRTKSPQQITGLLLKRLT
                     AAEYDIRPTQVYHLAIMPCFDKKLEAARPESDEQMDVDCVITPRELVQMLQEEEIDVD
                     SLLLSVQNDADYCDVKVLYEHFAPKNWLGPTESWYNDEGSPSGGYAFHYLNEVVKYAV
                     GNLGAKVESLEIRSVGGRNPDIYELELVNNDTGESIATSAVVNGFRNIQNMVRKIKKP
                     SGESIGNVRGRMAHRKRRGDASNKKTANTVSIDPLKCDLIEVMACPNGCINGGGQISG
                     PSDRYSAKQWIQKATDIYNSIPLSIEPDSAEMEQWITAWLEKFTVCNSRLLKTTFRKI
                     EQPKDTATIALTSTW"
     gene            <688698..>690212
                     /locus_tag="FOA43_003546"
                     /db_xref="GeneID:62196946"
     mRNA            <688698..>690212
                     /locus_tag="FOA43_003546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923797.1"
                     /db_xref="GeneID:62196946"
     CDS             688698..690212
                     /locus_tag="FOA43_003546"
                     /note="BUSCO:EOG09341EMA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779725.1"
                     /db_xref="GeneID:62196946"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00479"
                     /db_xref="PFAM:PF02781"
                     /translation="MTGIPFKENTVVVVFGASGDLATKKIFPALFGLFREKYLSKTTK
                     IYGFARTQMSNEEFKGRIKGFFQTPTEESKKLVDQFLELCFYHSGQYDQAEGYEELTK
                     SIEKFEAERGVKEPHRLFYLALPPGVFVPVAERVKKYCHPGDKGIARLVVEKPFGRDL
                     NTAKLLQSKLAPLWKEDELFRIDHYLGKEMVKNLIPLRFANSFLSACWDSRYITSIQI
                     SFKEPFGTEGRGGYFDNIGIIRDVMQNHLLQVLTLLTMERPVSGEAESIRDEKVHLLK
                     AVKPLNKDDVLVGQYTKSEDGKKPGYLDDKTVKPGSKCITYAAITLEICNERWEGVPI
                     ILRAGKALNEGKVDIRVQFKETKNGIFKHVARNELVIRVQPDEAMYMKMNTKIPGVSH
                     STTTTDLDLTYSSRYKKFYIPQAYESLIRDVLNDDHSSFVRDDELEISWSLFTPLLEY
                     LEGPEGPTPVPYAYGSRGPSLLDDFMVENGYVFQDDSGYQWPVTTPQSPGESKM"
     gene            <690557..>692857
                     /locus_tag="FOA43_003547"
                     /db_xref="GeneID:62196947"
     mRNA            <690557..>692857
                     /locus_tag="FOA43_003547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923798.1"
                     /db_xref="GeneID:62196947"
     CDS             690557..692857
                     /locus_tag="FOA43_003547"
                     /note="BUSCO:EOG09340J5B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779726.1"
                     /db_xref="GeneID:62196947"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF04802"
                     /translation="MESGHRTQARRVKVYTLDGDKWIDKGTGYCTGELKGGPHFMVRN
                     ENNSSEILLKASIEGSMQYQRQQDTLIVWTDLEGNDYALSFQEPEGCLALCKFLIDLQ
                     RTTEPNISLVAVFSNGEDGEVTEVIAGPVPEPSIPTDDNLAELLDLVSQGSKFPKFRE
                     MLLAYIQEKKYLHILIDTFHRNETRHKISNLHYLCDIIKTIIFYNDPDILDTLLEDDT
                     IDGVLGMLEYDVELGNMKTNNREYLAKMTRSQEVVPITNNDIKNLLKKTFRLQFLKDV
                     VLARVLDDATFNGISNHIQINEERILKFIKNDRCFLADLFEYFNTDGTTEPGLANKRQ
                     EAIRLLHQMVLIAKELQPSPRTRFFKALIEKGLFKAVQFALKQKCQDDISRVLATEVI
                     VTIIEHDVFLFRKSCGPGNNESRFLESRDTYDTALINILTGILINEPNIGLKTQAFEA
                     LKMILDPSNLTNAPESLRSSPANSSSDDDNDCITNPCETFLESFYKYSANRLFAPLMT
                     INENNMIGRGDMVTYIGLCELCSFIAREHDKFYSHRFIVERKLLDGVAQLMDKKYPYQ
                     LRICALRCIKVIILLDDDILTSYIIQNETLSKFVSFLTETNNCNSLVNSVCLNLLEIL
                     IQNNNLRNFHRIGRHLVTSYGRLLKDNFLGEHLVQIMSIEEDQIETTNDGEEDNKHEV
                     LRSEDSSLVFGEEDRSADISSLQTPADMSNIDTSILLERREEDGNPQDKGKNGKEEEK
                     SDDRDDSTQAKEKVVDESLLLAISKA"
     gene            <694069..>694770
                     /locus_tag="FOA43_003548"
                     /db_xref="GeneID:62196948"
     mRNA            join(<694069..694092,694414..>694770)
                     /locus_tag="FOA43_003548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923799.1"
                     /db_xref="GeneID:62196948"
     CDS             join(694069..694092,694414..694770)
                     /locus_tag="FOA43_003548"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779727.1"
                     /db_xref="GeneID:62196948"
                     /translation="MFHNIIKQCLAGNTLNIGNDIFLVHFALRLAQQNQAVLYSLVGW
                     GGMTLLGSDNKTARGIYKGFDLTRKRCSSAQNGDKPLTKKDYLILLTVYSLLLGAEIS
                     TGGVRYWFFYFYRRVIFQNNMHRH"
     gene            <695726..>696871
                     /locus_tag="FOA43_003549"
                     /db_xref="GeneID:62196949"
     mRNA            <695726..>696871
                     /locus_tag="FOA43_003549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923800.1"
                     /db_xref="GeneID:62196949"
     CDS             695726..696871
                     /locus_tag="FOA43_003549"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779728.1"
                     /db_xref="GeneID:62196949"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /translation="MLVLEHTSDWEILRYCQSRNYPTWGQPFTLTDYQEREEINYKHE
                     LCDIMRDYSKKKKGVYYWIMRDSEADIERSSNPKFQNIVSACEILVRDSYFVDASSND
                     KTDIQECLSAVIGSVFTFPEYRSRGYATKMLKLLVDKMKILLGNPYDFSFLYSEVGEF
                     YSKFGFKSYYEPLCVIQVGSHRTKVSYKYTELTTDFHAQMELYDERLKRLMKKHAQKE
                     NKLVVSLKPEQNIIEWFLNRSRFSARALKGFTDIRTKELVFGAKLDTETNDFIIWFDD
                     FRENTAVVLLLYADSLENVKKLVDICKFHIPNEMNKIIFWETELYDFDKSGESRNEKE
                     IQTFVKDQLGCETGLENGSLSALRMLKETVNSQRDTIWEGNGKWAWF"
     gene            complement(<697099..>697659)
                     /locus_tag="FOA43_003550"
                     /db_xref="GeneID:62196950"
     mRNA            complement(<697099..>697659)
                     /locus_tag="FOA43_003550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923801.1"
                     /db_xref="GeneID:62196950"
     CDS             complement(697099..697659)
                     /locus_tag="FOA43_003550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779729.1"
                     /db_xref="GeneID:62196950"
                     /translation="MGIPSPDYDSVLLREHLYKDLKKHFLVLPPEAKQGSFKSISDIG
                     LGLFQYKFADEEEVTASSPSLQGIMWRIFLRHFIAIIVLSIVYSFLYQLVFRRALFGR
                     WRWPVHFGHFRKISDIEEAVTPPLMTCHTPVPSLSFSPGVRNEDLSESSSPENVYIKT
                     TNISDSWSRFKPENEFISGIHTVKIR"
     gene            complement(<698431..>699645)
                     /locus_tag="FOA43_003551"
                     /db_xref="GeneID:62196951"
     mRNA            complement(<698431..>699645)
                     /locus_tag="FOA43_003551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923802.1"
                     /db_xref="GeneID:62196951"
     CDS             complement(698431..699645)
                     /locus_tag="FOA43_003551"
                     /note="BUSCO:EOG093422UK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779730.1"
                     /db_xref="GeneID:62196951"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR036410"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="PFAM:PF00226"
                     /db_xref="PFAM:PF00684"
                     /db_xref="PFAM:PF01556"
                     /translation="MVAETKLYDTLGVSPDATPSQLKKAYRKLALKFHPDKNSSPEAA
                     EKFKDITSAYEVLSDERKRQIYDQVGEEGLSGGGMGGMGGMDGSDIFSQFFGFGGQRE
                     PQGPKKGKDIKHTISCTLQELYKGRTAKLALNRTVLCKSCDGKGGKNVKRCSTCNGTG
                     MKFVTRQMGPMIQRFQTTCDVCNGEGDIIPSKDRCQVCRGKKVNNERKILEVHINPGM
                     KAGEKVVFHGESDQYPDTIPGDVIFVVDQKPDDKFTRKNDDLYYEAKIDLLTALAGGE
                     IGFKHVNGEFLKLEMIPGEVISPNKVKVIEGKGMPIQKMGDYGNLFVKFTVEFPPDHF
                     ATDEKLKDLEKILPPRPKLNVPRGVEVDDSCMLVDYDPIKHSGRRGHNGSGYYDEDEE
                     EEGQPGVQCAQQ"
     gene            complement(<700159..>701037)
                     /locus_tag="FOA43_003552"
                     /db_xref="GeneID:62196952"
     mRNA            complement(<700159..>701037)
                     /locus_tag="FOA43_003552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923803.1"
                     /db_xref="GeneID:62196952"
     CDS             complement(700159..701037)
                     /locus_tag="FOA43_003552"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779731.1"
                     /db_xref="GeneID:62196952"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="PFAM:PF13430"
                     /translation="MNVLKGFAEDFAADKALDNFNQIAVKQIKTKDPYRETLPDGSTK
                     KLKLPSNATKKEQKSWKKIQRRAWLDDRCFMGCYPVDCGCGLGPLAVIIPVIGPYLMY
                     LVHAKLVKMAIQKFDLDTETQAKLHANILFDLLITLPPIIGSFFSWLNGCSTRNAAII
                     HTYLSKELITRSRNEEPSLPNETGPNNQSNSFIQKVSYYVKRPGVEPQQSARQDVSHQ
                     EVPRESHKIGRPDMNSASSHQNVYYPSSNPYDTYTSRGKSSSQHLRKPPPSMKSENVT
                     ADINRELPPLPGRGNN"
     gene            <701317..>703353
                     /locus_tag="FOA43_003553"
                     /db_xref="GeneID:62196953"
     mRNA            <701317..>703353
                     /locus_tag="FOA43_003553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923804.1"
                     /db_xref="GeneID:62196953"
     CDS             701317..703353
                     /locus_tag="FOA43_003553"
                     /note="BUSCO:EOG09340RQ3;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779732.1"
                     /db_xref="GeneID:62196953"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="InterPro:IPR036404"
                     /db_xref="PFAM:PF12044"
                     /translation="MSITFENLPRDYEKLPVPVYILKGRSAGSKGNLIGAISDKFPPQ
                     YYEVVDGYFKAYLHLGPGTNNITLKHIEGSFDKSGYPVPKEGGKTYSETKILLTYDPL
                     TQQGQFQIPKIHLCVLLGRDSKGIFDCPKQTMYQGNALDTAVKKLRVAGRLMQAFTLD
                     EMAKNGVGKRCFQFVEETIPSTVSRQDEASGTSRSQIKVHVIRSKYSVAEIQDMNYAQ
                     QNKHAKEAGKLFEIALESLRDSGGDFADSATNHTPALAAVLILDAHWSKKNGVILGHA
                     ALGGGTERIKLAIFGSHGLHSWPMDWESVFRSFTDCSPLSIDEVANDCNECSCRWECL
                     CVTLGAFMHEIGHSLGCPHQENGVMLRDYVRMDRKFLSKERYCIRTKRSEWGPVFTKD
                     EPGWNRLDILRFLYHPAFSLIQDFKDISFKPLPLLANQGMKTPANTDVGPNFIALDGD
                     TLNVQSSTGIYLVECHIGEWSRLHYEYIPSFYNGMGPQKSIKLNYSIMEQQLAPKWRG
                     KPIKLEVLTVGFGQRSIDNLGSYLASHSQGIQLADGRIGRKTDLFGNNGGSPVQAIFP
                     PQRNITKIRITHGMALDGFEIYFDDKTFAKFGNSKSHYSDFPFGEGEQLIGVAIHSGA
                     WVDGIQFITDRQASPLYGGNGGSLHKFFSPAGTSILGFYGSMGSWCNQIGIIYG"
     gene            complement(<703366..>704589)
                     /locus_tag="FOA43_003554"
                     /db_xref="GeneID:62196954"
     mRNA            complement(<703366..>704589)
                     /locus_tag="FOA43_003554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923805.1"
                     /db_xref="GeneID:62196954"
     CDS             complement(703366..704589)
                     /locus_tag="FOA43_003554"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779733.1"
                     /db_xref="GeneID:62196954"
                     /db_xref="InterPro:IPR035278"
                     /db_xref="PFAM:PF17306"
                     /translation="MAYHDSDIPSPKTHLHTLLPGIPDSIMDVRATISEDHLMNATHI
                     IFDYINQLCTLASLHDHASSQTLKSLLETAKTIQIFKTGGNCPWNHYERRTSDSSEWS
                     VYDEIMVCVVSECLLANQITFGTLSKQRRAEMTDDKWKKSHNLLKLSFTLLNSFRPLV
                     EDTPAASHKVHINYAYHSNTILTQFIVIMKNLYQTSDQVDSQFGVFDKLPSNVGTYRK
                     IIIFIYNEYSVLGSIGQTSYLTYIHFLEIIYCYYSAVMYYKNNELGIALGLVQYGLLN
                     AVENNPIKSKLKIWKKKNQVNTKGKLKEGKLLDDKVHLSRQFTKDFPPLYQSILVVVS
                     RLLEILYFKFSKMNEIISFSHIVEPSEIQAKYLFKSSDLPAGLQVPPSGVDSFIPDCI
                     QTEGSSSALPARNYF"
     gene            complement(<704709..>706118)
                     /locus_tag="FOA43_003555"
                     /db_xref="GeneID:62196955"
     mRNA            complement(join(<704709..706042,706109..>706118))
                     /locus_tag="FOA43_003555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923806.1"
                     /db_xref="GeneID:62196955"
     CDS             complement(join(704709..706042,706109..706118))
                     /locus_tag="FOA43_003555"
                     /note="BUSCO:EOG0934295W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779734.1"
                     /db_xref="GeneID:62196955"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF01053"
                     /translation="MSKSLNFQTRCVQAGQEDPESANRARAVPIYATSSYVFKDSQNG
                     ADLFGLRVPGFIYARINNPTTDIFEKRMSSLENGSQAVATSSGVSAQTLAVLACAQSG
                     DNIISSSYLYGGTFNAFKNFKKWFNITAKFADGDDLDSMKKLVDEKTKAIYLESIGNP
                     KYNVPDFKAVIDWAHSEGIPVIVDNTFGAGGYYCTPLDLGADVVTHSATKWIDGHGTA
                     IGGIVIYKDVNKDNGFKFSDYPERYPQFSEPSTGYHGEIMNEKFGDLAYIAYVRVELM
                     RDLGPTLSPFAAFLMLNGLETLALRGSKHAENALALAKWLKKSPYVAWVSYPGLDDHP
                     YHENAEKYLHNGYGAVLSFGVKSVANPSGDQFKESGPRVVDHLKIWSNLANVGDSKSL
                     IINPWTTTHEQLSSEEKIASGVTQDLLRCSVGIENVNDLIGDLEQAFHAVFDEGK"
     gene            <707246..>707994
                     /locus_tag="FOA43_003556"
                     /db_xref="GeneID:62196956"
     mRNA            join(<707246..707249,707414..>707994)
                     /locus_tag="FOA43_003556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923807.1"
                     /db_xref="GeneID:62196956"
     CDS             join(707246..707249,707414..707994)
                     /locus_tag="FOA43_003556"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779735.1"
                     /db_xref="GeneID:62196956"
                     /translation="MQIISLAFGLTNLIILSGSYASQSCDNINSLIQTYNLSSVTDQD
                     YTSTFYEINQSDNSTYETWEDLIETYEKLNLTIPTSINPNNLTTSLLQTQMLLGVSSN
                     CRLKKATLGLSTIMLLTYVLTSGFTAVGGIKFYNSYKRTQRLIAEEQIPGNLEKAGIC
                     LIYSHKWCFPEIRALNDILTEEDMDSIDQVDTEP"
     gene            complement(<708850..>711150)
                     /locus_tag="FOA43_003557"
                     /db_xref="GeneID:62196957"
     mRNA            complement(<708850..>711150)
                     /locus_tag="FOA43_003557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923808.1"
                     /db_xref="GeneID:62196957"
     CDS             complement(708850..711150)
                     /locus_tag="FOA43_003557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779736.1"
                     /db_xref="GeneID:62196957"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001849"
                     /translation="MGSKLRSSQEDLVLKSYGLLDSSTLKDLTFSLEKEFLGKCKASP
                     QKLTGIKIGGKHRSAPLPPINGESSSDPVAGTSSPLDSYVKRINDFKRKLKMLHSKTS
                     HQPKKKISITDTPVHIAQLTSLPTSMGGSQSPSHTPPPHNHSYSSLSASPTPNRRARR
                     KRGSSIEQDCIFCNLPLQSTLSRDSGEKIIELKCGHHTHEQCILLQMQITENFSEDHH
                     TISFPDCPACDPKQKAVPLGPDTSSELSTAVLLNSRTNFVLPDLQLQPKLQPQLHPCQ
                     FSPSHIPRRSPKRHVKKHSRGSSITANLSTFSSASAVSPSSPDFSLFGWTSNYTIESL
                     RGKFIKELEQLSELKVIHVCEGNEEVHLSSTLMSSFGNLRLFDKMSLSHDAKEWSQFY
                     CYLFEHILIIVSCKKHLFRLVQITPLMIVETPSRWCVSIRVPKESEPGLFFSSVKPDI
                     LEKWISALMNTSCKFTAHLLTSTIKEDEFNEFVNVPTDVPSITAERNIDKPRVNSRFY
                     ESALKSLVFRKKPDNMLIILNNDNANANPSFLVSITNILKSLLLVKIDVTLVLCSTDN
                     FTVQSSVISTYHLTDEECFGKDGLLLERIGRYQKQVSSESFNRSQGEEIETVDLVSKR
                     YLQKMTAATLVVISSASLNEYEPPDDSDSVLIEVNSANDVKGGPDVIKLINWEDVMEA
                     ICSHCGLEFDDSDFERSSDEENEDDGKDEDIEEEEENVRQEVNDMKDNSDDTESTQKG
                     ARWSYILKDIDKALKDAHISMEKYKS"
     gene            complement(<711659..>714982)
                     /locus_tag="FOA43_003558"
                     /db_xref="GeneID:62196958"
     mRNA            complement(<711659..>714982)
                     /locus_tag="FOA43_003558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923809.1"
                     /db_xref="GeneID:62196958"
     CDS             complement(711659..714982)
                     /locus_tag="FOA43_003558"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779737.1"
                     /db_xref="GeneID:62196958"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MMPISCMECRRRKIKCNKMVPCNQCTVKDRHCEYPPKFRSIKVE
                     QLVMDDVAVAPLGDDKALLDGSVPLPNGLLTAPSSNSSSSSDSPHGITRPRELISMEE
                     SNSMFGSNGIKRPKIEETSTVLQLEGLHNLGQLTPESTVPLIQKLNKENEGLKLKIRD
                     LRLKNKRQRTKLKKIISSQIDCDDSSDDDIDDDIEDDGKPEQHDNFEKVVKPSSIYYG
                     PNSTRYMISSSMTKDEISEFDDFIKVKRQIKQKRNLPVLVHPKANSAKAKQIAKKENV
                     EAIIALLKKFFHLKVHYVNFISPIPLLELFAHYDSITEWNKNDDDKLLLSIIIIIVTL
                     RSLPANDPLLYKYGISYEKNRESLYKQYKNLKRGIQIETTTSLRAYVLECEDLFFNDQ
                     IEKSWSLLFRLVSSAYSLGLHVYDESIVKTLKAEQHEKSGDVIKKNPKTSLWLIINFI
                     SATLCSVLGRPNPVTFNFQPLLKNYEIRLNYKIALADLVKKSTNILIDSYKIPIDLDT
                     VLDIDESFVNEVLIYEKILIDTRIMRNMRSRDITKPSFITLPVIDKSLGGNPANDLHD
                     HDSGADDADDKDHHNHHHHFHRSHGKEADRDAETGTKRAISSADVGVQSNWLGKKSNS
                     VSQMDLSKLLVDCPLDIRFTILRPCPLQNEEEPWCLILEDADTLCDLIMLYGNRAKFH
                     QHFMSKYTKSLESCLDSILKVLEHTQDLVELMLKKFAEASFQRVYPFFYVFLYQTFVV
                     TYTLMHLGYAKLSAYYNEIGMIRQRLIKLFDTVGPKHWRPNVIRIIQYINDMCDNFFK
                     TYLEKEQQIPKSTTLPPLPEGNKSMVVHPGTYKIQHERLQQEKERQLQNAIPNFSEGA
                     DSATSLRTPLSLNSMFQINSLANSPNAAGNGNMQPMPMFPDLLVHNVPDDIRNKLSRS
                     IAISAPTVDAGATATGGPSSSGPSNETVVASQSGDGSSVVGVINAKPSGFLVSQPVQS
                     YLNNNSASLSQISLSNYNMDYYNPVQQFFPPPAQQQQHQKAESEEQQEPVTHVTNSTP
                     PTQTFTIDPLLGFDLNDPFFVQNPFNFNYASSPGNHNSVNAAPARSDAAEFVRNDSVT
                     TVTTNSNELVERSSSDCSK"
     gene            complement(<716037..>716768)
                     /locus_tag="FOA43_003559"
                     /db_xref="GeneID:62196959"
     mRNA            complement(<716037..>716768)
                     /locus_tag="FOA43_003559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923810.1"
                     /db_xref="GeneID:62196959"
     CDS             complement(716037..716768)
                     /locus_tag="FOA43_003559"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779738.1"
                     /db_xref="GeneID:62196959"
                     /db_xref="InterPro:IPR001810"
                     /translation="MSFDNFQSLPKELQLEVLEQCDPLILLQLQRVSRELESLSIYSI
                     RAKLLKLLYEGDFYISIFSPQHEEMHAELYDAKCVVKEKAKISPTSKSAYLFETSSRN
                     TSHYVSFFEIGDLNGSRDPLRSEVFDKYEGDDGHTHKIHLLVGEDSKYIQLHFGMYLK
                     MERDEIPLRIFCMDTRLKATGSQGEGVLDFCNGMFRIKYKLIKGEELPPRGPYDYEVV
                     FNYFIEFSSFEVNNLYLLNMYKDSH"
     gene            <717214..>721530
                     /locus_tag="FOA43_003560"
                     /db_xref="GeneID:62196960"
     mRNA            join(<717214..720851,721236..>721530)
                     /locus_tag="FOA43_003560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923811.1"
                     /db_xref="GeneID:62196960"
     CDS             join(717214..720851,721236..721530)
                     /locus_tag="FOA43_003560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779739.1"
                     /db_xref="GeneID:62196960"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR034001"
                     /db_xref="InterPro:IPR034003"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF01061"
                     /db_xref="PFAM:PF06422"
                     /db_xref="PFAM:PF12698"
                     /translation="MNNPIEKTIDTIHNDKLEIGRRETVGSSALKVRPSSSLAMEIDP
                     ETFVLKDSLQELCEKNSDNGIIPRPIDVIFQHMSTVGRNNASNILIDAGTAFFYMMFF
                     PVLKLIQRLNPHKAPKPEKFRTLIKDFTGIVKAGSLTLVIGRPGSGCSTLLKTLAGHT
                     STFVAIEGDIQYNEIPADRLWSRDQNRLAYIPEEDSHFPFLTVQQTLKFAIACKMPRI
                     RFDQTSQKTYVNTMTDFYTTLLGLNHVKDTLVGNEFVGGISGGERKRVTIAETMATGA
                     SEFCYDNAIRGLDSAIALEFVRSLRTFVSVCHTTIILSAYQASENIYNIFDNVLVLYS
                     GHEIYFGPVESAVQYFINMGYAKFPRQTSSDFLTSITNPSARVTNNKSHHQVPQTPEE
                     FEFYWLNSEEYGALIEQISAAIEINKVIESEKDMNHIHQLEKSKIVRKGSPYVTNFFQ
                     QLYLCNIRCFQTIRNNTAFNIALLVAAIVQSLIAGSLFYALPNNTTGIFPRGGTLFVS
                     LLYFCVMSLAEVAVFFENRPILFKQRAYLLYHPSAELLARITSSFIIRFVTIIFFSLI
                     LYFLTGLRRQAGAFFSFLLFVNLGVLAVNLIFNVISVASADLAVANACSGLLMLSMLV
                     YSSYMVQRPSMYWWFKWFSYCNPILYSFESMITMQFHNHNIPCANQNMVPTGGQYNSM
                     PLSNRVCAFPGAAATRDVYPDSNFVQGDIYLAVSFDYFFKHCWRNLGILFLFAVGLLA
                     IGIAIVETYNPLSDVGGRLLFLKGKLPTQTKDVEAQRSSSENRNDEGRESTGDDPKGE
                     IERLGSNDTFCWSNLCYSVKQNKMLLNDVSGYALPAKLTALMGESGAGKTTLLNVLAE
                     RTGSSGIVTGRITVNGELVGSDFHRRTGYVQQQDVHLGALTVRESLIFTARMKRSYKI
                     PDVEKLEYVEHIIRILGIQKYADAIVGNLDSGLNVEQRKKLSIATELVSKPSLVLFLD
                     EPTSGLDSQSAWDIIQVLKTLARAGQTVICSIHQPSAVLFEQFDQIMLFQKGGRVAYS
                     GNIGDNSKTVLDYFVNNGGRKCGLSENPAEYILDVIGAGITTTNTLNWGDIWLRSEES
                     QVVKQRINELDHFDDIRESQKKDSTEFQVPYWFQFWYVLQRTSKTIYRDLHYVLSKFV
                     IFLTVGLLIGFTFWNVNHSIVGMQNAMFANFMSMVLMAPMVNHIQSKVMRSREIYEAR
                     ERMSGTFHCNVELSYLMPPEGQKCGEYLEEYFQSHTGYVENPNATENCGVCQYAVGDQ
                     YLASIGIYYSDRWRNIGFFVVYIVANIVAMLTLYYLFRVRKIFTFKQK"
     gene            complement(<721539..>723875)
                     /locus_tag="FOA43_003561"
                     /db_xref="GeneID:62196961"
     mRNA            complement(<721539..>723875)
                     /locus_tag="FOA43_003561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923812.1"
                     /db_xref="GeneID:62196961"
     CDS             complement(721539..723875)
                     /locus_tag="FOA43_003561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779740.1"
                     /db_xref="GeneID:62196961"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR031906"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="PFAM:PF00533"
                     /db_xref="PFAM:PF12738"
                     /db_xref="PFAM:PF16770"
                     /db_xref="PFAM:PF16771"
                     /translation="MSLTCFDGLDILIIESDSLDSVIIHRIQKELSKVSVLDPSSLYH
                     VRKATDGFEDSDQKLSKITHIISNTVNFAEYDRVSDHLMIPVVSSDWLFDSVTHKKLE
                     PLRKYSTDPKLILRNCVITCSESISDEDKMVISSIVYAFGGVYVKDVIKNLTHLLSSN
                     EDDEWCTLIQEFNHHVGNNTIKIVSPNWLFESIGIDRKLQESKFPTGRTTKSLLESSL
                     LQQPNALKDKVFYFGSDYGISDQLFASLNAAVCTRSGAKLIRDKEHLNEANCYLGLYR
                     VGAQFTRASHNEKLTIGNLDWLLWMLVRGKWTLPLLNLLHYPYPKEKLKGMEKVVISA
                     TNYTGDSRLYLQNLVELMGGEFTRNLKPRNTHLLVAKAFGDKYKATEVWGIKCVNHLW
                     IEDSFAHWELQPENDPKYSRFPRDCDDVRLIGTTQIDANIVHTPQSADSGKGPKVLPN
                     EGFSSLSSSPQFLSAAETSSSSRPSTSAKVSVAKDTVLSQPSSPSEPTLPPPNVVPAK
                     RKLSNPPVLNNKKQAKHLPAATKPYNIVGIMTGCDTDLTPADRKNLHRVGIRLVDIPT
                     KSLNCIIAPTIMRTEKFLKSLSLGPKYIISPLFISDVLGTLDTYHKVSEFDSVKPDIS
                     QYGLENSITFSKDHKVKDLFMHPEKGEIFALQNLLRNSTSRLFEGFLFNISSKTPGEE
                     IVSNIIRLFGASDCQQVDTKASKLLCNDDTFSGSRYSEAYVLLCSPDEKSLISHFKKL
                     VKRDASDSKYIVVEWNWIIRCIFNTCLVQDKFIVDKNI"
     gene            <724091..>725701
                     /locus_tag="FOA43_003562"
                     /db_xref="GeneID:62196962"
     mRNA            <724091..>725701
                     /locus_tag="FOA43_003562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923813.1"
                     /db_xref="GeneID:62196962"
     CDS             724091..725701
                     /locus_tag="FOA43_003562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779741.1"
                     /db_xref="GeneID:62196962"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="PFAM:PF02184"
                     /translation="MTETDIDKLSEVHSQITAEQLLSEAYEYRQTPLKTPDYKIADLD
                     ELHDFERRKRQEYEDALRRNRFDIGQWMRYAQFEVDQHDMPRARSILERALEVDNTNV
                     SLWIRYTHFEIKGKNINHARNLLERATSVLPRVDKLWYQYVSVEENLGNVIAARAVFR
                     KWLQWKPGFEVWRHYIEFEERYKEYDNCRLIFEKYTTVYPNASTWLYWAAFEKKHGDA
                     TNVKNVYKLGLNGIYELGGLTAEFILSWISWESTIGEEVAIRRLFEFGIKTLNENEVR
                     KLQDDYSKFVKKYGSTQDIEDSVLNGRKLKYESKLSSNPEDFETWCLYLDLISDPLIH
                     LPPSEIEKKFELAISKRPSSSRKDDWLPYIYVWFRYITWEKSRSEDIELLRSIYRRVI
                     KIIPHKSFTFPKVWIGFAELEVKHNNLAEARRVLGQSMGMCPDKEVMNYYITLESNMN
                     QFDRVRTIFNKLIENFSDEEDCWEAYVQFESQLGETERADALKNLSREYLQKPDDEDS
                     QIAKAEHPKVLESMSPVRVPFKSRFEEG"
     gene            complement(<725755..>726849)
                     /locus_tag="FOA43_003563"
                     /db_xref="GeneID:62196963"
     mRNA            complement(join(<725755..726708,726844..>726849))
                     /locus_tag="FOA43_003563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923814.1"
                     /db_xref="GeneID:62196963"
     CDS             complement(join(725755..726708,726844..726849))
                     /locus_tag="FOA43_003563"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779742.1"
                     /db_xref="GeneID:62196963"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="PFAM:PF03595"
                     /translation="MGYFMLCERYHVSFKMILKDQNLNVFLGCEVMGLSTIINMLYYL
                     RPRWYIATYVLWWINVTLSLLAGWGITFIMIGYNKFSMKEANATILLPCVTMTVVSST
                     GSLISQSMMNRPGFQLSQDIITFLLWSNAVILATVLICFYFNKLLLHGLPAKEVIYTC
                     FIPIGILGQGGWAIQLNYKNLGNLIVNGSGLKLLNLDVGFSEEYLQTISATLNILGIC
                     VALFLAAFGVCLTALSFLAVVYCGRPPVWIRTMWASTFPLGTMALSFNEMYLTTKLTG
                     FQVISTIYSVMLILITTYCIIGTVLFDVPYKDICNIIRSSKKE"
     gene            complement(<727529..>728380)
                     /locus_tag="FOA43_003564"
                     /db_xref="GeneID:62196964"
     mRNA            complement(<727529..>728380)
                     /locus_tag="FOA43_003564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923815.1"
                     /db_xref="GeneID:62196964"
     CDS             complement(727529..728380)
                     /locus_tag="FOA43_003564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779743.1"
                     /db_xref="GeneID:62196964"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSNVYLETWKPDIFKGKVCLITGGSGTICSKQAEALVILGCSVS
                     ILGREQEVVEKKVKELSQIRSDVRVIGYGGCDVRSFQSMSDIVKKTVNELGKIDFLVC
                     GAAGNFLADFNHMSSNAFKTVVDIDLIGSFNAVKACFEQLRANKGSVIFISSTLHYYG
                     VPFQSHVGAAKAGIDALSNALAVEFGPLGVRVNCIAPGPIGDTEGFNKLVPNKRDFAR
                     KIPMQRLGSVHDIANATIYLFSDAASFITGTVQVVDGGFWQMGNFNTFDLYPDVLKGK
                     LEEKPKL"
     gene            complement(<728700..>734726)
                     /locus_tag="FOA43_003565"
                     /db_xref="GeneID:62196965"
     mRNA            complement(<728700..>734726)
                     /locus_tag="FOA43_003565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923816.1"
                     /db_xref="GeneID:62196965"
     CDS             complement(728700..734726)
                     /locus_tag="FOA43_003565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779744.1"
                     /db_xref="GeneID:62196965"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="InterPro:IPR036964"
                     /db_xref="PFAM:PF00617"
                     /db_xref="PFAM:PF00618"
                     /db_xref="PFAM:PF00620"
                     /translation="MRKFLSRRDKRRSLSGEGKSDKALDNHDSDAGAELECVQEDTAS
                     IFGSSSYLSKRASMLTDSFKFTKTEDHDRERVAGRTSGQDRDLNFGRHQGNEGRHFTS
                     HASGSVSDTPHHKAHILHSLSSKRSSTSLYLHSQQQQQQHNVQSLVIPDWDTSLIKTG
                     WLNVVNEDSSDDKLKLCRAELKGSTLFVYRSPQELASTSHFIAGQRGDDKDPESSSFS
                     QDYQANLMNLSGSQQQQQQQLDSVNNMSTDTPISIDSSRADNEMSQISPSNTSESIAS
                     IITPDSAQLNDQLQKLCLVDAALDDSLLAAGNLIQAIRGQKGTEENFRGTPVYNYNTS
                     KPVVADPEVGHTFSDFTDITYPYCRCPHPDLQFEDKTGVILGGTIESLCHTIVFYPSE
                     DVAEKLIRILPMVTDIATPLALFQLYLRLFASISQNQDEADNQTQSNSDNSSSNRAFI
                     PMETRDFMIKRISRCLKVIAKDFSGMLLDDSILRSIWNVMMALDDVSDCNDLKTTIHE
                     QQKSLRMLLQFENTTDTLSLSIFTADYFMSAPLESLAFEINALDHKFLKAWNARDDRS
                     LTLDRVHQSFEYWRKNFLVFDAIHNIHYLGRLICYQLFEDPETENDASSRAHILEKWI
                     LLGELLYRQGNMSSWLGISTFMCSVPILRLRDTWGKIDNKIVDLVRKSWAPIIFEVRQ
                     RRSQQARVGLYRVLVPAGIGRNYAKEDVIPYYGDIYFQKPLKLPEDYVKSFCAFSQKA
                     DYSIAKWDEFYQGVTNSDSVRLSNASKGMCGSVDISIAQKLRFVVNYTVKNKPFSLSD
                     AMSLSLGVEKPSEGQYFKYHNRSRSPLFLGSYASILFPKILDAYEIYDRKSLIGAIGG
                     VGLTQSVLRNSAYNISNLMKHGGHSLVSSKSMNRNTFLKHIRDVFNIDTFEFKETDDT
                     IMFKTVLDSLEQERKVSKHTSKSRPSSILFGENISVKRFSSYSTSSFNLDDFVNSYHS
                     FVRESSDGDGESVAVVQPLESPVIASSSRSSAEASARKLLTQGEQLVSIVAEAATSER
                     LLDLLVLTSSIFSSKIKEEDVKRFAEISCANGRSFLLRMDQGAFTVTFFAVYRCFMSP
                     YELISGLQKRFAGSKRCSISIASKALGSSSTIFPEWSPTVTGDTVKNINWKFVAQIEL
                     GVVESLLALFQHYYKHLLDDMETREAIESLFECIGHELDVTLPSALKDMRSQDEPDRE
                     SINAIEKCVRTIIQSYKDSKEYYVKNCYTPLVDPLPLRFTSDLSIIPADKILARYNDT
                     KALSRFVDGIDETIRRIMSSIIVEDWIETFQILEVLTAKSTLSLFNYDVQSLDTSSPL
                     LVVSNIYHWIATLVDIESSTSSKLSFVVDKFPSSVRSMLRFYFKLKNYFTVQLIDPSI
                     NFEHRIERMAAVLKLLVISRIKMRELELFSPDETDTDISPRVPSLIESCLVNTILSPE
                     CRFFSFDWCQASKLLSPSKELDQCHTYLDDLLPDEKDISAEISLQSHLTPCPGWILQS
                     LLEITCFIPNMYVQNTSLINFDKDRFAYNCVVNIMDLVPKTTENLDKESLFSFLLDFK
                     IRKPALKEVYETFLKEKEAEGYEEVSTFLESHLNEQRQLMKVEDEKKNLLLKQKPTYM
                     TELPLPSSIPSSSVSSGAIVDTPKTTLGASKRNGAFSTSAMSSESTLVLHRTRSAVSI
                     RSESSGSSKISRFKFSGLFSRASKGLNIGHGSNSQQVVEKSPCSFLELPPADNFVRGH
                     KAKILYTLNLKDSSAFPTYVTPYSFKIDFGNGRSDEYCFQATDDLDRDDWLRNINYSH
                     RHWFFSKALNKSSMGVQANMVFGVPLKFVCIRENRPIPNIIEKIMSEIEFRGLEEVGL
                     YRRSASLASIQKIKDKINRFGDFNMEDQLVFDVHNLTGCIKSYLRELPDPLIGDSSIG
                     KFTEVKELSKDDKRFDVYREIFCELPVYNYNLLERLFRHLKLVVDYKQCNKMTSSNLA
                     TILGGSLIEGCNPENLRNYFGLMTFVCEDLILNYDRIFLNAARPQQKKSS"
     gene            complement(<735331..>736317)
                     /locus_tag="FOA43_003566"
                     /db_xref="GeneID:62196966"
     mRNA            complement(<735331..>736317)
                     /locus_tag="FOA43_003566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923817.1"
                     /db_xref="GeneID:62196966"
     CDS             complement(735331..736317)
                     /locus_tag="FOA43_003566"
                     /note="BUSCO:EOG09342NCR;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779745.1"
                     /db_xref="GeneID:62196966"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="PFAM:PF03690"
                     /translation="MSLATLNICTHSGTFHADESLAVFMLKLLKRFSNAKVTRSRKPE
                     DWESADIVVDVSGKYDAKKFFDHHQREFTGTFNSEYKTKLSSAGLVFKHFGKEVIAKV
                     LKFDVKEKATDIEFLYDRVYKDFIEAVDANDNGIDKYANQKELVPRFHDKNFSLAGVV
                     SNLNPSWDTDPTDADFDRMFIKASQIMGEAFLEFLTYMGKSFLPAKQYVEKAYGERFD
                     VDKSGKIIVMEQYVPWKEHVYNIEKANNAVGQILFVLFPDTTGSWRITAVPVSAASFD
                     SRKKLPEQWRGLRDNALSEKTGIPNCVFIHAAGFTGGVKSKEGAIKLAKMSI"
     gene            <736581..>736929
                     /locus_tag="FOA43_003567"
                     /db_xref="GeneID:62196967"
     mRNA            join(<736581..736610,736669..>736929)
                     /locus_tag="FOA43_003567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923818.1"
                     /db_xref="GeneID:62196967"
     CDS             join(736581..736610,736669..736929)
                     /locus_tag="FOA43_003567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779746.1"
                     /db_xref="GeneID:62196967"
                     /db_xref="InterPro:IPR018625"
                     /db_xref="PFAM:PF09803"
                     /translation="MSRSQFELAKFTFYLMTPISIMYYVGIDTDRKFNIPGFWPDPDT
                     LNKIPKEPYEIQAELARIRAAKTEKRKRLEAKALELGITPDNVQSEDNSDKH"
     gene            <737334..>737993
                     /locus_tag="FOA43_003568"
                     /db_xref="GeneID:62196968"
     mRNA            <737334..>737993
                     /locus_tag="FOA43_003568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923819.1"
                     /db_xref="GeneID:62196968"
     CDS             737334..737993
                     /locus_tag="FOA43_003568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779747.1"
                     /db_xref="GeneID:62196968"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PFAM:PF00179"
                     /translation="MAASKRLWKEYRDIVNPRTGLHQVKVEVDDDNIFFWKVVLMVID
                     PESNYYGACFKGQLKFPENYPFSPPNFKFTPAIYHPNVYSDGRLCISILHEHGNEQSD
                     EPENETWSPAQSVESVLLSILSLLEDPNISSPANVDAAIAFKKHKDEYKKRIHNEVNR
                     SKLNMPDGFKLPILADIRAPLEEEETVDDEEWWDEDNYYDDEDEEEELEEEMISDNNN
                     L"
     gene            complement(<738087..>738719)
                     /locus_tag="FOA43_003569"
                     /db_xref="GeneID:62196969"
     mRNA            complement(<738087..>738719)
                     /locus_tag="FOA43_003569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923820.1"
                     /db_xref="GeneID:62196969"
     CDS             complement(738087..738719)
                     /locus_tag="FOA43_003569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779748.1"
                     /db_xref="GeneID:62196969"
                     /translation="MLQSRNISKVLVQLLEPTPEVTRSIPIAIALLSLTSELPLLSCV
                     SQLYKDRKDEANDSNLAKIDSQESSADNADISGNYDFTPNQGVTIEDPIVANGKPSTS
                     SQKLEQLQKKINDFEDNFDSNYINANVNPSDNLNIISILALRQFQERKTSGVPCAMEP
                     WMVFTTNEYISYLYQVNDEYAVLFCCDSSYPKGFAIKRLKKLCKYLQSNM"
     gene            <739312..>741201
                     /locus_tag="FOA43_003570"
                     /db_xref="GeneID:62196970"
     mRNA            <739312..>741201
                     /locus_tag="FOA43_003570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923821.1"
                     /db_xref="GeneID:62196970"
     CDS             739312..741201
                     /locus_tag="FOA43_003570"
                     /note="BUSCO:EOG093417ON"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779749.1"
                     /db_xref="GeneID:62196970"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="InterPro:IPR036420"
                     /db_xref="InterPro:IPR038545"
                     /db_xref="PFAM:PF07535"
                     /db_xref="PFAM:PF08630"
                     /translation="MSAQQRPYKDSIASSKRIPLKESSKTFLNVNKISKNQLQQQHED
                     SWKPSLDEKAEKMSQKVSQKQYKHTQSNQLVGSQFLEWQQSWRRILKRSIVFFDETSK
                     RHEHEYARAVSAFKNLGSNFSSFFTDQVTIIVSMRTYDKQGEYPKGDIFHTARKKELK
                     VWNYDKVFRFMKNLGEPVPDEKASSKLSFLLRNEKLFGPNDRDPNARREDIKYFSDLF
                     LYVYDLKQQTRPVAVREWTRDGDFPRLHHSTNGKSIFVSNGYTRLERNKRIIRVVYFL
                     NSKEYRKKLIEESYVDSGMDVPTYTERKRLFDEWREEFYQQSGSLPPRRLRVFPIAND
                     SEENNLNEGIYPESNACLPVKQNDSINEKDEEVPNIHTVANTSKKQWGTRWTENTTEL
                     DDHTVNRGSSVTVRVPALCRDDSVIGAGCTKFKNEYGEIQASGVQNQSGSNAVSGNNV
                     GNGLAPSYSEVHSKKIAQNQRKTMVFDPPSKKHLVKETIVEEGKENEVPPNSIMSPGE
                     GPDFVKEPPKVFIKHAQLAKLNPLSVEMTERKLKRRRERYSEKKHKRAKHSSKPGYCE
                     NCRVKYSDFDAHILTDKHRQFAINSKNFEEIDDLITDVREHISFSEERRQHETKKELK
                     YKQKY"
     gene            complement(<741236..>742546)
                     /locus_tag="FOA43_003571"
                     /db_xref="GeneID:62196971"
     mRNA            complement(<741236..>742546)
                     /locus_tag="FOA43_003571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923822.1"
                     /db_xref="GeneID:62196971"
     CDS             complement(741236..742546)
                     /locus_tag="FOA43_003571"
                     /note="BUSCO:EOG09342JTF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779750.1"
                     /db_xref="GeneID:62196971"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="PFAM:PF04194"
                     /translation="MPQIHELSSDESDDELYDNEQDLSGVLLGFGDVVICEEDKPEVE
                     DTFIGGEPIWLNPESPPPSDLLLCKNCHLPLRLFLQTYALIGESLYDRVIYIFGCNKA
                     SCRRLKGSIRAIRALRKDPNVMKRREMEFKIDELKVKRDNDIIRAKKTHTKELASKIF
                     ASKESHLANPFDTSDSNPFSTSLDPFTAVDNSGKPDQKISVPQEQFNVTASDYLAFVP
                     HLAPLKPSRRELDFELPSFPGTILYLEDEVLDPSERISPPIQSNINFKETVDAPEMET
                     GSSFKMPEKVNTNIKEAGEIIKSLDDTTFQHFTDIISYNPTQVYRYKLNGFPLLYNTK
                     DDVSKVFYDENGKLRDEKDFALPRPGYHPNGSRRFELQLMPQAIIDLESDDSIDILKD
                     GMEWGTILVATDSDDFIPDTYFDENYVAYVEEWCGVQWEEQMHN"
     gene            <743060..>744142
                     /locus_tag="FOA43_003572"
                     /db_xref="GeneID:62196972"
     mRNA            <743060..>744142
                     /locus_tag="FOA43_003572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923823.1"
                     /db_xref="GeneID:62196972"
     CDS             743060..744142
                     /locus_tag="FOA43_003572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779751.1"
                     /db_xref="GeneID:62196972"
                     /db_xref="InterPro:IPR007272"
                     /translation="MFTPAESSIGALFIQYATGSYMAVEGKVVGFSNIIFNSVFKPTI
                     HNISIVLGVLFSGRFIKRFLPDFVPLYASSTTNNPSILGSLSNYSLSGALVGLGTSLA
                     HGCTSGHMIAGVSRLRLRSIVATAVFASTAAITSALLHNGTSLGLGVTPFTYDDQFVA
                     FNANKDILLKLLALGFAHSYIVMPYVMKRVKASGDETWIKVAKFFSGLSTGFQFGLGL
                     LISGMASSTKVLGFLSIFNKEKFDPSLLLIPALVVLPNIFIWRKQLPQTKLEGIQKSP
                     ILENSYDLSFSDTIDTPFILGNVVFGVGWGLSGICPATGLLGAEFNGKNGAFWLASFI
                     GGYFAGNQLEYHQVWPCSSSGSTATI"
     gene            <744739..>747945
                     /locus_tag="FOA43_003573"
                     /db_xref="GeneID:62196973"
     mRNA            <744739..>747945
                     /locus_tag="FOA43_003573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923824.1"
                     /db_xref="GeneID:62196973"
     CDS             744739..747945
                     /locus_tag="FOA43_003573"
                     /note="BUSCO:EOG0934060J;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779752.1"
                     /db_xref="GeneID:62196973"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR036612"
                     /db_xref="PFAM:PF00013"
                     /translation="MPSPAQLLAMKHAESDVEANADVHVLIAASIPVDSTSAATPPAS
                     STNSSSSMSSAISSSTVTEEEPEDLKEQNHSKRISMDDEEAFPSLGSSVGASAPLSWG
                     PSSNGSKSSAAAGNSLYAKTTASAFPSFRQAVRSSNTQLTFIVNVDQQLDLSKAEIFR
                     IFSRIKQVYGVSIESTLSTATSKRTFLLSGPASNIQDAKRDVLKRLTKPVKIQFSVPS
                     SLRAAIIGSQGKNLKPILEATKTKIDIERNNPESSSSFNAVDSGAADNTKEEEEDEIF
                     GRMLTATIEGDIAGCNEAKARIMAIVNEHTKTLNIRLNMDPELKPFLRGALNEVSFAD
                     DLDITYPDTETESSSLILTGSREAVLDAREKIKSVLALLQTNLISEEQIVPKYVHSLL
                     DPQKVFESTNVIVRVPDEDSDVQTVTFIGARSNIPTAVAFAKQYCASFFVDSLDLARS
                     HGGNSLHAKCLTAYFLYTKFFEELSSKYDVKIHAPSYASLANDDIKTAILTFASSKEK
                     KDVLKQVRKEVVDAVNKMTPNLVRVESDINSFVFGKINNSFVTDNGVSIVPLGNLAGF
                     GNKLILILQQGDNEFLPSDQEIQQKLDSVDLSLEPLRSISKTVVSKVIPVGNEDQAHL
                     VGKTLGVLLGKFESGNIEIKLHQNATGPSSDEIFLRGFDKDIENAISDISQAIEDVKN
                     YEEACKYNTSVDFPSNLLSRLIGHNGKHLDQLREDFDVKIDVLDEGSRSEEQNTTTPV
                     QVTGLKSNADECIKHLSRLTKKWSDEKTVVMKIDPKFHRRLIGPGGVYVNRLQDRYNV
                     NVRFPHEKDKDHKDEVVIRGPTKGVTKAAEEMKELLQYEQENGYTEKIKVPAEVLSRV
                     IGRNGEHIKDISADAGVTINNMKTTHEQEKKQGFAEFEIIGSRSAIKKAKESIGAIVD
                     KVENYTTEIINVDRKWHRFLIGPRGSIKRQIILEAGGSDDNRSEFRKFLQVPDKDSDS
                     DQVICSGDRLTVDKIVKEIKRIVSEQESVVTKVVVIPKKKHRLLIGPGGSVRRSLEEE
                     YKVNVTIPRVSVDSDEVQIRGSSDQIAKVISQIDHLVE"
     gene            <748301..>750799
                     /locus_tag="FOA43_003574"
                     /db_xref="GeneID:62196974"
     mRNA            <748301..>750799
                     /locus_tag="FOA43_003574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923825.1"
                     /db_xref="GeneID:62196974"
     CDS             748301..750799
                     /locus_tag="FOA43_003574"
                     /note="BUSCO:EOG09343TUS;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779753.1"
                     /db_xref="GeneID:62196974"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR006993"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="PFAM:PF04908"
                     /translation="MDIEVKYQNFKEQHAPSLLGSTVRNESPSGERENGHDNGDDGDD
                     SDNAASVKPLLHEVKDDSRETDEENQDPKKYGEEDALLGDDEDDDLNKLLNQEGALNE
                     EALQMKAKLREHTESVKRKNPSGYQRRASESEKVRDDDLNRVAPAASFPDTTFKHKAH
                     SVTAGEDDDDDVEAEKSKVEYYKPHDRPTPNQIVEKVNEGNYVSPEREGNNIFVKNVG
                     INEEDDVDDEENALDEEIAKKLHLSSIDTIAEEVPDATIENDSGYIPPAAMSEGSSSR
                     LLKEQRRSRSREAARSADQTSSKGEKPHLARGESYHGGLSNDDYYKKGFPLDDIPRGT
                     AAVERKPRHEPGTVKYMHQSSLNYLRSISSSRSRADNDKRAMGYKLIDEGDLKDTGGL
                     VNDNNLAQIVDLEEAMDDVLQEVSNTQHSFELKGLHKLPSEGAKVTGVNIDAEKDTED
                     ATSPLEVGKSDKSGNDLEEKEKGSQDVKNGDTKEEYLSVEAEDEAKDEPEGKPEDEPK
                     GEAKGEPEDEAKGEPEDEAKGEPEDEAKGEPEDEAKGEPEDEAKGEPEDEAKGEAKDE
                     AKGEAKDEAKDKAKNEAKDEAQGEAEDKSEDEAKNEAKNEAKDKPEDEAKDEPEAEAK
                     DEPEAEPEAEPEDKPKGEAKDEAKDEAKDEPKDESQGEAEDKPEDEAKDEELAVSASS
                     GHTEAAETAEDTEASQVSEADDTEQLFAEAAKEQKANTQIFSNGGEAHVSKAGKMEFE
                     DVPVYVYTSLAGGMKIMTRTNRLQTILVANKIKFEFKDLGTDSAAKRVWKTYSQGKTL
                     PGVVRGKDDFIGNWEDIEDANEDYAVRSLIYETY"
     gene            complement(<750926..>754145)
                     /locus_tag="FOA43_003575"
                     /db_xref="GeneID:62196975"
     mRNA            complement(join(<750926..753942,754139..>754145))
                     /locus_tag="FOA43_003575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923826.1"
                     /db_xref="GeneID:62196975"
     CDS             complement(join(750926..753942,754139..754145))
                     /locus_tag="FOA43_003575"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779754.1"
                     /db_xref="GeneID:62196975"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="PFAM:PF06738"
                     /translation="MTHFIYCIVYHISLLNTENMAKSRTLGSPTDSEASSVESSKSKR
                     LRSNKPRFKLNSRFQSTAIQGIPIPEDDEHDADFYHPVFPTFKPKQGQDSKTGTYTEN
                     EKIITPHDPMPLKNEGSGIGSSSEFVQEIERDFDEGFDRDTAGNEAQQHYQGIHKKIV
                     SNHLQPFSSNGFEESSDDISTEEEDEDNADLSRIKKLNSSSSIERTASQRSERSRRDI
                     ILKKIRTGLSFGGGNDNKPIESIEKDISDMDSVPSIHKSGGLFRRLFGLNEAPIGGGM
                     VPGGISSSTPHHIEDEESRLEGTDPTNEFEDEAKLLVNSIFRNKRKTMSSELDSSASL
                     DDSTLLQQAIAHDEFDDLANDSELDIDIPESVAQKPRKLRRGIASSLLSLYNNMPGGR
                     HQQKSHHEGKQIESDVFSHTNASDEDFRGRRRQKSHAGKRMLSGLRIGHRSSSSLPKT
                     FHSRRNSSSDGTTDTIELQNLSRVELLKGDAVTTLEANVESSNNSDRKDSPIRLPQFS
                     RKKDGKVEFSSETGAPLEGEAEEYLNEYQNMKKRRKNLKHRFHQENTARITVHIADVL
                     QRQMFILTLCKAFMRYGAPTHRLEEYMTMTARVLEIDGSFIYFPGCMLVSFGDASTRT
                     TEMRLVRCAEGLDLGRLDEAHEIYKNVVHDREGVQEATEALEAMMARKPHFSSWICIL
                     MYAFSSAMVAPWAFGGSWKDLPICFAVGLVIGFLQFVICPRSPLYSSLFEVSASIASS
                     FMARAIGSVNGGQTFCYASIVQSSLALILPGYIILCGSLELQSRNIVAGSVRMFYAFI
                     YSLLLSFGITLGAALYGWIDSNATSAAVCTSNIDPWWRFLFIPGFTIGIALANQASWG
                     QLPIMTFISGSGYVVNYFSSKHFKNATELSATLGCFVIGLVSNLYSRMMKSFSKYLSR
                     SSFMTVSLMLPGIFVQVPSGVASQGSVLMGLSTANDIVNSNTTKTSVTNTSSLGSMAF
                     GLLMIEVALGISVGLYMSTVVVYPFGKKRTGLFTL"
     gene            complement(<755140..>757038)
                     /gene="DED1"
                     /locus_tag="FOA43_003576"
                     /db_xref="GeneID:62196976"
     mRNA            complement(<755140..>757038)
                     /gene="DED1"
                     /locus_tag="FOA43_003576"
                     /product="DEAD-box ATP-dependent RNA helicase"
                     /transcript_id="XM_038923827.1"
                     /db_xref="GeneID:62196976"
     CDS             complement(755140..757038)
                     /gene="DED1"
                     /locus_tag="FOA43_003576"
                     /codon_start=1
                     /product="DEAD-box ATP-dependent RNA helicase"
                     /protein_id="XP_038779755.1"
                     /db_xref="GeneID:62196976"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /translation="MAYVPPHRSRTEGSGDSSSSPVSSSRKGGDFFGHDDGNNSRDGY
                     GSYGGNRGYGGNRGNRGYSGYGRGGRGYGEGYGQRDNGYGGRNGSYSRGDNKRYGQGS
                     FTDGVHHPAPKNEKLERELFGDPAEEKAPSGINFDNYDDIPVEVSGEGTPDPINQFTS
                     PPINELLLENIELSLFNKPTPVQKYSIPIVGSGRDLMACAQTGSGKTGGFLFPVLSSL
                     FENGPSPVANEGNVFARRKAYPSALVLAPTRELAIQNFEEARKYAYRSWVRVCVVYGG
                     SDINSQLRNLERGCDLIVATPGRLNDMLERGRVSLKNIRFLVLDEADRMLDMGFEPQI
                     RHIVDGCDMPCAKDRQTLMFSATFPKEIQVMARDFLDNYIFLSVGKVGSTSENITQRI
                     LYVEDDEKKSSLLDILSATDDTLTTGLTLIFVETKKMADILSDFLISQNFPATSIHGD
                     RTQSERERALEMFKTGRAPILVATAVAARGLDIPNVTHVINYDLPGDVDDYVHRIGRT
                     GRAGNNGLATAFLNRGNRNVVKDLIDLLHDSNQEVPDFLSNIARESPSGRGGRGGRGR
                     GRSTPYKDYRKYGGGNSGSSNWGSRSNGYGDNGYGYNNSSSGNGNGNSSYGSNNYSSA
                     SSSNSQWW"
     gene            complement(<757579..>758748)
                     /gene="RPL3"
                     /locus_tag="FOA43_003577"
                     /db_xref="GeneID:62196977"
     mRNA            complement(<757579..>758748)
                     /gene="RPL3"
                     /locus_tag="FOA43_003577"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_038923828.1"
                     /db_xref="GeneID:62196977"
     CDS             complement(757579..758748)
                     /gene="RPL3"
                     /locus_tag="FOA43_003577"
                     /note="BUSCO:EOG09342BXF"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_038779756.1"
                     /db_xref="GeneID:62196977"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="PFAM:PF00297"
                     /translation="MSHRKFEEPRHGSLGFLPRKRAAYQRGHIKSFPKDDSTKPVALT
                     AFLGYKAGMTTIVRDLDRPGSRVHKREVVEAATVIDTPELVVVGVVGYVETPRGLRSL
                     TTVWAEHLSEEVKRRFYKNWYKSKKRAFSKYSEKYANGSADIETEFARIKKYCAVVRV
                     LVHTQVRKTPLSMKKAHLAEIQLNGGSVSDKVDWAKEQFEKTVPVESVFEQNETIDVI
                     AVTRGHGYEGVTHRWGTTKLPRKTHRGTRKVACIGAWHPSHVGWSVARAGQNGYHRRT
                     SVNHKIYRLGKAGDETSGATDFDRTKKTINPLGGFVRYGNVNNDFVMLKGCIPGPVKR
                     VITLRKSLHHPTNRKALEKVSLKWIDTSSNFGNGRFQTAAEKHAFLGTLKKDYQN"
     gene            <759368..>760621
                     /gene="CPA1"
                     /locus_tag="FOA43_003578"
                     /db_xref="GeneID:62196978"
     mRNA            <759368..>760621
                     /gene="CPA1"
                     /locus_tag="FOA43_003578"
                     /product="Multifunctional pyrimidine synthesis protein
                     CAD"
                     /transcript_id="XM_038923829.1"
                     /db_xref="GeneID:62196978"
     CDS             759368..760621
                     /gene="CPA1"
                     /locus_tag="FOA43_003578"
                     /note="MEROPS:MER0060647;
                     BUSCO:EOG09341X9N"
                     /codon_start=1
                     /product="Multifunctional pyrimidine synthesis protein
                     CAD"
                     /protein_id="XP_038779757.1"
                     /db_xref="GeneID:62196978"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="InterPro:IPR035686"
                     /db_xref="InterPro:IPR036480"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00988"
                     /translation="MFALFSKGVKKRISNAVRYSSTKTFDRATMTIRDGPVFSGFSFG
                     ADKNVSGEAVFTTSLVGYPESMTDPSYKGQILCFTQPLIGNYGVPSSSVKDKYNLLKF
                     FESPHIQCIGIVVSDVAMQYSHWTAVESLSQWCKREGVAAITGVDTRALVTYLREQGS
                     SLGRISIGETYDADEDAAFDDPSAINLVHKVSTKAPFHIEAPNAKYHILVIDCGVKEN
                     IMRNLVSRGASITVVPYNYPVQKIAPKFDGLFITNGPGDPTHCSVTIHNLRQTMDENK
                     DLPIMGICLGHQLLALSSGAKTIKLKYGNRAHNIPTLDLTTGQCHITSQNHGYAVDAS
                     TLSSDFKQYFINLNDLSNEGMIHKTRPIFSTQFHPEAKGGPHDTTFLFDNFFDSVANH
                     RSTNNHHISAGDLLADLLPNERVLQ"
     gene            <760898..>761839
                     /locus_tag="FOA43_003579"
                     /db_xref="GeneID:62196979"
     mRNA            <760898..>761839
                     /locus_tag="FOA43_003579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923830.1"
                     /db_xref="GeneID:62196979"
     CDS             760898..761839
                     /locus_tag="FOA43_003579"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779758.1"
                     /db_xref="GeneID:62196979"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="InterPro:IPR036523"
                     /db_xref="PFAM:PF01975"
                     /translation="MRVLLTNDDGGPNDLASPYVKYLVEAIEKHTDWELTICIPSSQK
                     SWIGKAHFAGKDVTVKYIYSSIENPQDNSYHGPFGYPQKRLREDVTLKEWCLVDDGTP
                     ATCADIGINHICGHENVDLVISGPNVGRNSTSLYALSSGTIGGAMEGCSHGKKAVAVS
                     YAYEKRFDTDPTILRQAALLSVKIIENLYQQWREGIDLYSINIPLVPDLRFGTTKIYK
                     VPMLKNRWGKSLFKASENVVEESADVRHSDIVDQSVSAGQLFKWNPDFAQVHRDVAGS
                     EQISDGKVISEGAVSVTAIKAIYEQVDSFNHGEMILE"
     gene            <761942..>763150
                     /locus_tag="FOA43_003580"
                     /db_xref="GeneID:62196980"
     mRNA            <761942..>763150
                     /locus_tag="FOA43_003580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923831.1"
                     /db_xref="GeneID:62196980"
     CDS             761942..763150
                     /locus_tag="FOA43_003580"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779759.1"
                     /db_xref="GeneID:62196980"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="PFAM:PF03133"
                     /translation="MNLKEDPRIVITYPQSDYIVSPLKAAISKYLPSSSISDDLKTVP
                     KGVKLLHYGEYEDLDHERLFQDKFYLANSYTYRKGLIRKQYLANTVAYYVAKHPDSSL
                     KNAYPETFQLECAYAEFLDDALDEAYELRCDLIENEKDLEKTYILKPSMSDKGQGIRL
                     FKTIDQLQTIFNSFDEADDEADNKEGDDESSENGIILSQMRNFVVQEYIANPLLLKEY
                     DNRKFHIRTYVLCVGCLEVYVYQRMLMLFSESCYVIPGKAGGIINMTGHLTNTCLQED
                     TNKTVVVELDKSVLSPELKNGILSQINVTVAELFKASMSFDRINFQPLPNAFEIYGLD
                     FLVDVEERVELLEVNAYPDFKQTGQDLKEVIYELFDGIVAKGVVPFFEGTEKDAENML
                     KVLDTNNSGY"
     gene            complement(<763205..>764281)
                     /locus_tag="FOA43_003581"
                     /db_xref="GeneID:62196981"
     mRNA            complement(<763205..>764281)
                     /locus_tag="FOA43_003581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923832.1"
                     /db_xref="GeneID:62196981"
     CDS             complement(763205..764281)
                     /locus_tag="FOA43_003581"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779760.1"
                     /db_xref="GeneID:62196981"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="PFAM:PF08595"
                     /translation="MSTKNSTATLRSLKGDILRFRHSVESRKKDGPEFNEAPLLEQED
                     EEFSSGGSNRGNKFLYNSDTVDCGKLNSSRDNFKLVTMNSVDQTTGKHTTKLVLQDKR
                     MSLDELVKMELDEEYGSVSDDEDNDYYGADARKVLESIDLADILGPITSPSDVVNRKS
                     ISTIYKSQHLSALAEETIHIIEKEQDNVNQLSQLLAVFLGDDSSNIYADLLKLPNYDH
                     HLDLGEEMNNADEHDNVSHDESALKNGEAGKDEDTIQDDDDITNQQPNGSLHMVSNEA
                     SNKLIKDPFFKLPQYRRDFNFGVHKTENAEETRQLVQIALQRNEEFIRSLCSIRMGFI
                     KAERLKDSIYGWCKEMGEDARREQ"
     gene            <765240..>766601
                     /locus_tag="FOA43_003582"
                     /db_xref="GeneID:62196982"
     mRNA            <765240..>766601
                     /locus_tag="FOA43_003582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923833.1"
                     /db_xref="GeneID:62196982"
     CDS             765240..766601
                     /locus_tag="FOA43_003582"
                     /note="BUSCO:EOG093422PQ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779761.1"
                     /db_xref="GeneID:62196982"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="InterPro:IPR036075"
                     /db_xref="PFAM:PF01937"
                     /translation="MTTVPPLYYNNDPHSFGFATARSRWPSILDSVIKDVEATMVDSN
                     SRTEVSQGKEIVQDITRLKEAIMKNGEIGSFAKPDIPGLQSYDDTLETLGAITWLTGP
                     WLFCECYLYRRIDAYFKSRSEWVEFDPFESKKETAFRSSGPGIIELCLRYKKMSLSLA
                     KQQNEGSITIDRLRVIFEELIDVSLWGNAIDLSLLANATLEDLQSRQGAEAIAKASKN
                     VLCNDLPLAWNRLLSVPIEKRRVDFVLDNAGFELFTDIVLSLFLLDSKLTKKVVFHCK
                     TRPWMVSDTMIKDYDVFFHEILHAFSGSNDERKYLVDRLHDYKASGKFQLVDSEFWTV
                     DLDYWHLSPEETKYGGADLCNHFQDSALVIVKGDLNYRKLTGDRKWPRDVPFTTAIGK
                     LAHSGIHILALRTCKADVCAGLPVGKDEELCDYWRSQGNKYGELWCSSGKWAVISYSS
                     GEN"
     gene            complement(<766669..>767946)
                     /locus_tag="FOA43_003583"
                     /db_xref="GeneID:62196983"
     mRNA            complement(<766669..>767946)
                     /locus_tag="FOA43_003583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923834.1"
                     /db_xref="GeneID:62196983"
     CDS             complement(766669..767946)
                     /locus_tag="FOA43_003583"
                     /note="BUSCO:EOG09342O7A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779762.1"
                     /db_xref="GeneID:62196983"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="PFAM:PF08783"
                     /translation="MAVIYYRFRSQKPEQISTIRFDGTGLTVFELKREIIYANKLLSA
                     TDADILLYHFEDPAKEYSDDNGVIQRSSTVLVRRTSAGKKGKGNVSRYIAGRQRLTRP
                     TTTSSVSTLPLAASALATSDGRQSEEDLIKQMFNQQDDQWNQQQEIMATAQRVDTMRP
                     DAKLDETIPEYYICYKCGAKGKHHIRNCPKNNDPNWEGVRVKKTTGIPKSHLKALDTP
                     AGVVDDPTQNYMVNEEGKYVVAVADKRAWERFQKIQQSKHEAAGKGDEIDVDDPELQD
                     PETHKLFNDPVKTKCCQKLYSRHVIEDLLLESDFKCPNCGQEDVYLDSLQKDKETQKK
                     VDEYLAKRKAELGQSEQDATKRQRLNPTGLPVIPQSNANLMGVPPMGMPFMPFPMPGQ
                     MPGQMPMPIGMGVLPVNAAKSTNVKSGGSGSGK"
     gene            <768191..>768581
                     /gene="TOA2"
                     /locus_tag="FOA43_003584"
                     /db_xref="GeneID:62196984"
     mRNA            join(<768191..768231,768287..>768581)
                     /gene="TOA2"
                     /locus_tag="FOA43_003584"
                     /product="Transcription initiation factor IIA small chain
                     (TFIIA 13.5 kDa subunit)"
                     /transcript_id="XM_038923835.1"
                     /db_xref="GeneID:62196984"
     CDS             join(768191..768231,768287..768581)
                     /gene="TOA2"
                     /locus_tag="FOA43_003584"
                     /note="BUSCO:EOG09344K9Z"
                     /codon_start=1
                     /product="Transcription initiation factor IIA small chain
                     (TFIIA 13.5 kDa subunit)"
                     /protein_id="XP_038779763.1"
                     /db_xref="GeneID:62196984"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="PFAM:PF02268"
                     /db_xref="PFAM:PF02751"
                     /translation="MNGPSYYEFYRRSTVGTTLADALDTLIVDQRIQPQLAMKILANF
                     DRVTSDNLRDIVKSKLSFKGHLHTYRFCDDVWTFVIKDVNVKFDDNETINVDRFKIVA
                     CNSKKSGEN"
     gene            complement(<768655..>771318)
                     /locus_tag="FOA43_003585"
                     /db_xref="GeneID:62196985"
     mRNA            complement(<768655..>771318)
                     /locus_tag="FOA43_003585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923836.1"
                     /db_xref="GeneID:62196985"
     CDS             complement(768655..771318)
                     /locus_tag="FOA43_003585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779764.1"
                     /db_xref="GeneID:62196985"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR036322"
                     /translation="MAKLKGYSLDVGYPVYGAKFVGDKTLIVVGGGGEGKNGVPNKIT
                     ALLVQPDHPKKPIKRYRELVLNDQEDCPMSMDVNSNVILLGANENSEMIKKGVNKHLR
                     KFKFVNDHLKFVESCQIHPGSNPQHYQKITCLSRDGSLGVISMSDNPSSVYIVDTSED
                     LEERFKIVTPGDVKDIGISPDGKMMCYLTSSHLEAISTITGRSVFKTDIKFQMSKVGF
                     YDNNILVLAGSQKNGITLALFSIAKSAIVKESVICKNLKGVTSMDVNSNSGLISLSGS
                     DCSLLLVRFKDFKLLRKVNQVHNFAITKVTSSSDGHYLASVSAANTVSVLVTPPKFAE
                     SKSLFLSLFEFFLSIVCIALLAICSQYLYANGYIALAKEKLVQFYESRRPADSSSYFT
                     IQPMESSETFLSGPPSTTTYLPEDATVKSDIISFSSEPSVTTVTPITSIVSSSIEISL
                     DTPVSLVDREVERKDIYESRVDSKTESSFELASKIETKPETQYTSDSDSGSAPDVSVS
                     EVESKLKLTQQLLSSCTSRSLAKSTIVLSALSKSKSAVVTPLTSTVLSTTSDNNEISE
                     DTLEHLTVPEIVSHLDSLASTASRPLATSSVADISASVIVTSSPSSSPLVSSSEISLP
                     SPSLSPTPAVPELSVSPDIDIVIPSNSIHELLQPSEESMSVSDPELQHIEKETTSFSS
                     KKTVTDTVKQTVKETVIEIQTSVVTQISVQIATATETSTIVEHVTVTHSESGSSVKTE
                     TTELLDESFEIPHSGDQIDPSKILEKPAISATDKPRKESDLPGNPETIDVPVASDLLE
                     VDVEAESFIVRSDSSISEIFETSLLDDHTDSVSELRTSTSETAMNVKESSSVSFGSST
                     ISSVSEFRVESLTSDVSLSTSISSETSKSPI"
     gene            complement(<771546..>773375)
                     /locus_tag="FOA43_003586"
                     /db_xref="GeneID:62196986"
     mRNA            complement(<771546..>773375)
                     /locus_tag="FOA43_003586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923837.1"
                     /db_xref="GeneID:62196986"
     CDS             complement(771546..773375)
                     /locus_tag="FOA43_003586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779765.1"
                     /db_xref="GeneID:62196986"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="InterPro:IPR036168"
                     /db_xref="PFAM:PF00928"
                     /translation="MSSAIYILDEGLNLLIHREYKEELNNDFIIEKFKELFIESLPVS
                     QPILYSDGVTYVCLRCDDVYMMSPVYEDVNVMRLMTFLNKFSHVLRSYFIEYHFLDRC
                     SKRIDSDLIKDNYILIYELFDETLDWGLPQLTEFSILKEYVKPIEQKVVMTEKEKDNR
                     KSDAAASLDKQIEADINSSISRASTAMISWRPKGIFYNKNEFFMDFDEHLKFKYNFNA
                     KKVIVNHISGQILCRSFLSGMPALKLELNEQIEQKNDNSELLETRSIFTNVNYHQCVE
                     LSAIHNSSLSFVPPDGEFKLLFYQILQTSVLKPLILVKPLYRIFYKEGRFILRIKAEI
                     LTSFKRKYSMTDIAIKFPLLVPLEPFKIDFDQPLRYKTKLGKVTHNLDSHSVTWHIAK
                     LEGLSKGDMMCDFQLVVKPKLFEEYEEDMLHNKQSKNDLIYFDLPSEASNLKGKSNNM
                     ALSSAMENVLDSRAENKDILVTVAFKLSAMLYSGLKVNYLQIKEPQIDFHSFSWVKYK
                     TICEGDDYSFVVSDDQIQVDLTEQQIAESGNIQTSPNDNTKEPNFNERDNDNNHGDQH
                     NDEIAPAVQSSTVYSYGDRVIDFEEYKIEGEGANDQASGYPSK"
     gene            complement(<773955..>774695)
                     /locus_tag="FOA43_003587"
                     /db_xref="GeneID:62196987"
     mRNA            complement(<773955..>774695)
                     /locus_tag="FOA43_003587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923838.1"
                     /db_xref="GeneID:62196987"
     CDS             complement(773955..774695)
                     /locus_tag="FOA43_003587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779766.1"
                     /db_xref="GeneID:62196987"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR034904"
                     /db_xref="InterPro:IPR035433"
                     /db_xref="InterPro:IPR036498"
                     /db_xref="PFAM:PF01106"
                     /db_xref="PFAM:PF08712"
                     /translation="MLSSRSLTRAIRPFSFLQRRLLSLQTVQTPNEDALKFVAKDAKF
                     LPEGLTSAVEVDSLADADERSLMATQLFKINGVKSIMIGPDFITVSKIDKSLSNNKEL
                     EWNSLSPRIISTITDFVRSKIPAINKDYKNKLQKELDEAQDEDDDVVYEIKEVISTRI
                     KPALQDDGGDIHFRSFDEDSGTVYIKLQGACKSCSLSEDTLRNGIESMLTHYIPEVQS
                     VKPVLDPEEEIAIQEFERLERRLKQRHL"
     gene            complement(<774890..>776443)
                     /locus_tag="FOA43_003588"
                     /db_xref="GeneID:62196988"
     mRNA            complement(<774890..>776443)
                     /locus_tag="FOA43_003588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923839.1"
                     /db_xref="GeneID:62196988"
     CDS             complement(774890..776443)
                     /locus_tag="FOA43_003588"
                     /note="BUSCO:EOG09341617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779767.1"
                     /db_xref="GeneID:62196988"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="PFAM:PF01593"
                     /translation="MAPDWKITVFEANDKTGGYIRSQPTKVADSSSTVFEKGPRTLRG
                     VSEGTLILLDLVAKFGKQQSILGVHKEAAANKKYLLSPSKARQLVQVPDDFTSLRKFL
                     TNSIGRSIPMALGKEFFTLRRGHGEETVEQFFNRHYGKGLSDNLISAIFHGVYAADAG
                     KLSINAVMPSMVKLESKSASIGRYTVWKALFNSKKSQESAPPIKLSANLRKYQDLFSP
                     KLNLLNMSEFLKSFPMTLLQGGLETLPQCIANNLPKNVEVVYNSKISSIKPLASGQVA
                     LTFEDGNTERFDHLRSTINTRALSSLIDSKPMKDVFSQVNYSSVSLANVYIPKKNILP
                     VSGFGFLVPKASTDKAKLLGVIFDSDVEHSARPLFSLESVRKELTSKTVSTPDKLKQL
                     AEDVFHSQPLNTRPYTKVTFMLGGHMYDGIKTFPKEHEIKKIVEDTFGSILHTPLSDY
                     QLEVGLIENAIPQYNVGYLDLKAQAWKLADSEFHGALSFGGMTFADGVGVPDCVMSSF
                     KDAVKLAHL"
     gene            complement(<776745..>780101)
                     /locus_tag="FOA43_003589"
                     /db_xref="GeneID:62196989"
     mRNA            complement(<776745..>780101)
                     /locus_tag="FOA43_003589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923840.1"
                     /db_xref="GeneID:62196989"
     CDS             complement(776745..780101)
                     /locus_tag="FOA43_003589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779768.1"
                     /db_xref="GeneID:62196989"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF11715"
                     /translation="MKSIQYTELSLEIDTSLQCIAIYLPTNTDRVVKKQRLSSEDLRV
                     EVQTAENTNGTDSSSFGGFCELNALDSLCRTVAYRVSESKDSITLTPLLINNSLNLKF
                     QSLKFVVPATIRPNCVTLIEQTDAEDTVVLDIITEANLLITLNVHLRSLLVEHPRNYP
                     LQLDNFYSWCSYSLPYSFLDRKPFFLKGINVHTSIAALVDGGVLLLSKQSPLDSFLVI
                     PFSDSSYFESIKSRLFSRKPAGAIPSFVDIDGERISSKAVLDIIAFQNNRYLLSVSID
                     KQLKVWSLSDGVCLNTYKLDDFLSDSLKPVLISRCLPKKILHLLNDSLASLFLPIGNN
                     YLKVLNLNADGAVSEAKNIDVPLPSTNWLFHSCDAQLRNSTLKIWICWCFGGNYMLQK
                     CELPDKGVESWTSSTSANDVEAKLQSRFIADVENATDYESLSKIGTLWVLDSFRYETS
                     ILQSAMELCSKFYEGSISGLSLKEQILKTITANKDSTDDDYLSVMKRQWLRFANVCDE
                     VSRSFQNIISVCYDRSLDENDGFFIIMKTLNYSIVKKASIFAALTSGSDEVSETMNRI
                     FNVEGIEFDSLKRVVKVLQEFRRRFSSADLYKLEQYLYRGKSSSTTDLMTTIVQTCMK
                     GRMDSSAFDLLGSLNSIPNCWDQIQFLANASILNTLGYKPINNVSLGNVGDSLILSDV
                     RAESVFAQDIMLDIMLVLLAAEINDPMEELFRHVSMSYQRYGMILKTLGYSLDMKSGK
                     LISNEVNVTSSSLVLSYIKSFHQGGALIRNKNLNLLTNDIFIKLFGDDYGYFIMSSLL
                     ALNADSYVLFDLLAYLKVKSPITLMLTGLVKMKSKDESAYDIFTESADLITGGIKSIS
                     SRERVALEPISSLADAILTESKVEYFFNLSILFESHGMEKFALKFALDSLAARNEVQD
                     TTDDASILAKVFKLALKLDELELSYDMISKMKFRNRKHPIKQFIYKLFQINQLSKILE
                     FHFSEDFDAVDELIYGLGESSALTGDLSNALKYYRTCYSLRLQEGDIRAAIEALYRIN
                     CVGFELIKIGKFSDPQLLLDNYLIVFNLLHTMKEDDRWIIKHPVCFKSDGSEGDMNFD
                     NNGTNQLLTFEDLEEEYNQIRARYSESIAV"
     gene            <781594..>784307
                     /locus_tag="FOA43_003590"
                     /db_xref="GeneID:62196990"
     mRNA            join(<781594..781600,782548..>784307)
                     /locus_tag="FOA43_003590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923841.1"
                     /db_xref="GeneID:62196990"
     CDS             join(781594..781600,782548..784307)
                     /locus_tag="FOA43_003590"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779769.1"
                     /db_xref="GeneID:62196990"
                     /translation="MTKNGKYKGETLVDDSNSSHVVESIERKQPEISIPSILNSGTSV
                     DSKLDVISKDVVTVLRLLHGRRQACEDDTHLPSLEDLASNSGVAESNLMLNMTDRLVS
                     SGENSPMCVLAKVPGLLNLDKETALSNSLPNGIFRSLNMSRCISPQNSLMTNVITIGL
                     LDEKEALKLLTIFRDRYGRWISFPDTFSTEQILRQIERKCPLLLTVACCLSLKYSDPL
                     LKDRCYLRLLETIKLDLQRGLVDPPLCLEFLQAVLVLSIYATNLSETDAADLHIDSWD
                     LSSFGISLFLKMNHLGLLNRLYDANEVEPEFNELTAYRTWNILVLVQLAYSLILGRRS
                     NYSLDLLKPKEVSEFSMSTKFDYRIIAEVLIYIVNYHYSVLNGSLICFKKDIEDWFHR
                     WNYMFGKSLNQFIEIDYHWTNAMVLLRIYRFRIDMPALTFICEDGTTGTVHSDAFSQL
                     RYHTVKVVELMSSIKDDSYFAFLSDQIHIIVFFSCIVLQSLLSFEHHASETDHTITDP
                     LKEIGKSAPISLLIRHINRLKKVSTSQDDTFFKYSVMLEKNLLYKFPSERLELQPMVL
                     EELYSFEDIGDNQEEEAEQIIE"
     gene            complement(<784958..>785993)
                     /locus_tag="FOA43_003591"
                     /db_xref="GeneID:62196991"
     mRNA            complement(join(<784958..785941,785991..>785993))
                     /locus_tag="FOA43_003591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923842.1"
                     /db_xref="GeneID:62196991"
     CDS             complement(join(784958..785941,785991..785993))
                     /locus_tag="FOA43_003591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779770.1"
                     /db_xref="GeneID:62196991"
                     /translation="MAGLVSRWADDESLVKKAVTEDVREEEEDPFKKVRESKLTMNVA
                     PTNNEDSVGIDHREAPESENVDKGDSSFKPVPKNNLSNETQRLFPVEDGADEKFEQNV
                     RSIPTSFKTPKHRRRNRRGQKMDTNETNTDFQVEKEDEGSFIPVSKNRLSKETQRLFP
                     VGQLPTPPNSAYKERLPREQSRRSSRGKKGTLLPSKWADRPITKDQLPTPPSTGKSYH
                     RNEHGRQPDEKLPHRGGGNSKSSTGTRGKTRARGGRASEILREEKNGGRIRRDRQEYN
                     SGEQTHAKDDRRGHQSKQPQKLAANNLDFDKELKELMQKFDTKSSWADDLDI"
     gene            <786476..>787327
                     /locus_tag="FOA43_003592"
                     /db_xref="GeneID:62196992"
     mRNA            <786476..>787327
                     /locus_tag="FOA43_003592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923843.1"
                     /db_xref="GeneID:62196992"
     CDS             786476..787327
                     /locus_tag="FOA43_003592"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779771.1"
                     /db_xref="GeneID:62196992"
                     /translation="MPNNNTLSSGPPYARAIIPPSVKDSKPYINPESLRTSKRAQRDT
                     EILDSIEESVKRGEYKDHPTSMWTKFGFVFFSSFVFLGGFVVYQTSKGKPAFFPLWFR
                     KVVPLAKADGVNKINLEALKRATKESLLIKLSMNGQVKQLFGLPLQLGEFERFDVSIE
                     YRDYSMEGLQVDCSKQWWKPEFSIKKIMVSIPENFGGMLEPLKTNGEIDYDAIDKKFP
                     NQRDYSILIDGRISAMGNSNSIVDKGSGAITFRGLIEFDHTKTIKLVNVLLSYKTNGN
                     ASIEKLW"
     gene            <787473..>788622
                     /locus_tag="FOA43_003593"
                     /db_xref="GeneID:62196993"
     mRNA            join(<787473..787478,787732..>788622)
                     /locus_tag="FOA43_003593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923844.1"
                     /db_xref="GeneID:62196993"
     CDS             join(787473..787478,787732..788622)
                     /locus_tag="FOA43_003593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779772.1"
                     /db_xref="GeneID:62196993"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR006642"
                     /translation="MVSGLRKVLLLDGIVSWFTEHRAELIGKVKKADHVSRDPHTDEA
                     NDIIDLTDEHFHKYNQQELEVKSRRISDSPKEPDTLVECPVCSRFMTTHELQSSHLDI
                     CLRGETIDDSQISTESSPATGMISSFFNSPRKKRKKMQDPSHQLQPKQVSERQRIPNL
                     DTMMSTVKLREKLAGFNLPTGGTRQQMEARMKEYINLYNANLDSISPVDEVVLVNRLH
                     KWELLLTQSQHRLAEKKREEEEQRRQGDDESDEEVKREATRKSKREMREWRQKYRSTY
                     HNLIQKAKNNMKDSAKPEPTDK"
     gene            complement(<788661..>789811)
                     /locus_tag="FOA43_003594"
                     /db_xref="GeneID:62196994"
     mRNA            complement(join(<788661..789587,789806..>789811))
                     /locus_tag="FOA43_003594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923845.1"
                     /db_xref="GeneID:62196994"
     CDS             complement(join(788661..789587,789806..789811))
                     /locus_tag="FOA43_003594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779773.1"
                     /db_xref="GeneID:62196994"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PFAM:PF08543"
                     /translation="MAIYPTRDLLSISSHVVHGKVGNDAIQFPLNIRHWNVDCIHTTN
                     LSNHPGYKKFKGTKSSFQLIQDLYKGLTKIELRYDAAIVGYVASKQVLEVIYTEILAK
                     LPKETIVVMDPIMGDNGKLYVEEALVPLYKHILRDQTCEGLINLVTPNQFEMEILTDV
                     KIVDLDSLKQAIVSFFELYRVQKVVITSVSFDDSDTVLCIGAGSDGEVFTIQGSRIDA
                     VFSGSGDLFLGILTDRFVKSHGDLKESLTHTMNVVHKVLENTCQLSANLQPKRYVGDK
                     LYIPDLRLVESKFFLRDDSSDGILDNLTTSTTFL"
     gene            complement(<790088..>791542)
                     /locus_tag="FOA43_003595"
                     /db_xref="GeneID:62196995"
     mRNA            complement(<790088..>791542)
                     /locus_tag="FOA43_003595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923846.1"
                     /db_xref="GeneID:62196995"
     CDS             complement(790088..791542)
                     /locus_tag="FOA43_003595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779774.1"
                     /db_xref="GeneID:62196995"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="PFAM:PF00349"
                     /db_xref="PFAM:PF03727"
                     /translation="MVAKENILSVELQERLNHFQDEFWVPKEKLNHIIEYFISELNRG
                     LHDGTDPLGIPMNAAWVMDYPTGNEKGDYLALDLGGTNMRVVVVHLLGNHKFTTEQSK
                     FKLPSTIRTTKNREDLFGFIAESLGKFLKEKNPNGIPEGKVFPLGFTFSYPCTQTRVD
                     VGVLQRWTKGFDIPGVEGEDVVALLKKDIKKRNLPIKIVSLINDTCGTLVASRYTDPL
                     TEMGCIFGTGVNGAYYEKVSNISKIDGTLEDDILPSSKMLINCEYGSFDNIHKVLPRN
                     TYDKEIDEESPRPGQQTFEKMTSGYYLGELIRKSMLECYNGGVLFKHLAKNSEGAKNL
                     NKAYLLDTSFLSALESDETQDLSETDSQFKETLAVQTTLEERLFAKKLASFIGTRAAR
                     LSTCGISAACKKMNYKHCHIAADGSVFMRYPHFPERAAQALSDVWGWDGMKMEDHPIQ
                     IVRAQDGSGVGAAIIAALSDIRISKGLSLGMKKN"
     gene            complement(<792474..>793376)
                     /locus_tag="FOA43_003596"
                     /db_xref="GeneID:62196996"
     mRNA            complement(<792474..>793376)
                     /locus_tag="FOA43_003596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923847.1"
                     /db_xref="GeneID:62196996"
     CDS             complement(792474..793376)
                     /locus_tag="FOA43_003596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779775.1"
                     /db_xref="GeneID:62196996"
                     /translation="MNFMIAATVLGFMMLIQMAGAAYIEKVDGIYKEENSLESSLQDA
                     IMIRNLNRRDNNQEAEDVDPSFNQYMELKEDKWVAFLATASPNHFEKLIKKIKKIFGK
                     GYEEEEEETEEEIEEPGDGYEQPPADEEDDCEDSKTANYKKSLERDIFVSSSMINETK
                     PFAEFLFKLKDYANKGDLKNVLKEAGDFNYENFGMENTDNDNVADFGVEHVTFNDVKG
                     SDMKKWLKNNAKRRAEIIQLALTDDHFNDTAIFEAEEFEYRKGNIFLDEDENDLENSG
                     CTIMTRRSIVSAILAFSVAIFGSF"
     gene            <794729..>796681
                     /locus_tag="FOA43_003597"
                     /db_xref="GeneID:62196997"
     mRNA            join(<794729..795254,795576..>796681)
                     /locus_tag="FOA43_003597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923848.1"
                     /db_xref="GeneID:62196997"
     CDS             join(794729..795254,795576..796681)
                     /locus_tag="FOA43_003597"
                     /note="BUSCO:EOG09344AOW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779776.1"
                     /db_xref="GeneID:62196997"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="PFAM:PF08618"
                     /translation="MSSTSTSEQLSPGSESQDIATVPASSFESNTSSATASVAYDVEP
                     SSVYKRRSRLRIDDLVDPGTYQDAQINATDTSSGSSDLLIAATALGELGSSSPPKEPV
                     AGTTSSDTIFDKVTSHPLISSSINYMLERTIYTSSSYLLSTPLSSTATTHSTVADSTM
                     DGSLISPISALASSKQLSVINLNIESRRKLEMLIHFLKLGNSQLSERIESLIGMVESK
                     RQASDALMLSNSQTPTQLSDNETSDAGQNDPLGEDSRLPTSQFDNGSTVSLASLPRTN
                     SATSADNQGQFLSDESIQQMKDDIVSTVKKIVNVVSKVSASSLSEPARSNVREALLRL
                     PSNWAALFEQEQQRDDENENDKEKEEEDDDDDDDDDISYKSHSNDNESIDDNASLETT
                     YEDSRESWVQDDMNSEKFRNEIGNPNGSAKHIRRSVTQRLLANLFRYTGGVSSRSTTT
                     FKTREWFGSKIRSQMMYDPNGKILVLAQESLDMINKIIKFCNENLDKAETWNTSKQMQ
                     QKKTLISKLQDMDYVSQNDNEKIETIVVKEPEDSS"
     gene            complement(<796774..>797356)
                     /locus_tag="FOA43_003598"
                     /db_xref="GeneID:62196998"
     mRNA            complement(join(<796774..797276,797335..>797356))
                     /locus_tag="FOA43_003598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923849.1"
                     /db_xref="GeneID:62196998"
     CDS             complement(join(796774..797276,797335..797356))
                     /locus_tag="FOA43_003598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779777.1"
                     /db_xref="GeneID:62196998"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR037944"
                     /db_xref="PFAM:PF00578"
                     /db_xref="PFAM:PF08534"
                     /translation="MTQIATGSKLPTAVRLGYIPYTPEHENICSIGRPAELDLSKILP
                     GKKVVIVAAPGAFTPTCTERHIPPYVADYEKLKSRGIDDIFIATTDNPFVQAAWGKAL
                     GNKGQLKFVSDPKGAFSAQLGLADLKGDDYVPARTFRYALVVDNGTVKYVGVEKNGSL
                     EHSTLDAVLKFLKA"
     gene            complement(<797556..>800286)
                     /locus_tag="FOA43_003599"
                     /db_xref="GeneID:62196999"
     mRNA            complement(join(<797556..799895,800281..>800286))
                     /locus_tag="FOA43_003599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923850.1"
                     /db_xref="GeneID:62196999"
     CDS             complement(join(797556..799895,800281..800286))
                     /locus_tag="FOA43_003599"
                     /note="BUSCO:EOG09340NMQ;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779778.1"
                     /db_xref="GeneID:62196999"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="PFAM:PF10300"
                     /translation="MPALKLEKALKAMDYVLDDRPEEAFHLLGDHEEVAISELAYGVC
                     EFLEATLGFEDQTMHHASDILSKVESKAWREKLISEKNKIKASAIYPPGTEFGVAYAE
                     ANLLNALLMLMSENFMETAKALIKLRRAYHTLDVMSKSMEKMSHGELTTAAEAVKNLG
                     LDEISHCSSDSVNSTSHFADIPVPLTNRQLEDKKVIIKLESIYRMRKARIGGSHIGNP
                     PVAKALRTHLGDQETTPQIEGKEEQYGDPDIASVDEYIHSGVNLCFGILQVVLSLLPP
                     GLGRVLSIVGFKGSRENGLKMVWKASQERNIHGGIGLLALLVFYDGPFQFTDVDFDVP
                     SISEMKIIEEKRDNTVPSLQSKNITSNEMDCDTDSSDIGSFETAVSLQSTVSSINKIA
                     QEKMDLERKATRGDGEPTILHPGPKLVKTLLHARALFPNSNLWLLQESRMLAGRGRLE
                     EAVKLMDSANKSQMKQVDALMYFDRCMLLVFLHRFERAAEEFISLMKVNSYSHALYMY
                     FAGACYLEAYRMCETGLFLPEDKDGDTHDRVDPKKKEEYKMLAEKCLLEAPKLIGKKK
                     FMARILPFEKFVNRKFKEIIQRKKETQLPLIDCVGTSPIHELAYFWNGYNRMPENCLR
                     LSIKLLGYNASRIIDPELDLVNPKTGKTYSSFAETREQGMIRNTLQSISLRRLGKLEK
                     GMKVLDEGVLCYITESGRADPHDKLFKLSENPWLYPTALYEKALFCWKINGVAGLQDS
                     MDWLKKSQSYGGDDYELSTRVSMKTKAAIDRLEDLDFESSI"
     gene            complement(<800313..>801679)
                     /gene="GAS5"
                     /locus_tag="FOA43_003600"
                     /db_xref="GeneID:62197000"
     mRNA            complement(join(<800313..800335,800356..>801679))
                     /gene="GAS5"
                     /locus_tag="FOA43_003600"
                     /product="1,3-beta-glucanosyltransferase"
                     /transcript_id="XM_038923851.1"
                     /db_xref="GeneID:62197000"
     CDS             complement(join(800313..800335,800356..801679))
                     /gene="GAS5"
                     /locus_tag="FOA43_003600"
                     /note="CAZy:GH72;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="1,3-beta-glucanosyltransferase"
                     /protein_id="XP_038779779.1"
                     /db_xref="GeneID:62197000"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="PFAM:PF03198"
                     /translation="MKFSTLGLAFAIGATAAASLPAINITGNAFFNSETGERFYIRGV
                     DYQPGGSSNLTDPLGDSTICGRDIPYFEELGLNTIRVYSVDNTLDHSECMQMLDDAGI
                     YLILDLNTPDASISRYDPGCSYNAVYLNEVFSTVDEFSNYTNILGFFAANELVNNNAS
                     LDTAPYIKAVVRDTKKYIKARGYRQIPVGYSAADVSSLRKELADYLNCGNDTDAKIDM
                     LGVNDYSWCGQSSFTTSGYSEKVEMYTGFSVPIFLSEYGCNQVPGSRPFTEVKSIYST
                     QMSPVFSGGLVYQYTEDSSKYGLVEIEGDSVETLTDFENLKDELNLTSDPIGDGDYSA
                     TGEESACPTDWAFSINIPTAPDGLSKLLKNGATGGNGFDAETQNSCGDDAYYVSSTIT
                     ANSSSMEHTSSSTASSAHSTSTKSSSSSSKGIADQLEAHGMTALLALIAIRKIYIK"
     gene            <803198..>804334
                     /locus_tag="FOA43_003601"
                     /db_xref="GeneID:62197001"
     mRNA            <803198..>804334
                     /locus_tag="FOA43_003601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923852.1"
                     /db_xref="GeneID:62197001"
     CDS             803198..804334
                     /locus_tag="FOA43_003601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779780.1"
                     /db_xref="GeneID:62197001"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF01053"
                     /db_xref="PFAM:PF01212"
                     /translation="MTVDQEYRLETEVVRIDHNDQYHSSAPPLYQSATFRASDASHEG
                     KFAYTREGNPTRTTLQNHVAKLIGCKYVLAVNSGMACLDIIIHLLEPGDELICGQVLY
                     SGSDRLMKYAQKSSGISLHHENLADFEAVKAKITKKTKMIVIETPTNPLMQVVDVKKI
                     ALYAHEANPECIVVCDNTMNSALLMKPLELGADIHYESGTKYLNGHHDLMAGVIATNR
                     KEFADEMHYVIESIGSGLAPFDSWLLMRGMKTMVLRMERVCQNALQLAQWLESQGLKV
                     RFPALKSHPQYQLQKMQTKGTGALFSFETGNVAFSEAIVANVKIYSVTISFGCINSLI
                     SMPFKDETNPEHPADLIRVCVGIENIQDLIDDMGQAIKKAKKNI"
     gene            <804999..>806585
                     /locus_tag="FOA43_003602"
                     /db_xref="GeneID:62197002"
     mRNA            <804999..>806585
                     /locus_tag="FOA43_003602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923853.1"
                     /db_xref="GeneID:62197002"
     CDS             804999..806585
                     /locus_tag="FOA43_003602"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779781.1"
                     /db_xref="GeneID:62197002"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSSSQNANSSGEKISDLNVVNAVATTKRRVIKSRDADVTLKFME
                     RNGGEVPEITPERERKLAKKTTIIIILLTSITNLLLYSDKATLSYASIFELWKDTNLN
                     QNRYNNANTLFYVGYMVGQVNLLLMQRLPIGRLLSVLVFVWAALMFLHCTAHNYQGIY
                     ALRFFLGFVESIVIPILNTTMAQFLTADEKAATAPVFYSTCLGVTIPVGFIAYGVLHA
                     NVAIPIWKLFMIIIGSCTIAWLVIVVFFYPNNPTDARFLSTEEKVWVIRRVQRTTGAS
                     IEQKVFKKHQAKEALKDPITWLFGLFFLLQQLANNLPYQQNLLFEGIGNIDNLDSTLV
                     SVASGGFAAICCFIATGIMYYKRNITAYSVFFWTIPSFAASIAVVALPWDDKIALLGM
                     LCLASPLFGIPWILMFSWNSTSCSGYTKKLIRNAVVMLCYGIANLISPQLWQESDGPR
                     YIPAWIVQIVLSFFTAPIIALVIRYLLNKRNILREAASQEKSETSSGYVEEDDGAEIK
                     VNKASLDLTDFENEEFIYPL"
     gene            complement(<806782..>806988)
                     /locus_tag="FOA43_003603"
                     /db_xref="GeneID:62197003"
     mRNA            complement(<806782..>806988)
                     /locus_tag="FOA43_003603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923854.1"
                     /db_xref="GeneID:62197003"
     CDS             complement(806782..806988)
                     /locus_tag="FOA43_003603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779782.1"
                     /db_xref="GeneID:62197003"
                     /translation="MVLKFAILVSIRIIFARENAKKSKLLGFNDENNVISSDLPYREK
                     SDQKGASVKNAYVSKFDLTDLENK"
     gene            complement(<807311..>808930)
                     /locus_tag="FOA43_003604"
                     /db_xref="GeneID:62197004"
     mRNA            complement(<807311..>808930)
                     /locus_tag="FOA43_003604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923855.1"
                     /db_xref="GeneID:62197004"
     CDS             complement(807311..808930)
                     /locus_tag="FOA43_003604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779783.1"
                     /db_xref="GeneID:62197004"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="PFAM:PF01425"
                     /translation="MTWIEVKKSKLEVQKQLIKEYLAPHNQLPSVDDLNDVTGYLDRC
                     ALMTSREKQITNYSISELQYRYLAKELTAEEVVRAFCHRSTLAHQLVNCITEVRFKES
                     LEEARKQDAFVEEQQRLVGPLHGVIISVKDNINVSGLATSLGLVGLAEKEAVQDSAVV
                     TLLKKLGGIIICKTNVPSGLMFAETSNMLWGRTLNPFNRKYLNVGGSSGGEGAMASLK
                     GSCFGIGSDIGGSVRHPAALNNVYCIKPSFGRFPCYGTESGQPGQESIRTVYGIISSK
                     IENVEYSLRVCIDAKPYLDIDASCLPLPYSSYDINYKVPLNIAFMESDGLTTVTPPVQ
                     RGLYIVKEALKAEGHNVIDWPCEYFDDIRKTIYPFYDANGLKTIKDILEKSEEPVDPH
                     IHLDNCRDMPVSELWALQHTRTALVQKYLHYWNTGYEGGRLDAIIIPTSAFPACLMDK
                     VPPQPYTSVWNVVDYSASTFPVTRCDTDIDKPMKKNHFISDTDRQVHEIYSKELQKFE
                     GGPVGLQLVCNRLEEEKCLALTRYVSSLLEN"
     gene            complement(<809399..>810955)
                     /locus_tag="FOA43_003605"
                     /db_xref="GeneID:62197005"
     mRNA            complement(<809399..>810955)
                     /locus_tag="FOA43_003605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923856.1"
                     /db_xref="GeneID:62197005"
     CDS             complement(809399..810955)
                     /locus_tag="FOA43_003605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779784.1"
                     /db_xref="GeneID:62197005"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MSDKSEEAVKSSAVESVHPLTSFISPVSGEVIVDFEYSGDRALK
                     YVQNLEVISDVTESEYNKLKRKIDWYILPLISLIFGTQYIDKSTLSFAAVMGLKTDIP
                     MHGQQYSWLTTAFYLSFLVFVFPISRCLQKYPLIKTTSICIIAWGIVLCCHAACHSYG
                     TLLLCRILLGGLESAVTPAFVLLSSKWYKQEESFLRTTVYYSNNGFGTIIGCAIAYGC
                     FIHTTGYAIGSWRVLFIVTGLMTMVLGGILYFHIPDNPPDAWFLKKREKSLVLQRIKD
                     SKQGYGSPKWKWYQFKESMKDPRTWLGFFYAFSSNIPNGGLGSFMSILLSDSLGYGPK
                     KSLLMRMPGGAVETVGLIAFALFVGWFPQRIFISSFITVVVIAGSCMLAFCSNTGAQL
                     AGLYLYSLSPIGMICFLSLFSANTLGYSKKITSQAILLIGYCVGNLVGPQTFVTSEAP
                     KYHSAKVAIVVCYVFSLFCLIALFFVNYYDNKRRDKLESDPSYAEPHIENIEFADLTD
                     REVPAFRYLY"
     gene            <811660..>812901
                     /locus_tag="FOA43_003606"
                     /db_xref="GeneID:62197006"
     mRNA            <811660..>812901
                     /locus_tag="FOA43_003606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923857.1"
                     /db_xref="GeneID:62197006"
     CDS             811660..812901
                     /locus_tag="FOA43_003606"
                     /note="MEROPS:MER0003798;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779785.1"
                     /db_xref="GeneID:62197006"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="PFAM:PF01546"
                     /translation="MEQLPEINEKDCLEFLSNFVKIPSHSKTPAEIDAIKYVTKAMKD
                     IGLDASNVGFKDKNDGMQRFDSVGIWKGTGKKEGGRKLLFNGHVDVNPVSEGWTVDPY
                     GGKYDDKFIYGIGVSNMKSGCSSYYMAVKTLKNAGYKVSKDVTLTFVVGELQGGAGTV
                     ALIEQGVVTKATADCFINCEPTDVVALTMHAGSAIFSVNVIGDTRHMSKREEATDSIL
                     ASMDAIDRMTDMTFSHAKSKVHESINRCHIGTIRGGLGRKYEDWRQPQVADFVTFEGA
                     ARYAPGQDVSIVLEDLDTKMKETQKKYPKMKYELSIVKRDCMPPYEVDPKAQIVQTLN
                     KHYKFVRGYEQPTGAIKPPCFYGSDAGHLYEKLGMEGIVCGPGGKYNTMPDERVDIPD
                     YLDTIRIFMRTIVETCGAYKE"
     gene            <813503..>815548
                     /locus_tag="FOA43_003607"
                     /db_xref="GeneID:62197007"
     mRNA            <813503..>815548
                     /locus_tag="FOA43_003607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923858.1"
                     /db_xref="GeneID:62197007"
     CDS             813503..815548
                     /locus_tag="FOA43_003607"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779786.1"
                     /db_xref="GeneID:62197007"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MSGSSLIVDDSSTPRPATGNKHRKACANCIKRKVKCSSERPSCK
                     NCLSSGRKCFYTPYEKKISVLLSKYQGMEATISKLKSQLDGMAQLKTLREDLRSSKFS
                     PNTPISSDRTEITSGSILVSGSSDGIVRKLEEMQNHHPIDSKVGNNMTPLQSSSEMKD
                     QIDRCGSIVHNLLKSLSLEEAFQLIDQCHFFLNDIYFPYDVNLMKLKLRRAYRPVSNF
                     APFLQQEDSYFKPLVLLTFALGKRYFGESNDIIQSLLSYSLLLVTPVTKLKQKKDSYL
                     LVSVYTMASFYFRSINLEEDSIMYSNLSLQYAAHLKLHEFEKLELFEGELKSRIMWVC
                     FGSNRTLSAKMGNPFILSSQQISRPLPHLISYDEDGTMISDINLGHDMCPNESEFRAY
                     IDLTCIAEEICKVIYSNSSSATLTSNLGNIIQRLISWNSTLPDNYRFDRTFNGREKKH
                     KRLICSLHLNYCFCIHLTTIPILYSLVEKKKYHEKALNINENLTELITICVNAAEMTV
                     NVLLSCHKEGALAIFGVMDLDYIYSSSLSFFMCGDVLGLQYVQNRRLLDSCLFLLKEM
                     AKSGNECAQAKYDRLQDLIETYRKQNPKATVKIEPGPGGDQILSGTAHIQPLGLQDEY
                     ETLVPESSWFMDPRIVETFQGLTDDDLDIWENGYRNLQQLDSYWDNFQRSLFNGDVM"
     gene            complement(<815641..>817758)
                     /locus_tag="FOA43_003608"
                     /db_xref="GeneID:62197008"
     mRNA            complement(join(<815641..817495,817754..>817758))
                     /locus_tag="FOA43_003608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923859.1"
                     /db_xref="GeneID:62197008"
     CDS             complement(join(815641..817495,817754..817758))
                     /locus_tag="FOA43_003608"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779787.1"
                     /db_xref="GeneID:62197008"
                     /translation="MKPHINRLGSQPEALEPLEPPETSETAEIPTIPSHRPRGNISSS
                     GSVEPALKNSPISRNGSFTSLDSVKQSEESQKGEAPNDQKEVLGPTGVLEVPRIPSRR
                     PERKSTSGIEEDETRKGSTYEENINACGNLEEPTKDSNGLEDTSISKSVSEEHETKIK
                     TPEVDDGETDIALAEEEDSKKTESDDEKVQDKAIFDPSFSPLKTGENTLSRASEDPTL
                     AVLKESAKQLNAAGEFPGDPKKSPSIPPTRPLKKSSTVEQSVSRSNTDTSLPYDNLID
                     MYGKDLLLENYEESETLQDSTAGGVLANAQKEKKIPPRVPKKPSSRIAQFQQMLQEQQ
                     KQDLGLLGKNLPPKVPSHRPKENNVTSSGEEKLDEDSPLATQSTTHTIGTFARNLNQM
                     LGHNLPGMPRGGIPLPGMVLSNMYISDLPEPAVESEGASQQIVASSVKDRRRGRAKGP
                     RGRRLPEILKNTVEVSDETLGAKKFGIVVEESWNFEFEETEKPEEPEEPEAPEEPEEP
                     EEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPTPVNEREEPTELKEEDKSV
                     EPDNNSSPKPKIEAEIKSIGSTHNPLKFENDLDDGSNKPSSETSDTESHNDGD"
     gene            complement(<817879..>818307)
                     /gene="NTF2"
                     /locus_tag="FOA43_003609"
                     /db_xref="GeneID:62197009"
     mRNA            complement(join(<817879..818160,818215..>818307))
                     /gene="NTF2"
                     /locus_tag="FOA43_003609"
                     /product="Nuclear transport factor 2"
                     /transcript_id="XM_038923860.1"
                     /db_xref="GeneID:62197009"
     CDS             complement(join(817879..818160,818215..818307))
                     /gene="NTF2"
                     /locus_tag="FOA43_003609"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09344EBU"
                     /codon_start=1
                     /product="Nuclear transport factor 2"
                     /protein_id="XP_038779788.1"
                     /db_xref="GeneID:62197009"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="PFAM:PF02136"
                     /translation="MSVDFNALAQQFCNFYYDQFDKDRSQLGNLYRDHSMMTFESSQI
                     QGGRSIVEKLVSLPFRKVGHRISTLDAQPASENGDVLVMVTGELVVDDEQNPQRYSQC
                     FHLIPEAGSYYVLNDVFRLNYG"
     gene            <819158..>821440
                     /locus_tag="FOA43_003610"
                     /db_xref="GeneID:62197010"
     mRNA            <819158..>821440
                     /locus_tag="FOA43_003610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923861.1"
                     /db_xref="GeneID:62197010"
     CDS             819158..821440
                     /locus_tag="FOA43_003610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779789.1"
                     /db_xref="GeneID:62197010"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="PFAM:PF09295"
                     /translation="MSLDSIRRSSTDESTQRSIMSSQSSSIPASFTSHLKTKLGIEIP
                     TIIENQLGESIQFRTSILSDIKDLGPADLIHVSKYHKRSKEEVGEYYYCVGLDTSSII
                     QPLTYMQTILLNGKHAGTDKHPNIGTYCSYNCFGHGDLRIRCTFPGSTAPLVQFVPSG
                     KDKISVNMGSEETQQSKSIWKETYISALVRALLFCDSTDRQLPGMCKFNPVQSSRDAR
                     QAVITMCQLLPRGPMLSSNDLYNQPTLCKNYLVDALLKLLDIVGYHDLAIDEITKIEK
                     ESSGSLDFSVLKVDILLAKGDQTAAVRLMHESLKVKPRDGWMLEMQASFLVRNDRSDL
                     ALVSAIRSVECLPTEFLCWMTLIKVYILLKDYRNALLTLNSSPMYSNKKKDIYAAIKP
                     KNFDFPFPLEGKLKDVWEDCEKFGCISGFGGIIEFSPSNQFRSISELHAEVYEQTKLQ
                     RTFKEAYNLLAIMTRRLGWTDLLRIRSEIFVMEDEYNASVEVEQEREMKANMNAQDNT
                     SESERRPRSYSSGRSSVQSLSRISCKFKKKRLSERWLDSLFLIFYENLKSVLIWENER
                     RSKEKLEHSALEWELIGDECFKVRHYESGILPLQTSLGSRFSIFACQMLLEYYVQYSQ
                     NPVEFKTLNGIGKTKRERESEAAGLLQPYQLSEDLILTLVCKLISWNYRYYGEFSVLC
                     LKVLKILIDSCDSDSALVRSKLEVLFDERIPNENVGDKSGVKSPKLEGKRRSIEHRQG
                     IAGIVGRYISWLNQLDENGP"
     gene            <822022..>825069
                     /locus_tag="FOA43_003611"
                     /db_xref="GeneID:62197011"
     mRNA            <822022..>825069
                     /locus_tag="FOA43_003611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923862.1"
                     /db_xref="GeneID:62197011"
     CDS             822022..825069
                     /locus_tag="FOA43_003611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779790.1"
                     /db_xref="GeneID:62197011"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="PFAM:PF04499"
                     /translation="MSGFWKFTNSYASKVSKILEHDDFTLEDLLDERETIPELLASNS
                     KLVEYFRQTDILENLVDYVVGDDEYQKQELQEHKNDLEEQGELLIEKMEHKGHQETLT
                     DLENSSLKENDVAIAGHNEKTSSDIKATADSDSDSDSDSDSDSSSSSSSSSSSSSSSS
                     SSSDGENEELPEDPGGQTLEDSESNSKIDESPDLERLAEAEAEDEDEDDDTNINDNDA
                     DGDEEEVDKETPAEIHTRRAQVAAEILSVDVWSLTDTFMENTILIKKLWSILDKEPPL
                     PIFSATYFMKINEHLLDMKTPEMIQFILQKSDIVERFLHHIDTPPLMDFLLKVISTDK
                     PDSSTGILEMLKDQNLIPSLLSLLASEVPSSIQSSAGDFLKAFITISANNAESTTIGP
                     NELTRELVSEPMVKLLVNMMLQGGTGLSNGVGIVIEIIRKNNSDYDPVPVVYVTPESH
                     PPMPRDPIYLGTLVKEFAKAMPGFTKLLEKKKDKTLLTPFGAIEPLGFERFKICELVA
                     ELIHCSNMALLNDERGEAIVKERDIIRNKLIEKHKELMQAADEDSTVSWDEMDISREI
                     ENLQLNDEEEKPQSDESADKLFENNVKDDEDSANATEEEADNDKDDEETVDENDYSEV
                     ERMLRKNPVVGDKLKIALYDNEVIVTILKMFCQFPWNNFLHNVVFDIVQQILNASIEI
                     GYNRQLAIDLFDRGRITEMIVQGYNKCMDYENATGIRLGYMGHLTLIAEEVVKFISLN
                     LDSTLKSSIIDEAVSDSDWKYFVDEILVDTRNKYNAVLGNDGADTEGSCGIPFPASVI
                     DGEEYQDPQDVDGDDSNDYYDYEQDNMNTESEDQDLDEDQFSRYMSQEMASDFNDRMG
                     VSSDDDSEEEEKPAGDVSWRFEGEGNSSDEEGLVDSEIGGKPYYEMENKTTTIETNSH
                     QVKEKLSENELIEKQIPEADELDIADHDLERVHDDTTVSSENEEYEDPNDDGQSYTKA
                     NHPLYQADGSLNYPILPMNLPLPMDDNDELYDGPAGDLEGLTD"
     gene            <825313..>826515
                     /locus_tag="FOA43_003612"
                     /db_xref="GeneID:62197012"
     mRNA            <825313..>826515
                     /locus_tag="FOA43_003612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923863.1"
                     /db_xref="GeneID:62197012"
     CDS             825313..826515
                     /locus_tag="FOA43_003612"
                     /note="BUSCO:EOG093430VW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779791.1"
                     /db_xref="GeneID:62197012"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR036915"
                     /db_xref="PFAM:PF00134"
                     /translation="MSANYWTSSQREKWQFTREEIAIARNEINQVEKQMFGDSPALIG
                     CKYDINMRIYLHQLIVKLGRRLNFRQIILSTAEVYLTRFLLRASIKEVNIYLLVATCV
                     YVACKIEEYPQHIRTILSEARNCWPEFIPNDLTRLAEFEFYLIDELECYLVVHHPYNS
                     LIEITQLLKNYGEADCRLDISPEELQSCWSIINDSYILDLHLLFPPHIIAISSLYLTL
                     IMVTDLPGLDTNVTDTKPQKLISNVVSNNSSSNRTVTGNANNNAITNSNENGNSTTNT
                     TSTPGSLTDTSRNVNGQLSDRRRASSSHSSTAQKCLKKGKQSDSSLNKAQLKRGRFSQ
                     TSLIQFNPRVEAFIKFLAASNVNLDEIIETVQEMLTLYDSWNYYDEVSVRNAAHSMLL
                     ALNRTHNV"
     gene            <826830..>827948
                     /locus_tag="FOA43_003613"
                     /db_xref="GeneID:62197013"
     mRNA            <826830..>827948
                     /locus_tag="FOA43_003613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923864.1"
                     /db_xref="GeneID:62197013"
     CDS             826830..827948
                     /locus_tag="FOA43_003613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779792.1"
                     /db_xref="GeneID:62197013"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="PFAM:PF03798"
                     /db_xref="PFAM:PF08390"
                     /translation="MVQNFDISDRTRTELKSRSGGGEKTADGSVSVGSSDSEASSDLE
                     YSEKEQVNRLDNLQIEFSLIYDFAIFACTYYLHLSLGKKFYVMRYYQVDTATYGRGLE
                     DGYLMITMIVNLMLVRSFMIRFVFSQLANLLGIHKYKAVQRFKEQGWSLTYYSCSWCF
                     GFYLYWKSDYFLNMRNVFAGWPDQNLSYGFKFFYLIETSCYIQQMIVLHIEEKRKDYL
                     EMFFHHIITSILCLESYRTCFTRVGHVILLLMDIGDVFLSLAKVLKYCGFGRICDVVF
                     ILFMIIWIVLRHGVYNYVVYYIYSSALGVMENDCSKFSPGSNEICCTQGKLNSFVVLL
                     TGLQIITCLWLYMIFRVAIKVIRGAPAEDVRSDDEQVI"
     gene            complement(<828074..>829465)
                     /locus_tag="FOA43_003614"
                     /db_xref="GeneID:62197014"
     mRNA            complement(<828074..>829465)
                     /locus_tag="FOA43_003614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923865.1"
                     /db_xref="GeneID:62197014"
     CDS             complement(828074..829465)
                     /locus_tag="FOA43_003614"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779793.1"
                     /db_xref="GeneID:62197014"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="PFAM:PF01490"
                     /translation="MNEGLKPGATMSSSIVNTINTIVGSGMLVLPFAFKTDSIVLGSV
                     LMIVAAGSNGIGLIVQGMSSKFIRPGSATFFSVCMITFPSLSVLFDIAIFLQCYGVAI
                     SYVVLTGDLMPLVYSIDGWSAQQMRVSYMLLSTVITVPLCFLHKLDSLKYASVISLVA
                     IAYLMVLIYAQFFYSWGLGFKNVPVDNLGPVSWFQPRGIKPVFKTLGIIVLAYTCPNE
                     YAIVAELQHPSMARISKIVYISMGIITMLFLTVSIFGYLNFGDAIKGNIILMYGNDFY
                     STLGRLLLVLMVLLSFPLMFHPARISFNNIYFAIKTKLTSKVSEDLGEGSPLLGAVQI
                     AQQRATADDEDKVDERDIELPPSRFIWMTVVLLVAAYCISVILDSFELILSLVGATGG
                     VLISYVLPGFYGYRLIDTADEKLLARFDKYGGNEESSYWLFKSKKLKWCCMSLIVWGL
                     FSMVICVYASLFE"
     gene            <830378..>833371
                     /locus_tag="FOA43_003615"
                     /db_xref="GeneID:62197015"
     mRNA            <830378..>833371
                     /locus_tag="FOA43_003615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923866.1"
                     /db_xref="GeneID:62197015"
     CDS             830378..833371
                     /locus_tag="FOA43_003615"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779794.1"
                     /db_xref="GeneID:62197015"
                     /translation="MPSFDSSTENMALKPLDESEIRKHVVKKENTDGTAALKLAELSF
                     LPATSKKSKILNIPTASEDSDTKEGSNSSPITEQPQQSALDSSSLALSAPSLPPNIKT
                     RANSNYDSERLIMDRFGHTHFIGNFGTASLLNGLCDIIIKRSSYNRHPPTSTQDIRDS
                     SVQTITSENEPAYQYPTHLYNLDTINVDRFPLINLIGKEEADIYVEVFFEKVHPYYFI
                     FNRRKFSERYRVFWEEINNTSNADCDNDEPLHISSAEICCIYMVWILGRRFQEFSNPS
                     DTPKGAVLDTEMMNRFIDIIRLTLSDVVLTPTIDGIRLLFLFSTYLSSIKVRESGYCL
                     MQMAAIQAKGLGLHRKVIVNKFKDEKSDEMKRIMWSLAKSESLLCCSLGRASVVPWEE
                     IDVEFPNIEDETDELFKTYYFESVKLTKIIFEILDYKKKTQKEPLSLPSLEKALTFQK
                     ELHNFWDNLPEQWKDYKSLPIRRYKPKLHIQYHYYFITLTLPMFLHIVSVPNYIIKKG
                     DPLLTLLVHGIQSSFRTAELVTYTDANGFFNGTIYYDVFYCYNAIMVLTLTYILFVTS
                     KKSGKNRSTIDLEYLDSEYGINLQQLLKEINMIRKLILNNLHKIDGTMKRMSDIIETL
                     LEDLGIIQILVRDYNAPKSNAKRIEGKKESGQTSVSASLPGSFRRLKLHLHHDRHKRR
                     KSNAIAAETLKKEESLKLLREHHRSGDQVPQMPRKPQPEQKELQKMRVRRQPGTQMTA
                     SRPDYSTMSSVYLPSGSKSVSATSESFASEFSDITPISGSPQSLALSQHHNLPNPNTF
                     IRQNVLPSQPAYARAYQQQLQLQQQQQRQQQQQEQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQEQENSINDQYLNDMIGPPLTSTHVQLQYSAPN
                     LFTKNNEKSRTSSISSSSHTRVSQLVGQEAQTHTDSAVSTPSSSNINDVLTSMALNTD
                     LMDALFGSELLSSVSPDSYSSLREE"
     gene            complement(<833457..>834152)
                     /locus_tag="FOA43_003616"
                     /db_xref="GeneID:62197016"
     mRNA            complement(<833457..>834152)
                     /locus_tag="FOA43_003616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923867.1"
                     /db_xref="GeneID:62197016"
     CDS             complement(833457..834152)
                     /locus_tag="FOA43_003616"
                     /note="BUSCO:EOG09343X57;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779795.1"
                     /db_xref="GeneID:62197016"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="InterPro:IPR034904"
                     /db_xref="PFAM:PF01883"
                     /translation="MTEPLNANPTVLDFSELPKRDNDSRGLNDKNLESREETLIYNRL
                     KSLSLLKADSYDDENDLEDFNIEDLRLPDLTDDSDSQKSAKALVKCEPTTTENKGKLE
                     PIDSQEIYDLVSSISDPEHPLTLGQLAVVNLDDIKVTNPTARDQIGEVLVHITPTITH
                     CSLATLIGLGIRVRLERCLPKRFRIVILLKQGTHQSENQVNKQLNDKERVSAACENPQ
                     LLRVISHMLSTCK"
     gene            <834342..>835100
                     /locus_tag="FOA43_003617"
                     /db_xref="GeneID:62197017"
     mRNA            <834342..>835100
                     /locus_tag="FOA43_003617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923868.1"
                     /db_xref="GeneID:62197017"
     CDS             834342..835100
                     /locus_tag="FOA43_003617"
                     /note="BUSCO:EOG09343JH7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779796.1"
                     /db_xref="GeneID:62197017"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00485"
                     /translation="MSAPIIIGLSGASSSGKTTVANFLKKLFPNSDIIHEDDFYYPDE
                     KVPFNQEIQDRDWDCPEAINFEDFVVVVDKLKHNIPIDKRKSIHLEKTNISNHVKTKV
                     SISPELHDILVGKIEHALGDRKVFLIDGFLMFQNETLRKLMDIRLFFRTDFSTLKHRR
                     SSREYSIDSGVWMDPPFYFEKRVWPQYYKYHHSLFVDGSDEDLIKRTGGTLNEYAKDT
                     LGIDGFRNDDNSNLNVLLQKVVDTILNRIEREQI"
     gene            complement(<835129..>838311)
                     /gene="KRE33"
                     /locus_tag="FOA43_003618"
                     /db_xref="GeneID:62197018"
     mRNA            complement(<835129..>838311)
                     /gene="KRE33"
                     /locus_tag="FOA43_003618"
                     /product="killer toxin resistant protein"
                     /transcript_id="XM_038923869.1"
                     /db_xref="GeneID:62197018"
     CDS             complement(835129..838311)
                     /gene="KRE33"
                     /locus_tag="FOA43_003618"
                     /note="BUSCO:EOG093408ZK"
                     /codon_start=1
                     /product="killer toxin resistant protein"
                     /protein_id="XP_038779797.1"
                     /db_xref="GeneID:62197018"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="InterPro:IPR033688"
                     /db_xref="PFAM:PF05127"
                     /db_xref="PFAM:PF08351"
                     /db_xref="PFAM:PF13718"
                     /db_xref="PFAM:PF13725"
                     /translation="MTTNINNKNKKKILDARIPDLIRNGLQTRQRSFIIMVGDKSRDQ
                     IPNLHYLMMNTDLKMNKSILWAYKKKLLGFTSHRKKREHKIKKDIKRGRREANELDPF
                     EAFISNQQIRYVYYKESDKILGNTYGMLVLQDFEGLTPNLMARTIETVEGGGIIVMLL
                     KSLQSLKQLYAMTMDVHSRYRTEAHNDVVARFNERFLLSLADCKTCLVLDDSLNVLPI
                     SGARGVKKLPPKDDDEISAKQQELNELKESLADTQPAGSLVALSKTANQAQSILRFID
                     AIAEKTFNTTVTLTAGRGRGKSAALGISIAAAIAQDYSNIFVTSPSPENLKTLFEFVF
                     KALDAMEYVEHQDYDIIQSTNPSFHKSIVRVDVKKAGHRQTIQYILPTDSHVLGQAEL
                     VIIDEAAAIPLPVVKKLLGPYLVFMASTINGYEGTGRSLSLKLISQLRKQAKSVTKEG
                     ADGHQYGEPTFKRTNDDENDLDIRARNLVEVTLDEPIRYAPGDPVESWLGKLLCLDVK
                     LSKNTKYATRGCPHPSECSLFCINRDTLFSYDPVSEAFLQKMMALFVSSHYKNSPNDL
                     QLMSDAPAHQLYALFGPDVGKDASIPTPLCVIQLALEGEISRESIRRSLSRGIRAGGD
                     LIPWLVSQQFQDDDFASLSGARIVRIATHPDYQDMGYGSRAIELLSDYFEGKFTDVNE
                     SNNLDNDRFSLRRLTDEELAQSSLKDEISPRKEDSLPPLFINLAHKAPYYLHYMGVSY
                     GLTRPLLKFWKKGGYSPVYLRQTPNGLTGEYTCVMLKVLPNRKDEWLQDFARDFHKRF
                     LSLLSYSFRAFPSVQALSVIESTRTGGSIASSGSLSKSDLDVIFSPFDLKRLESYANN
                     LLDYHVILDLVPHVSNLYFEGKLADGVRLSHVQRAILLSVGLQRKEIDDVARELKIEP
                     NQSMAMFAKVMRKVSGYLHSIIKESISGELPEVETKEDVDNKLNNVEDMERELEEDLN
                     TAGKEAVSEVKEKQRELINSLKLDKYVINDFEDEWKSNKTSLEKAAKRKGTVSLKSGK
                     KRKPTETAEDIYKQEMTSLQNEKKKRKAKK"
     gene            <838554..>840170
                     /locus_tag="FOA43_003619"
                     /db_xref="GeneID:62197019"
     mRNA            <838554..>840170
                     /locus_tag="FOA43_003619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923870.1"
                     /db_xref="GeneID:62197019"
     CDS             838554..840170
                     /locus_tag="FOA43_003619"
                     /note="BUSCO:EOG093431R5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779798.1"
                     /db_xref="GeneID:62197019"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR038664"
                     /db_xref="PFAM:PF04410"
                     /translation="MEEKVLESSEELHNGAVADDNNEQAVHEDSIFDKKTDFSYSSDE
                     YEPELKEPTEEQKKEQSPKAKDVADSVLSSNSRSGTSSSSDSDSDSNSNSNSNSNSGL
                     SVSNPGSESEDNVTDFEEDKDNDNDEGPIRSKNEIVDENAPSLPDDFIIDSNTPIRYL
                     GNVTGIVEKNVIIQSSASAEYQVLEGAILCLKDRTPLGPLFEVFGRIHSPVYRLKYNT
                     KQDLEKRSIKKGDQVYYVIPSAQFELTQNIKAIKGSDASNWNDEEIPEEEQEFSDDEK
                     EKAAKRMKKRKHKNKTNSDNKKKKTDEIGSTSKKLIPDYIKSRLTSLPSSQASKKKDN
                     KSKDSQSKDGGDQILMNDRSNISRQVYPQPLSIPCSIAASSQQPVSSTSQYSPAPLLN
                     VLSQTSQAFVSIMNPQNQVQSSQNMTQQTHQQSEPPFSLDSTNQGQLLQNLISNVQSN
                     FDQQQAKILAQIVSLLANQTKSAVTSIHSAVQNTLPANSEVYPCLEGQSMGPYAIQHG
                     QMQNEDIKYSTAVDEEEADDADAYDPENPN"
     gene            complement(<840187..>843066)
                     /locus_tag="FOA43_003620"
                     /db_xref="GeneID:62197020"
     mRNA            complement(<840187..>843066)
                     /locus_tag="FOA43_003620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923871.1"
                     /db_xref="GeneID:62197020"
     CDS             complement(840187..843066)
                     /locus_tag="FOA43_003620"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779799.1"
                     /db_xref="GeneID:62197020"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR017261"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036187"
                     /db_xref="InterPro:IPR036678"
                     /db_xref="PFAM:PF00488"
                     /db_xref="PFAM:PF01624"
                     /db_xref="PFAM:PF05188"
                     /db_xref="PFAM:PF05192"
                     /translation="MNRIPLYFKVPAGVIHRRIYGAAQFYRSVVGRRGIAKASETDRI
                     TLSDIDLVVDTKPKPKFKKTAKKVKDISLKNDNENVIADEYTHTIPDRGAVTSDNSLT
                     DFYLEMKEVIDKYSHRIEGEYVVLIQVGSFYELYFEQAELYANILGLTLTKKRLKRQN
                     VSFAGFPDYKLEKYLQIIFSEGLRAVICDQKKLDFSNVICRPIDRLVTPGTVIDDGLR
                     DYHRNNYLLAISFPEDPFKGDILNGKIGLAWCDVTLGSFYVLETNFDDLMAAITRIDP
                     SEILVNSNFDIDQLMSGRDIPQYADLRHYYLTRFNVPTKRKHIEEFAGRFSDNKKLVT
                     SMMDELKSKELSASKLLLHYLDECLPNYNTSFHLPTRSFPNKIMHIDPRAAQDLELTE
                     TIRDRLRVGALASIIDRTVTAPGARALNSWILMPSTDISVIKKRQKYVSMLIKYGDFT
                     EELVIILRKTSDISRIIRRVDNNRAELSEYIDLSTTILLLEEIYKRAKEFSELLGLLF
                     PLYEEFNKTPEFHKLALLIKNTIDPLVCSKIDTRYNRFRLDTDITRKTWSIQPGASQR
                     LHTLRNKYDGYMKDYDLMIQKLKIQLEDFGYTGNLELIRHYRTGEFLVELKSSSKALS
                     CVVEKSLYKHKEKTKSSVKLFVPEWELLGKKMIKLEGDIVLEESVVMIDLERKIFSMA
                     EPLRNVSPIIEFLDTTQSFANMAKEKNLVCPIVDNSTEFDVVDGRHLVVEEGLRGRSS
                     GVENFTSNSCHLDSGKAWIITGPNMGGKSTFLRQNALIAILAQMGSFVPATSARIGII
                     DKIFTRVGSSDSIFKNQSTFMVEMNETAIILRESTDKSLVIVDELGRGTSTQEGVAIA
                     FASLLTMVKKNHSKVLFATHFGPELSSMIDSCSDLNEGTEFYCTELKSIATDDIPIDE
                     RIIFNHKLKKGLSMYSHALEIAQLAGFPKSTLRIAKENLPENYIK"
     gene            <843559..>845490
                     /locus_tag="FOA43_003621"
                     /db_xref="GeneID:62197021"
     mRNA            <843559..>845490
                     /locus_tag="FOA43_003621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923872.1"
                     /db_xref="GeneID:62197021"
     CDS             843559..845490
                     /locus_tag="FOA43_003621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779800.1"
                     /db_xref="GeneID:62197021"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="PFAM:PF01504"
                     /translation="MAAEAIKLKNRELPSMSLRDINLMSVPLRKKNGDDQPFTDALDS
                     LSLNANSDTLIGASSNSRSTGESGAGSSVDSGADSSHRADVQRSPTSARSDGDNDHHM
                     YKIEHTRSSLGDCVPATYLPEKGHSSTDLNYTTPKQYHRPATLRPFKSPSFSIDLISK
                     SRQHDDIYNALANTTRRNSTMALTTSNVERHGYNETGTITIPEAYEKTERAKEMVLRD
                     HGRIHNNRSQSSLSNRHRFPKTGSFTNKEQRHHPSERYVIPGQRVVEGHHNYALAYNM
                     ITGIRVAVSRCSQIPKPLTDYEYKQVSKMVFHWEGSSTTPSSKYEFKFKDYAPEVFRD
                     LRSVFHIDQADYLLALTEKVALTELGSPGKSGSFFYYSGDYRFIIKTIHHSEHCHLRK
                     ILKQYHDYVVQNPDTLLCQFYGLHRLKMHTRRGLLKLHIVVMNNIFPPTREIHKRFDL
                     KGSTSGRYTNLVDGKVEGKTSLCLKDLNFLKSNEKIHLGPQRKGSILAQIHNDVEFLQ
                     RTNIMDYSLLLGVHNLTEDELTTPVDQEPEFFSNRDREVSNIFALADGGIRAADENGH
                     ELPVIYYMAIIDCLTNYSTLKRLETFFRSFKHKRSTISAVPPIEYGKRFYKFLEKGIT
                     PANTARENKDAKVKPIKQD"
     gene            complement(<845632..>847278)
                     /locus_tag="FOA43_003622"
                     /db_xref="GeneID:62197022"
     mRNA            complement(join(<845632..847227,847273..>847278))
                     /locus_tag="FOA43_003622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923873.1"
                     /db_xref="GeneID:62197022"
     CDS             complement(join(845632..847227,847273..847278))
                     /locus_tag="FOA43_003622"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779801.1"
                     /db_xref="GeneID:62197022"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /translation="MFDRSRSPRRNDMRDRSRSPPRRDYFSGYRGRSFRGRRGSRRGG
                     SGYRYRDDRGDRGDRGDRGDRGDRGDRGDRGDRGDRGDRGDRGDRGFRETPRVYENSI
                     FIGNLPYEATWRDLKDCFRDAGEIARADVLTSHGSSKGLGTVEFADRESAEKAIDMFN
                     GFNFMGREIFVREDQPPPPRDDDRGARFRGRDRDSERSERSDRGRDFSHTSRLPVPQV
                     DGIEVFVGNLPFRTSNIEFQSVFQDCDDIKSAQVKVDFRGRSRGYGILIFGTEEAAEK
                     AIQEFDGRDLGGRPMEVRPGRASAPGGADMGGDAPSKNTEFTAGVTGNGDPSETLFVA
                     NLPWETTEADLFDLFGSIATVSKAELQYDHTNRPSGNAVVQFADDDGAANALGQLDGY
                     EYGNRDLHLSYANRQQGEDAEMNEAPEIPANNGIPSGPSSQQVQAPVQGSNPVATIGE
                     TPTATTSAFAPVPAPVPVAVAPPISANPPAVASLPVSASAPAPIDAFVAVPATSSAFT
                     TIPTPAQASSTDLANAPAEEEHIEE"
     gene            complement(<847834..>851040)
                     /locus_tag="FOA43_003623"
                     /db_xref="GeneID:62197023"
     mRNA            complement(<847834..>851040)
                     /locus_tag="FOA43_003623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923874.1"
                     /db_xref="GeneID:62197023"
     CDS             complement(847834..851040)
                     /locus_tag="FOA43_003623"
                     /note="BUSCO:EOG093406PW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779802.1"
                     /db_xref="GeneID:62197023"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017111"
                     /db_xref="InterPro:IPR024636"
                     /db_xref="InterPro:IPR024657"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00856"
                     /db_xref="PFAM:PF11764"
                     /db_xref="PFAM:PF11767"
                     /translation="MVYRESRYYYSDRYRGDGSSRYNDDAHSGRPSRPRGPNNSNSIS
                     PTDDISLLPNNQSSAVQGYRDLHKHDYYTPISQRSSTYSLDMSRTGTEENSTLSHEVD
                     RYDYDNKLSRKESYEQGTPLPKDYNYTDIPEQNHSSIKIAEAGRPSSQSVKSFKLVIK
                     KQDGRPANSNGKLPPSVLEPIKAFSRDVHDPRLNGDIGYEKGRSKTLHKKIDSLIPVH
                     YTYDKKHSVGPKPSGELVIWNFPPTTSIMIIKNYFIPFGDVREVHGVDDPRTAVPLGV
                     CLLLFDGDPTIAHEAASKAVSSTNNILSVGGQAIKCGVNIGNKLYHEIFDRVMEDKKE
                     KEMKEGREMERKRDLELKRQREKAVERKAQNVLHKDPERESKAEMTSTVNTMNAGLIN
                     LSIHDRHIKPFSSADLPPGFLKFIAGRPFIWIPDQYVNTRNVGSSTIRKIVAAYNCDR
                     ILTHRTGFYVVFDRLDDAQKCFDTEDGKKVMRYRMLMTFYVPDDMMLHTRIGDEISAV
                     GQSKAYLLGELRNYLLKDLREKVIGPKVLNIIGTDRYRSHIDAYKKLIAKRKENEIMK
                     QQAKLEHEKVEDDMISKLPIGLAPVRVNHQSADIASLTSFRRKRNGNNSKIIHRLPRK
                     RYITKRNAMPMSHVLNESDGEDNDEDDEDDEDGEEDEESEDIEATIPAVEDKSAKRKL
                     EDVVQIGKRRKVKDSSISSSEEEMKAVLSSQPTSPENEVSAALKSEYFGVDERYRPVL
                     GSPIPVCKDKLDVTSPNLDWIQNIIRDDEDLKLFRTFSQHIASASTIVKDVRYLCWKK
                     KHEKETEDKLLGDSEKRQNEGLSDFINEVVNNNELRSSTGCFRTTGYRKIPDRLKTDY
                     LPYRRRIKKPLSTIENEDDNDSTAQSSSVHSSRVNRAISRRFAAGISAQKQMLGSESD
                     LLELNQLLKRQKPVQFARSAIHNWGLYALEPIAVKEMIIEYVGERIRQKVAEVREKRY
                     LKSGIGSSYLFRVDDNTVIDASKKGGIARFINHCCDPSCTAKIIKVDGKKRIVIYALK
                     DIAANEELTYNYKFEKETNPEERIPCLCGAPNCKGYLN"
     gene            complement(<852390..>855392)
                     /locus_tag="FOA43_003624"
                     /db_xref="GeneID:62197024"
     mRNA            complement(<852390..>855392)
                     /locus_tag="FOA43_003624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923875.1"
                     /db_xref="GeneID:62197024"
     CDS             complement(852390..855392)
                     /locus_tag="FOA43_003624"
                     /note="MEROPS:MER0003297;
                     BUSCO:EOG093409NE;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779803.1"
                     /db_xref="GeneID:62197024"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR025926"
                     /db_xref="InterPro:IPR036034"
                     /db_xref="PFAM:PF12812"
                     /db_xref="PFAM:PF13365"
                     /db_xref="PFAM:PF17820"
                     /translation="MPLSPQKRSVDFPSTNGSHKKQKQDSSTSSANNQSNGISSNADT
                     SLLRKIPAASSYNDSQWQETVNKVVKAVVSIHFMQVEDFDTESAMCSEATGFVVDASL
                     GLILTNRHVVGSGPFIGYAVFDNHEECEVKPIYRDPVHDFGFLKFNPADIKYMKIMEL
                     KLRPDLAKVGCEIRVIGNDSGEKLSILSGFISRIDRNAPDYGPQSYNDFNTEYIQAAA
                     SASGGSSGSPVVNIYGNAVALQAGGSTESSTDFFLPVYRVLRALKCLQDNKPITRGTI
                     QVQWYLEPFDKCRRLGLTPDTEKVMRQNFVHTNGLLVSAVTLPKGPADKLIKEGDCLI
                     SINDKLISSFVTVDEILDSSVGQDVKILIQRGGKDIEVICKVQDLHSITPDRYLSVCG
                     ATFNDLSYQLARIYGIAVQGLYVSNAGGSFVLGAPDLTNCWIIDSIDNIDTPDLDTFI
                     DIMKNIPDRAFVPVKYHHLTDIHVPLFKYIYIDRHWHKSFRIAKRNDKTGLWDFSNIQ
                     KEPLPPPVVTAKHAKFMNLPTEFPACKTIIRSFALVDATYPLPLDSFPGHVRRVYGVI
                     IDAENGYILTSRHCVAHDLCDINITIAESIIIPAKVVFLHPTKGYAVVKYDPSLVKAP
                     VETPKFGTKPLNRGEKVIFIGYNKSLRVVVEMTKVSDVGVINIPTNSNAPRYKATNVE
                     AVLVDSTTCQKCGSGVLADTDGTIRAFWLSCDGEEDRMYTMGVNVTDVMWELEFMKSG
                     KLPDLKIIDVEFGSILIATARINGVPEEWIKRIENNSTDKLQFLYVPSVSTNLDNKRS
                     CNLKPGDIILSVNDKLITRFRDVDSVIRELAPEVEDASFKVVREKKVVDFEVSLTRTA
                     NFLTRQVVFWSGCALQEPHHGVRQAISKLPSKVYCTSMSQGSPSRFYTVGITNFITHV
                     NEIPTPTLDEFLKVVRNIKDNTYCKLRIVSFDNIPMAQTLKVNYHYFPTVELVKDQSA
                     DKWMFHEIISEGKEESKKHSDEKSTEQS"
     gene            complement(<857641..>858848)
                     /locus_tag="FOA43_003625"
                     /db_xref="GeneID:62197025"
     mRNA            complement(join(<857641..858212,858617..>858848))
                     /locus_tag="FOA43_003625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923876.1"
                     /db_xref="GeneID:62197025"
     CDS             complement(join(857641..858212,858617..858848))
                     /locus_tag="FOA43_003625"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779804.1"
                     /db_xref="GeneID:62197025"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="PFAM:PF01679"
                     /translation="MHAKDWLMAFVGVFLPFVPVGIKRGICSADFWINIALCFLGFLP
                     ALIHCWYIISCYPYESRSNYTGVTLPGREAQGYVLSESMAGGSVWSSLGYQPEIAVTT
                     PNSQMQIVLVDKTINKDTVNDLRESNIHQVCNIQEMHFQFNINDKTMSDPMLSTESIV
                     RKLIFHLNYLMLCNYIQLEERSPLAFSYAARKKYSISSNVMPSLSESFAKSKETLILE
                     KRALNAGFLKQVCHENLAGYLKRMSHRRLEQLAERQKETPLVLEFFALA"
     gene            complement(<859119..>863483)
                     /locus_tag="FOA43_003626"
                     /db_xref="GeneID:62197026"
     mRNA            complement(join(<859119..860572,861071..861705,
                     861768..861794,862033..>863483))
                     /locus_tag="FOA43_003626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923877.1"
                     /db_xref="GeneID:62197026"
     CDS             complement(join(859119..860572,861071..861705,
                     861768..861794,862033..863483))
                     /locus_tag="FOA43_003626"
                     /note="BUSCO:EOG0934441H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779805.1"
                     /db_xref="GeneID:62197026"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="InterPro:IPR037278"
                     /db_xref="InterPro:IPR038508"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00169"
                     /db_xref="PFAM:PF01412"
                     /db_xref="PFAM:PF07714"
                     /translation="MDSIIKQLVAGVNETKSVGISRLEIFDEPGTQNKLSIDIGYGNI
                     VSEGSLIELIQHGDSGFVLKIPAAFNRLKVILTEGLDLTQMAWSICERQSQDIQSESI
                     SISLAEVDGYIEFNLINKTTKNNVSFICLYKSPCTIKIPASAKESFIGSSSEVATAFP
                     VPEVTTPEDHTSLSKVSSFFPVTQEDGPVLRQTLAEYELKIPVLLNDFARANEVLESF
                     ANLSRQTASSKNSLVKYLRDISRNSIPESLKRKASKGAIDNSTVNQLNALFDDSYKKI
                     VLNIRHKLSGRIISVDTLSCQKKLFEDESKKYYDWLSKLLNSGKNRDDKLLLKRKAFE
                     VAKIDYLSFLYDLMIGVNLRFISQNDEGFKFSSYVLELQGKRKEFRASVVKSSSLAQL
                     KAQMATATFSNLNHTPGEKSGILFTQRGQGKSGWHKQWVVLKAGKLTEYMDWRKGVSV
                     RNKPIDISLCNIKSIDFEKRKNCFRLITSTGLESAVIVDLRILSMGTSISKVRSLKLD
                     SFDRETLALLYHINNESSNAFYEALLPEDQRINDSVCDSRRLDFITRKYSKRSWFDFM
                     KVSDPSSLLIHGVQYHDIDQILRSIGAKVDINMKVTKRASSLDSSERIEFSILEYALS
                     HPVKDEITGKPLFDSAELLILNGTRLGDTTQSHLELSKEAYYYWGQKINKVNCVKCEP
                     SNATTVTDSNTATSSITDSSSREDGLHQLALIKLTVHIFLNHIRDFVMSAIPNWTPTS
                     CKTYLFIPNGKELVCENIELKECIGRGNFGDVYRGISVGTKVTVAIKTINLDKSDDDI
                     PILLQEIKLLRDLNSPFITKWYDTCVKDVTMFICIEYCGAGSCTDLLRIHKSLNEVAV
                     AYITRDTLRGLEYLHSLGIIHRDVKAANILLTEDAQVKLADFGVSGKLQNSAKRKTFV
                     GTPYWMAPEIILRKNGYNEKVDIWSLGITVIELRTGRVPHSDEDPLKALYQLCKRPPP
                     GLIGSEYSHYIKEFTRICLQKQPQSRPTASDLLKMRFITRTRFKSNPLIQLIQEKLEA
                     TKFRPKKRQPKHPLKFDSNHFGPNMQWNFEVTTRKDKMGGSSGGNIAHIGDVQSSTMM
                     YDSNKENSVVTSMEPPVYAKSPSQSNDIILNEQSGLIQKVFENILVLDQKRHTLGEHN
                     TCRDDAKFKSILNNVQSLTMELEFLHPGFLKTLCIAYLNSQY"
     gene            <863888..>865909
                     /locus_tag="FOA43_003627"
                     /db_xref="GeneID:62197027"
     mRNA            <863888..>865909
                     /locus_tag="FOA43_003627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923878.1"
                     /db_xref="GeneID:62197027"
     CDS             863888..865909
                     /locus_tag="FOA43_003627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779806.1"
                     /db_xref="GeneID:62197027"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF13445"
                     /translation="MKDYQQASINASSMSFGTVKRSCNNPKAFNNNKAIKTGSRNRKN
                     GRHFKRYNENGSDSNTSVSTDTLSLLNDDDLMLERSILMSNKKGLDISHLLDFSIADD
                     ENRELESIETSAKKHSHFRGNRKKSFNGRGAADISLSGRSYINVNYKFIVDYRADYKS
                     QILDPNFPLDDSSIVRVIVNGEDYHCPICLEDEFIAPRMSKCGHIFCYPCLLRLFAYS
                     AEAKEKAENGPKDLPGNRCASCPLCNEIIRERHRLLPVLITHEEDFKPVPGQPTTLTL
                     MYRPANKIFAQPFQFYLEDSEFDGNIPWIEQGSTAEDFYESSKYARYSRIMKCDFHFI
                     LSSFNGELSSIEAHKSYDEEVNHDSSLYYDLAKAEIESQIEDARDTFYDDKGKCVIAP
                     TYRHKVSRVGSLSENEIDELLVKQSEFQLENGQKGYFFYQYLAGPSSKVKYFLSGLDV
                     QVLRTIYVDYFRFPFTLTLNLENISHDYEMVTEEMIHKLKYLGHLPFGTEVGFLEMNW
                     IGKSNTLIPPEVYSEFKKKLKDRSRRTRNKTLKEDRNKKTFERELELRTLKFYSSENN
                     IPLEDYGYKLKKENQFVHFPSRRSSSDTAQPSLDDTYAKMGSSNSTDGNVKYGTSVWG
                     TKVPMLEEEAIQDDEDYFDIEKKIQKAKEEQQKKGKKGRRGKKIVLSFN"
     gene            <866144..>868336
                     /locus_tag="FOA43_003628"
                     /db_xref="GeneID:62197028"
     mRNA            <866144..>868336
                     /locus_tag="FOA43_003628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923879.1"
                     /db_xref="GeneID:62197028"
     CDS             866144..868336
                     /locus_tag="FOA43_003628"
                     /note="CAZy:GT39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779807.1"
                     /db_xref="GeneID:62197028"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR032421"
                     /db_xref="InterPro:IPR036300"
                     /db_xref="PFAM:PF02366"
                     /db_xref="PFAM:PF02815"
                     /db_xref="PFAM:PF16192"
                     /translation="MAAKPIELNDEPDTQFSSEKGPLRAFVSRKTSSVPLQINVTEKI
                     HLLLLLIVAIAVRRWNIAEPPSVVFDESIVGKSINNYLTHAFSLDTDPPAVKLLYTWL
                     VELCNYVSPTFNFNTGESYLNSESQPFFPYTVTRGFSSLLGGCTILFTYRTLRASDVR
                     HYIALFGAFIVAFENSISEQSRFMFVDSPMLFFIAFAVSMIKTLQNSRAFSRKWLSVL
                     FLSGISLGFVISSRVIGIFTLIWAILVTIKETWFDLGDLRLKTSFVMKTGFSKLTAFL
                     TIPFTIYLFFFFIHLNILTNKGPGYGKMSPEFERGLAHNHLSNLIEEVSYGSDIMLRN
                     FHSGQYLHSYNGTYPNGHQQITLVDDYQDEENLWFVEERVKALGNELLEKLKPIRNGK
                     TLRLFHKNTKAFLRIHESSKPALSEQDYNKEASALGNDSWTGDDFADFEVKIASDYCK
                     TEHGKHTLKAGNTIFQLYNRKKSCYLLGTDKKLPEDWGHGQTEVICIESPTFVKSLWF
                     VDYNRHPLFNEDSNTVDFKKLSFWEKFIETNNAMLKLFSENKFEHEYMSKPKEWIFLS
                     RGIPYFVQPGKTIYLLGNLITYYLVAFSVIIFGLWELGKLITWNPNRVTTSSGRVYDY
                     EFHGLDFFIGYLINLVPFYLMDQTVFLFHYIPALYFGILLVCQTFEFIVSRRAKVGYC
                     FMLLWGVAILVTYIEFAPLIYGLKWTRQACERMLISPAWDNLCLAYAE"
     gene            complement(<868398..>868874)
                     /locus_tag="FOA43_003629"
                     /db_xref="GeneID:62197029"
     mRNA            complement(join(<868398..868772,868833..>868874))
                     /locus_tag="FOA43_003629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923880.1"
                     /db_xref="GeneID:62197029"
     CDS             complement(join(868398..868772,868833..868874))
                     /locus_tag="FOA43_003629"
                     /note="BUSCO:EOG09344T6B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779808.1"
                     /db_xref="GeneID:62197029"
                     /db_xref="InterPro:IPR021384"
                     /db_xref="InterPro:IPR037212"
                     /db_xref="PFAM:PF11221"
                     /translation="MTDRLTQLQICLDQLTDMFFASLTYVDQNHDSVKLNESDLKMVN
                     PDYHPASQLDFQSSLQELSRDIILKTRQILTIIDTLPGVGVSKEEQLAKIQLLSRELE
                     EVELQKKKVILKKDDLMKVVDKLILLVSDGIAMTRD"
     gene            <869046..>870242
                     /locus_tag="FOA43_003630"
                     /db_xref="GeneID:62197030"
     mRNA            <869046..>870242
                     /locus_tag="FOA43_003630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923881.1"
                     /db_xref="GeneID:62197030"
     CDS             869046..870242
                     /locus_tag="FOA43_003630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779809.1"
                     /db_xref="GeneID:62197030"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="PFAM:PF04757"
                     /translation="MDFYSNLDSRLLHRQTPTLFEIISANELERLLSPSVRYILAHYA
                     SRHPRYLIRILNHFDDLNLFVRAFIEYKYLSSWNSTFIEKFYGLKRVNKKRLGVSATP
                     DTEDVSQKIESLKRLSKIQLLGSLCDVLLVPYAKEKLDVLYEKYLPLFVLHRLKPRES
                     FKDFIKYSFVRIYPIAVMLLRIVDLAFKLLFIGGKMSSTTILQYFFNIEFSRLNQYDY
                     ELDEKRVSKFLAAPAIPSNRVRPESMLESIAKLWTKILLPLKKTTLITSNSVLPISIF
                     LLKFLEWWNTSEFSKDFGKDSEEKRILPKPDILPSAVLQNKKVGRILKTRDNLCRICH
                     KEIHNPAIIETGYVFDYSCIYNYLREGDKESGGRCPVTGKILLGCKYSESLNEWKVTG
                     IRRLMI"
     gene            complement(<870316..>872181)
                     /locus_tag="FOA43_003631"
                     /db_xref="GeneID:62197031"
     mRNA            complement(<870316..>872181)
                     /locus_tag="FOA43_003631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923882.1"
                     /db_xref="GeneID:62197031"
     CDS             complement(870316..872181)
                     /locus_tag="FOA43_003631"
                     /note="BUSCO:EOG0934102Q"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779810.1"
                     /db_xref="GeneID:62197031"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="PFAM:PF05327"
                     /translation="MTTIQSAAAPPISTNASHVVIGDEISSHRKRPIDEFTESATKRM
                     KPDFSHQMYSRLIRSALDSLDQGDFSAIDTLTSQVNMNPAKSDSLSIGSITVILRLLN
                     QEISRLDNRATTPLIQALLNYNWLGHLENPAFVKSYSTFLTVLVSGIPKWFNEVVSKL
                     VSGFTSKTDTELYQLHKTLKYLIQISPTSFNLLPLILRDKFPNKAAPMDDMVNYTKNL
                     LALLSYCDDLRYPIWSLIVEKLINLDVELQNQIDDVDDDDLDAALNDDEESNARATDN
                     DISAMSDISTVVASDAINDICDAEEVASDMDNDEDDDDSLMDDEENYNAEIHSISDLS
                     AKLDSIMKLIFEKTESSFTPEGLESGNGVKLFSTLTSIFKLYVLPTHYTRCVQYLMFH
                     MVQQQPDLTDSFLVVLLDVVFNATEIIANRIKAMQYVSSFMARAKGLSKEQLLSVMKY
                     LMAWCNEYVTEREKEVGDGNGGMDRFKMLYCVLQGLMYIFCFRYKDLKKEDNDEEWEL
                     RLDKFFNKMIVSKFNPLKYCNESVVLIFARIVQNVDMCYCFSIIEKNKRERLNGVRNA
                     SANSDSSENRFESKQEFLDLEAYFPFDPLMLKNSKKIVNTNYIEWQSSDDSEDSE"
     gene            <872740..>873801
                     /gene="SNF4"
                     /locus_tag="FOA43_003632"
                     /db_xref="GeneID:62197032"
     mRNA            <872740..>873801
                     /gene="SNF4"
                     /locus_tag="FOA43_003632"
                     /product="AMP-activated serine/threonine-protein kinase
                     regulatory subunit"
                     /transcript_id="XM_038923883.1"
                     /db_xref="GeneID:62197032"
     CDS             872740..873801
                     /gene="SNF4"
                     /locus_tag="FOA43_003632"
                     /note="BUSCO:EOG09342PSQ"
                     /codon_start=1
                     /product="AMP-activated serine/threonine-protein kinase
                     regulatory subunit"
                     /protein_id="XP_038779811.1"
                     /db_xref="GeneID:62197032"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="PFAM:PF00571"
                     /translation="MQNQYENNGEQLQQGLEQPQEPPLNQRGMIAHPNLLSTLSPDQI
                     RRDQRIGLHAIREFLQSKTSFDVLPVSYRVIVFETSLLVKRALNILLQNSIVSAPLWN
                     SKTSRFAGLLTSNDFINVIQYYSQNPTQFQFIDNLTLDGLRDVEKAVGTPSLETVSIH
                     PFKPLYDACVKMIQSSARRIPLIDEDENTHREIVVSVLTQYRILKFVSMNCKETKILL
                     QPLHELNMGTTTNISAAKLETPVMEVINLMIQKSISSVPIVDEQDKLINAYEAVDVLT
                     LIKGGLYADLTLSVGEALLKRSEDFEGVYTCTLNDSVFAISETIRKARVHRLFIVDDD
                     GKLLGVLTLSDILRYILFS"
     gene            <874040..>876226
                     /locus_tag="FOA43_003633"
                     /db_xref="GeneID:62197033"
     mRNA            <874040..>876226
                     /locus_tag="FOA43_003633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923884.1"
                     /db_xref="GeneID:62197033"
     CDS             874040..876226
                     /locus_tag="FOA43_003633"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779812.1"
                     /db_xref="GeneID:62197033"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="PFAM:PF03169"
                     /translation="MAPIELPEDIQWSSKASLPQVTLRSTIAGLCIGSVILISNFQFG
                     LQTGWVSMMSLPAALLGFAVFKAFEEKLGFEFTDVENVFVQSVAVAVATGPLAYGFIG
                     IIPAIEKLLTNAESGYIDGIDLKPLWKLVVWSAGVAFFGVFFAIPLRRQFVIREKLPF
                     PSGSATATLISVFHGTSLKIDGTASVKELPQDEETSDDQPIGPYHSNMTIIESQDICE
                     LAHMQEYHSNLKLLGITSMVASLYTVVSYFIPQIRAIPIFGSQLSEEYMINFQPSPAY
                     IGQGIIMGFQTTVYMLFGTILGWAILSPLAKFQNWAPGPTDDWKEGSEGWIMWISLSI
                     MISDSVVSLTVLITKSLIRLFFQCLAHAPSDDISSEIAHQELAQLMENNNSANSGQID
                     INPDTVTYDSTSDGSSDTMDHIFTSGSKEASESTENDSSLDDVGESYMVPMQWVIIGL
                     IGSCVLCIVSTRIVFGSVIPVYAIVSSVVMSLLLSILGVKALGETDLNPVSGIGKLSQ
                     LICAVIIPKGTRGSILINLISGAISEATTQQAGDLMQDLKTGYLLGASPKAQFIAQIY
                     GSIFSIFMSSLMYKVYTNLYEIPGKMFKIPTAVIWIDCARLVNGTGLPPKVLEFSIIF
                     GTIFGLISLLKNLVTNTKCKFYRYLKYLPDGVPVGIGIYNVPSFTFARFIGGLISYYW
                     LKRIGNCEKYRSSKVQMIIFSSGLVLGEGLFSVVNMVFSSLKVPHL"
     gene            complement(<876551..>878245)
                     /locus_tag="FOA43_003634"
                     /db_xref="GeneID:62197034"
     mRNA            complement(<876551..>878245)
                     /locus_tag="FOA43_003634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923885.1"
                     /db_xref="GeneID:62197034"
     CDS             complement(876551..878245)
                     /locus_tag="FOA43_003634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779813.1"
                     /db_xref="GeneID:62197034"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR036612"
                     /db_xref="PFAM:PF00013"
                     /translation="MLKRKSEESEHNTVKRIALDSDAVEQKDIENDKHQTSASLTATD
                     ESAENGDLEDMNDAESVKDVNDDNSEILEPENTSVTSGSVGGDIAEKNKDELETSTTP
                     EESKQDLPGQSEEETKTPPISSHRVVYNDDPSYVHFRMLCTISEAATVVGKGGETISK
                     IKEMSNARVNVSENLKGIPERVISVRGPAEYVAKAFGLIVRMLLGEQLNVPSSLESKQ
                     YNLRLLFPHTVMGYIIGKRGSRFREIEENSAAMLKANDQILPASSDRVLNINGVADAI
                     HIAAYYIAQTVIEHKPQMSKAIYYNPANFAQPTIPVYNQALRPFPPSQVPQSQPSGQD
                     AHQQMGDYRGPRMAHQQYSSPAQSGYPPIMGVPSQMMGLYGHIPPPPPATSGQQQSSL
                     GESQGGISSDSRGAKPVNMSGGFYQPSYGTTQFNPDTATSNTRTGAVSTGSDGKLNQE
                     VFVPQNHIGLVIGRGGRNLKDIRLQTGCYVKINEEIPGSTERKLTLMGNMYGIQNALL
                     LINNKIENEKLRELRGDSREQHTSHGGNNESNNPSNESSLPQRTFTSQGNQNGTNE"
     gene            <878451..>879705
                     /locus_tag="FOA43_003635"
                     /db_xref="GeneID:62197035"
     mRNA            join(<878451..878576,878725..>879705)
                     /locus_tag="FOA43_003635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923886.1"
                     /db_xref="GeneID:62197035"
     CDS             join(878451..878576,878725..879705)
                     /locus_tag="FOA43_003635"
                     /note="BUSCO:EOG09343Y7Q;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779814.1"
                     /db_xref="GeneID:62197035"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="PFAM:PF07572"
                     /translation="MIRDFRKSVLIAPQDVTLMKRFESNVFNNSIIGQLRVKAEQQHD
                     QLPSSTSEGNDYNESEDEDYDPNKADQDEAEPDKLNQNVNSKNIGDDKGGEKEDDEYN
                     DDDFELGEEDKKEMRKYSAIESATGGLIKTRRQRQGEEEEAKLRKRQNLGSILKNNKT
                     GSTDINNIWADMKGQSRKALSRSSTLGSSSEATTSRPMEEEVTECNSLPSNPDSQNPE
                     KVKIKRTYEFAGKVVTEEKWVDRNSQEARAQVNSTKLRSEATQEDSKKGGEKRSFTQR
                     NANLLYPLRRKRRRKTSLLEAVINNSSAAKISTLEKSRLDWATYVDQNKIHDELKYKN
                     KAGYLANQDFLDRVNNRQASLFRDARSSSSKKKQ"
     gene            complement(<879778..>882840)
                     /locus_tag="FOA43_003636"
                     /db_xref="GeneID:62197036"
     mRNA            complement(<879778..>882840)
                     /locus_tag="FOA43_003636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923887.1"
                     /db_xref="GeneID:62197036"
     CDS             complement(879778..882840)
                     /locus_tag="FOA43_003636"
                     /note="BUSCO:EOG09344TO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779815.1"
                     /db_xref="GeneID:62197036"
                     /db_xref="InterPro:IPR007015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="PFAM:PF04931"
                     /translation="MTTVSKDNYYRLASDLEPERISAATILIKELSAVDNRKDWHYAL
                     SRLIKGLTSSRASARIGYSLCLAEILSILINDKHEYTIKEFLDDLNDELYDNSGKSSN
                     GKNLRATLFGRLFGYQALINSNALQGHVEHILEVYDCLIEIALTKSWIREICFVTIYK
                     GLKSLQLLDDEVVITALLKMIKNADLVLSPEGLLIYLAIDPAKRQFYSEKVGINSWKN
                     GNPLSKGNMEILAKVLSDSEVGSADDQSHQSGNRQVGSWTPTLHYVWTPLLNELSSPE
                     ITTTTKKIKKHKHNKKEDNKVIEQISLTEFWKPVIDEQFFKLSASPERKYWGFEIFNL
                     ALSIPSLTQSQVSALLSANLLRSLINQSSKDNRMLHSLAKNTLRLLTETTKKYEERRI
                     PILEKLLGTSLNFDKLTKSKTITDILNSCFSKQSLSDTIDYLTSVEVNSDYDIIKYQL
                     LALDSLLKLVRSKREILSKSPELLKHVLNYLIEHTFLIKTSDPLRYTERMSKLSMERL
                     YSVLSEAMSIQKNIDWTNYVIEYLMNFDHQINEVEVEDFEMRFKFEDSLTGLKSESIN
                     TLEAIKERLQNMKLDDPKTHLLNCFEILFSTALIELYTGDSESASILSDLTEAFGKAS
                     NIKSDRDENEQKKITEVLIDLMLTYINQRSTLMKKVAFTIWENLIEGIGESQLDRLFE
                     ILLTRENKQGQDKLFDPAMAEEEAEEEEEKEEVSSSSTEEPDSYANASVSSDLVVDET
                     EASAFEDERRKKIEEVNENTTSALSKALRISENEMNSETDETNTAADANKGEKEENHE
                     EKEDDEGEEDDDDDSHVTDSDDYESMSDEEMMALDSTLSQIFKQRREALQAIDGKSGN
                     QRKLEAQEAREMMIFFKTRILDLLEIFIDERPTDSLNVNILLALINLMVLTMDKSVGV
                     KAHKLVKKICKGKTELESERSALEALSKVQETAAHSKIQALTSACNHTCIFFTKNIEK
                     QFGDKALDRVLDIYLKNFKKWLAHKSNKTTSGMFSDLVNWASSRRQEN"
     gene            <884165..>886663
                     /locus_tag="FOA43_003637"
                     /db_xref="GeneID:62197037"
     mRNA            <884165..>886663
                     /locus_tag="FOA43_003637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923888.1"
                     /db_xref="GeneID:62197037"
     CDS             884165..886663
                     /locus_tag="FOA43_003637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779816.1"
                     /db_xref="GeneID:62197037"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MKYSFALNLPMKTSRLFLATTLRSFTTYSSRSEQLNRQSLPQNK
                     IGGNDLAEKKASTLQTDKEPFQSKSKKTWKEKWFGLTVEQQRQAGFGEVKRLLQLAKR
                     DSKLFAVAVILLVISAAIVMALPKITGSILDATRKYEKLEEIQLFGLSLTQFLFVMAG
                     FLLISTFTTYGRIIILRVLGEKLVARLRSRIMKKTLRQDMAFFDENKVGDLISRLSSD
                     AYVVSRSVTQNLSDGIKHSIVGASSITMMFFLSPKLSLILLAFGPPLVFASYIYGLKI
                     RAISRELQQSTGSLTKVAEEQLNSIKTIQSFTAESKELHRYDNQIRDVFRISYKDAVT
                     NATFFASTGIMGNITFLLTLGFGTYFVMAGGMTVGDLTAYLMYTEYCGSATFGMASFY
                     TELFKGAGAASRLFELLDKKPLIDEVTGAKIHTSKGHIKFEDVSFRYPTRPDNVIFDK
                     LNLEIKAGSNVCIVGPSGRGKSTIASLMLRFYNPESGRITLDGVDISNYSVHSLRQII
                     GFVQQEPILMPGTIRDNIKYGMPPNVKVTGDMIEWAAAKANCDFINQFPDRYDTDIGP
                     RGSLLSGGQKQKVAIARCLIKEPRIMILDEATSALDSKSENAINTTLSRLLRDHSMTT
                     ISIAHRLSTIERCDEILVLGYDGQIAEQGKFSDLYANMNSRLYKLLNEVSKEDTQKEN
                     EEKHRRERERKLKLEEALKDCRNKPTVLSQEQLQKREAEDRELIGDSFREEGSEMKDD
                     FSHKFIIPQHMGNEEMVMKVAENDSEIQGMEEENESNGDEVSKEQDISDNKAGQDDDS
                     KNADNDVAKAKNKSHVGVTVTTGDHIRGQSEARH"
     gene            <887023..>887709
                     /locus_tag="FOA43_003638"
                     /db_xref="GeneID:62197038"
     mRNA            <887023..>887709
                     /locus_tag="FOA43_003638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923889.1"
                     /db_xref="GeneID:62197038"
     CDS             887023..887709
                     /locus_tag="FOA43_003638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779817.1"
                     /db_xref="GeneID:62197038"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="PFAM:PF00179"
                     /translation="MTSSAVLLQKELKDLSKNQPYFYLRLENDNIYLWDVGLYISNPD
                     SKYNGAFLKAQMRFPTNYPFVPPSFRFTPSIYHPNIYADGRVCISILHEAGNVYSDEP
                     SNENWSPAQCVESIMLSILSILDDPNINSPANVDASKLYRDDRNAYNRKVAKDVERSR
                     EDMPDDFRIPNPDDIKAKDYEEEWFYDEDDEDDDDDDDDDDDDDHSFYDDDDVEMSED
                     YGDIDNEKKH"
     gene            complement(<888525..>889487)
                     /locus_tag="FOA43_003639"
                     /db_xref="GeneID:62197039"
     mRNA            complement(<888525..>889487)
                     /locus_tag="FOA43_003639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923890.1"
                     /db_xref="GeneID:62197039"
     CDS             complement(888525..889487)
                     /locus_tag="FOA43_003639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779818.1"
                     /db_xref="GeneID:62197039"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00970"
                     /translation="MLYGPPFFRYPFAHKQGDQLRYAHRAASSCYRTKLGYRFGRGNP
                     LLRLAGLGLVGFLGFKALHRFYWGKPASFSQDGMTAFPSYLSGVRMKLISTKSITPDV
                     KMLKFELPKNYESSGLKPGSAVLASIKHSKTGKLLMRPYSPIYTPGDQHHLVFAIKML
                     NSQGASGAMHTLLPGDMVKFRGPKPGRSVDLSTISSVNLIAGGSGITPLYSVLNYLMT
                     EKPDSRVNLIFANKSMDDIIFKKELDALHEQYSNRFLVTYVVDRENTPATPSTVVGRI
                     NPDLLEKTIWKDSDIFVCGPDGMVSALRKQMNLDSFTDRKVVVF"
     gene            complement(<889822..>890787)
                     /gene="DIM1"
                     /locus_tag="FOA43_003640"
                     /db_xref="GeneID:62197040"
     mRNA            complement(<889822..>890787)
                     /gene="DIM1"
                     /locus_tag="FOA43_003640"
                     /product="Dimethyladenosine transferase"
                     /transcript_id="XM_038923891.1"
                     /db_xref="GeneID:62197040"
     CDS             complement(889822..890787)
                     /gene="DIM1"
                     /locus_tag="FOA43_003640"
                     /note="BUSCO:EOG09342PQS"
                     /codon_start=1
                     /product="Dimethyladenosine transferase"
                     /protein_id="XP_038779819.1"
                     /db_xref="GeneID:62197040"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF00398"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF13649"
                     /translation="MPKASRKHFSKKPDPSATGQINRVFKFNTELGQHILKNPLIAQG
                     IVDKAEIRPSDVVLEIGPGTGNLTVRIMEKARKVFAVEVDPRMAAELTKRVQGKPSEK
                     KLEIIMGDFMKLKELPYFDVCISNTPYQISSGIVFKLLSMIRPPRIAVLMFQREFAMN
                     LTARPGDALYNRLSANSQMWANVKHVMKVGKNNFRPPPKVESSVVKLIPKIPRPNIDF
                     NEWDGLLRFCFNRKNKTLGSVFKNRKILSILEENYGRYMAYMAEKNGEMVTVSSNEDT
                     AALVKSNVVKVLEETNYSLQRASKMDETDFLKLLYAFHNVGIHFA"
     gene            <890977..>891561
                     /locus_tag="FOA43_003641"
                     /db_xref="GeneID:62197041"
     mRNA            join(<890977..891244,891401..>891561)
                     /locus_tag="FOA43_003641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923892.1"
                     /db_xref="GeneID:62197041"
     CDS             join(890977..891244,891401..891561)
                     /locus_tag="FOA43_003641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779820.1"
                     /db_xref="GeneID:62197041"
                     /translation="MGDQIKVPSPKKPQVHKYTSRKRREINVSPEQLKRVKGYQKMVA
                     GVLFMIVPCVELYRRLYRDGERKMQEGEYNPVDGTIKKYTEEEKIEVDARFRRELLDL
                     TFILREFSSGYEGVLGLMVALEAAYVMLHSAVFGLEGNFN"
     gene            complement(<891835..>893381)
                     /locus_tag="FOA43_003642"
                     /db_xref="GeneID:62197042"
     mRNA            complement(join(<891835..891888,891960..>893381))
                     /locus_tag="FOA43_003642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923893.1"
                     /db_xref="GeneID:62197042"
     CDS             complement(join(891835..891888,891960..893381))
                     /locus_tag="FOA43_003642"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779821.1"
                     /db_xref="GeneID:62197042"
                     /db_xref="InterPro:IPR013889"
                     /translation="MKPSLADLINGSVKVKRFKDRLDIKAENNTFEKLQNYDSLSTFL
                     KHIEDYVRLLSDTLQQVVQNIDTVSTQNMVMWVSKGYEEINIVCFNLETINQLTDSIL
                     RILDTSTDNIDFLLSTVSSICEFTVDANKSIQILKAIATIGIRYNEISNSIMSSIEAE
                     IATGFEEVLQLKTQMDVFIKEDGYKITLNQILSQQAHTYKEGVGSSDMKLPLFDKDVA
                     ATVKQFIRLLTRMDPISVSLSYIPQELKMFNAISKEKYPSCVLELVGTYRKLIRDFTV
                     LESEISELQDQIIGSRWKHIFDSLAEEFEGILEGSHSKEQLNYANFILEYLCLILADG
                     VIKDDDYNNRYDSLVAALSESAPSKNRSVSTSSTSSSDSSTGRRMFKGQKFINSLDLK
                     PVMIEGTPMSIRHPRECKDFIGSLSNIDKTQLRRDSKDVVDQLMKELGVHAEDKENAA
                     ELAQARLQARSHLVGSRTPMREKNNTYYEADKVRTTSGAAY"
     gene            complement(<893671..>896349)
                     /locus_tag="FOA43_003643"
                     /db_xref="GeneID:62197043"
     mRNA            complement(join(<893671..895770,896341..>896349))
                     /locus_tag="FOA43_003643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923894.1"
                     /db_xref="GeneID:62197043"
     CDS             complement(join(893671..895770,896341..896349))
                     /locus_tag="FOA43_003643"
                     /note="BUSCO:EOG09340QF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779822.1"
                     /db_xref="GeneID:62197043"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR036599"
                     /db_xref="PFAM:PF01068"
                     /db_xref="PFAM:PF04675"
                     /db_xref="PFAM:PF04679"
                     /db_xref="PFAM:PF09414"
                     /translation="MKKIQLDETTEDLETCKGSKDVEMTTADETTTSKHEEVEGDIEN
                     HKANNEILEAKSLLQIDHEVHRTENSSKIIANKPVQYAALCDVFEKLEEETGRLKNLA
                     IASEFFCDILKRGVNQDVAEQNLIEVTYLMINRLGPDYEPDLELGLGETLLLKALAQS
                     TGRELRHIKDDYHKAGDIGKVAQISRSRQPIMFKPKPLTIHQVFQNLAEVAKSTGNSS
                     QSRKIGIINRMLAACAGQEAKFLMRSLEGKLRINFGEKSVLVALAKAFAEFECGTGNH
                     SESEADLNALVRAQDQIKEAFAQTPNYEMIIHNCLKYGVGHVAEHCTLKPGIPVKPML
                     AKPTKSITEIMDTLQDRKFTCEYKYDGERAQVHLLPDGSMRVYSRNSENMTERYPDLI
                     PVIDELRAKNPEIRSLILDSECVAWNLESHEILPFQILATRKRKEVQEKDIKVRVCLF
                     VFDVLYFNGESIIQKPLNERREYLDKHVIEIPEKLQFATRLDSTSVDEMSAFLDQSVH
                     DSCEGLMIKALFGKESHYEPSKRSKYWLKLKKDYLEGVGDSLDLVVIGGYIGKGKRTG
                     WYGGFLLASYNQDTGEYESICKIGTGFSEELLASLTEQLKPKETPKPKPSYVYDKDNS
                     NAEPDVWFEPSMVFEVKVADLTTSPLYKSGASYFGNRDKGISLRFPRFIQIRTDKATE
                     DATSSEQIVEMYESQAVVQS"
     gene            complement(<896382..>902567)
                     /gene="FAS1"
                     /locus_tag="FOA43_003644"
                     /db_xref="GeneID:62197044"
     mRNA            complement(<896382..>902567)
                     /gene="FAS1"
                     /locus_tag="FOA43_003644"
                     /product="beta subunit of fatty acid synthetase"
                     /transcript_id="XM_038923895.1"
                     /db_xref="GeneID:62197044"
     CDS             complement(896382..902567)
                     /gene="FAS1"
                     /locus_tag="FOA43_003644"
                     /note="BUSCO:EOG0934019W"
                     /codon_start=1
                     /product="beta subunit of fatty acid synthetase"
                     /protein_id="XP_038779823.1"
                     /db_xref="GeneID:62197044"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR003965"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016452"
                     /db_xref="InterPro:IPR020801"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="InterPro:IPR032088"
                     /db_xref="InterPro:IPR039569"
                     /db_xref="PFAM:PF00698"
                     /db_xref="PFAM:PF01575"
                     /db_xref="PFAM:PF08354"
                     /db_xref="PFAM:PF13452"
                     /db_xref="PFAM:PF16073"
                     /db_xref="PFAM:PF17828"
                     /db_xref="PFAM:PF17951"
                     /translation="MTVNRPLVVNHGSIETTILTPQENYLFYQQLTSGFYKSLPEPTD
                     GFAGDDEPSTKAELLMKFLGYVVESNSIDSEKEDAAKLILGEFETRFLRGQDIHAFVA
                     HALADDEQPTSLVKVQNNLIKNYYLAKVFLDSSFGVQVKAAPKSALFNAAINSKADIY
                     AIFGGQGNTEDYFEELREIYTVYHGLIAEFLVKVENKVQSLISSTPGTDKVYTHGFDL
                     VNWLEDPSATPGSQLLLSIPVSCPLICAIQLSHYIITCKVMGIHPGELRSILKGATGH
                     SQGLVTALAIASSDSWESFEIQSMKAIEFLFFLAVRCTQTYPPTSLAPSMVKDSEENG
                     EGEPGPMLSIRDLTIDQVEKFVADTNRHLPEAKHITISLVNGARNLVVTGPPESLYGL
                     NLNLRKAKAPSGLNQARIPFSQRKLKFSSRFLPITSPFHSKLLNPANKMILDDFKKSG
                     LAYPQSDIGIPVFDTYNGTDLRDLSDDSAAVRAVNLITTLPVYWVEATDFKATHIADF
                     GPGGASGLGVLTHRNKEGTGVRVIVAGAISASDDDSEFGFKQELFDIRPCSLKFAPNW
                     LENYKPRLVKTKNGKIYVDTKFSRLLGRPPLMVPGMTPTTVSPDFVAATINAGYHIEI
                     AGGGYFSKSIMEGALKEVASQIKPGSGIGINLIYVNPRMLQWGIPMIKELREQGFPIQ
                     SLTIGAGVPSLEVASEYIETLHLTHLGLKPGSVDAVAQCITIAKAYPNFPIVLQWTGG
                     RGGGHHSFEDFHQPMLQMYGKIRRCSNIVLVAGSGFGSADDTYPYLTGSWSKRFNYPE
                     MPFDGVLFGSRVMTAKEAHTSPAAKEAIASCPGVPDSEWESTYVKPTGGILTVKSEMG
                     EPIHKIATRAVVFWKEMDDTIFSLPKPKMLVALQKQKSYIIAKLNADFEKPWFGRNDE
                     GVCDLKDMTYEEIAKRCVELMYVRSSKRWIDPTLKKFVGTFLRRVEERFAAQTATSVI
                     QNFSELDSPEKAVAAVFDKYSLARSQIITAEDCDYFINMCLNPIQKPVPFVPILDDKF
                     EFFFKKDSLWQSEDLEAVVDGDVQRTCILQGPVATQYTKKVDEPIKEILDNIHYGHIK
                     RLLEDEYDDDASRIPVVEYFTCEEAVSIQSLEGVTIAKNGNDTTYSIGPVVPDAEKWF
                     KLISGDKYTWRHAFVSSKIVVQEYNHVKNPTRNVLAPSKNLIVRISNVNTPEATVISV
                     WEPVKGKHREVVNVSISGKKITLRLIESRTCDGRPVALMLYYDYDPSDGFAPIREEMK
                     GRNNHIKEFYWKVWFGCKSPVDLDFSVDATIDGGSSTITSKDIVELTHAVGNSCEYFV
                     PRADRIQLAPMDFAIIIGWRAIMKAIFPKTVDGDILKLVHLSNSYRMLSGASPLRAGD
                     KVSSDANIVSVVNGPTGKTVKVVGHIYREGVEMMQVTSGFFYRGQYTDFENTFKKTVE
                     TPVEVTLATQKDVAVLKSKDWFHCDDDTSLLGKDLTFRLTSLYKFRSADVFSYVSTTG
                     AVCYELPTKEIKKVAEVEYEAGDSFGNPVVNYLSRNGRPIEQPLMFENHIPLAKALST
                     KSPGSNETYAAVSGDYNPIHVSRVFSSYAGLPGTITHGMFSSASIRSLVEMYAADGVA
                     PRVRAYTANFIGMVLPNDELSTSLEHVGMINGRKIIKIVTKKVETDEVVLSGEAEIDQ
                     PITTFVFTGQGSQEQGMGMDLYKNSEVARGVWDLADKHLIDTYGFSILDIVRNNPHEL
                     TIYFGGPKGRSVRENYISMMFEYVDEDGNLKSEKIFKSIDEDTTSYTFRSPTGLLSAT
                     QFTQPALTLMEKAAFEDMRSKGLVPEKCMFAGHSLGEYSALSAIANVMPIESLVDVVF
                     YRGMTMQVAVPRDSLGRSNYGMIAMNPRRVSSNFSDSSLRFVVEHIAKQTGWLLEIVN
                     YNVENQQYVAAGDLRALDTLTNTLNIVKVQKIDVDKLLEHMSVEKVAEHLSEIVDKVS
                     KDSSAKPQPIELKRGFSCIPLRGISVPFHSSYLRSGVKPFQGFLNKKIPKSAVKPAEL
                     IGRYIPNLTARPFQITKDYFEYVYQLTHSNKIKNILDNWESYECA"
     gene            <904246..>908862
                     /locus_tag="FOA43_003645"
                     /db_xref="GeneID:62197045"
     mRNA            <904246..>908862
                     /locus_tag="FOA43_003645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923896.1"
                     /db_xref="GeneID:62197045"
     CDS             904246..908862
                     /locus_tag="FOA43_003645"
                     /note="BUSCO:EOG093402YN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779824.1"
                     /db_xref="GeneID:62197045"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="PFAM:PF00027"
                     /db_xref="PFAM:PF01734"
                     /translation="MSSSETIGHEIITQASRMDLIASEIGSEELRYSSGNSFITNVVG
                     AISWLIYKLLSHTLFYVPSVIYLILSHTVQVNLSFTSLLIFSSLIVLIAYSYVRYRYL
                     TKYSRLPEEPKRQEPTIDTFLEPSNEDGKSRVSYLDEFLSAIKIFGYLEKSVFHELTK
                     SMQTQKLDSGEILFLDDSSGFTICVEGEIQVYFKIGEERDRKQALFAKDSSKDVVIVD
                     GIRYQLLNIIKSGAPVSSFISILNLLTNPSAALPYAAPTPSVLVPGSAHHSLPLPHDG
                     FALDGPFDGVSSPNYLGKLSTDMSGKLPAANSLSFSPTSLNAHSASPNLPSLNSYPTE
                     SNAGGVPCATDSTSQSSSAMELIAIPKGNCTISIIPRESFSRLAHKYPKATTHIIEMI
                     LTKLYRVTFQTASDYLDLTSDIFQTEINLNKYAKNKISRYLCDNAIKSLDRRADVEAA
                     TLNSSSNESETSENGLHDSSLRSPITVMSSRHFQNSNYDATISTSPAVSSAAKRRQRH
                     FRRSIRHGNQSSDILAYDSADESTNSLNEDPRSSSVSCVRSGSARNLSLKSRNKSNTG
                     DLMSKVPLPRSGSDINVGTGNSDMHALRDRTFSGNDEGSEDFILMSSLADAICSIIGI
                     EKGLFISTDTPLTSSVSSSRNGVQMISSLAAVNVVPVVEEHPGSKLRTFSTSGIQISS
                     SNDDEPEGSTPESGEADYLNVKKDLADEIQILRISQGTRIIKSEEQTPGIYYVIDGAL
                     DVTYWKRQMEELDGHSVDLKDRRDSLKEKLHEEFLYTVRKNQIAGYLGTVIGSKSFID
                     VRAATTTYAAFIPRNVFDFMIERYPRVEACIARHLLTVLDRRLYLTDYAIEWVHSSAG
                     ASLYLQGDPANGIYIVLNGRFRSVKLDRITGKHEVLSEHGQGVSLGEVEVLTNTKRLV
                     TLIAIRDSELARIPRTLFEMIALSNPSIMVNVSRIVASRVTRAITTSVNTIPIGASAT
                     SPHIKDEPLLNNFTDFRTLTVLPVTQGLPVMEFGERLGLALEATGKSVKMLNQSSALT
                     SLGKHAFDRLAKLKQSGYFAELEEKYDIIVYLVDTIANSSWTRTCIQQGDCILLLADA
                     MASSDIGEYERLLVKTKTTARTELVLLHPERSMEPGLTNRWLKNRIWVHSHHHIQMQL
                     NLARSDAQNVAHQEDDISRMEKIPELFRKSTAKIRDNLKTKVESIITGNDLLIRLARD
                     SFKSKKYYQPMQTHKNDFMRLARILTGQSIGLVLGGGGARGLSHVGIIKALEDNGIPV
                     DMIGGTSIGAFVGGLYAKDYDFVPVYGRAKTFAGRMATLWRSVLDLTIPVTSYITGHE
                     FNRGIWKAFGDSRIEDFWIKYYTNSTNITESLMEVHTSGYAWRYIRASMSLASLLPPL
                     TDNGNMLLDGGYIDNLTVGEMKRRGARTVIACDVGSADDHTPMNYGDSLSGFWVVLNR
                     FNPFSRHPNVPTMADIQMRLAYVASVNALDRAKNTEGCLYLRPPIEDYATLDFGKFDE
                     IYRVGAKYGSKIVKELRDNGELPMLKARKREVWGTHPLRRRYSI"
     gene            complement(<908988..>909281)
                     /locus_tag="FOA43_003646"
                     /db_xref="GeneID:62197046"
     mRNA            complement(<908988..>909281)
                     /locus_tag="FOA43_003646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923897.1"
                     /db_xref="GeneID:62197046"
     CDS             complement(908988..909281)
                     /locus_tag="FOA43_003646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779825.1"
                     /db_xref="GeneID:62197046"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR034105"
                     /db_xref="PFAM:PF01423"
                     /translation="MVVEKSVSASEPLDLIRLRLDEHIFVKLRGNREMSGKLHAYDSH
                     CNIVLGDAVETIYFVEDGSKELKSRQEKSELVFVRGDSVMSITDSTNLDTNSA"
     gene            <909536..>911845
                     /locus_tag="FOA43_003647"
                     /db_xref="GeneID:62197047"
     mRNA            <909536..>911845
                     /locus_tag="FOA43_003647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923898.1"
                     /db_xref="GeneID:62197047"
     CDS             909536..911845
                     /locus_tag="FOA43_003647"
                     /note="BUSCO:EOG09340U51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779826.1"
                     /db_xref="GeneID:62197047"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="PFAM:PF00753"
                     /db_xref="PFAM:PF07521"
                     /db_xref="PFAM:PF10996"
                     /db_xref="PFAM:PF11718"
                     /db_xref="PFAM:PF16661"
                     /translation="MPSVTPDTSKEHLDFYCLGGGNEVGRSCHIVEYKGKVVMLDAGV
                     HPAYSGIESLPFYDDFDLSRVDVLLISHFHLDHAASLPYVMQHTNFKGRVFMTYPTKA
                     IYKWLLNDFVRVTTITDDSNGMDDNSNAFLYTGEDLNTSLDRIETLDYHSTVEVDGIR
                     FTAYPAGHVLGAAMFLVEMGGLKYLFTGDYSREEDRHLSSAEVPNVTPDMLICESTFG
                     TATHVPRLERETKLTTVIHSTLQQGGRCLLPVFALGRAQEILLILDEYWQQHKDLQSV
                     PIYYASDLAKKCMAVYQRYVNMMNESIRKKFTETNENPFHFKFVKNVTHIDRVDDLSP
                     CVMIASPGMLQNGISRLLLEKWCPDPRNTVVMTGYSVDGTMAKQLLTEPDEIPSLNNP
                     DVMIPRRVNVEEISFAAHVDYEQNSEFIDKVNAKTIVLVHGESNPMGRLKSALLSKYQ
                     KYKDTENEVKVYNPRDGTKLELEFKGVKISKVMGQLATELPKEHNTVSGVLVQKNFDL
                     NLLKVDDLREFTGLTATVVRERQTLRCNSNRNLLRWQFLQMFGYIKILADVSDEFSFQ
                     VMDVVTVTLEESASIATVEWQSGIIDDTVADSAIAIIMSCDSLPASVKISSKSHNHED
                     ADVNAEEVSVGMEDIEQNGQLSSVKREPKIAVKEENYQAALKKLDGGDDDANEHHENA
                     LANFPTLHNDYSPETRLHHIEGLLKVQFGDSFTSKVDDHCGIIKIGRHEAKINYKDFT
                     VVCQSNVLKGRVEGVLHRSLDLVAPLSHE"
     gene            complement(<912069..>914165)
                     /locus_tag="FOA43_003648"
                     /db_xref="GeneID:62197048"
     mRNA            complement(<912069..>914165)
                     /locus_tag="FOA43_003648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923899.1"
                     /db_xref="GeneID:62197048"
     CDS             complement(912069..914165)
                     /locus_tag="FOA43_003648"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779827.1"
                     /db_xref="GeneID:62197048"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="PFAM:PF04082"
                     /translation="MSGEVPENMKGTTGIDLFPTFNASRSEESLKKVFDPRMLEQSLD
                     KCYISPALTKDLDVESIVNTYYKYFHSIHPFLPHREDIMTYLNSVPYNYDLLLAMKIM
                     GDGQVSSIYSRDVETVQFLVTSVVNYIKQVGKDLISLQSLLILAMIAHISSLHDLSML
                     LREALVSLALELKLNLLDQHTVPDIFMDVNGFITERRESDNNASTNTIHGVQLMNTPS
                     ESDTKDDVLTELMQACRVANIPKRILADTIRRTLWEVYFFDTISGTASGHTMSLLASC
                     KIIVLYPTTISAHAFDYKSRAEACKLVNDSIKLNVAIQAEEEVESHLVHMKAAIGNWE
                     LRLDNPDMYSTPYLVNANGQVNEGVFEAIMLVNYAQIFTHRPFSYLWRSDVSKHPKCT
                     DEEDVSEDCPPLKRQEVDSQKIIETRKTIDSASSVVKSLLDTNAADVTKRTPFLACAL
                     AFSSLVHLSAFSWVESSLQVLGDDASTASLLKENINEEELDTYTEYIKLELGAIYQIS
                     RHWALSAKLAQHIKETLRRVSLKLYRKVQAALPEPKFKPVEIAALTPIQKDIRRTSYR
                     TPSLSTSSSTQPTFTKTTTDPVLPDVFSRRPREYIRSLPNTYSGTNPTTSNSTRSPDP
                     GAVSTGNISAEKPEISGQTNLINEINDAELNMMMDDSYLSLSPTSDTGCDWVDKHIFE
                     FDAYNLAAGDESKTPN"
     gene            <915809..>917047
                     /locus_tag="FOA43_003649"
                     /db_xref="GeneID:62197049"
     mRNA            <915809..>917047
                     /locus_tag="FOA43_003649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923900.1"
                     /db_xref="GeneID:62197049"
     CDS             915809..917047
                     /locus_tag="FOA43_003649"
                     /note="BUSCO:EOG09341RIW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779828.1"
                     /db_xref="GeneID:62197049"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="PFAM:PF00022"
                     /translation="MPKNIIIDNGSYHIKYGDASGEKPVHAQNCVIRTNDRRVLLGEA
                     LDPGTKIINDYSGIHFRRPIEHGQLTQWSVEKQIWDNSFAEEYFTDDWLKDSNLIYCE
                     TPFTLTLFQNLTDEVLFEEYDISNLYRCSSGSLMPWLSQNNAQYNDFQLVIDSGFDST
                     WVIPMIYGLPYWKGVRKMPIAGRFLNSYLREIISFRHYDVTDEMVLVNNIKEKACYVT
                     SDYEASLKKVEKQRKNRNLNDAGEISINYVLPDYKTTNIGYTVTDDKLAKMQKQDTVQ
                     SLKLYDERFAIPELLFHPELSGVHKAGIITTIKDSLKHVPALIRPLLTANMVVIGGTF
                     NLSGFKERLAQELKKEIPIDDEIIIHDFDQSKDLSEIGWYAGKQLFAKNGFEKVCVSR
                     EEYQELGAEYTQEKFGYKLP"
     gene            complement(<917196..>919986)
                     /locus_tag="FOA43_003650"
                     /db_xref="GeneID:62197050"
     mRNA            complement(join(<917196..917232,917330..919883,
                     919947..>919986))
                     /locus_tag="FOA43_003650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923901.1"
                     /db_xref="GeneID:62197050"
     CDS             complement(join(917196..917232,917330..919883,
                     919947..919986))
                     /locus_tag="FOA43_003650"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779829.1"
                     /db_xref="GeneID:62197050"
                     /db_xref="InterPro:IPR004331"
                     /translation="MKFGSEMNDRSIERRSSSSISLSSTVSRSGSTDTSVNGASRKGH
                     LERRQKRYLKDLYAAFKEQINFVSLFVNSKYGEISRRILATKKQLNAFINSEDNYSSL
                     HVSEDIYQRMTAHKFLTIHKELEILSTDLQDLSRFILLQKIALKKLFKKFLKHSMYTY
                     KQELVDKITSEFLVGNPDSFFELDLSDAAMELTLLFDVVNNYYYDGTALDSNGLQSIK
                     KRYYHSNKAVDRQLVFGSSPSSLLSIDFPQSIEVASDPKLDRMYSSRVTAFDIVSHKK
                     APVSQVFWIHNDNLAEIRFLLLREFKLISDDTGIVDEDTKVQSAHQLKKTESSLNLMR
                     NQERNSQTIGVGSSEDACESMFRPDTQRVSFWLANLANPKMTATRALSSNEVIDSASA
                     ASAASDFSNKESRGDIYPCDIAPQVTYSDFTIQNVPLIIAPLGGLRQFTLAPINQDII
                     KSLMGKNFDKSQLIRQWRKSGLMGNLKVSQLTLDWFYDENMVPLAKVKSDRIHFIDLG
                     PPQKKIECYLTLDSNVRTSKLSDNSDLGWSETDEVSSDVFPHSILEIRYDSPLKSFSK
                     SVQLLIDSHLVYRVDNLGFSLNNYLFAKYYASYVPDNIMLEFVAPWYEELQNKDIRKL
                     PSLHRQESGSNNMNSGILLNKNEVQPQRSHTQGYWNEFDYGSDLEDDDAGFYVYEDGN
                     NADGRSFGGGDANLFGFNFLTPEKVEAILGFANKVSNAFGRLNFLASKDDAADPENRP
                     LMSRYQGEGHSHNYSYSGSSSRISSSPESDSEAEFCFSTKERERQKHRSIIEEAAGIS
                     AGMATSSQFRPNELARQVIHDKVLTCLYFSLVLISYLIDGAGIGIVFSVIRNTLKNPD
                     VIGGNSVLIGTISLYGPPSS"
     gene            <920742..>921614
                     /locus_tag="FOA43_003651"
                     /db_xref="GeneID:62197051"
     mRNA            <920742..>921614
                     /locus_tag="FOA43_003651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923902.1"
                     /db_xref="GeneID:62197051"
     CDS             920742..921614
                     /locus_tag="FOA43_003651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779830.1"
                     /db_xref="GeneID:62197051"
                     /translation="MSKKNLKDRPNKALSQIQRGEPSKKVSDYARDCESEATQDQIIE
                     SPESEFEDISYGSPTNSQNRCKPSSATVAMDPRQRVIYNAIVNTLRKDLQPQLNQLAN
                     DSAKYHTLKSIYHLPSITDLKKELSKGLEARSKVDLEFDETRLMRMISNESLKQRGQP
                     PVKRLKQRKHPHFPEVQEQIRTNFNSNRALDPIEEVLEMNTKTDNLYKEFISYRKGYH
                     RSKDSRTLTEIETEELKSIAYRIEAEKFPDLGRIGKIAQKFDLHQGEPQLRYFSNKEL
                     TVEITTKLKERRLK"
     gene            complement(<921673..>923376)
                     /locus_tag="FOA43_003652"
                     /db_xref="GeneID:62197052"
     mRNA            complement(<921673..>923376)
                     /locus_tag="FOA43_003652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923903.1"
                     /db_xref="GeneID:62197052"
     CDS             complement(921673..923376)
                     /locus_tag="FOA43_003652"
                     /note="BUSCO:EOG093420X0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779831.1"
                     /db_xref="GeneID:62197052"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /db_xref="InterPro:IPR035417"
                     /db_xref="InterPro:IPR038167"
                     /db_xref="PFAM:PF03531"
                     /db_xref="PFAM:PF08512"
                     /db_xref="PFAM:PF17292"
                     /translation="MSTEYERIYLNQSKMPGRMRIAESGLGWKAQSVPGATTKTSPFL
                     MPSEEISSAVWSRGCRGNELRIDTKNRGVVMLDGFGKEDFSSLKNELEKYFDMQLEAR
                     EHSLRGWNWGKTQLARNELIFNVSNKPAFEIPYSFVGNTNMTGKNEVSVEMDLSSNNK
                     IERGGDELVEIKFFLPGSMKQEEEEVLKKKEEEREKVEGEGKEATGDKIEQLKTKALF
                     FYDELKEKADLGQVAGEMIVSFGEILFLTPRGRYDIDMYDSFLRLRGKTYDYKIRYAQ
                     IQRIFSLPKIDGLHQLMILQVDPPLRQGQTKYSFLILQFDTQEEIEVELNLDDEEYEK
                     KWKSRLNKTYNNYTYLVLSNIFKGFTERRVVQPGSFLSKESEVAISCSVKANEGHLYP
                     LEKCLLFVTKPTILIPYSEVSEIVFSRVDSTGTQRTFDMNVNLKFGGSSHSFGNIDRG
                     EQPLLENFFQSKNIQVKNDEKIAQDMMAAALMDSDGDEDMDMGSADEESPDEDFKPGE
                     DDADVDDADVDDADIDDADIDDADVDDADIDDADVDDADVDDGDAKDDDGQPEIKKQK
                     N"
     gene            <923692..>925274
                     /gene="SUB2"
                     /locus_tag="FOA43_003653"
                     /db_xref="GeneID:62197053"
     mRNA            join(<923692..923914,924196..>925274)
                     /gene="SUB2"
                     /locus_tag="FOA43_003653"
                     /product="Suppressor of the cold-sensitive snRNP
                     biogenesis mutant brr1-1"
                     /transcript_id="XM_038923904.1"
                     /db_xref="GeneID:62197053"
     CDS             join(923692..923914,924196..925274)
                     /gene="SUB2"
                     /locus_tag="FOA43_003653"
                     /note="BUSCO:EOG093421YT"
                     /codon_start=1
                     /product="Suppressor of the cold-sensitive snRNP
                     biogenesis mutant brr1-1"
                     /protein_id="XP_038779832.1"
                     /db_xref="GeneID:62197053"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MSAEGEEELLDYSDSEEINVASTTAKTVEETKKEEETDKKGSYV
                     GVHTTGFRDFLLKPELLRAIADCGFEHPSEVQQACIPQAILGNDVLCQAKSGLGKTAV
                     FVLSTLQQLDPTPGEISTIVICHTRELAYQIKNEYTRFSKYMPDVRTEVFYGGVSITK
                     DAETLKNKDTCPHIVVGTPGRLNALVRDKIIRLNNVKNFVIDECDKVLEQVDMRRDIQ
                     EIFRATPYQKQVMMFSATLSTEIRPICKKFMKNPLEIYVDDEKKLTLHGLQQYYINLP
                     EEKKNLKLAELLDSLEFNQVIIFVKSTRRATALNKLLCESNFPSICVHSGIPQEERIA
                     RYKSFKEYNKRICVSTDVFGRGIDIERINVAVNYDMPSEADQYLHRVGRAGRFGTKGL
                     SISFISSKEDEELLSQIQERFEVKIQEFPAEGIDPSTYMNT"
     gene            complement(<925458..>926744)
                     /locus_tag="FOA43_003654"
                     /db_xref="GeneID:62197054"
     mRNA            complement(join(<925458..926621,926739..>926744))
                     /locus_tag="FOA43_003654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923905.1"
                     /db_xref="GeneID:62197054"
     CDS             complement(join(925458..926621,926739..926744))
                     /locus_tag="FOA43_003654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779833.1"
                     /db_xref="GeneID:62197054"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="PFAM:PF02535"
                     /translation="MVDFLSITMDSSLAVASEFVSLVARDEDACVSTNDYNGSYMGAR
                     ISSVFVILITSAFGSFFPILSSRYSFIRLPQVCFFLAKYFGSGVIVATAFIHLLEPAS
                     DNLSSECLGGVFLEYPLAFGICLIMLFVMFFAELLAYKWMETRGMEDDGSSNSHSHSH
                     FGDESMFVRPAASDEKLNTDLAANPAEQEGLARGQQWDADHYGHERIHQDPEVIGTEI
                     DNKAKERYTANLLNVFVLEFGIIFHSVFIGLTLACSGDEFVSLYIVLVFHQTFEGLGL
                     GTRIALVEWPKTRRWTPWILALAYAFTTPISIAIGLGVRNSYPPYSRTALIVNGVFDS
                     ISAGILIYTGLIELMAHEFLFSDEFNGKGGFKKMLWAFFVMCIGAGLMALLGRWA"
     gene            complement(<926930..>930411)
                     /locus_tag="FOA43_003655"
                     /db_xref="GeneID:62197055"
     mRNA            complement(join(<926930..930111,930405..>930411))
                     /locus_tag="FOA43_003655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923906.1"
                     /db_xref="GeneID:62197055"
     CDS             complement(join(926930..930111,930405..930411))
                     /locus_tag="FOA43_003655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779834.1"
                     /db_xref="GeneID:62197055"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="InterPro:IPR038770"
                     /db_xref="PFAM:PF00999"
                     /db_xref="PFAM:PF08619"
                     /translation="MLPGFLIIGLFTWLLIPDFSYSESLLIAACVTATDPVLAQAVVG
                     KGKFAQRVPAHLRNLLNAESACNDGISVPFTYLALNLIVHAGQPGRIAKDFLVNTVLY
                     ECVFGSLLGVIIGYVGRKLLRFAERRHLIDAESFLAFYILLAVLCAGFGSILGCDDLL
                     ASFCAGTAFAWDSWFTKKTMESHVSTVIDLLLNLSYFVYLGSIIPWQEFNDHKLGLDC
                     WRLICLALCVIAFRRIPAIFAIKRICPDINNWKEALFVGHFGPIGVGAVYTSIIAIGD
                     LEAEVLHLDDGPTSNYPTSLTYYTLIRVIWPCVTFLIVTSIVVHGSSVAVMALGRHLQ
                     SMSFTLTFTRTETMGGGWTTRLPKRDKNGNYFVRHTDRDSADAAQDEPAELTDSSAED
                     VVAIPAGLHPRKKRRRRKKRKGLARFTRARGEFIEEENPKPVELDLRKGRHNSNDESV
                     SSYSRSTSSTGSLSSLSVIGSVAGSLLLNSPTQSEKQAFEDEFTNPISSSGEPSPENS
                     RETGNGTSIGTKGAANDGGGGNINHVPTTSTASGSNDVAVAVAVPSVHISDTSSESFS
                     NSNSASESGPELNKEESKEQALTRMVTYIRGNPELLEKLQREYQLTEADLEPVYRDGE
                     FRVPTRGYKDGGTLVIEDQHGEVLRSLKSVNPDSDQESVRSLRSISSLHSLKRTLSKL
                     ASKVGVPMPKEDSQKNDKTIHEILSEAPTKGGASDQNNKFENALSPGTPSTMHRINST
                     HSIRYVSNDDHDLQGGPSYRKTTEESSLSPPSNRVVKTVTPGTSAKSDVALGPKERLR
                     KKIKYLGYNKPRRLHISEKLHGFRVGDTIIIEDREGNVVGTYKINPEREEIYNTKPDD
                     LVSKALQAVGLARQSEPNVNDREKNLEGSSTLYPAEDTIDDKRIESKLRAFIKNPGKF
                     RMDKKDARRAARNYKKEHREDEDSEEDDESHSSDSDSSGDQSYSSGQSESSSESGRSM
                     KHDVLRDSGSESEDKIIEGKGSSGIEKDLNQGNQESEDSQEDQDEIEEKLAQEVIDKQ
                     KVEDKKRRREGSSARRLKRGIRHRHSTLSKPN"
     gene            <931413..>935729
                     /locus_tag="FOA43_003656"
                     /db_xref="GeneID:62197056"
     mRNA            <931413..>935729
                     /locus_tag="FOA43_003656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923907.1"
                     /db_xref="GeneID:62197056"
     CDS             931413..935729
                     /locus_tag="FOA43_003656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779835.1"
                     /db_xref="GeneID:62197056"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF05773"
                     /db_xref="PFAM:PF07717"
                     /translation="MGHKIRSQSSAPSKKTKNDKKEEPEKPDENSRAAKQEARKQARE
                     IRQQGRTIVAQSNSWTGKLPGSLLHEYCQKQKWNKVQYDMHKQKDGFVATAVLSWKNP
                     KTQEVITVKIHPPTSLVKPQETPIEARHYAATFALHSIAFDKNIHMVLPSNHKALWRE
                     LEDARKEMVKQNPYKAKLKFTSNPFAAVLEKRKEDEQRARERHSIEAEEKKIKKPTIV
                     IGNGNHVNNSDETNTGHRISNQLRKESSVRFPRKVWQNAVMMDLEPRTRVLIDDAIRH
                     HIDWSEGDENGNKQVDYVLILEEIGFRKSHVEEALQYTSTFADSLEWLIFHVPEDDLP
                     PVFAKNDEDSHVRLKITKNIKKEHQIETLCQGSCSRNEASTALDTCDGNIVKAAVKLT
                     NRLVEFKSIEKCQSSEESWNEERESLNAIFANRVLDSLGHADDAYEILLEPEGFLQSG
                     GKHMLSLRAYRSDNYPCDICGLQVVVKDPSYRLPKYINMSILTQLLKFIMKSDLTGMP
                     YLYSCIDWLESNISCIIADPGPLYDLSSRNNAVSIRRTDSSTAIDSSSSQSHTRHKGR
                     GNGQRSDKLLSSMKEMYAKRAVSRELKDSLSKRAALPAWKKMKELVNTIQSNRASIVT
                     GETGSGKSTQIVQFILDALCQSGDFSTNIICTQPRRISAIGLAERVSAERVSKCGEEV
                     GYIIRGENRASRSTRISFVTTGVLLRMIQSIYAVSENTDKGFFEHVGYIFVDEVHERS
                     IDSDFLLIILKKILHKFPHLHVVLMSATIDLKTFEGFFKTKNAVSGPAHVHISGRMFP
                     IQDFYLDTILPELNFTVKTPRDEIIKPRADSRYFQDGNINYDLLTLLVRYVDKQLTNV
                     GSDGSILVFLPGVMEITKCLNKINDTGSFWGLALHSGVSSADQRKVFNRAPLGKRKIV
                     ASTNIAETSVTIPDVVAVIDTGRVKSIRYDVTSDTTKLVESWSSRAEIAQRRGRAGRV
                     REGLCYRLFTHDTEENTMLAQPIPEIKRTPLGAVYLVVKAMGISDVYRFLLDGLDPPR
                     RENVENAKQTLTEVGALRNDKLTALGKYLSMLPTDIKSGKILIFSTLFGCVESGLTLA
                     SVGVTNSPFLRSREVRDQVKIAQNKFSHGEGDLMAILNAFNAYSELTTSAQKRHFIED
                     NYLSRNALRDIQSTRSQYMADLEDLGFLPMGYSKHEDKFPVFNRNSQNFAILRAISTA
                     ALYPHIARVEPPDPKYLSSGFGSIVMDPDVRKIKYWIRNEEYIKKRLEGRDARDDNLL
                     PATRAFLHPSSTFFSFSGFSEEVSQNDIKMDSDGNYVYAPTIPNAGGSSVSSSPLSAS
                     FIAYDSSQTTTKLYLHGATPTSVLALLLFDGDISYDLSSTSSGRPSPGIVMDSWLPIR
                     TWCKNAVMIMKLRRLLDKFLDKRLSTPLYGEQNEENIDDEGILSSDIMTTIERVLSIE
                     RR"
     gene            complement(<935783..>937654)
                     /locus_tag="FOA43_003657"
                     /db_xref="GeneID:62197057"
     mRNA            complement(<935783..>937654)
                     /locus_tag="FOA43_003657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923908.1"
                     /db_xref="GeneID:62197057"
     CDS             complement(935783..937654)
                     /locus_tag="FOA43_003657"
                     /note="BUSCO:EOG09340DDR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779836.1"
                     /db_xref="GeneID:62197057"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR036317"
                     /translation="MMYSIPIDVKIVSDIFGSPYHEEVDQDDPSSDYAVVLDWLSEQI
                     NPDFTQMVEVPLRVKNSLRTIGSCNDWMFDKFSGMIRRKLNTLSEDEGSLVGYEWLEI
                     LLRHISNLSELLHRTYEIVGLNSTQERLMERLEDTVFQSWVNKSTVLQAIKRVYEDNL
                     FSDDTTTSHSLVKLAGLLNKIDLDSELTLLLLDTAHSRIKMFVNDICAHSWNKPRLSR
                     LLSWVKDELFPRMDRLVPDDEFSAVCLVEIAKIELAKLRTDEIFDIVIDYPDSKCALE
                     EVRLCLGTAEQQSRLVESFIFQSKKRLLHAGTDSTDIISCYISAIRSFLIIDHRGVLL
                     DKACRPIRNYLKSRKDTVQRIVYALLNTSPENKLIELAIELRNSNNRSMAHNETERVL
                     EWVPDPVDALPDFRKGVVEDIVESLISIFESKDLFVEEFVKVFSERLLQVTNYDVRDI
                     YNDMHLLKSRFGNQEFNSLDVMLKDMLQSKSIDRKLKGKAPDNVHASIISHLYWPKLP
                     KYSFKLPEEVNAAYVGYQKAYEAHKRGRKLLICPSLSKVNLSLEIKGTSHKFLVTADK
                     AAIIYFFQEQPPKSRVKLGLLCMRLQLPLKLAKEGLKYWTSQAVLSECGLNEYRVNE"
     gene            <937830..>938627
                     /locus_tag="FOA43_003658"
                     /db_xref="GeneID:62197058"
     mRNA            <937830..>938627
                     /locus_tag="FOA43_003658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923909.1"
                     /db_xref="GeneID:62197058"
     CDS             937830..938627
                     /locus_tag="FOA43_003658"
                     /note="BUSCO:EOG0934323B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779837.1"
                     /db_xref="GeneID:62197058"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="PFAM:PF03556"
                     /db_xref="PFAM:PF14555"
                     /translation="MARPASVRQFLEVSGISSSEVATFFLDRNNGRLAESINDFFSNP
                     RVVQEVEKRTKKNSKKSMKSVSTELKELFNKYKEPQLDSTGKSYIGIDGTMRYLEDLG
                     YEPEDEVVLCLADFLDSQKVGDFKEEQFLTNWNNVGCNTIEQMHNYIDINLRPKLLDD
                     PEYFRAIYQYTFKFILEKNEKTLPLDMAQEYWHLLLPGEFSLELETFIKFLHDTSKTE
                     ITRDQWNMLLPFLQDYHNDPTLNGYDESQSWPLLMDKFYEYIKSDEH"
     gene            <939044..>941920
                     /locus_tag="FOA43_003659"
                     /db_xref="GeneID:62197059"
     mRNA            <939044..>941920
                     /locus_tag="FOA43_003659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923910.1"
                     /db_xref="GeneID:62197059"
     CDS             939044..941920
                     /locus_tag="FOA43_003659"
                     /note="BUSCO:EOG09340CD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779838.1"
                     /db_xref="GeneID:62197059"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF04003"
                     /db_xref="PFAM:PF12894"
                     /translation="MVKSYTRYELANTLGVIASHSNSIYIAPNLEINKKSAGKVITAG
                     LEEILVWNIKAGELLERLRDGVVPGALNSATQSPPAQVNSLAYEPVSNVLAAGYSDGS
                     IKIWDLTSRSVIINFEGHRSAVTVLKFDRSGARLISGSRDTTIILWDLVGETGLFKLK
                     GHRDLITGIEFLSDVDKTGTDDLDDWLLTTAKDGLIKLWDLKSQQCIETHMAHSGECW
                     SLALNTTKEMCITCGMENQVKIWKIDLSQDNTKIIEQGVFEKQSKRRGTKLGFKMTTQ
                     GEFFYISNADKMLELFRLRDEKEIAKGTTRRTKRLKEKGVTDEEIKSSLEQSKIQMLV
                     APFTTLYMDRAKIRDVAWGLTNNRKLDVVVTLTNNTIEYYNVAVPESVRKHKVGDHVS
                     QLKYSLDQLGHRHDIRAVDISDDDTLLVTGSNNQLKVWNTKRSTCIRTFDKVGYVISA
                     KFLPGGALVVIGTKEGHLQLLDLASSTVVDSIDDAHNGKAIWSIDLTPDGKTIVTGST
                     DKTVKFWEIKVDQELIPGTTDKFIKLLHLKHTRTLELTDDVLCVRISPDCKYLAVSLM
                     DNTVKVFFYDTLKFFLSLYGHKLPVLSIDISFDSKTIITSSADKNIRIWGLDFGDCHR
                     SIFGHQDSIMAVRFFPESKDFVSCSKDGMVKCWDGVKFENIQKLAAHQSEVLNLAVSH
                     SGEFFVTVSHDTSIRIWKQTDDQVFIEEEREREMDETYENDLLNSLEGSNGDEIGKKN
                     VDDEEASDEDNVERVTKHTMENLKAGEKLMEVLDFGWKEVEARREYEAQKRMFKQGKL
                     SSKPIMPQSNPLLLALKVTPEQYVLETLSKIRSAQLEDALLVLPFSYTVKLLRFIRIW
                     TNPEVRAKNGAQIPRICKALFFAVRTNNMELISQKDPEIRMEVIELKDQLRHILKDRC
                     DDLGFSIAGLKYMQDQWKQNHSHVFEDPETNNEKSRKRVYTTLA"
     gene            <942900..>944609
                     /gene="HSP60"
                     /locus_tag="FOA43_003660"
                     /db_xref="GeneID:62197060"
     mRNA            <942900..>944609
                     /gene="HSP60"
                     /locus_tag="FOA43_003660"
                     /product="chaperonin"
                     /transcript_id="XM_038923911.1"
                     /db_xref="GeneID:62197060"
     CDS             942900..944609
                     /gene="HSP60"
                     /locus_tag="FOA43_003660"
                     /note="BUSCO:EOG09341CKN"
                     /codon_start=1
                     /product="chaperonin"
                     /protein_id="XP_038779839.1"
                     /db_xref="GeneID:62197060"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="PFAM:PF00118"
                     /translation="MLRFVRPQLKKSVAFMVRNYSHKELKFGVEGRAALLKGVEIMAR
                     AVSVTLGPKGRNVLIEQPFGAPKITKDGVTVAKSINLKDRFENLGAKLLQDVASKTNE
                     SAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQAAVNAVIKYLEKNRKELTTS
                     EEIAQVATISANGDTHIGQLLASAMEKVGKEGVITVKEGKTLEDELEVTEGMRFDRGY
                     ISPYFITDTKSGKIEFENPLILLSEKKISSIQDILPSLELSSKMRRPLMVVAEDIDGE
                     ALAACILNKLRGQVQVVCVKAPGFGDNRKNILGDVAVLTGSTVFTEELDLKPENATPE
                     QLGSCGSVTITKEDTVILNGVGSKESIAQRCEQIRGAVEDKATTEYEKEKLHERLAKL
                     SGGVAVIKVGGSSEIEVSEKKDRYDDALCATRAAVEEGILPGGGTALVKASRILKDLK
                     AENFDQKLGIKIVEAAITKPAKIIVENAGEEGSVVVGKLLDEYGDQFNLGYDSAKNEY
                     VDMLEAGIIDPFKVVKNGLVDASGVASLLATTECAIVDAPEPKSAAPNPGMGGGMGGM
                     GGF"
     gene            <944873..>946132
                     /locus_tag="FOA43_003661"
                     /db_xref="GeneID:62197061"
     mRNA            <944873..>946132
                     /locus_tag="FOA43_003661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923912.1"
                     /db_xref="GeneID:62197061"
     CDS             944873..946132
                     /locus_tag="FOA43_003661"
                     /note="BUSCO:EOG093431P2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779840.1"
                     /db_xref="GeneID:62197061"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR018460"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF02487"
                     /translation="MSSVQIFSSFWLFGLINNVLYVVILSAAVDLVGPTAPKAIVLMA
                     DVLPSFICKLTAPFYIQIIPYHVRIWILAGLSGTGMLIISLVDSLTLSLCGIVLASVS
                     SGLGEITFLQLTHYYTDISLHGWSSGTGGAGLIGSFVFMLLTTIIGISPRTTLLIFSI
                     VPCVLVAAFFLMLPSRSRLVRNCPASNEEIQHIFCPTVPIGSTQDISPDALPIIRGEA
                     EDGAEEMTKYEHRTFKDHILVTVERIKPYFVPYMGPLFTVYMAEYIINQGISPTLLFP
                     LKDMPFAHFRDAYVTYSTLYQTGVFISRSSGALVKLDHLYIPSLLQVVNLLACVLQSM
                     FMWLPNIYLVFLLVFYEGLLGGLSYVNTFRAVAERTDISEREFAMGCVGMSDSGGIVV
                     AAIFSMFLEPSLCSYQVSNGRPWCSLQ"
     gene            complement(<946189..>948297)
                     /locus_tag="FOA43_003662"
                     /db_xref="GeneID:62197062"
     mRNA            complement(<946189..>948297)
                     /locus_tag="FOA43_003662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923913.1"
                     /db_xref="GeneID:62197062"
     CDS             complement(946189..948297)
                     /locus_tag="FOA43_003662"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779841.1"
                     /db_xref="GeneID:62197062"
                     /db_xref="InterPro:IPR013745"
                     /translation="MNSYRRACSDSVGSSASRDSQKSRHMYSFRRMSGMFHHTPHSQA
                     TNPHNSEEGRRMYNLNDTTSSIAESSISEDYDDVSTLGTIPRTSGRSRAATDVEFNNV
                     RSVNKDPNHTLTSLPSVSSLNLFRAHSGDSSIDSADTYSTLRGRERKLGKFFPRKSAE
                     KNQTPSGADDDSFRYSKVPLENSYEGTTAPSSNKVFLPLKTAPTTSGGFASKLKRHDN
                     LSIQTSLLPSSNRDMKSPLVRTSKELERIAGYSDAVAADRYSMANSTSLPPKSWTKYR
                     SHHYLLHPRKDSLKSSSNSNSKLSLDGGREALYSFHPSAVNTSLSTSDMHSVLQELQQ
                     LNLDGNSKKNTANDVSTLAEDKDAIGDEAWAIFCSLVKPIFHGGRLKAPVEEINKLVY
                     LYMKLCSGSSSYDSNDNVNSSTNEITDVSPTTSAFSPLTAPVPILSSTYSMNTSPATS
                     SMKTITPTLTGFGRYGKIEEKITNFLRVGMSTLMNLLYYDERERTVKLRSINEDSPSK
                     RARNHSNSLGNSPNTAVFSTNINFEKSCSLLWDTFYDKIFFYLQGVFLPLESGAALFD
                     DLSIQFPTVPTNIPVSNIALASFRDNLVIPLYEMNRHSETEKERREHDSMISSINILN
                     TNSSLSSPIGENTHADVDGSGSANDEAMKESYSVNLTLLQCFTILNGVQTNDTNQKII
                     ENLMQQTREKCLIYESAVKV"
     gene            <948487..>950604
                     /locus_tag="FOA43_003663"
                     /db_xref="GeneID:62197063"
     mRNA            <948487..>950604
                     /locus_tag="FOA43_003663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923914.1"
                     /db_xref="GeneID:62197063"
     CDS             948487..950604
                     /locus_tag="FOA43_003663"
                     /note="BUSCO:EOG09341TGO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779842.1"
                     /db_xref="GeneID:62197063"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="PFAM:PF19036"
                     /db_xref="PFAM:PF19037"
                     /db_xref="PFAM:PF19038"
                     /translation="MPSPILLHEDYISEPNYEAGDSESAHLSEPTIKRKTSRISIVAH
                     GLIPVDLLTKASPTASINMDNVQDVAFSNRESSESMASRSANSSSLSASVTPHIRLHD
                     EADGNEINTMSLDKSTDGPDSFLSNGSLSRVLSPLVNDTRSNYNMAAPSIFSEGIDSR
                     DGSANVLDQSSLADLGFKIENTDTSSDEELFFSRRKHFFILSCAGKPIYSMHGSEDII
                     TVYAGLIQTIISFFEYGSDGFSETLKSVVADGPQKGQQIRFLFLNKSPILLMACSTLG
                     ESDTQLNQQLDFLYNFLLATLSKPHIDKVFQRRENFDLRNVLGKTDIACLDAICNDLA
                     NFNNSGLILGGLECLRLHKTTRNKIDDILLKNKTESLLYGLLVAPGGRLVSVLRPKRH
                     TLHTSDMQLLFSMIFNTNTFKSSVSGIDRTDDGISNGNSTENLTLSHNEDFWVPVCLP
                     KFNPNGFLYAFIQFVELKDERLMKLHDLNLGILDEAEEQDVPTQLTIIMISASKETFF
                     EMRKASNIIVQDLKLSRAVYRELYKSIVGTQGADGSTGLPSGRVSPIDIPAPLVKHFV
                     FKSKRYTQYVYSRLQGNKEELKLEDNKQLKGQLMMIYAYLQSKRSSSVRIGGANIGLN
                     DDAQEDSAIDFLRENYMDMIKWKAGTDFLTGILITTPAYEVFLINNGGIVNKKIIVDS
                     CKRIIRWCRRNEGRLFIKSGAVF"
     gene            complement(<950633..>951094)
                     /locus_tag="FOA43_003664"
                     /db_xref="GeneID:62197064"
     mRNA            complement(<950633..>951094)
                     /locus_tag="FOA43_003664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923915.1"
                     /db_xref="GeneID:62197064"
     CDS             complement(950633..951094)
                     /locus_tag="FOA43_003664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779843.1"
                     /db_xref="GeneID:62197064"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="PFAM:PF03006"
                     /translation="MVGIIYYGYSDLPYARFFFLTLTTVLGTISMITTWNPKFKSAEW
                     RPYRAAIFVAFGLSALCPIGYGFARFEFQEAVRRCGFWYVLMEGVGYISGALLYALRI
                     PERFSPGKFDIFGHSHQFFHVLVVISAFSHFKGLVQSYTYSHIRSTLTNTL"
     gene            <952045..>953391
                     /locus_tag="FOA43_003665"
                     /db_xref="GeneID:62197065"
     mRNA            <952045..>953391
                     /locus_tag="FOA43_003665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923916.1"
                     /db_xref="GeneID:62197065"
     CDS             952045..953391
                     /locus_tag="FOA43_003665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779844.1"
                     /db_xref="GeneID:62197065"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR002494"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR037278"
                     /db_xref="InterPro:IPR038508"
                     /db_xref="PFAM:PF01412"
                     /db_xref="PFAM:PF13885"
                     /translation="MRSSQESRLLSLLNSPDNRNKCAECGSSYPTWASCNLGVFLCGK
                     CASAHRTLGDDVSVVKSLTMDEWSSTELEFMESMGNRRNHKIWNNRNEPFPYDDMDKD
                     AVIMFLRNKYVLGDFRTTPIGEDDYHLEVLDGSGRGRHRGGRSSRNRYDRYGDDYSDT
                     RNDNSSHYSLPSLYSRSSRSSRDIELKLRHRSSTREEKTRYADVARKMKFDMGFEDLE
                     LNIEALCLTRGNIEQAADLVRKDNVTHISSETPPPLPKRRDTVTNSAPVSGSTTTESK
                     SGNDSTYNWLDSDTTAKPATAPATMLQSSAASNQIYQYVDPNTGQYYYLDSNGQQYVD
                     PNQQQQLQMQQTAAVLSPYINVQQTMTGQAIRPMMGQSTMSQPMMNQPMMGQPTMGQP
                     TMSRPMMGQSTMSQPNMSQPTMVQPMMGQPNMSQPNMSQPMYSASQQAQQNQFTGF"
     gene            <955497..>957935
                     /gene="ATG1"
                     /locus_tag="FOA43_003666"
                     /db_xref="GeneID:62197066"
     mRNA            <955497..>957935
                     /gene="ATG1"
                     /locus_tag="FOA43_003666"
                     /product="Serine/threonine-protein kinase"
                     /transcript_id="XM_038923917.1"
                     /db_xref="GeneID:62197066"
     CDS             955497..957935
                     /gene="ATG1"
                     /locus_tag="FOA43_003666"
                     /note="BUSCO:EOG09340KQC"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase"
                     /protein_id="XP_038779845.1"
                     /db_xref="GeneID:62197066"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR022708"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF12063"
                     /translation="MTDLPSNKVVGNFKIGPEIGRGSFANVYKGYDRRTNQPVAVKSV
                     FRNRLKNQKLIDNLEVEISILKNLKNPHIVALLECVRTDQYFHLFMEYCSLGDLSYFI
                     KQRDQLAERHPLVRSILQRYPSPPNSHGMNEVLVINFIKQLASALKFLRSQNLVHRDI
                     KPQNLLLCPPTHSKEQFETKGYAGLWELPILKIADFGFARFLPSTSMAETLCGSPLYM
                     APEILRYEKYNAKADLWSVGAVIYEMAVGKPPFRAANHVELLKKIENAKDQISFPASA
                     QVPQEIMRLICSLLKADPTERMGFAEFFDDPLVVCEVKRTDEPLTCALDDEHLFISEY
                     LPKKSVTKKNIITTAVPETIKEEPVATTKVAIHPSSPTAKDDIIKSIITKSSPPPKNI
                     KAGLKMNGKAGFSNSRRQASDNDDVIYEKDYVVVEKRTVEVNALADELNEAGSGVTAI
                     SPNDDKYLSSAHRYSSSSRSSSNASSHRKPSFSDRKTPLSISPTNALSKALGYTSSRL
                     FGSDHQAVPRRRSSQEPQSSEQQQQRAVSAARIFEEKMLNPSGGSLGKQQQPPLRPIH
                     STGGKVEDSDVISRLEVLGTMAHAVSLFAEVKFSQLIPMPPSTGSLDRVSPKSSVNNV
                     DIDPLPPFMVKSISEEGVALYVKTLSLLAQAMSVASEWWHQNAVRLTASPRLNELVQW
                     IRLRFNESLEKAEFLRLKLAYASERISVDDPRQKDSVVAEKLIFDRALEMSRSAAMNE
                     LKNQDFYGCELSYATAIWMLEALLNNKENLSSSKSLEKLDSEDRKTVELFIDSIGNRL
                     KVLRQKIELQNAKG"
     gene            complement(<958126..>959310)
                     /locus_tag="FOA43_003667"
                     /db_xref="GeneID:62197067"
     mRNA            complement(<958126..>959310)
                     /locus_tag="FOA43_003667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923918.1"
                     /db_xref="GeneID:62197067"
     CDS             complement(958126..959310)
                     /locus_tag="FOA43_003667"
                     /note="CAZy:GT15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779846.1"
                     /db_xref="GeneID:62197067"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF01793"
                     /translation="MRSRRALLVLITLLVSATILGAFRLVPIDSFALRTRTKIVVEDA
                     VYFNKDKPQEVQRENATLFSLVRNEELDGMLSSINYVETRFNKDYNYDWVFMNDQPFS
                     EQFKTNISSAVSGRAIFYRIPEQYWEIPSWIDKAKMEKSMDFLANEGVLYARKVSYRQ
                     MCRFNSGFFYKMPIMDNYQYYWRVEPYIRFECDIPFDPFQMMRTNDYVYGFAMALLED
                     KKTIRKLWSTSLEFFETEHPEYVSKSNSLKFVTHDSDDNTFGSRFYNLCHYWTNFEIA
                     NLDFYRTAKYESYFRYLDKTGDFFYERWGDAPVHTLALSFMEPFDRIHYFANTGYFHN
                     PNVDCPQDPDIYDKLHCTCRPAQSFSPLPWSCSHRFLLADEAEKAEVAKDNQRSTVVN
                     GE"
     gene            <959730..>962093
                     /locus_tag="FOA43_003668"
                     /db_xref="GeneID:62197068"
     mRNA            <959730..>962093
                     /locus_tag="FOA43_003668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923919.1"
                     /db_xref="GeneID:62197068"
     CDS             959730..962093
                     /locus_tag="FOA43_003668"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779847.1"
                     /db_xref="GeneID:62197068"
                     /db_xref="InterPro:IPR011043"
                     /translation="MKLSRLVCLWSLVSTEVFGTSDIQDTVYNYEKSIAYIHIQDSSI
                     SNDTIIPLPFNAKYTSGSLVNSTFSTPGNSCELISANSSLYSVCSSDSSDIELFLLNA
                     TSQKWTELQLGDSVPLFEGSSYMNTFDDPLSLYIFGGYDSDNEEISDRMLRVDLDKLT
                     VSNFSTSVKPSSFYGASSLKINFNTELLVGGKVSSGWIGMTQLALWQYGSWAFKSVSI
                     PEDDVINARVQPLLLPVFDSTRYQLETTSSNFSSFSVDSVMMLGGQLMGNSSNPDFVS
                     LNMSDNSWQWTPLDTDVSLSNSRVNSKYDDNLSLDEILGAATLYDTLIVIADNAGKPV
                     NSSQTETNTVSKRSQSYYIKLYDTSTLEALNTVDYSSLASTGKKKSSKETSKSAVIAL
                     STIIPILVIIIAAVIGFLLYKRYKKRKEEEANEKEIKDIMEFYKSSGNQFSSSYSSLG
                     SDITEKARASEESTLDGDAEENDVDSDIIEINNYDDNDNLSITSWRRKRKLYEKQRKT
                     RLRSGGGSLMRHISIMSSQLGMSLRRSFSYQSSVATELSTVPDSGYQDDFSDNGLPES
                     PIRRPSSTYSPSLKHNQSNSALYLIPEDSSVSPLRSSHRFKSPVSGTPEGSPGILPTQ
                     QLEEHRQQKELSSVARQLRFNAPSKQGSRSMSRSTSRQSRPTSRSSSRPSSPSKFWRK
                     YDPFTQISDNKKEPDENMDVQILVSSKRRSKLRVTNPDLDDDLGDIDEFAVVKNESEA
                     RDASMEALKGETQQDSVEATASSVSDSDVRLRHVSDESKSKDESSYK"
     gene            complement(<962185..>963309)
                     /gene="ARO2"
                     /locus_tag="FOA43_003669"
                     /db_xref="GeneID:62197069"
     mRNA            complement(<962185..>963309)
                     /gene="ARO2"
                     /locus_tag="FOA43_003669"
                     /product="bifunctional chorismate synthase/riboflavin
                     reductase [NAD(P)H] aro2"
                     /transcript_id="XM_038923920.1"
                     /db_xref="GeneID:62197069"
     CDS             complement(962185..963309)
                     /gene="ARO2"
                     /locus_tag="FOA43_003669"
                     /note="BUSCO:EOG09342629"
                     /codon_start=1
                     /product="bifunctional chorismate synthase/riboflavin
                     reductase [NAD(P)H] aro2"
                     /protein_id="XP_038779848.1"
                     /db_xref="GeneID:62197069"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="InterPro:IPR035904"
                     /db_xref="PFAM:PF01264"
                     /translation="MSTFGTLFKVTTYGESHCKSVGCIVDGVPPNMSLSEDDIQSQLS
                     RRRPGQSKLTTQRNEKDRVQIQSGTEFGKTLGTPIGMIVLNQDQHPKDYSEMDNYPRP
                     SHADYTYIEKYGIKASSGGGRASARETIGRVAAGAIAEKLLKQVNNVEIVAFVSGVGK
                     CQLDRSSQNPEFMDLLQNITRDQVDAGGPIRCPIPDKASEMTKIVEHYKSQNDSIGGI
                     VTCVVRNVPVGLGEPAFDKLEAILAHAMLSIPATKGFEIGSGFAGTVIPGSEHNDPFI
                     MKGGHLGTKTNNSGGTQGGISNGENIYFSVAFKSPATISKPQDTATYDGEKGVLTAKG
                     RHDPNVVPRAIPIVEAMTALTLADAYLIQKSRASTFGVVH"
     gene            complement(<963555..>965813)
                     /locus_tag="FOA43_003670"
                     /db_xref="GeneID:62197070"
     mRNA            complement(<963555..>965813)
                     /locus_tag="FOA43_003670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923921.1"
                     /db_xref="GeneID:62197070"
     CDS             complement(963555..965813)
                     /locus_tag="FOA43_003670"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779849.1"
                     /db_xref="GeneID:62197070"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="PFAM:PF09402"
                     /db_xref="PFAM:PF12949"
                     /translation="MPDDLEKYLDPEFDPHDLRVLDLRQLLKEYDVSYTHKAKKAQLV
                     TIFREEVLPKMDAKQKLAKRKTKTNNIERSSRKSTHRSQPRKLHPSPKQQHGSQSPSK
                     ESRKRLQQLLESQRSPSKIRQHLEIKNNPLKSVMQKTIPSKRSLKTSGDDEYDGKTSV
                     YEGYSRILKKPTNRKNDFSSSPSASSPRNDTLFPRDKRIKFEKTPEEKDEKTIPTRTK
                     SRSLVTDSKFKPKKLTFEEDDLADITPHRDHSLSDSSRSSVVYRPNVSPSSSSVGYIT
                     AINELPEKHISSSPVVPFIPLLPSSTPMHPRTKVVSRKMGSHNDVSTKLLKEARNGEY
                     KVISGPRTILKDVASGDDDSSSLRERIHTPEISSSEEEDETMLKQLQAEFDSETSRVE
                     EESKKVMKSIDHNKHVSFAFNRTVYKLISYLLVVLLSFMAFTVYREERIAVGFCGHSN
                     YRPIFHVDLKAHPLLAEYVNAVEEALKLECIPCPEHGICFDNSELHCKNDYTVQKPWY
                     SLFGLIPCFDKCVLDSEKVAKIDRIVKSACDALAKRNANLRCGTGSNEEVGLSFESLQ
                     HYLVEKLALETEVQSGEFEYLWNKSLAILKEKPELAFNNDDTFVRSNSLAKLTIKCKL
                     KRVFVDMLLRLRYWLLGIVAVSAIVGYIYLRISWFQQERKLVKELTSKTLNRLQEQAT
                     AYRHEEVKHKYIGKIQLRDYYLSDPSINQKKRLEIWEKVAKVVEKNSNVNAYSLEVNG
                     EIMKAWEWASDI"
     gene            <967883..>969586
                     /locus_tag="FOA43_003671"
                     /db_xref="GeneID:62197071"
     mRNA            <967883..>969586
                     /locus_tag="FOA43_003671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923922.1"
                     /db_xref="GeneID:62197071"
     CDS             967883..969586
                     /locus_tag="FOA43_003671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779850.1"
                     /db_xref="GeneID:62197071"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="PFAM:PF00205"
                     /db_xref="PFAM:PF02775"
                     /db_xref="PFAM:PF02776"
                     /translation="MSTITLATYIFTRLKQVGVDTIFGVPGDFNLSFLDYIDEVDGLR
                     WAGNANELNSAYSADGYSRIKGFAALCTTFGVGELSATNGIAGAYAEHVGLIHIVGAP
                     TVSAEENKLLLHHTLANGKFDIFKNMSKHITAKAVTLDDIATAPGIIDDLIRTGYIYK
                     RPVYLAVPSNFSEAQVPASLLNKRIDLALPANDKESEKEFVDEVVEKIINAKNPCILV
                     DACASRHNVKASIEALVKATKFPVYVTPMGKSSFNEDNERFSGVYVGALSKLDVRESL
                     ENSDLILSIGGLLSDYNTGAFTYHYHTTNVIEFHSDFCKVKAAVYQGIQMQAALGKIL
                     QGLKQAHLNYVPTPIPASVKEYKAVQKVTSGPLTQQFLWSKLSYFLRSGDIVVAETGT
                     SSFGILQAHYPEGVTAISQVLWGSIGYALPAAVGAAFAADDIRDEQRVILFIGDGSLQ
                     LTVQAISDACRQHLHPYLFVLNNNGYTIEKMIHGLHAEYNNIQTWDHTKLLELFHDKE
                     KFQNYRVSTVEEMNKLYADKEFNVPSKIRMIELMLDEFDAPKNLIEQAKLSERINSGK
                     N"
     gene            complement(<969744..>970883)
                     /locus_tag="FOA43_003672"
                     /db_xref="GeneID:62197072"
     mRNA            complement(<969744..>970883)
                     /locus_tag="FOA43_003672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923923.1"
                     /db_xref="GeneID:62197072"
     CDS             complement(969744..970883)
                     /locus_tag="FOA43_003672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779851.1"
                     /db_xref="GeneID:62197072"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF16912"
                     /translation="MKGLLYYNRGDLRFSEEVPEPKVVNDNDVKIKVAYCGICGTDLH
                     EYLEGPIFFPKAGKKDKISGFELPLCPGHEMSGVVVEVGDKVTHVKKGDHVVIEATSH
                     CSDKARYKETMKQGLPFCSACKAGKPNICKDLNFLGLGTGSGGFGQYVVYGSDHVLKL
                     PEFVPLDTAALVEPISVAWHAVEQANFKPGQTALVIGGGPIGLASILALKGHKASRIV
                     CSEPALMRRQFAERLGAEVFNPMEHKDTVGDLKALVPETEGFDAAFDCSGIPITFQTS
                     IDALGHGGIAVNVAIWADKPIQYNPMSLTYQEKLATGSMGYVVKDFAEVIEAIANGLI
                     PLESVRVLITGKVSAQDTVEKGFNELINHKESNVKILVTPNGEQL"
     gene            <972103..>974775
                     /locus_tag="FOA43_003673"
                     /db_xref="GeneID:62197073"
     mRNA            <972103..>974775
                     /locus_tag="FOA43_003673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923924.1"
                     /db_xref="GeneID:62197073"
     CDS             972103..974775
                     /locus_tag="FOA43_003673"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779852.1"
                     /db_xref="GeneID:62197073"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="InterPro:IPR036864"
                     /db_xref="PFAM:PF00172"
                     /translation="MPSPNIVSKTVKVNPSNEKRSSSELSDPDVHHSVKHHKKRRKYS
                     RNGCLSCKRRKIKCDEKLPMCSRCARLSLDCVYYRVYKFQSGLRSQEIDPRPIKSIQD
                     VQDSVPQQSLIQPLQFKNSLPSTQPLLLDTGQSIAFTNSSDGAAKNNSVPLNLSSSSR
                     TSMKALPPSCISSTGFALDPTSSGSTVPSSVFTPSISDNFSSQQMTSLLANQELLVGD
                     ILAADERYHSPTSGLINQAGISLDASNSQVSLGSQDSQVPVEPQAYQMSRSLYMDTNL
                     LDLSRYQDIDLQDFANSFFNNGKIKMDTRISDENTLFEYDFHSNLNKSAHDLEDSNIY
                     EAFHLSQTETVHFHSFMKNVHLILNPFAATYLSSPFMKVFLANAQKSPYLLNAMLASG
                     ARYLLEKVRSERDSILKLSDPVDSAVVKNIGRQINIHEKSRTLYLSNCFNYLKQALEN
                     PEKIFLEVESALLTSLILTADLSSYPDNRWSVHLKGAQQFLRNYAKAKRTATPAIMIA
                     KYLFSGMEISAWMFCSSASCMVNYDELNEWLPIPMNHGSLRELSRLGLVYDGYKEEVN
                     DLGASCIVPALGAFKVYVGFTDDVANVVKHIILARSQVIHSSEAVDPMMVCKIFALIE
                     KAKSFFIMTNEAPFQIPITSKFHPLYEGEDKTKAPLGGYYHILKQGLESKDSWFSYFD
                     FCNRIRIDALHLYVLVSSSFMDASPKRKLVRKLFKSAIKDVQFLIWFLGNHLSEADEK
                     MLEEYYSSFIIVTGTDGIENIDLQSDKVRMSKEKIDRICAKTLRETLDGKIHYSEFIE
                     YQIDHRICMVQWCLLIFGYCCVTAREKILIECLLMRLLQVGVRSGKFSLNILNKVWTQ
                     RRIRYKDTTGRLLKLDPGFENSFFMDHDNGFLFT"
     gene            <975012..>978095
                     /locus_tag="FOA43_003674"
                     /db_xref="GeneID:62197074"
     mRNA            join(<975012..975020,975051..>978095)
                     /locus_tag="FOA43_003674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923925.1"
                     /db_xref="GeneID:62197074"
     CDS             join(975012..975020,975051..978095)
                     /locus_tag="FOA43_003674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779853.1"
                     /db_xref="GeneID:62197074"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="InterPro:IPR031327"
                     /db_xref="InterPro:IPR033762"
                     /db_xref="PFAM:PF00493"
                     /db_xref="PFAM:PF14551"
                     /db_xref="PFAM:PF17207"
                     /db_xref="PFAM:PF17855"
                     /db_xref="PFAM:PF18263"
                     /translation="MSGGFGNSSSNILSEDSNSQHLRSSNIQSQSQATFLSSSKQNEP
                     KPTRPDEMDTDEPPQQVLRRRRDLSSIPKVADLTAEKVREAFEQFLEEYEEPVNAENI
                     TADADTTEANRKVYLHQISAMALYDLSTIYVDFQQLLTRENGILASAITEQYYRFIPY
                     LGEGLRHVIKRHEPALLRRSARVADDDINAASSTVRIFQISFYNMPSTHRLRELRAEK
                     IGTLMSISGTVTRTSEVRPELYKGAFTCDVCKTLVENVEQTFKYTEPTSCPNPNCDNQ
                     GFWTLNVPKSVFLDWQKVRIQENSGEIPTGSMPRTLDVILRGDLVDRAKPGDRCRFTG
                     TEIVVPDVSQLGLPGVKPASVRSRGFAAAADSLNPGITGLRSLGARDLSYRISFFGCH
                     VCSLTGASNGDDPGIMGNAGEEAGKSGMPITREESEREQEAFLNTLTEQEVNELKEMV
                     GDDRIYTKLVRSIAPSIYGHELIKKGLLLQQLSGVHKKTVEGIDLRGDINVCIVGDPS
                     TAKSQFLKWVNSFAPRAVYTSGKASTAAGLTASVVKDEESGEFTIEAGALMLADNGIC
                     CIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNPKHG
                     LKSNLNLSAPIMSRFDLFFVVLDECNEKIDTQLANHIVNLHMLKDDAIEPPFTKEQLL
                     RYIRYAKTFKPKMTKEARDYLVEKYKELRAADSQGFGRSSYRISVRQLESMIRLSEAI
                     ARANCTEEITPRFVAEAYDLLRQSIIRVEKDDVEIEDGEDDEEEGAEGGDKSPHGGDD
                     DDDDEDDDKNVEGKEDKSSIPKVSQPREKKNLIPYDKYVKMMNMFVRRISEKEREAES
                     TSDEPQGYNAGQLVDWYLIQMEGEINNERQYYTERKTAYKVLNRLVKDRVLMKVSPES
                     LESIDEESGIPPELRDRKELSSLEREQLQFQREEWLKKRADEKHRQMIYILHPNCAIV
                     DLMDQARDDESGIVTAGDEEVEEQDDALRSGTQENIVNEESTQAD"
     gene            complement(<978192..>980213)
                     /locus_tag="FOA43_003675"
                     /db_xref="GeneID:62197075"
     mRNA            complement(<978192..>980213)
                     /locus_tag="FOA43_003675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923926.1"
                     /db_xref="GeneID:62197075"
     CDS             complement(978192..980213)
                     /locus_tag="FOA43_003675"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779854.1"
                     /db_xref="GeneID:62197075"
                     /translation="MSLPSTYSRLGPEGRKLYAQIHSSSDQYNTAGTTFRVPGALDYL
                     FDEIVRPNATTTPAKVLSYLAYYYPKIKNPENVRLLSECFLSCPFFFGDQRVIQISDT
                     YKVIDCCRYIMDQKYRISEPTVPFYSFYRSLFNGIYNVYESNPFEESWKVQPLILGCL
                     LAIESRNDYDPYPAYTGLIKEVDEQLLGLLQRALIDTSRNPSLGMDVRYLELSYMALL
                     QEKISNGTFKIILKNQPFLPSLIIDFIFNSLYGFQGGILLEKSWSLSQATEKAPALRH
                     LNRLSKLYCKLISIHPLTVDNLNGIDLALNNIQNYSISLFATLEKRDDFIHSDKDSDT
                     WKILKQCFFSIVVMFEGICTKIYQNEDTSRSPIYSRFCRKILNSFFSIGFIIEKVGTG
                     GFEEYNFVYGISANYLNQNDVGAVELLVKVWLDNLSLDNYTIISSPFNQAKLLFCLNF
                     VEGYLNSLTEETKSSTILPLVEKLLKQGPNQDVLEGAHSVMLKYFTTLDALRSMDSQQ
                     QRRIEKLLLDYLALSFEQFPFCLSLNQLAIIVDTLANAVFPGSLIYSWDHSICLKLQQ
                     EVFSQCVKSANFDISQKNPEAVIKHRRPAITMTLILISPLFLTETFVAWLERIKTKLI
                     DPTMDTTERLYLLDKLWDSILSTNKYYPQKGALGIEWWYNRINTGDPKL"
     gene            <980723..>981325
                     /locus_tag="FOA43_003676"
                     /db_xref="GeneID:62197076"
     mRNA            <980723..>981325
                     /locus_tag="FOA43_003676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923927.1"
                     /db_xref="GeneID:62197076"
     CDS             980723..981325
                     /locus_tag="FOA43_003676"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779855.1"
                     /db_xref="GeneID:62197076"
                     /translation="MIFTTVLMFLCYTILRINIYVPSGPFGIIFGLVYPYYKFTPTLY
                     TFELDFRGIGKSSNDADDQLVHANESHKLVFTNNFVTTILVAQLFLSEGLISSPIVCL
                     TGYLISSLLFNGVLPLLHSKFVFLTTLYGRLMKKFGHSTGYHAIPNIVSTVPSVGIQS
                     HSRSISPEDVDNTTEEHDDNDQDTDMPARSLGTQLLDTFR"
     gene            complement(<981377..>981973)
                     /locus_tag="FOA43_003677"
                     /db_xref="GeneID:62197077"
     mRNA            complement(<981377..>981973)
                     /locus_tag="FOA43_003677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923928.1"
                     /db_xref="GeneID:62197077"
     CDS             complement(981377..981973)
                     /locus_tag="FOA43_003677"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09343WPY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779856.1"
                     /db_xref="GeneID:62197077"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="PFAM:PF02996"
                     /translation="MASDRLSTGKTNARGIPQAVFIKKIEEFINPKTCTDDDVSNFLK
                     ELQMRMEQYRFMEENKRTTLDNLNTKIPDIKKTLDICKYLKLKQESGETDGEEEEDEN
                     IEVNYQLNDTVYSKAVIDTKDIGSVRLWLGANIMVEYPVDEAIQMLTERLKVTGKNKD
                     NTLEDIDYLRSNITTMEVNTARVYNWDVQRRRTQKADA"
     gene            <982251..>983041
                     /gene="RPL18A"
                     /locus_tag="FOA43_003678"
                     /db_xref="GeneID:62197078"
     mRNA            join(<982251..982362,982593..>983041)
                     /gene="RPL18A"
                     /locus_tag="FOA43_003678"
                     /product="60S ribosomal protein L18A"
                     /transcript_id="XM_038923929.1"
                     /db_xref="GeneID:62197078"
     CDS             join(982251..982362,982593..983041)
                     /gene="RPL18A"
                     /locus_tag="FOA43_003678"
                     /codon_start=1
                     /product="60S ribosomal protein L18A"
                     /protein_id="XP_038779857.1"
                     /db_xref="GeneID:62197078"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="InterPro:IPR036227"
                     /db_xref="PFAM:PF17135"
                     /translation="MAVDHYSKPHKRSGHRTAPKSKNVYLASLVKLFGFLARRTDAAF
                     NRVVLRQLFLSKANRQPVSVAKIVRTLKQEDASKKIIVVVGTVTDDLRLHSFPKATVA
                     ALRFTRGARTTIEKNGGEALTLDQLATRAPTGANTLIVRGPKKAREAYRHFGMGPHQH
                     KAPRIMSKGRKFERARGRRRSRGFKV"
     gene            <983466..>984193
                     /gene="RPS19B"
                     /locus_tag="FOA43_003679"
                     /db_xref="GeneID:62197079"
     mRNA            join(<983466..983485,983752..>984193)
                     /gene="RPS19B"
                     /locus_tag="FOA43_003679"
                     /product="ribosomal protein S19B"
                     /transcript_id="XM_038923930.1"
                     /db_xref="GeneID:62197079"
     CDS             join(983466..983485,983752..984193)
                     /gene="RPS19B"
                     /locus_tag="FOA43_003679"
                     /codon_start=1
                     /product="ribosomal protein S19B"
                     /protein_id="XP_038779858.1"
                     /db_xref="GeneID:62197079"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="InterPro:IPR018277"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="InterPro:IPR038111"
                     /db_xref="PFAM:PF01090"
                     /translation="MSGVTVRDVPAQEFIDAYAQFLQRQGKLEVPAYVELVKTSASNE
                     MPPQDQEGWFYKRAASVARHVYLRKQVGVGKLNKLYGGAKNRGFRPAKHFDASGSVNR
                     RVVQALEKIGVLEASSKGGRKISENGQRDLDRIAAQTSEALVEGDDEEDEE"
     gene            complement(<984308..>985627)
                     /locus_tag="FOA43_003680"
                     /db_xref="GeneID:62197080"
     mRNA            complement(<984308..>985627)
                     /locus_tag="FOA43_003680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923931.1"
                     /db_xref="GeneID:62197080"
     CDS             complement(984308..985627)
                     /locus_tag="FOA43_003680"
                     /note="BUSCO:EOG0934241C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779859.1"
                     /db_xref="GeneID:62197080"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR016691"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF01170"
                     /translation="MKEYLIYLANAHPNFRKAELESLATLNNVRVDLSSHDESSPFMI
                     VQLEDDDAARKLVDRAVLTRGIYELWGKGNTLEELHSDVKTRYKALREPYMNSTFKFQ
                     VLDFQGARKSKRRHLQIIDSFMYLQFKGKVSLENPQQIFTILQTYTIDKDLCPRKEPD
                     YCWFGRQVHLSARSRGVVDEYEIAKRPYYGTTTFESELSLVTCNLALVQKGQLVLDPF
                     VGTGSFLLASGYFGGYTYGSDIDFLALKGGKPEQKCIKRLKDNFEHYGTENKFGDVLC
                     MDFTNNALRKNLKIDTIICDPPYGIREGLRVCGTNDIASAELTMNKIICGEKAFLRKD
                     YVPPKKTCSLDFMLDDLLKFANERLPIGGRLCFWMPAADNEDIPTLIPQHEGLELIHI
                     LVQHFNMWSRRLLVYVKRDSSYQGITVTRDQRKHKNNFREQYFNRFK"
     gene            <988108..>989662
                     /locus_tag="FOA43_003681"
                     /db_xref="GeneID:62197081"
     mRNA            join(<988108..989542,989556..>989662)
                     /locus_tag="FOA43_003681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923932.1"
                     /db_xref="GeneID:62197081"
     CDS             join(988108..989542,989556..989662)
                     /locus_tag="FOA43_003681"
                     /note="BUSCO:EOG09343OLR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779860.1"
                     /db_xref="GeneID:62197081"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PFAM:PF00076"
                     /db_xref="PFAM:PF16367"
                     /translation="MSDNIDDDEALFDDIYEDDSKTDAVKTDAKLDEKPIEKVGGITE
                     GVQNDVAPPPPPPTEQQPEQELQNQQAIPPPPPVEGDAAAAMAAANQLAQLAGQNPGY
                     GTPQQQQQMQQMQQQMQQQMQQMQQQYPQQQQQQQSGSMQYDARQGFHDKVKADMEGK
                     DVGKLFIGGLTWETDEDSLGNYFNQYGEVTELHIMRDTATGRSRGFAFLTFKDAKSVD
                     EVLKKKHILDGKLIDPKRAIPKEEQEKTGKIFVGGVAPDVSHDEFTEYFKKFGDIIDS
                     QLMIDKDTGKSRGYGFVTYDSADAVDRVTRQKYVMFHGRQMEIKKAEPRNQQAPRRQN
                     YGGYGSMGFAPQQGQQAANQYSQMGGYYNQNNMAQYWQQMQQMQQYWMQMQQMQGQQG
                     GENAEQEGENGGGSMNASSSANDNGGSSASPEPSSNFQGAAAMTTAQSQEASGPATGG
                     DNNEDDEVPNPQERAAPKLPSGPKNFHGEEAQGQEEPTTTVVVHEDEEVAGIILTDAK
                     VGVLN"
     gene            <990054..>992990
                     /locus_tag="FOA43_003682"
                     /db_xref="GeneID:62197082"
     mRNA            <990054..>992990
                     /locus_tag="FOA43_003682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923933.1"
                     /db_xref="GeneID:62197082"
     CDS             990054..992990
                     /locus_tag="FOA43_003682"
                     /note="BUSCO:EOG09340XO6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779861.1"
                     /db_xref="GeneID:62197082"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF08147"
                     /translation="MSDSDSGTEDIASSLVTKSNPLLNNDADSSDEEGLSTNENYEVQ
                     DEIIPSSDEEKKEPEQKKQKNKRIKTSKPAIVSFPVLEATEEGDDMDKEDRDDSRFIL
                     SVKQQVARSKAKSKGTFASFGISRQVLNNIKRKGYRIPTPIQRKTIPLIMGDRDVVGM
                     ARTGSGKTAAFLLPLVEKLKQHSQKIGIRAVVLSPTRELASQTYKQLNEFARGVDLRI
                     LLLVGGDSLEDQFGAMVNNPDVVVATPGRFLHLKVEMRLNLRSVEYIVYDEADRLFEM
                     GFSEQLNELLASLSDRRQSLLFSATLPRNLVDFAKAGLTNPVLVRLDAESKISENLQM
                     CFVSSKKNERDANLLFILEEIIKMPSASKKQLEDLRKLTAWDGEGVDYDESDGDDFNK
                     KRSRNHSFKVKSARANELPSKHATIVFVPTRHHVDFVTKLLESSGFCVAYIYGSLDQH
                     ARKRQLLAFRSGICSILVVTDVAARGIDIPILANVVNYSFPTSSKLFVHRVGRTARAG
                     NSGWAYSIISEAELPYLLDLEVFLGRKVLLTTMQEKKIEILKHRWGEKHSGVLDEFSE
                     PKVSYTSRLVLGSGPRVDVEEKQEIFDTIMKSHYDMTVQRNVCERAEKMIKRTRQPAS
                     ADAVRRAKEMLVFGWDEQNLLFGKNQEKEKDILLAQFQNRRHKETVFEFAGADDYLVD
                     LMAKRRREIAPIQKRAKKKRELLEQERMMGLTHRLEDEIERNKEGKDKDEAMEVGFDV
                     KEEELMNNFQDADQLEEEQKISKRQKRRALGQSSYRDPNFYLSHYAPTSSIQEQQLSV
                     GGGFVNQVQDAAFEINGDDGKSKTGQKQNIVWDKKKKKYVKNQDNKRYIMGENGQKIP
                     ASFRSGKFDEWKEKNKIDDFRVGSMETATTASSTEPLSGRKVHGRYMHKQQRAPRLPD
                     RARDDYTKQVEKVKNATARGISVKGWRAKGVAENELKSTEDIRKQRELKDKRKAKNAR
                     PSRKRY"
     gene            <993706..>994942
                     /locus_tag="FOA43_003683"
                     /db_xref="GeneID:62197083"
     mRNA            join(<993706..993711,994436..>994942)
                     /locus_tag="FOA43_003683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923934.1"
                     /db_xref="GeneID:62197083"
     CDS             join(993706..993711,994436..994942)
                     /locus_tag="FOA43_003683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779862.1"
                     /db_xref="GeneID:62197083"
                     /translation="MQASKLLPESASDVQQRLNMLQLDVNKLMVQLSTSSLIPDESKE
                     VVCQKVLTILQETLNAHNNYSSDSANRYRTSSPTSTTNSPAHNTSLNYLYANSDVNSG
                     NKEKNGTAVTVPGSISTGYKGLGSSIVCGTNRILLPALGSNLQPTSSGIGINVNANYG
                     AYNRMYWDNK"
     gene            complement(<995068..>995409)
                     /gene="RPB9"
                     /locus_tag="FOA43_003684"
                     /db_xref="GeneID:62197084"
     mRNA            complement(<995068..>995409)
                     /gene="RPB9"
                     /locus_tag="FOA43_003684"
                     /product="DNA-directed RNA polymerase II core subunit
                     rpb9"
                     /transcript_id="XM_038923935.1"
                     /db_xref="GeneID:62197084"
     CDS             complement(995068..995409)
                     /gene="RPB9"
                     /locus_tag="FOA43_003684"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II core subunit
                     rpb9"
                     /protein_id="XP_038779863.1"
                     /db_xref="GeneID:62197084"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="InterPro:IPR034012"
                     /db_xref="PFAM:PF01096"
                     /db_xref="PFAM:PF02150"
                     /translation="MSFRFCAECNNMLYPREDKEHKRLLYQCRNCSYSELADSPRVYR
                     HELITHIGETAGVVEDIGSDPTLPRSQKTCPKCSNKECVFFQSQQRRRDTSMVLFYVC
                     LECKHVFRSDE"
     gene            <995698..>996273
                     /locus_tag="FOA43_003685"
                     /db_xref="GeneID:62197085"
     mRNA            <995698..>996273
                     /locus_tag="FOA43_003685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923936.1"
                     /db_xref="GeneID:62197085"
     CDS             995698..996273
                     /locus_tag="FOA43_003685"
                     /note="BUSCO:EOG0934491Q"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779864.1"
                     /db_xref="GeneID:62197085"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="InterPro:IPR036235"
                     /db_xref="PFAM:PF00542"
                     /db_xref="PFAM:PF16320"
                     /translation="MSVIFKQSIRALLRTSSGRSCMIPAVSIAIRLNSTADGAAANAS
                     TDSSSINSKKTDTPVDSKIAEIVRSISKLTLMETSALIKELKSKLDIPDIAFPVAGTA
                     GAAAPQAAEDIAKEEPKQKTIFNLKLESFDPKSKAKVIKEVKSELGLSLVKAKKLVES
                     APKILKENMSKEDAEKFKETLEKHGAKVTLE"
     gene            complement(<996734..>998038)
                     /gene="TPK2_1"
                     /locus_tag="FOA43_003686"
                     /db_xref="GeneID:62197086"
     mRNA            complement(<996734..>998038)
                     /gene="TPK2_1"
                     /locus_tag="FOA43_003686"
                     /product="cAMP-dependent protein kinase catalytic subunit"
                     /transcript_id="XM_038923937.1"
                     /db_xref="GeneID:62197086"
     CDS             complement(996734..998038)
                     /gene="TPK2_1"
                     /locus_tag="FOA43_003686"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase catalytic subunit"
                     /protein_id="XP_038779865.1"
                     /db_xref="GeneID:62197086"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF14531"
                     /translation="MEISLENQQQQEVEQRNQQPQQQQQQLVQPVQIQQTTMQYQQDA
                     PSFIPLGEESKPLTAVNTGSKGIEALTDTQRQRVEYLQRIPSYQAIIQPEYKDLQKAM
                     GSVSVLPSRPSSSKGKYTLKDFQMLRTLGTGSFGRVHLVRSVHNHRYYAIKVLKKAQV
                     IKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDSNNLFMVMDFIEGGELFSLLRKSQR
                     FPNPVAKFYAAEVTLAIEYLHSHNIIYRDLKPENILLDRNGHIKVTDFGFAKEVQTVT
                     WTLCGTPDYIAPEVITTKPYNKSVDWWSLGILIYEMLAGYTPFYDQTPMRTYEKILVG
                     KVYYPSYFHPDAVDLLTKLITSDLTRRLGNLQNGADDIRNHPWFSEVVWEKLLMKDIE
                     TPYEPPITAGVGDTSLFDRYPEEQMDYGAEGEDPYANLFTDF"
     gene            <998798..>1000303
                     /locus_tag="FOA43_003687"
                     /db_xref="GeneID:62197087"
     mRNA            <998798..>1000303
                     /locus_tag="FOA43_003687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923938.1"
                     /db_xref="GeneID:62197087"
     CDS             998798..1000303
                     /locus_tag="FOA43_003687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779866.1"
                     /db_xref="GeneID:62197087"
                     /db_xref="InterPro:IPR016650"
                     /db_xref="InterPro:IPR019010"
                     /db_xref="PFAM:PF09440"
                     /translation="MSSEQSGFQLSEEQLEIARKYDLTEKFVKFLDRHLVYTLIENLE
                     YTHDPQEVEKWEYQLLKDTYMTKFIEQKWLDLHPGESLPKEFEEKQDKINKELVSLNE
                     STKKTLEILSSQEVQENLKQDKSYNRDYLAKNHSIDDEKIFELYKFGKFQYNRGDYVM
                     ASDLLNNFRLLSTNQELNFSATWGKLAAEIISFSWTEALNELNKLREVIDNRNYQGST
                     LDQLNKRTWLIHYSLFIFFNGNFTASDAAKAEDAAKIAEEAAEAAESAAAGDSEEENE
                     AQTEVETEASAKAEEAAETNSFKKERDAKDKYKGLSTMVDLLLSSSYMSTIQASCPWI
                     LRYLIVAVLQMRQYKRLRDIVRAVDVETYEFQDPFSKLVQTLFVTCDFDNLSSIVDEI
                     SVLIETDFFISNLDGERLMLNLQELIFNTVAKIYKGITVESLGKMLNRDTSDVEKFLE
                     EQKDKVTLEEDGTISFNRQAPPSVYQQVYEKTKAFNFKANQMLNTAFNKAD"
     gene            complement(<1000424..>1001392)
                     /locus_tag="FOA43_003688"
                     /db_xref="GeneID:62197088"
     mRNA            complement(join(<1000424..1001090,1001388..>1001392))
                     /locus_tag="FOA43_003688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923939.1"
                     /db_xref="GeneID:62197088"
     CDS             complement(join(1000424..1001090,1001388..1001392))
                     /locus_tag="FOA43_003688"
                     /note="BUSCO:EOG09343W8V;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779867.1"
                     /db_xref="GeneID:62197088"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="InterPro:IPR036373"
                     /db_xref="PFAM:PF01196"
                     /translation="MLTEVSPLLFVALFIPFAMTLGRNAKMLNHTMRNLVSSLIEYES
                     VTTTMAKAKIAQGIIEDLIVKTKKSTLAKNELKSKLYGELYNQEKTVPKLMNEISERY
                     KERNGGFTRILKLEPRIGDNAPQALLELVDNGIREMRFWYIAKTVARLELQGQPLDNL
                     TQKNVKDLLLYRKNGEEEFRKTVEICKNEFFQDDEDLKNLPRMKNDTNGFHRAFHNYE
                     VVPRE"
     gene            complement(<1001623..>1002621)
                     /locus_tag="FOA43_003689"
                     /db_xref="GeneID:62197089"
     mRNA            complement(<1001623..>1002621)
                     /locus_tag="FOA43_003689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923940.1"
                     /db_xref="GeneID:62197089"
     CDS             complement(1001623..1002621)
                     /locus_tag="FOA43_003689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779868.1"
                     /db_xref="GeneID:62197089"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MKVFSNQFDVDGKVGIISGSSQGLGLAMAKQLYSKGASVILISR
                     STAKLQKAKKSILGSSVKVHKDQFVQYLAADLIDYNSASQILPLLDELKVEKPDFLIC
                     CAGAAHPQYFLNMTGKDLDFGIDTNYKTCVNLVQLVARRMVDESTSIGEGGLISDMKT
                     SMGFKSSTIRHIVLISSEVAFFSFIGYAEYAPAKAAIKAFGDAIRQELAPYNVMIHVV
                     FPGNFASEGYVEENRTKPAACKELEGPSSAISSDRCSQRIVKGLERGQVYIFTDFMGW
                     LLNSFSLGIGPRNWGIFQVFFALIGAMIGGIFDFFNQVTIFGYFRKEKGFIKDKNN"
     gene            complement(<1002787..>1003353)
                     /locus_tag="FOA43_003690"
                     /db_xref="GeneID:62197090"
     mRNA            complement(<1002787..>1003353)
                     /locus_tag="FOA43_003690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923941.1"
                     /db_xref="GeneID:62197090"
     CDS             complement(1002787..1003353)
                     /locus_tag="FOA43_003690"
                     /note="BUSCO:EOG09344D4O;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779869.1"
                     /db_xref="GeneID:62197090"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="PFAM:PF06127"
                     /translation="MSPNPPLFALEDQLALYKEYHLNPINIKIHLVCIPQILFSAFVI
                     ASYVSFSDSSKYCNLGWTAIGVYELYYLILDLEAGLIAAPFMFGIGIFSNYLHEAYPA
                     ETAFIIKFALFIHFFSWAAQFYGHFHFEGNAPAVFDNFVQPLILAPYFVIFEWMFIFG
                     HRLDLKKAIFRKAKVLLDERTKQGAKKN"
     gene            <1003590..>1004288
                     /locus_tag="FOA43_003691"
                     /db_xref="GeneID:62197091"
     mRNA            <1003590..>1004288
                     /locus_tag="FOA43_003691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923942.1"
                     /db_xref="GeneID:62197091"
     CDS             1003590..1004288
                     /locus_tag="FOA43_003691"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779870.1"
                     /db_xref="GeneID:62197091"
                     /db_xref="InterPro:IPR012917"
                     /db_xref="PFAM:PF07957"
                     /translation="MTDKETSTNNNKNGNSAEPASLQDQINQLKAQLSKQRKVLTQTA
                     EQLLSLQLQQSRQQLSAIPNPDPKSVLAAQSSRGSTTTTTTTADTTDFATNEDLVQLV
                     GELQGQLTILEKRSINRVTNSQLTEDLDAVLPMPNADGAPATDALHYPATLKDFKELS
                     ADALLDLCSFYELLPETAEEEAIMRAFMTGKIESPNVPLGQFKPKAEDYSKETISQLY
                     EELRKFIGLAYKHN"
     gene            complement(<1004307..>1005335)
                     /locus_tag="FOA43_003692"
                     /db_xref="GeneID:62197092"
     mRNA            complement(<1004307..>1005335)
                     /locus_tag="FOA43_003692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923943.1"
                     /db_xref="GeneID:62197092"
     CDS             complement(1004307..1005335)
                     /locus_tag="FOA43_003692"
                     /note="BUSCO:EOG09343C2W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779871.1"
                     /db_xref="GeneID:62197092"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="PFAM:PF01256"
                     /translation="MFKTLKTKSELIKLTKQIIPPLLPTLYKGQCGKIAIIGGCEDYT
                     GAPFFSAHAAATLGCDLTHVVCELSAATVIKSYSPDLMVHPYLRDSASLRKFKAETKA
                     EPSTAATEADFEIEYITKQVMPKINSILDRIQVVVVGPGFGRDRIMLLTLQYILEEIK
                     ARNLPVILDADALFLVSEKPEVISGYSNAILTPNIMEYKRICHTMHIKNRDNTKEVQE
                     LSKALKVTIFQKGRNDVIINGDNLIISDERGSNKRVGGQGDSLTGMISTFLAWGMSAY
                     KNKIWPESKTSQPQLDDEGIMMLACFGGSILTKTSARKAFAKYGRSMQTTDLHKYISE
                     AAKEVFNV"
     gene            <1005818..>1006690
                     /locus_tag="FOA43_003693"
                     /db_xref="GeneID:62197093"
     mRNA            <1005818..>1006690
                     /locus_tag="FOA43_003693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923944.1"
                     /db_xref="GeneID:62197093"
     CDS             1005818..1006690
                     /locus_tag="FOA43_003693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779872.1"
                     /db_xref="GeneID:62197093"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00970"
                     /translation="MSSRTSRILVSLAAVAGSYYLYSAYAAAANAKPVLAGDGKWIDL
                     KLKTVRDVTHNVKLFTFEFPDKNSTSGLVVASAILAKFVTEKGSNVVRPYTPISDIEQ
                     KGTFDLLIKRYENGKMTNHIFNLKPSETLSFKGPILKWKWEPNQFEEITLIGGGSGIT
                     PLYQLIHQVLKNKDDKTKVNLLYGNQTPDDILLKAELDTLAHSHPEQFNVQYFVDKKV
                     GSEEFNGKVGYLTKDDVKAVVKGPSPTTHVFVCGPPGLYQAVSGKKNSPSDQGEVSGI
                     LAELGYDKTQVFKF"
     gene            <1006901..>1007512
                     /locus_tag="FOA43_003694"
                     /db_xref="GeneID:62197094"
     mRNA            <1006901..>1007512
                     /locus_tag="FOA43_003694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923945.1"
                     /db_xref="GeneID:62197094"
     CDS             1006901..1007512
                     /locus_tag="FOA43_003694"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779873.1"
                     /db_xref="GeneID:62197094"
                     /translation="MVKKVSRRSRAARRGEVDPDAPQDPSVEALDTVPRLEKTDVIGS
                     MIRASVKKNSRLLGDKLNKGAKAASENEHIEIINAGIHKKDHGKQSKSVRTRRKKGVL
                     RDGRLEARIASSVDRRRHRRLVRKSDWDSVNNSAKETLAPKSIASKDDHTEMSDDEVD
                     VGEVGSGWKELIGETEESSKKEHSKSNDDHMKNAFALLDEVEA"
     gene            complement(<1007562..>1010453)
                     /locus_tag="FOA43_003695"
                     /db_xref="GeneID:62197095"
     mRNA            complement(<1007562..>1010453)
                     /locus_tag="FOA43_003695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923946.1"
                     /db_xref="GeneID:62197095"
     CDS             complement(1007562..1010453)
                     /locus_tag="FOA43_003695"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779874.1"
                     /db_xref="GeneID:62197095"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019414"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="PFAM:PF10304"
                     /db_xref="PFAM:PF10363"
                     /translation="MSETSAKKLTQDQLKELRKHLARFKKDASYKRPRNTPMAKDFGE
                     ISDYLDGYDTANDKISFLYKKLPTNEQKEHSLLICKRIAVVNRLMDYLWRIHQKSVQV
                     TRSSFISIPVYDMKTVEQLVNVMVIEGVYSCLPDGVGIPLEKRRMKNFTVPLEIHAVP
                     FTKGIPILDSIVSTLIKIFSEKSDLRDLIQVGSGFTDALTSAIVLTINPSNSKKDKEK
                     YSGYVKILEDASSTYQLFSLYTLLIAASGPSSRRNALSALFRSFVLERLSKLLVERSN
                     SGVQAMIDVVMGLRNDDNIDISRISQVVKVIVSCKPKHMDDAEYFNNICGQLYDLLVF
                     VNRPVMTTIAAAVIKSLFDKNPKIVTDFLFKRVWQAFNPELASHSPDAIVLTSEVQLN
                     NAFNVAISFSRQLISQDFSNTMFKPLIVPLWGYLIYQKKQKKDFILVEETLVSVLSLE
                     QRQDGFEMLSILVDNLYSLQGSNWQFAEGDNGLTIIKEVLSDDKAAQFENHFLSILDD
                     VDLSLELFSDLLRSLYAHDPEKLDFVFTRALKKWMVTSDDTHQLLEGDDDPVEMLMNL
                     KLVQMIVENFKDELAASPDGLLEFVMLLLSKKSTGSSSTIPLGAPDSDDEDEIDNSRQ
                     DNEAVNTALDILSTVLSVITASNSFTKNTLKLLKQLDEALSLSDEYASYGPLKDQVKI
                     LVAKSSSLETKDNIKKKEEDRLLEKAMKSINDPVPAVRIYGMQLVRQLVHPSVNKVSI
                     NFAMKMHLNQLKDEEPFVYFNAIKGMETLLSMNVKQVLPECVKIYAGIAKNPVSLDER
                     LRIGEVFVRYFEKTSSSITEETISTLLVPLMALVSKKEGNKPVDNRLRMSAMSIIGSI
                     CHNVPIPELLSPFLSDVVDLITGILTFEKGIEESVMRRSAIVVISDIITSKNGLSLLG
                     PYGARLEESLKYITENDNDVLVRNQAKEVLYIIDESFERKFEKDFSLHS"
     gene            <1010668..>1011288
                     /locus_tag="FOA43_003696"
                     /db_xref="GeneID:62197096"
     mRNA            <1010668..>1011288
                     /locus_tag="FOA43_003696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923947.1"
                     /db_xref="GeneID:62197096"
     CDS             1010668..1011288
                     /locus_tag="FOA43_003696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779875.1"
                     /db_xref="GeneID:62197096"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /db_xref="PFAM:PF13857"
                     /translation="MGKLTTLTQDEMDNVIFDARFGDLDSLRTVFTDEVEPSILPKIQ
                     DGVSMATPFHMAAANGHSEVLKYLFSLLNEKEINSIINKQNDSGNTALHWAAYNGSVE
                     SMRILCDHGADPFIKNTFKHDSFYEAQNNKHDDAEKYLLETFEDALQAAEGDAKSGDE
                     NENFDESTVSYTEGTEIQKIPEGGNYEEKVDEDVEFLKRETENLKV"
     gene            <1011619..>1012464
                     /locus_tag="FOA43_003697"
                     /db_xref="GeneID:62197097"
     mRNA            <1011619..>1012464
                     /locus_tag="FOA43_003697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923948.1"
                     /db_xref="GeneID:62197097"
     CDS             1011619..1012464
                     /locus_tag="FOA43_003697"
                     /note="BUSCO:EOG09343V4N"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779876.1"
                     /db_xref="GeneID:62197097"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="PFAM:PF01873"
                     /translation="MSTEELGFDPTLKKKKKKKVVSKENGTASPGSGTISSKESLDDL
                     FAGAKKKKKTKYSKETNGNDAVDDLTEGFEGLKLKKKRKKKIVSKADESADFEKELAA
                     AGVQEEDSGEIYDEKQKETFIPYISLLDRFYEVLREKNPEMAGGQHQKLRIPPPEVAR
                     DGNKKTVFVNVQVIAHVLQRNPEHLIQYLFAELGTSGSIDGEKRLIIKGRFQAKNLES
                     VLRRYIQEYVICQTCKSMNTELKRESTNRLHFIVCKACGSTKSVSSIKTGYQAQIGAN
                     RRKRG"
     gene            complement(<1012562..>1014043)
                     /locus_tag="FOA43_003698"
                     /db_xref="GeneID:62197098"
     mRNA            complement(<1012562..>1014043)
                     /locus_tag="FOA43_003698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923949.1"
                     /db_xref="GeneID:62197098"
     CDS             complement(1012562..1014043)
                     /locus_tag="FOA43_003698"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779877.1"
                     /db_xref="GeneID:62197098"
                     /translation="MPMLTHISNGTDDDPSRCYICLCNKGERAPYCSRRESDDFIRPC
                     KCSLVAHRKCFLSWVSSLAIPKVIGRDDSENNRFGIPMPFTSTPNPSASAYHCSIFRL
                     FTGTLSPAYDKMCVFVDCPQCRRQICLATKNSLILNFRRFCEQIVDNVGSAALVSGVI
                     TTACVSLMASALFSLGVAGQDILEVMAKPSVQLGLYGTKHFPSISISDALDKSLISPQ
                     RFVSVTCFVPLYTMYMNSALPFGIQTDMMLIMLSYSLFNDPDGLVDTIPCRILRRLAF
                     MKVGFKALYNITLNRAYYRWHKTIQPCFFADKMSAADLQRIEAEIEQDTERENQEEAA
                     EIKDATYPFALRMFRKTGRFLSSMAHDWWREMILCYTVDFSRMFGSSSLYRRVLSTFL
                     LPRVGVFVSTNLLVLVPGINGFLSKFSDTPDESLFLRNILGCVTVAFGRELLSFSLNY
                     FRYRQFQSIDVDADPSDYWKYMADVYQDGNSTASTADDNAANV"
     gene            complement(<1014190..>1015935)
                     /locus_tag="FOA43_003699"
                     /db_xref="GeneID:62197099"
     mRNA            complement(<1014190..>1015935)
                     /locus_tag="FOA43_003699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923950.1"
                     /db_xref="GeneID:62197099"
     CDS             complement(1014190..1015935)
                     /locus_tag="FOA43_003699"
                     /note="BUSCO:EOG09341BT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779878.1"
                     /db_xref="GeneID:62197099"
                     /db_xref="InterPro:IPR026258"
                     /db_xref="InterPro:IPR034652"
                     /db_xref="InterPro:IPR038253"
                     /db_xref="PFAM:PF16969"
                     /translation="MEHPLSSTYGVRLGYFLQSADDYHRHRHRINKKLSKLRRSLEIS
                     TKDTKNYKEKEKISSITSENYDSSIRYGDVILYQVERDLLYAEETQLLLDVHMSKVKE
                     KFLVSKYKKALLNAKRLLKIAEHETDDFRMLEILVYAAFASGFLSVSKKRWGFAKNAF
                     SIARCSLQCLYEHQKLPSDLNKELYMDLIDKVVDPVLKVSTLEESGIRSPDLVLISRG
                     QAAEFADKIPFLKKAVDIIRKIDATLVTISSEGEEKEMIKSITWYSYSAVIKSEDEAR
                     VVMKALEAEKNVDAGDASSYDPALIAFQDALSFHAQEMERAEVFASDEEKQEAHIILT
                     YLKYNHILLRIRRDITLLEGINRKGNSKVTRVAVLDNIRDYLKILEGVNSSIEEIREL
                     PGVSNDDELTGTLTSLDSYFKTVQMAKLARGYTAVQKCRESLALLQRAHQLIDSTSDF
                     SGDLPGNLPSNRSLTDLKKEVNMKLRNAHVVTVYNDTTAAYLSKEFIIDNTNKFPEIS
                     AQNITEMIAPLDLSIEPVNVKPVLFDVAFNYINYKGEGSFTAAPGQEFTEEPEADSID
                     EEHKKKGGFFGFFSH"
     gene            <1016742..>1018499
                     /locus_tag="FOA43_003700"
                     /db_xref="GeneID:62197100"
     mRNA            <1016742..>1018499
                     /locus_tag="FOA43_003700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923951.1"
                     /db_xref="GeneID:62197100"
     CDS             1016742..1018499
                     /locus_tag="FOA43_003700"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779879.1"
                     /db_xref="GeneID:62197100"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MTSDNKFDPASIIKSTQTVLSVDDIPVDSVLSGQDRKLLIDHEI
                     DKDEAVILALGYKQEFKREFSLLTTFGVSFSVLGLLPSIASTLWYSLAYAGNAGITWG
                     YLVGMIGVMAVALSMAEISSTYTTAGGLYYATARMAPPKYKAILSWIVGWSNYFVQVT
                     GAPSVGYGCAAMILALAQISNPNYVYQDWHCYLLTVGITFVGAIIASAPTKWIAYINS
                     VSTLLNLLFLFISFVVMLAGNTREEQGLPKFNSNSVAWGIDNQTDWPDGICILMTFMA
                     VIWTMSGFDSPFHLAEECSNAQLATPRAIVLTASVGGVLGFVFQLALAYTIVDIDEAV
                     NDELGQPYIAYLNQIMTKPRVMAIGSFAVILAFTMSFSCMIAASRVLFSYSRDDCFPL
                     SRYWCRVNKLTSTPVNAVWANWFIGLLLCLLMFGGVAIDAIFSVGAIGSFISFTVPTL
                     LRITYARRSFKKGPWNLGRFSIPCGIVACSFVLLMIPILNFPQYRGADNTPDLMNWTV
                     VVYWGSMLLVVLWYFIYAHKIYQGPRSNIDKNTVITGDEAAEVIEAVVSSNHNVKFGY
                     DDEKALVKVPGSLEEKFDA"
     gene            <1018715..>1022374
                     /locus_tag="FOA43_003701"
                     /db_xref="GeneID:62197101"
     mRNA            <1018715..>1022374
                     /locus_tag="FOA43_003701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923952.1"
                     /db_xref="GeneID:62197101"
     CDS             1018715..1022374
                     /locus_tag="FOA43_003701"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779880.1"
                     /db_xref="GeneID:62197101"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012880"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021773"
                     /db_xref="PFAM:PF07919"
                     /db_xref="PFAM:PF11817"
                     /translation="MDKYPAEVTSLLAPFIVIQGLVSPTEKVQSVDSVGSTADLKLSN
                     LRSRKSIECDAVIKIPSIEDPSSVLHKSLYEDRQVTIIDRKLRLSQGPLASSIATLLD
                     KHNIKDSYLPTNKGKEFSSQIYYRIKYATNQYRLPRGAVLGASQSDSVSPQQDLQDIA
                     GLLSPLSPFNPDSSYSNTILPLEWVQKYRDVIPSVFVDVHELRITESDTSDMQADQLV
                     IDDINSVKKDVTGRGIRFLSVLLCEETKVESSVLETRIEKIRRCTRLPQRTGLLFISS
                     VNTRDIGIFVESIIRLIKPWTSDFYNSQISKLKNQTSLDLNYNSSFWLARQSMKTAIF
                     EEFCGITESSTKFMEYCYEKLIDAIRIVKLDTNPVIWNQCRVLLDLAGLHIARSYLIL
                     GDSNMAYRKFDIHIQNIRLMLPQTESYSTYSWLATQLSWFVQLLQGTPEGIIPIDRAL
                     QPVLQNKWFGNGSTPIKGFCPLPQGGYLCLDACFLVEKRRSLAQAAKQTAIDTYLSLE
                     LEAEKKFNHSKQCINMLNKCLDFYSRSKKTKFSRTESFAYFLLGEEYYKDHNYSMAIN
                     NYMVSISVYKDERWLRIISVIIFRLFQCSVKIRDYQDAQVYYLRLAVLPEKFITPLKV
                     LIENEKFVFDQEESEEQLFFKEDVFDSYVVIKSQSLLLNSKLEFQVVLNTKVNSLIDH
                     AIVEDITIRFNDSFREIRVKHDTNADSKVFNIFDSDNKVQSCLTFTTNMVFGGDQKTK
                     VLQFSICPGKIGKFRIESIHATVKTLEFDFRNSLNFSKPSRRSLARWYQRANDKLNKA
                     YEGILMNVKEPSFAFEVTPRQPKVEIKFDYAEFAYSGQVFPIKIHVHNKDVESYKLQY
                     EMNALVGDEDMTTEWKERTQNDEFNVGVVNENFALIHLPLITDLPTIVDIQSEQAGVI
                     SNHRQKVKVTFKFKYLMKNGDDTTVETMKVVEIPILEIFKLQFTINPSLSSVIPSIFD
                     VNETSVIPVHDRVWKCAALVRNVSFLPISLKHFKFEIKCLSSNAKAELIESKSLPDEL
                     ELTENDSEFTKLPFWFRSYCETGFLKRSIQVEIVLSFNYEDHNTNLEFSPLQLVHQYQ
                     TVIWKGSLPHLDPRMLVDIKEMDSVIEVDYILENPTSKIFQFSSSLATSECFVNLNYK
                     NQQAFSVLPFVKEIFKFRYKVVDEFKNKKLLRLPEFKVYDLHYKVYMNQLVVTDKIDH
                     SKEGMFYVNKNYLLN"
     gene            complement(<1022383..>1022715)
                     /gene="FPR1"
                     /locus_tag="FOA43_003702"
                     /db_xref="GeneID:62197102"
     mRNA            complement(<1022383..>1022715)
                     /gene="FPR1"
                     /locus_tag="FOA43_003702"
                     /product="FK506 binding protein proline rotamase
                     rapamycin-binding protein"
                     /transcript_id="XM_038923953.1"
                     /db_xref="GeneID:62197102"
     CDS             complement(1022383..1022715)
                     /gene="FPR1"
                     /locus_tag="FOA43_003702"
                     /codon_start=1
                     /product="FK506 binding protein proline rotamase
                     rapamycin-binding protein"
                     /protein_id="XP_038779881.1"
                     /db_xref="GeneID:62197102"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="PFAM:PF00254"
                     /translation="MSSELKIEVIAPGDGKTFPQTGDLVTVHYTGTLENGKKFDSSRD
                     RHKPFQFRLGLGMVIAGWDQGFAKMSLGEKAILTIPGHMAYGDRGFPGLIPPNATLIF
                     DVEMLKIN"
     gene            <1023018..>1023674
                     /locus_tag="FOA43_003703"
                     /db_xref="GeneID:62197103"
     mRNA            join(<1023018..1023021,1023175..>1023674)
                     /locus_tag="FOA43_003703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923954.1"
                     /db_xref="GeneID:62197103"
     CDS             join(1023018..1023021,1023175..1023674)
                     /locus_tag="FOA43_003703"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779882.1"
                     /db_xref="GeneID:62197103"
                     /db_xref="InterPro:IPR036249"
                     /translation="MELIPILKARKSSQSFDFTFINVVQPWHHLNSGASHEVALAVAQ
                     AYPDKYWHFSTVLFNHIEEFYDTELYETSRKQVYEKLIKLATDNLDSIDAATLWDLVE
                     IKPSADGKPHNSGNKVTADLKYFTKYQRTCGVHVTPTVFVNGVECSQIGSSTDVNKIV
                     DILCSQI"
     gene            complement(<1023747..>1023968)
                     /gene="SNU13"
                     /locus_tag="FOA43_003704"
                     /db_xref="GeneID:62197104"
     mRNA            complement(<1023747..>1023968)
                     /gene="SNU13"
                     /locus_tag="FOA43_003704"
                     /product="RNA binding protein snu13"
                     /transcript_id="XM_038923955.1"
                     /db_xref="GeneID:62197104"
     CDS             complement(1023747..1023968)
                     /gene="SNU13"
                     /locus_tag="FOA43_003704"
                     /codon_start=1
                     /product="RNA binding protein snu13"
                     /protein_id="XP_038779883.1"
                     /db_xref="GeneID:62197104"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="PFAM:PF01248"
                     /translation="MAADTEPIEILLHLPLLCEDKNVPYVFVPSKTALGRACGVSRPV
                     IACSITTNDASSIKSQVYAVKDKIETLLI"
     gene            <1024548..>1025030
                     /gene="VMA3"
                     /locus_tag="FOA43_003705"
                     /db_xref="GeneID:62197105"
     mRNA            <1024548..>1025030
                     /gene="VMA3"
                     /locus_tag="FOA43_003705"
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /transcript_id="XM_038923956.1"
                     /db_xref="GeneID:62197105"
     CDS             1024548..1025030
                     /gene="VMA3"
                     /locus_tag="FOA43_003705"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /protein_id="XP_038779884.1"
                     /db_xref="GeneID:62197105"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="PFAM:PF00137"
                     /translation="MSDLCPVYAPFFGSLGCASAIIFTCFGAAYGTAKSGIGICATCV
                     LRPDLMIKNTVPVIMAGIIAIYGLVVSVLISSSLKQEQALYTGFIQLGAGLAVGLSGL
                     AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLMNSRATQDVVC
                     "
     gene            <1025279..>1025599
                     /locus_tag="FOA43_003706"
                     /db_xref="GeneID:62197106"
     mRNA            join(<1025279..1025310,1025365..>1025599)
                     /locus_tag="FOA43_003706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923957.1"
                     /db_xref="GeneID:62197106"
     CDS             join(1025279..1025310,1025365..1025599)
                     /locus_tag="FOA43_003706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779885.1"
                     /db_xref="GeneID:62197106"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="PFAM:PF09341"
                     /translation="MFDQSTLTYKLEFSIPFQNESQSTIARNSLSPDPILKPDELNVT
                     FSSKANVLNILFEGSSDKVIRVAANNVIENLKTVIECIEVFDQH"
     gene            complement(<1025670..>1027250)
                     /gene="INO1"
                     /locus_tag="FOA43_003707"
                     /db_xref="GeneID:62197107"
     mRNA            complement(<1025670..>1027250)
                     /gene="INO1"
                     /locus_tag="FOA43_003707"
                     /product="Myo-inositol-1-phosphate synthase"
                     /transcript_id="XM_038923958.1"
                     /db_xref="GeneID:62197107"
     CDS             complement(1025670..1027250)
                     /gene="INO1"
                     /locus_tag="FOA43_003707"
                     /note="BUSCO:EOG093416GY"
                     /codon_start=1
                     /product="Myo-inositol-1-phosphate synthase"
                     /protein_id="XP_038779886.1"
                     /db_xref="GeneID:62197107"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF01658"
                     /db_xref="PFAM:PF07994"
                     /translation="MTIEYIPKVKVSTKKAKYTNTALITKYAYQNSLVEKEADGTYNV
                     KPFTEDYEFKVDLKIPKVGVLLVGLGGNNGTTFTAAVLANHNKVVFKTKRGPLAANYL
                     GSVTQSATIKLGIDSKGNDVYAPFNSLLPLVNPNDFVVSGWDISATNLGEAMERSQVL
                     EHDLQVQLKPEMEKIQPLSSIYYPDFIAANQNERADNCFNRDGAQGDISTKNKWSHVE
                     HIRGDIRKFKKDNDLNKVIVLWTANTERFSELIDGVNDTADNLIKAVHDDHPEVSPST
                     IFAVASILEKVPYINASPQNTFVPGAIELAKKYDVFIGGDDLKTGQTKFKSVLAQFLV
                     DAGIKPVSIASYNHLGNNDGYNLSSPKQFRSKEITKSSVVDDVIESNEILYNKKKNEK
                     IDHCIVIKYMHAVGDDKVAMDEYYSELMLGGHNRISVHNVCEDSLLAAPIILDLLVMT
                     EFLSRVGYRKEDTQGDFESFYPILNFLSYWLKAPLTREGHQVINSLNKQRLGVDNLMR
                     MLIGLEPLNELRFEERLK"
     gene            <1028250..>1028765
                     /locus_tag="FOA43_003708"
                     /db_xref="GeneID:62197108"
     mRNA            <1028250..>1028765
                     /locus_tag="FOA43_003708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923959.1"
                     /db_xref="GeneID:62197108"
     CDS             1028250..1028765
                     /locus_tag="FOA43_003708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779887.1"
                     /db_xref="GeneID:62197108"
                     /translation="MSTDDQSSQATLGTSNSTIGESSLTNYVILDRHDYASSTDSNDH
                     TSVPTTTNDANEDNGFDTSNNNSDDDPLEVRRLALTFDYLMYKIQDHVTGLSDAVTQN
                     VDYTKKQRQLELSQINRDIHDARKLISECNCINLEIDKLEQLQLMTRDFKERLTVIDS
                     RTKTHDRKFSK"
     gene            complement(<1028814..>1031513)
                     /locus_tag="FOA43_003709"
                     /db_xref="GeneID:62197109"
     mRNA            complement(<1028814..>1031513)
                     /locus_tag="FOA43_003709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923960.1"
                     /db_xref="GeneID:62197109"
     CDS             complement(1028814..1031513)
                     /locus_tag="FOA43_003709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779888.1"
                     /db_xref="GeneID:62197109"
                     /translation="MFRSHKQLIRTPTEKRGPRRTEFTPVGATGDDNSQLVPSAAVRT
                     NVNNGSPMNRNFSADNLTDNTSSSFSALLDSPARPLIHKGTDIFPIDSSDEEENNSTS
                     TFHGRRDLVGSKTTLVKKQADEVQKLRTDNFNLRVELISLKKGLQILPKDKKHLIDEN
                     MILNQKVIQLQRMVGEYHDREDSAPVDHSESIRKSNEAKIEEYENRLAGIREEVEEVR
                     RERDNSETMRQELQDEVSSLKLQVAELHEELSKRPRFDEADAKDDKILELQTDLDHSE
                     SEADKLRRENDALNDRMKDLEIKVSDDTWKDDMTRLENRDKLLQKENNRLHERIKALK
                     TGKEKTTDLMKGEIDNVYDKANKFQGEKAELVEKLRSMEDLLADAHKRYSDDYVEDIE
                     ADRKDLYNNLLSLNEKYKKLSEESQRKDQQMKKLKELKSHDSNISEELQLQLKEERRK
                     FSEKQDQLLDEISQLKEERSDLVRDYQSIQIELESMKTDRRVDPEQFDKLESDFLKVS
                     SQLKVQGQEYELLEDQLDIKEDELQKLRIELVSGYDKKEVIRLQKIIDSDKEERLKLL
                     REKERLVDENLSLSEQVTTLKNVKDRLKTRMVSTTDAEDKLDELRKKNSKVLKDSRAQ
                     SERLQHIQAELDKISEEKVELLESLTKLGKTLQKTMDKNNQLSEQLRSIHNATSTSKQ
                     DLQAKLAEKNAANKKLVDEYNSMKNELLDRLESSRDEKKQLESKINELKEQIERHKVK
                     EDILLQDQEKVKAQASQKIQYPPTPKTPNHAMEESSTVDALEARLELLGAQRKLYRIK
                     LQDMKDANGDLKFANGYLTKELKSKDRLIEKNVTLLQASSMGLVTPESSPRITRKSQR
                     TFEGCALAVLAGIRLQHRLEELKRKKNRERQAKAQIIQQQKYI"
     gene            complement(<1031672..>1032757)
                     /locus_tag="FOA43_003710"
                     /db_xref="GeneID:62197110"
     mRNA            complement(<1031672..>1032757)
                     /locus_tag="FOA43_003710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923961.1"
                     /db_xref="GeneID:62197110"
     CDS             complement(1031672..1032757)
                     /locus_tag="FOA43_003710"
                     /note="BUSCO:EOG09342LX8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779889.1"
                     /db_xref="GeneID:62197110"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="InterPro:IPR035902"
                     /db_xref="InterPro:IPR036320"
                     /db_xref="PFAM:PF00591"
                     /db_xref="PFAM:PF02885"
                     /translation="MGKALSTFIKALLIEPPSLSLDDFARALRLIFDGEANDIETASF
                     LTAIRLRKIDFDSEFIATAVETILEYSDTIDASSVAREGYIDIVGTGGDSQNTFNVST
                     SAAIVGAGMGLKVCKHGGKASTSTSGSGDLMSELGVKLMKVNAETTPIIVGDSNLCFL
                     FAPAFHHGMGKVVNVRKNLGIPTIFNILGPLLNPIPLKARILGVYTETLGETYCKAAI
                     KSDKKKGRVPANTMVVYGEIGLDEISPIGKTKVWKYNKTNDSIDTFTISPEDFGLPEH
                     SLDLVRSGLAVENARVLKDILSNKVDTLPGHNPLVDYILLNASALAVVGGLTNDWKQG
                     VKLASDAIISGAALRALDTFVASVDRL"
     gene            <1033197..>1034369
                     /gene="CDC12"
                     /locus_tag="FOA43_003711"
                     /db_xref="GeneID:62197111"
     mRNA            <1033197..>1034369
                     /gene="CDC12"
                     /locus_tag="FOA43_003711"
                     /product="Cell division control protein 12"
                     /transcript_id="XM_038923962.1"
                     /db_xref="GeneID:62197111"
     CDS             1033197..1034369
                     /gene="CDC12"
                     /locus_tag="FOA43_003711"
                     /codon_start=1
                     /product="Cell division control protein 12"
                     /protein_id="XP_038779890.1"
                     /db_xref="GeneID:62197111"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030379"
                     /db_xref="PFAM:PF00735"
                     /db_xref="PFAM:PF01926"
                     /translation="MSQPATINAEPIGITNLPNQRYKIVSKEGAAFTIMLAGESGLGK
                     TTFINTLFQTVLAPHQDNRNRFNKPVKKTVEINIVRAELEEKNFKLRLNIIDTPGFGD
                     NVNNKNAWQPIVEFIDAQHESYMKQESQPQRSLIKDLRVHACLYFIRPTGHTLKPLDI
                     EAMKKIGTRANLIPVIAKADTLTPNEMLEFKKRIRAIIEAQNIRIYSPPIEADDQAAA
                     EHAKQLIESMPFAVIGSEEDFEVDGKMVKGRRYPWGFVEVENDQHCDFRKLRSLLLRT
                     NMLDLIVSTQEIHFETYRRLKMNGEVNTDDSKDTSSKRKSAERFIDNPEFVEEEKRLK
                     RYFAEQLRNEDQRFKQWKQNIHTEKNRLNHDLANLQSDMKKLEEEVKVLKQAKAHN"
     gene            complement(<1034471..>1035115)
                     /gene="RPS24A"
                     /locus_tag="FOA43_003712"
                     /db_xref="GeneID:62197112"
     mRNA            complement(join(<1034471..1034875,1035113..>1035115))
                     /gene="RPS24A"
                     /locus_tag="FOA43_003712"
                     /product="ribosomal protein S24A"
                     /transcript_id="XM_038923963.1"
                     /db_xref="GeneID:62197112"
     CDS             complement(join(1034471..1034875,1035113..1035115))
                     /gene="RPS24A"
                     /locus_tag="FOA43_003712"
                     /codon_start=1
                     /product="ribosomal protein S24A"
                     /protein_id="XP_038779891.1"
                     /db_xref="GeneID:62197112"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="PFAM:PF01282"
                     /translation="MSDAITIRTRKVLSNPLLKRRQFVIDVIHPSKANVSKAELTEKL
                     AELYKAEKDCVSVFGFRTCYGGGKSTGFGLIYNSVADAKKFEPRYRLVRSNLAEKIEK
                     ASRQQRKQKKNRGKKVFGTERRHAAKKAKRAQD"
     gene            complement(<1035473..>1036377)
                     /gene="VTC1"
                     /locus_tag="FOA43_003713"
                     /db_xref="GeneID:62197113"
     mRNA            complement(join(<1035473..1035904,1036372..>1036377))
                     /gene="VTC1"
                     /locus_tag="FOA43_003713"
                     /product="vacuolar transporter chaperone"
                     /transcript_id="XM_038923964.1"
                     /db_xref="GeneID:62197113"
     CDS             complement(join(1035473..1035904,1036372..1036377))
                     /gene="VTC1"
                     /locus_tag="FOA43_003713"
                     /note="BUSCO:EOG09344A2H;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="vacuolar transporter chaperone"
                     /protein_id="XP_038779892.1"
                     /db_xref="GeneID:62197113"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="PFAM:PF02656"
                     /translation="MLCELACQLNRRLVRNSTDYISSMSAAPLLQRAPGKRIALPTRV
                     EPKVFFANERTFLSWLNFTVILGSLAVGLLNFGDKIGRISAALFNLIAMGTMIYALIT
                     YHWRANAIRRRGSGPYDDRFGPTMLCFFLLIAVIVNFTLRIRA"
     gene            complement(<1036705..>1039014)
                     /locus_tag="FOA43_003714"
                     /db_xref="GeneID:62197114"
     mRNA            complement(<1036705..>1039014)
                     /locus_tag="FOA43_003714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923965.1"
                     /db_xref="GeneID:62197114"
     CDS             complement(1036705..1039014)
                     /locus_tag="FOA43_003714"
                     /note="BUSCO:EOG09340HAW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779893.1"
                     /db_xref="GeneID:62197114"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="PFAM:PF06046"
                     /translation="MPQQNPVVLAKVSELLKTEDDLAKVEALTRNLRKEKSTIDSQIK
                     IEEERGMDSVQRMINQMQAANKHLKELGYSVQKLDDLQKDSTSNSEVSAVFDRAATAL
                     KNLTDVEEIYNGFKTLEEKMNLIEALMAIELPEGSDYYSETSSGDNLLIIHYELTALR
                     DFRDKIIALGMRSSPDVQQAVDKSFDRLDKLIDNFDYMLSLVVDGFIDIIGCENYGLV
                     IKLVKIIQYEANEDLKFQLLDKIMNMKQENEVVPNTSLNVKRSEPRRYMEKFENDFQS
                     TINASFKNLAEDSEYGQMLKLLDENYYDTLGVYSDAVEKCFPSEWHFFDKILSWNQSS
                     LRKIFLKMLEDQSVANSVIVQILNFEYENKKKLKEIFHISKEQLKIVGIITDAKKDEL
                     LESCLKFNNSKTDEWIKNSLKSSITLFQTRTKEPPDSKDEKLGIESAQMVVEILRSNI
                     HALAELGDSKVMLKYLDFFASKIMKYYYDLWNHALDDEVKKWTLPENGKEDDKKEIDP
                     TIGYMPRYITVLANDCVKLVDALDSQFGEVKKLVHASFHEQVDEIAGRASGYAIDLGI
                     DCLKKLNGFIVVEYQPFLSEVFSKQWYKSSSMIELSLQIVDESYMGPLQEFLQQELYI
                     SLFEIVFDQYLLSYLNALFLKHSIREDKFADRIERDGNLIQQTFSNYDTAGIIGDQLY
                     ILDILINISTCDHEDEFIEQWKSAVEVFNDLPIDFLQIILDNKGIRDSKENSVLERCL
                     AISKQFAVANGDNQAPTFMSDFHFHSARK"
     gene            complement(<1039188..>1040201)
                     /locus_tag="FOA43_003715"
                     /db_xref="GeneID:62197115"
     mRNA            complement(<1039188..>1040201)
                     /locus_tag="FOA43_003715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923966.1"
                     /db_xref="GeneID:62197115"
     CDS             complement(1039188..1040201)
                     /locus_tag="FOA43_003715"
                     /note="BUSCO:EOG0934354A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779894.1"
                     /db_xref="GeneID:62197115"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR036901"
                     /db_xref="PFAM:PF00185"
                     /db_xref="PFAM:PF02729"
                     /translation="MSFTYVARRSFSTTMSMASSELSAIRHLVSISDLSTPELRSLVS
                     RAAYHKKLIKSGKASTSLPLQGKTIALLFTKRSTRTRISTEGAAAYFGAHAMFLGKDD
                     IQLGVNECLYDTTKVISSMTSCIFARVNKHSDIQELCRYSSVPIVNALCDTYHPLQAI
                     CDMLTIKETFGNTKGLKLAWIGDANNVINDLAIAALRMGISVSVATPQDVNISEHVQK
                     VAEEVSEETHAHIELTHDPKIAAANADIIVTDTFVSMGEEAQTKRKLAKFQDFQITSS
                     LGSIAAPGWKFMHCLPRHKFEVTDDVFYGKHSIVFPEAENRLYAAIAVIEALVVNKGK
                     FIE"
     gene            complement(<1040473..>1041369)
                     /locus_tag="FOA43_003716"
                     /db_xref="GeneID:62197116"
     mRNA            complement(<1040473..>1041369)
                     /locus_tag="FOA43_003716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923967.1"
                     /db_xref="GeneID:62197116"
     CDS             complement(1040473..1041369)
                     /locus_tag="FOA43_003716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779895.1"
                     /db_xref="GeneID:62197116"
                     /translation="MDSDSNNDEEKQESKVMTSKFFKRRIRNFKETTNDDDDDDDQGS
                     NETEDIDQSDSDDLEIQTLPIRRKSPFRGKKVRPPEAGELEYTTGSYNQSATGIPEAS
                     LVKELKERRYRKQTKEFEAAKEEERQEDYDSDFRRNKQNEKDSNDDEDSEMEVDRDEK
                     LSDGRLALSTNEEKVQKLIKRKEIEEALFELEEESTSDSEKNEGVSSGSDSVLKEVFE
                     SVAPKHFLKKDIIDSLEAKYPMPRLKKVPPLEICLQQMQKRLQNLQQIQKLNRKKKEQ
                     IDTQLHGLRAEEGKLAQKLQKQ"
     gene            <1041523..>1042566
                     /locus_tag="FOA43_003717"
                     /db_xref="GeneID:62197117"
     mRNA            <1041523..>1042566
                     /locus_tag="FOA43_003717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923968.1"
                     /db_xref="GeneID:62197117"
     CDS             1041523..1042566
                     /locus_tag="FOA43_003717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779896.1"
                     /db_xref="GeneID:62197117"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PFAM:PF05158"
                     /translation="MSSPIITKTVPSISDVSEIAKSMHQMMTSDGRSSYTQSDLMEMM
                     HLGSIKELMSNAQELLNKGLLKILESSQRDSKEKGLMFAPISEQEAQKVNTMSNDEAM
                     IYSYIAAADREGIWTKTLKAKTNLHQHVVLRCLKALESQSYIKSVKSVKHPQRKIYML
                     YHLTPSIEVTGGPWFTDSELDTDFIDSLLIIVWKFVASKTYPRCFKKKGIIFNGRKQY
                     SYPADILSGLGCQLPTITEISKFIAGSGVTTVDLSLSDIKSLCDVLIYDEKLELVDEH
                     CYKSTWQSVLEAGGGRVEGVDVYAPQNDQIFSIKDAYRTVEAVSGGDNAEHPATDDEN
                     HRTRFYLNSWSAV"
     gene            complement(<1042599..>1044278)
                     /locus_tag="FOA43_003718"
                     /db_xref="GeneID:62197118"
     mRNA            complement(<1042599..>1044278)
                     /locus_tag="FOA43_003718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923969.1"
                     /db_xref="GeneID:62197118"
     CDS             complement(1042599..1044278)
                     /locus_tag="FOA43_003718"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779897.1"
                     /db_xref="GeneID:62197118"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR014752"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="PFAM:PF00339"
                     /translation="MSYSMQSFLKRILTDSGYSRSRKCNAKLSNSKTSFDSDDDNLGI
                     TSHSTLFSANSDNCTLSSFDQADPENALCLSVDGLRDRAGSVRSTTHSTSSNLKNSRT
                     IIDNENYSVSVDLLDKVTYLDVRTSLPTPIRGTLVLKVKKAIRIHEIQLFLEGNVLIH
                     YFYKSRALVQSHQMEEKQFLCERRCWTYESSSSPYISGDFSSADIDTDHFSKGTYNFS
                     FQYFVDSSLPESIKNVFGSIYYVLHAKVIFPKRKYHPRHRTKEATLPMEFIQCALDPV
                     RRNSRGALSSEFVSTANWRNLLLYKVSVSYPRPLAIESHISVSIKVLPIIRRCYKIRS
                     IRVSLVQTMEYNVDSKNNQYFNDLVQTEEIPLQIINIMDNQDPSTLTPYVKQLDVPLE
                     KVYIRNTDEDRFVVCPSTNSVESELCHFKVGHKINVEITVQEVPMPWDYEKNVHQNDA
                     EEAEVSSVAKSRRHLTAEQEEDESLRATAKIIEEGNIESLRYRKVQLQMSADVQILKS
                     ESKDGNMPPPAYSKSGADEAEIETTKGYAMPPAYEEALEQVAMLVMPPVYS"
     gene            <1045178..>1046908
                     /locus_tag="FOA43_003719"
                     /db_xref="GeneID:62197119"
     mRNA            <1045178..>1046908
                     /locus_tag="FOA43_003719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923970.1"
                     /db_xref="GeneID:62197119"
     CDS             1045178..1046908
                     /locus_tag="FOA43_003719"
                     /note="BUSCO:EOG09341CPR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779898.1"
                     /db_xref="GeneID:62197119"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR038425"
                     /db_xref="PFAM:PF00790"
                     /db_xref="PFAM:PF02883"
                     /db_xref="PFAM:PF03127"
                     /translation="MSSLSSLQGSSGKLLRRIHRACRPSLDEPNIALNLEICDLINQK
                     QGNLPREATIATVKLINSRDPQVSELALTLLDYIVKNCGYPVHLQISRKEFLNELVKR
                     FPERPPFGYTRIQRLILGTISEWVQTICKTSRYKEDLGYIRDMYRLLRSKGYDFPSVK
                     SEDAAVLNPSDNLKSIEELRDEEHVAQSAKLQELIRRGRPQDLKEANDLMKIMSGFKE
                     DESYEQTRQQVHEELDKVGRKADLLDEILTNATNVGSLDTSDGTVQELISAIKVAQPK
                     LQKIIQEESDDDESVQRLLKLNDKLNIVLQKVALLTKGDATAAAQIKVPGGAPTMNLI
                     DFDDDDVDDNSPVSNYPSGVSAAAISSSGMAASTGDAIADLLSDLGGLTFDSNHNPQS
                     TTLGGGAINLLGTPEPEKKATKSAAATNYLLAGFGAPATSAAAAASVVSPTSATAQFD
                     PFQFNLSSKPSSSLLNQSENLKITYTVNSKQASSVDLTFHFSNLTITKQITQLQFSLA
                     VTKQFDLNLKSPSTLSLSAGVTDGISQAATISQKEHKPFDNLKLKFKCSYQLAGIPIE
                     EQGVMSVSLK"
     gene            complement(<1047011..>1050616)
                     /locus_tag="FOA43_003720"
                     /db_xref="GeneID:62197120"
     mRNA            complement(<1047011..>1050616)
                     /locus_tag="FOA43_003720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923971.1"
                     /db_xref="GeneID:62197120"
     CDS             complement(1047011..1050616)
                     /locus_tag="FOA43_003720"
                     /note="BUSCO:EOG09341P2L"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779899.1"
                     /db_xref="GeneID:62197120"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="PFAM:PF07529"
                     /db_xref="PFAM:PF13921"
                     /translation="MPTTIPGSFIKGPVKGPISMPANESINEIENIPIEKVKREAIDK
                     RRQDSNNIVKERKRRLSELYCVSRLPLLPLSNDQMLQIKDMLALFLEKNDLEKGYEFS
                     ISALAHEKRDLVTEDAENDTRPPKKLQKTLPIQASEILTRKHIELSPDEAPTLSSMIH
                     KYTEQREAGRADEKVKRDLDYENVEIKKLLVTLMPERKPHKVAAARSLTEMFYHQQTL
                     QLPKLLLRARKTLTSESFETSLVEGKVSVLYSRIEELKRKHSWSLRQPRKYLEPFLMK
                     GRKTHWDYLLSESKWLATDMKQERRFKVAQCYFVSQAVQDYWSYGKVCCIKTKPIVYL
                     KDVEIESKVTTGTEVQVVSNDAQGYPANGVTEDVTMTDAGADASADAPATEVHPEVDD
                     QGTKSAEGEDKSIREPQVDGDCDKDVSTHEGPKIINLVDIVVEEATNVDGDAGISSKK
                     ENDDETVKEITIRDAPMVSSEQEPIVIEAEKEVEKLRHDPMMSYAPLEKTAHFFLHAS
                     LDTFTPTEVSIVEHLPAYDPFSEKEPDHIVDRDLYGHVSALLPPPDEEPEWEKIVFRQ
                     QDDADKHIATYQKALFGPYRRFNVLKPPKPPSIRNIELRIPTIWLPQDDRYLIKYVTE
                     FSFNWEIISAHLSSQPTLRYFSNIERRTPWQCFERYIQLNNRFRFSDMRGVYTIAAKE
                     WLEAAHRVQATTRRRISPLGVGQESIQRGNRRLRWASMLEAIRKLMKKRESIQRPAPQ
                     ERKPAEIGSFETPSPEDLSKLKWERDKAIQQAYVAANPKGYNDRVRANPSVGNGVRSA
                     VAAATASHIVTNGVHQHDGGMAVNQRHGQSRPMSLQATVSAASAAGYTPEQIQRLVQI
                     QRQRQKQALAQRVRQVRSADSNSVGGSMSASSSRASSTVPTPLQGHAGLARPQTQPPA
                     STFSSPSTPAPTPEQVLAAAAGQHAGRGSPVASNLSISSPVHRSSPRISFTTAQVSAI
                     ISQIQTRNPNLSKDQVSRLAVAYLANYQQKLTQRQKQGQHAQQIQQAQRSSRSSPIPA
                     ISSPRNQNVPMGKRAPRKQLTPQQLAMLAENPKLTPQQRQQVQILQQQQQQQIQRRQQ
                     QAKVLQHTNDDSGSPSGNGSHHTPTPEEIQLAMNRRRTVRDSNMVVSEVARSPQKSST
                     PSGSPHSVAGANLNLEVIENDLLNADFSFLEGAWLSSSPHVGNASLSNDEPNNTM"
     gene            complement(<1051033..>1051440)
                     /locus_tag="FOA43_003721"
                     /db_xref="GeneID:62197121"
     mRNA            complement(<1051033..>1051440)
                     /locus_tag="FOA43_003721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923972.1"
                     /db_xref="GeneID:62197121"
     CDS             complement(1051033..1051440)
                     /locus_tag="FOA43_003721"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779900.1"
                     /db_xref="GeneID:62197121"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /translation="MKYRVKSSNKFGSKVVEFEVFENQRRWFGVGWSDSLLPIERQHY
                     TNEYLKQCCDTLDSYNFPNLPEMSGLSELSEKHPWKWMDEHWKIDREFCKGKDPDGWI
                     YYDNTWGGMSYQDSISKFTRTRRLIRRALLKLV"
     gene            <1052349..>1054185
                     /gene="RPT5"
                     /locus_tag="FOA43_003722"
                     /db_xref="GeneID:62197122"
     mRNA            join(<1052349..1052460,1052518..1052541,1052900..>1054185)
                     /gene="RPT5"
                     /locus_tag="FOA43_003722"
                     /product="26S proteasome regulatory subunit 6A"
                     /transcript_id="XM_038923973.1"
                     /db_xref="GeneID:62197122"
     CDS             join(1052349..1052460,1052518..1052541,1052900..1054185)
                     /gene="RPT5"
                     /locus_tag="FOA43_003722"
                     /note="BUSCO:EOG093422ED"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit 6A"
                     /protein_id="XP_038779901.1"
                     /db_xref="GeneID:62197122"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032501"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF07724"
                     /db_xref="PFAM:PF16450"
                     /db_xref="PFAM:PF17862"
                     /translation="MVKDATVEKKAEKTTEDKVQAIKTLEEDDEFEDFPEDDWDDNHT
                     IATMPTLEDLDDNQDIEIDDEILNSSTTDIINRTKLLDNEIKLFRSELLRLQHEKSVM
                     LEKIKDNKEKIKNNKQLPYLVGNVVELLDMNPDEDATNEGANVDIESTRVGKSAVIKT
                     STRQTVFLPMVGLVEPDKLKPGDLIGVNKDSYLILDKLPAEYDSRVKAMEVDEKPTET
                     YADIGGLDKQVEELVEAVVLPMQQADKFKKLGIKPPKGALMYGPPGTGKTLLARACAA
                     QTNATFLKLAAPQLVQMFIGDGAKLVRDAFELAKEKAPTIIFIDELDAIGTKRFDSDK
                     SGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPS
                     EDARAQILQIHARKMSVDDNVNWQELARSTDEFNGAQLKAVTVEAGMIALRTGQSVVK
                     HEDFIEGISEVQARKNKSVSFYA"
     gene            complement(<1054208..>1055662)
                     /locus_tag="FOA43_003723"
                     /db_xref="GeneID:62197123"
     mRNA            complement(<1054208..>1055662)
                     /locus_tag="FOA43_003723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923974.1"
                     /db_xref="GeneID:62197123"
     CDS             complement(1054208..1055662)
                     /locus_tag="FOA43_003723"
                     /note="BUSCO:EOG09342JGC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779902.1"
                     /db_xref="GeneID:62197123"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="PFAM:PF00400"
                     /translation="MSIIAGYSSSSSEDESEKQQLTTLPMRIISGGRKTITGYIQQEA
                     VDPLKFDTNKRLYDRLDGTKSPNNSYFTVSKRESQKIKRQRKDKGDSSQLDGNNAYRG
                     PWASEKSSSSDEESDRAEVSRNYTVELPPDLENGVGNGVKPSETSEYFPTSTSSGILT
                     PPSSNRINFLNSQPGAQKCYVPKKKVYIYTAHRGGVQAIQFLPNTGHLLLSCGNDSEI
                     KIWDVYGNRELLRGYYGHTKAVKNVQFNSDGTKFLSCSYDKWVKLWDTETGKCTYKKK
                     LRGFPSVAKFNPNNQNEFLVGTNKMTVEHYDISADEIIQTYEHHTGAINYLEFIAENK
                     NFVTSSEDKSLKVWDLRINMPIKQIADPKQHSMPYLRLHPDGRYFVAQSMDNTIVTFS
                     TKKTDKFRKNKRKLFKGHNSAGYSVGLQFSPDGRNLISGDSYGYTYFWDWNTTRLIKK
                     IKVDDKVISCVDAHPLETSIVAMAGLSGNIYLYD"
     gene            <1055831..>1056712
                     /locus_tag="FOA43_003724"
                     /db_xref="GeneID:62197124"
     mRNA            <1055831..>1056712
                     /locus_tag="FOA43_003724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923975.1"
                     /db_xref="GeneID:62197124"
     CDS             1055831..1056712
                     /locus_tag="FOA43_003724"
                     /note="BUSCO:EOG09343WSE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779903.1"
                     /db_xref="GeneID:62197124"
                     /db_xref="InterPro:IPR025602"
                     /db_xref="PFAM:PF13862"
                     /translation="MPKRTQKDIEREEHSESDISLSSSDDEELRDEVDTVNVDFDFFN
                     LDPKADFSATKNFLRQLFQGDSLLFPLSEMADILLSTNQVGTTVKTDGKDSDPFSIIS
                     VTGLTDNLSKDPVKKLSQYLFEKTGKHPQFNAMLRQLLSPSSKRKLALIFSERLINMP
                     VETAPPMYRMLMEEIDKAGFKYDYFLIPSRVYQMIDSEVDKELNDDGEDDCHKKRSKK
                     NKEKISEFEYYHYEDEVLESHALHHAFFDYTKKGINPDARRVFNDYAVVPKLSLILIG
                     KNSLETATQDMSEKFAA"
     gene            <1056919..>1061343
                     /gene="RPC1"
                     /locus_tag="FOA43_003725"
                     /db_xref="GeneID:62197125"
     mRNA            <1056919..>1061343
                     /gene="RPC1"
                     /locus_tag="FOA43_003725"
                     /product="DNA-directed RNA polymerase III subunit"
                     /transcript_id="XM_038923976.1"
                     /db_xref="GeneID:62197125"
     CDS             1056919..1061343
                     /gene="RPC1"
                     /locus_tag="FOA43_003725"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit"
                     /protein_id="XP_038779904.1"
                     /db_xref="GeneID:62197125"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR035697"
                     /db_xref="InterPro:IPR035698"
                     /db_xref="InterPro:IPR038120"
                     /db_xref="PFAM:PF00623"
                     /db_xref="PFAM:PF04983"
                     /db_xref="PFAM:PF04997"
                     /db_xref="PFAM:PF04998"
                     /db_xref="PFAM:PF05000"
                     /translation="MKETVVDVAPKCISGLQFGALSDAEIVAQSEVEVSTRNLFDLDR
                     GRLPVKSGALDPRMGISSNASECVTCHGNLATCHGHFGHIKLALPVFHVGYFKAIIQV
                     LQTICKNCSAVLLDENCKRKFLTELRRPDLDNLRKMKIVRKVLDQSKKQRRCLRCGAL
                     NGVVKRAAAGGGPAALKIIHDSFRWVGKKGAEEKTQWNEDFQMFFEENPDLEKFYKRC
                     YDDLNPLKVLNLFKQISPTDCELLGIDPSKGGRPEMYIWRYLPAPPVCIRPSVMMGES
                     NTSNEDDLTVKLTEIVWTSSMIRAGIQKGITLNSLMEQWDYLQLAVAMYINSDVVSPN
                     MMPGSSGSSKTSKPIRGFCQRLKGKQGRFRGNLSGKRVDFSARTVISPDPNLRVDQVA
                     VPELVAKVLTYPEKVTRYNKKKLQQLTRNGPDVHPGANYIMKKNENVKRNLRYGDRNK
                     LARGLSYGDVIERHLVDGDVVLFNRQPSLHRLSILAHYVTVKPWRTFRFNECVCAPYN
                     ADFDGDEMNLHVPQTEEARAEAATLMGVKSNLLTPKSGEPIIAATQDFITGSFLITHK
                     DSFYDRAVFTQMCVMMSDGTSKFDLPPPAVMKPVYMWTGKQLYSLLIRPNHESNVLLN
                     FDSKCKTFSPPPLGKRNEMSSNDGYVLVRNSQLLSGVMDKALLGGGKKTSLFYTILRD
                     YGAEEACQAMNRMAKLTARYMGEKGFSIGINDVIPSEIVKEKKEEMVRAAYKSCDDLI
                     ELFKKGKLETQPGCNEEETLESKIGGLLSKVREEVGDICIKELEPSNAPLIMATCGSK
                     GSTLNVSQMVAVVGQQIISGHRVPDGFQDRTLPHFLKNSKTPQSKGFVSDSFYSGLNP
                     PEFFFHAISGREGLVDTAVKTAETGYTSRRLMKSMEDLSTLYDGTVRNSGNGIVQFKY
                     GADGLDPMDMEGNAVPVNFERTWGHCFFVTLNHNDRALYPYEVTKFVNLTLDPLKNRL
                     IRRDNVGKVVPKKDCDKIEFVDKYDAERNFYISIKQFISSKVKIIAKLREEKSLDPMR
                     KKHSKLQSPSRNAETSEEHLVNKLHKISRPMIKKFLDMCLTKYVRARVEPGTAVGAIG
                     AHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKFISTPIIKAVLVNDQDE
                     RAARVVKGRVEKSILEDLAFYIEDVYKEGQAFLQVKVDLDTIEKLQLELTTSQIANAI
                     VASKLKIPRSDVAVVGRNKIQILVSEMCLENGKPSSRSTASREIVALANRDPEEKARL
                     QKSALFYKMQLLKRQLTKVVVKGLPEVSRAVINVRDDGRKELLVEGYGLKDVMATDGI
                     VSSKTHTNHVIEIFHVLGIEAARSSIVSEIDYTMRSHGMVVDPRHLQLLGDVMTYKGE
                     VLGITRFGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDEVEGVSERIILGQTMGIGT
                     GSFKLSVKNKIPKDRLKPKEAIFDNLCNGIVPPSIKVA"
     gene            complement(<1061490..>1063080)
                     /locus_tag="FOA43_003726"
                     /db_xref="GeneID:62197126"
     mRNA            complement(join(<1061490..1062609,1063073..>1063080))
                     /locus_tag="FOA43_003726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923977.1"
                     /db_xref="GeneID:62197126"
     CDS             complement(join(1061490..1062609,1063073..1063080))
                     /locus_tag="FOA43_003726"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779905.1"
                     /db_xref="GeneID:62197126"
                     /db_xref="InterPro:IPR000782"
                     /translation="MGLYMLFGMIVVDAKNVVDISISDEAIAELSKRSPKNTFDAFHL
                     IVDDAALGTDSNHVKRSPKNIAHLNLVVDESKLLGETGKLQRRSSKNVAHLDLVIDED
                     ELLSRLIKRDSKNLADLDFVIDEKDLVVTKIKKDNDEEFTQLAFKLTDGDSSYSFIAD
                     LPQKVVAKLSNGYHQLKLKFSNDSHAIPEVGDIYDAAKKLKYTLMPSVKSGSLATALN
                     EHPDISIFASYVRDLNDLYNMCDSTDDFNINAAASSKAENMLLLFSPTNEAILSLQMK
                     PWQFPKSAHASDSDDVAQENIRHFVESHIAKVSSKSFNADRVVTLSSLNGNTIFLKNT
                     DTGFMYKLSETDQWLTIKRIEVLDNGALLSIDRTMSWPGKQ"
     gene            complement(<1063649..>1065414)
                     /locus_tag="FOA43_003727"
                     /db_xref="GeneID:62197127"
     mRNA            complement(join(<1063649..1065385,1065409..>1065414))
                     /locus_tag="FOA43_003727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923978.1"
                     /db_xref="GeneID:62197127"
     CDS             complement(join(1063649..1065385,1065409..1065414))
                     /locus_tag="FOA43_003727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779906.1"
                     /db_xref="GeneID:62197127"
                     /translation="MQIYSMVRGISSSSDIKFPPNGDLIDSDYRVHIFIDDIGYRFFQ
                     GWPREKFIDAKDTTVKNMVNRMLKSFSSFGSRIATTCKNEPEGLRKLGLLMVVHVEES
                     WTLLWIQFSSVARFARFYQVDSTPKFISEFPYNLKTLTKIVVARILGVADVEDMLLYY
                     RHIMPIMEDETYSNEALLISNIRAILSGYQEHGYNVTPEQINFSRRELPAMLKKFRGR
                     NQPGSEPALRTDDSGSPDDGDLNGSFDVNSKQQAVEPVKPSKRGPRVKKIGVAVAAED
                     KPHKRAYHSDKRRKKSEIIDAATSEIDMESKIPGRTGRPGRPGRLGQLGMSDRSGKPG
                     RPGRPRRPGRPRKSVTRPQLVASEVSGEQEEILESIIDLPIYVTLQNLKEIKRIIPYD
                     PNKMEQLAADFRKAYENIQRRFYSRWAGTPNTTEAESDDKNVLERGYADRRIQKRGTS
                     QKSAFPMYGPTQIEYEILKKQEILATGSLYKKLTLLKINPNRQQMRSISNARRWINQR
                     FKYNPSDDCVYYLRNPEVIIPDYHDIPYIVIATHLHYNCSNEANTYNVVRRNWYISRK
                     CIRYVIHKCYKCDN"
     gene            complement(<1065857..>1067707)
                     /locus_tag="FOA43_003728"
                     /db_xref="GeneID:62197128"
     mRNA            complement(<1065857..>1067707)
                     /locus_tag="FOA43_003728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923979.1"
                     /db_xref="GeneID:62197128"
     CDS             complement(1065857..1067707)
                     /locus_tag="FOA43_003728"
                     /note="BUSCO:EOG093412YN;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779907.1"
                     /db_xref="GeneID:62197128"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="PFAM:PF00415"
                     /db_xref="PFAM:PF13540"
                     /translation="MFLLRPRTVLHGHLLTQSLGLRQLPKISRTFHNLAVAFNEQKDK
                     KKYVFLKKQKLEGFSSSTGEEKPQPSSEQQAEFNEAYGATKKTQTTFWALAIVFIAVA
                     GVEVYRKRDEFMKWYNSKEAPDAELNIESPNAEISSRKVFHLDKKLHKVTNPNPSSVP
                     GLYVCGNNKHGISSEDSKLEQQLVMKRLSIFDNVLARSVCLGKKSGALVDDHGDLFQW
                     GEGFGGDSKHPTVKGENLLKAEISNDTIYALNSKGEVVYLPESMEDQKYFSSKKKTWL
                     GTQVKAFKRLTVTEPIQDIQCGKEHIVLLTRDGEVYTAATGFSKPIERSWGQFGLPNF
                     SQFDEPPRINEVHNVTLLNKFVEDGKLRKRHIKQIAAGDFFTMCLDSMGRVWAFGKNT
                     FGSIGREMDYNSEVISYPSEVKLVSKYFKRDELPRGISIAAGGDTAFATYASSNMYHL
                     FEKSLQEDVSFGMEDIKDQELENLVHMAWGHGLKGQLGSGHYIHGQYEPTKIKNLNDI
                     KEYNESTQRVEEIGVKSWAVGGSHIMVTLTNNDVYGWGDNEFGQLGNGRHGRVPEAVP
                     MPSLLEPDDTRKTMTLTEVINDRLQLADTNKFQQIIAVGPDTTAVYYKRK"
     gene            complement(1067847..1067930)
                     /locus_tag="FOA43_003729"
                     /db_xref="GeneID:62197129"
     tRNA            complement(1067847..1067930)
                     /locus_tag="FOA43_003729"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:62197129"
     gene            <1069236..>1071182
                     /locus_tag="FOA43_003730"
                     /db_xref="GeneID:62197130"
     mRNA            <1069236..>1071182
                     /locus_tag="FOA43_003730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923980.1"
                     /db_xref="GeneID:62197130"
     CDS             1069236..1071182
                     /locus_tag="FOA43_003730"
                     /note="BUSCO:EOG0934138A;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779908.1"
                     /db_xref="GeneID:62197130"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="InterPro:IPR039558"
                     /db_xref="PFAM:PF10637"
                     /db_xref="PFAM:PF13640"
                     /db_xref="PFAM:PF13661"
                     /translation="MAPARSKSTEKRRNEFPDRGNSTKNQKVTEPGAMSLRQTAEEDA
                     RSKGYFQPKLFTAEYEENLKNQVDKAGPYPWGSITNLIDDDILRNVRKEILSEIHFTK
                     KETDIYKVFQSGDLANLSGLSEDMRKRLPSLYKVRSALYSQAFRDLVSSVTGCGKLSG
                     SKMDISIHLYNRTCHLLTHDDVIGSRRVSYILYMPDPDRTWKPSNGGALRLFDSIVPN
                     VPKSDPYAQLSPQFNQIAFFKVQPGFSFHDVGEVISSKQRLSLQGWFHVPQPGDNGYI
                     PGEQEKSESKSTLEQLETEELKEYDFPKMELNDISEQEAKQFTLDLTAEDNKYLMKYM
                     NPLLMSEGSIKQLQNTFSENSVVDIVSFLNDEYATLFRKQMRHFELNEYPSMPSKQEE
                     VNFPWKLAIPSHKRRYLYIDGKPEEDISTAQSIQRINETYADEQPNFKLTEDIFKLLN
                     NEEKHDEVLMKMKVESDNDATTYNEVSASLCELASLFKSVAFGKWLYQVTKLEVLKDK
                     IFIRRFRPGHDFILATKIDERSRKEDDSSFLDGVLEATLNLTPTTGWEHGEWGAYELC
                     MMDEEAEKPEESEGKVYEDEAAIYRSSDSDESVAYESQACWNKLCLLFRDPSVMKFVK
                     YISYDSPGSRWDITASWLCKDAEE"
     gene            <1071276..>1073477
                     /locus_tag="FOA43_003731"
                     /db_xref="GeneID:62197131"
     mRNA            join(<1071276..1071282,1071523..>1073477)
                     /locus_tag="FOA43_003731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923981.1"
                     /db_xref="GeneID:62197131"
     CDS             join(1071276..1071282,1071523..1073477)
                     /locus_tag="FOA43_003731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779909.1"
                     /db_xref="GeneID:62197131"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR035684"
                     /db_xref="InterPro:IPR036695"
                     /db_xref="PFAM:PF00750"
                     /db_xref="PFAM:PF05746"
                     /translation="MKSTTTNINSIMAGSREELAAQLAKLNLETPEYIEGSYPEYNVV
                     DLCRNFIAGQLTKLTGVDKKIAYESLEWSIVLEKGDLLVPLPRLRLKGDLVQMAGDIA
                     GKFELGGYLDRVVPVGKFLQFFFSPKFLLNTVTPDVLKRGSEYGSAPLGKNKTVLVEF
                     SSPNIAKPFHAGHLRSTIIGGFLSNLYEKLGWKVIRMNYIGDWGKQFGVLALGFKKYG
                     SDKELAENPIQHLFHVYVRINQDISAEKEEAEKTGIPLDENTCTDGQARAFFRKMEEG
                     DEKALFLWRKFRDLSIKRYVDTYARLNIKYDVYSGESQVSQMTIADVTEKLKEKELII
                     EDKGAWLVDFKKLGHKKLGKVLVQKSDGTSLYVTRDLGAAIERKNAYKFDKMIYVIAS
                     QQDLHTKQFFTILDMMGNKWAKDLVHVSFGMVLGMSTRKGTVVFLDDILENVQEKMLE
                     IMQQNKEKFAQVDDPKKVADQVGISAVMIQDMQAKRVNNYEFGWDRMLSSEGDTGPYL
                     QYAHSRLRSIERNCQVRPEELLTANMSMDNLCGNEEEIRKLNLSEEEEEKQLRSLKLR
                     VEKATALIRIMASYPDTLRYASKNYEPSTLVTYLFKLTHQFSSTYKFLRVMGEPKEVL
                     LARLALFSAVRQILNNGLRVLCITPVDRM"
     gene            <1073762..>1074388
                     /gene="RIB3"
                     /locus_tag="FOA43_003732"
                     /db_xref="GeneID:62197132"
     mRNA            <1073762..>1074388
                     /gene="RIB3"
                     /locus_tag="FOA43_003732"
                     /product="3,4-dihydroxy 2-butanone 4-phosphate synthase"
                     /transcript_id="XM_038923982.1"
                     /db_xref="GeneID:62197132"
     CDS             1073762..1074388
                     /gene="RIB3"
                     /locus_tag="FOA43_003732"
                     /note="BUSCO:EOG09343Z1A"
                     /codon_start=1
                     /product="3,4-dihydroxy 2-butanone 4-phosphate synthase"
                     /protein_id="XP_038779910.1"
                     /db_xref="GeneID:62197132"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="PFAM:PF00926"
                     /translation="MSEFEFTPIEKALADFKKGGFVVVMDNEDRENEGDIIVAAEWVT
                     QEKMAFLVRHSSGYVCLPVSEEIADKLDLPLMSTHSTDRHGTAYTITADAKEGTTTGI
                     SAHDRALTANAIANPDSKPADFLKPGHCLPLRAKKGLLRSRQGHTEAGVQLCQLTGLQ
                     PAAAICELVRDEDGLMMRLPDTHAFCKKYNVDLITIPQITKYMDEHNL"
     gene            <1074544..>1075203
                     /locus_tag="FOA43_003733"
                     /db_xref="GeneID:62197133"
     mRNA            <1074544..>1075203
                     /locus_tag="FOA43_003733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923983.1"
                     /db_xref="GeneID:62197133"
     CDS             1074544..1075203
                     /locus_tag="FOA43_003733"
                     /note="BUSCO:EOG09343XTB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779911.1"
                     /db_xref="GeneID:62197133"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="PFAM:PF03357"
                     /translation="MNRLFGTRSNAPKATLNDAMNNIDGRISSLDVKISKLNSELTTY
                     QQKLSKMRDGPGKNAIKQRALKLLRQRKQLDAQKDQLMSQSWNISQAQMTTDNLKNTM
                     ITVDAMKHSNKELKKTYGKIDVDKLEDMQDEMLDLIDQSNEIQDALGRSYDVPDDISE
                     SELDAELDALGDEVEANNELAGESMPSYLTDSAIGESDKLPTFIDDKQSEGEEKEMVA
                     Q"
     gene            complement(<1075248..>1076201)
                     /locus_tag="FOA43_003734"
                     /db_xref="GeneID:62197134"
     mRNA            complement(<1075248..>1076201)
                     /locus_tag="FOA43_003734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923984.1"
                     /db_xref="GeneID:62197134"
     CDS             complement(1075248..1076201)
                     /locus_tag="FOA43_003734"
                     /note="BUSCO:EOG09342OQQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779912.1"
                     /db_xref="GeneID:62197134"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PFAM:PF05175"
                     /db_xref="PFAM:PF05401"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MIRRQIYTTHKRLFHFSLKCFNSQTHAIAKPDLTAINPSEKSHF
                     KNLAATWWDETGSQRILHKMNLLRMDFINDVIKSRLSLNEAITDPEQKVFIPGWNFQN
                     ILPEEVSHEIQKEIDQATREKCGDLQLKCLDIGCGGGILSESLARLSIVESVKGIDMT
                     PEVIQVAKLHKKLDPLLEDKLSYKVISLEHIDEKEKYDVITMMELLEHVDYPAMIVKE
                     ALSHLNPDGYLFISTINRDFVSWFTTIFMGEHVLNIVPVGTHTYGKYIKQRELKEFVD
                     EFQKDYRVVDSKNCGYFPTVGWFFTGIENMGNYMMAIKRKE"
     gene            <1076396..>1078459
                     /locus_tag="FOA43_003735"
                     /db_xref="GeneID:62197135"
     mRNA            <1076396..>1078459
                     /locus_tag="FOA43_003735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923985.1"
                     /db_xref="GeneID:62197135"
     CDS             1076396..1078459
                     /locus_tag="FOA43_003735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779913.1"
                     /db_xref="GeneID:62197135"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="PFAM:PF05764"
                     /db_xref="PFAM:PF08265"
                     /translation="MSDIKDSGLSSDSESESESDGFESIIATRERRANAGSRMRQLLA
                     MEEAGEPEIAADGKEDVDLLFEEDENDDEFVADDEEGGEEDALNQITDKRKHEGTEQS
                     EEDEEEQEEEFNLDENFSSDTEVNSSDSNADDSAGERELQKQEKLKRQKQKKREKQTM
                     IPLIKPVTPAKPQQPQKKKVKIYPSVLPTRRRYSARRSTVEKTDEVRRRLEKEEEEKK
                     YVRPRPKEQYTERTLEERLEEAKVTEEENTLSLNSYFEREADRKRKQRELANSRKLKL
                     KEFLRFYSTGVYITPNDEVEEIELEKERQEELLRVRNRRKRGKRKKKTPTSEDKEVKV
                     VSIEGSIGEFTQDVVRDATQDATQGATQVTTQNTTQNTTLEVRQDATQDNTQDATQDS
                     QEVKQETDQETKQETRMETKQKAQQDNEASSDGTPENKNEVSLASSKIPNEVPQNSIP
                     ENEAENGYPSEKPAVEEEDNLVDKTTVDATTVDATTVETPRYEGPPQFVTVNYVSLEE
                     FDHDPSEGQIKTFLFGEQSNLPATRRDPRYRTISIIKQDDTADIGLEQIKNEREASFK
                     SLLKFPRFGQKYRIVEELQSETPQEEVKVEIATPAPVGIYLPNGHRKKCLINGEFASY
                     YDPQNGIPYNSVECFKVLQGISEGEYLWIQIDKGGVNSQFKGGIGCYLGRKDQRNAKG
                     VPDGF"
     gene            complement(<1078505..>1078954)
                     /locus_tag="FOA43_003736"
                     /db_xref="GeneID:62197136"
     mRNA            complement(<1078505..>1078954)
                     /locus_tag="FOA43_003736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923986.1"
                     /db_xref="GeneID:62197136"
     CDS             complement(1078505..1078954)
                     /locus_tag="FOA43_003736"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779914.1"
                     /db_xref="GeneID:62197136"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR036338"
                     /db_xref="PFAM:PF09229"
                     /translation="MTTIFNPDNWHWIDRDCLPWAKQYLEDNLSKVVLRKDGYNIAVT
                     KVGPITGDCDITQRKGKVRCLIELMVDFSIKLQKGDGEDSSYVIGLPEFEHDQLDSDY
                     NFEIRDGNPEYKPFIRKEFLPIVLDIFKGFQQELLEEHKNSLRHNAD"
     gene            <1082031..>1083503
                     /gene="GND1"
                     /locus_tag="FOA43_003737"
                     /db_xref="GeneID:62197137"
     mRNA            <1082031..>1083503
                     /gene="GND1"
                     /locus_tag="FOA43_003737"
                     /product="phosphogluconate dehydrogenase (decarboxylating)
                     gnd1"
                     /transcript_id="XM_038923987.1"
                     /db_xref="GeneID:62197137"
     CDS             1082031..1083503
                     /gene="GND1"
                     /locus_tag="FOA43_003737"
                     /note="BUSCO:EOG09341LOY"
                     /codon_start=1
                     /product="phosphogluconate dehydrogenase (decarboxylating)
                     gnd1"
                     /protein_id="XP_038779915.1"
                     /db_xref="GeneID:62197137"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006183"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PFAM:PF00393"
                     /db_xref="PFAM:PF03446"
                     /translation="MDSADIAMIGLAVMGQNLVLNMADHGFTVAVFNRHTDVVDEFLA
                     GPAKGKSVIGTHSLEEMIASLKRPRKVMLLIKAGSAVDSVIEQLLPLLEKGDIIIDGG
                     NSHYPDTTRRYEYLKSKDILFVGSGVSGGEEGARYGPSLMPGGSIEAWPAIKPIFQAV
                     AAKADGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLICESYDLMKRLAGMPDKEISEV
                     MARWNKGVLDSFLIEITRNILAFNDEDGIPMVEKIMDRAGQKGTGKWTAIDALDKGMP
                     VTLIGEAVFSRCLSALKSERVRASKILSGPTVEKISESEKKQFIDDLEQALYASKIIS
                     YAQGFMLIREAAKEFKWDLNFPSIALMWRGGCIIRSVFLGEITKAYREHKDLENLLFH
                     PFFESAVMKAQPGWRKTVAKAVLNGIPTPAYSTALAFYDGYRSERVPANLLQAQRDYF
                     GAHTFQILPEYEDDKKKAGKNIHINWSGKGGNISAQNYDA"
     gene            complement(1087387..1087460)
                     /locus_tag="FOA43_003738"
                     /db_xref="GeneID:62197138"
     tRNA            complement(1087387..1087460)
                     /locus_tag="FOA43_003738"
                     /product="tRNA-Val"
                     /db_xref="GeneID:62197138"
     gene            <1088994..>1091048
                     /locus_tag="FOA43_003739"
                     /db_xref="GeneID:62197139"
     mRNA            <1088994..>1091048
                     /locus_tag="FOA43_003739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923988.1"
                     /db_xref="GeneID:62197139"
     CDS             1088994..1091048
                     /locus_tag="FOA43_003739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779916.1"
                     /db_xref="GeneID:62197139"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="PFAM:PF01735"
                     /translation="MKLLPQSAFALIASFVSLTAANYAPSYGKCPSKNVMVPPGGQSE
                     GLLRKNTLLSENEYEWVQGRRNKTTSNLVDFLNGLNLTDFDGDNYFDDYFENGNDSQS
                     TINVGLSFSGGSFRALLTGAGEISALDSRTKSSGNSTGLQGLLDSAVYLSALSGGSIM
                     LSSLIFQNWSSVDQILDNNEIWNFTESPVSTDLTFWANLLSEAKVRETAGYDITLIDL
                     FGRILSKYMFANYEDDGDDLAWSEIQTMDAFVDHEMPYPMILATGGVDSNMSDFSYNV
                     FEISPYEFGSWSPFVGGFTEMEYLGTSYKAGKPANSSKQCTVKFDNAGLMVAYSSDFI
                     AAWSEYLPEITSGNQTALDALTDSESGTMLGSSFNVSVSTLSSLFNMVNTDTQDVLYA
                     LMANPFFESTLPSNESDIPSNKTLKLVDGGLFDEGVPMDPFLVPAREVDVVFAYDNSG
                     DTNDTWPDGTSLLATKRRWEKSFPDDNFYDIPDSADDFIAQGLNTRPVFFGCNGTSLI
                     TDEIEGDNADEFNYMKPLLVYIPNTNMTELSNTSRVVFTDEERDSMIQGGFEVATRLN
                     FTLDDEFAQCAGCAILRRSMERRNTDFGKQCQRCFDKYCYDSGNENTQNLDEENLPTS
                     LYGNGNGSTASSSATGTATGTATSSATTTSTSSSKGGAESSVNPKHSFWLGLMVMMLW
                     QL"
     gene            <1091186..>1092244
                     /locus_tag="FOA43_003740"
                     /db_xref="GeneID:62197140"
     mRNA            <1091186..>1092244
                     /locus_tag="FOA43_003740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923989.1"
                     /db_xref="GeneID:62197140"
     CDS             1091186..1092244
                     /locus_tag="FOA43_003740"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779917.1"
                     /db_xref="GeneID:62197140"
                     /db_xref="PFAM:PF13324"
                     /translation="MPELLKPTKSDIKQLIGSSKDALTFWVETIILEKSSKAGTTSSA
                     PAVSEIQTARLDSPLEELVKLASLVHARVTKLGIVFKPLIPEENYHACYKELDEGMHS
                     MILLVSVSKQLQQEEQKYSFVFVEELLNCIKIVLTGYMGCLNELENAIDAENQGQSQR
                     LVSVGKVWEACSDLQRQVQQGSSGLLKAKLKQTNQLINDASKEYNDWIANPTAEDQDF
                     NDFANFDDLHNSKSLHNETEVDTTLIEFAKRWNGKIKMIKLLIMTLNKSIPDAKYNIK
                     FSKTIDLLNSKSFKLSEKVDDLVASVIYDQDVEEAKSAGKELIEEATQAALLVRTMNE
                     GNSTRTRWLDTWSKKFVE"
     gene            complement(<1092313..>1094196)
                     /locus_tag="FOA43_003741"
                     /db_xref="GeneID:62197141"
     mRNA            complement(<1092313..>1094196)
                     /locus_tag="FOA43_003741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923990.1"
                     /db_xref="GeneID:62197141"
     CDS             complement(1092313..1094196)
                     /locus_tag="FOA43_003741"
                     /note="BUSCO:EOG09343QOA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779918.1"
                     /db_xref="GeneID:62197141"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR033927"
                     /db_xref="PFAM:PF00568"
                     /translation="MTILDTKDKEKVKRTVPKPSNKIIDATVARLYIAFPDSSSWVFT
                     GLSGAIALVDDLVGHSFFFKLVDISGNRGVLWDQELYVDFQYNQDRLFFHTFELDDCL
                     AGLLFENKSDAQNFYKRVTHRQKYASKQTLQNKKAIELKRKPQAEVAQVGLRGDMYTD
                     DESQQTTRSGILNEQRQRRIHNIIYYDKEPPPEWRSLYKELESVGITEDMIAENREFI
                     KDYIAKRGGPLVGLEPPVPRKYQYKVDAKPATIASPRSRSGTVGSSSSSRRKKAPPPP
                     PPGVSAGGRKASSNSVTTESASGSTDSLGSIPEPAASARSGPGSTTTYSVPPLPAYLQ
                     NNSQQNATAYSVPPPLPPSQQRPVPAVPFLPPRGNPVVSPFARVNNLAPPPPPSRNNG
                     SYQPFYQQQPSQHSGNRVAPPPPPPRRAGPPPPPHRNYIQSQPPAQITPLTPPRVPPV
                     QLQPPPTSFPTLSFPPPPARNTTAYNRPAAITPQAQETPAVVQAPDFMTPTASVFVPP
                     PPPPLPSTAPSSVTAAPPPPPAASSGPFTPSLPSTDPGRGALLQSIRSAGGLNALKKT
                     DKAHLDKPSVILQEVKGDTPAPTSSAGGPAGQPATLADALAAALNKRKNKVAQSDDED
                     DEW"
     gene            <1094412..>1095627
                     /gene="YPT6"
                     /locus_tag="FOA43_003742"
                     /db_xref="GeneID:62197142"
     mRNA            join(<1094412..1094436,1094492..1094619,1094966..1095545,
                     1095608..>1095627)
                     /gene="YPT6"
                     /locus_tag="FOA43_003742"
                     /product="Rab GTPase ypt6"
                     /transcript_id="XM_038923991.1"
                     /db_xref="GeneID:62197142"
     CDS             join(1094412..1094436,1094492..1094619,1094966..1095545,
                     1095608..1095627)
                     /gene="YPT6"
                     /locus_tag="FOA43_003742"
                     /note="BUSCO:EOG09343Q36"
                     /codon_start=1
                     /product="Rab GTPase ypt6"
                     /protein_id="XP_038779919.1"
                     /db_xref="GeneID:62197142"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF08477"
                     /db_xref="PFAM:PF09072"
                     /translation="MRQGGKQKPLKKPKKKGQNLDEQDVAFKEKKKEEEKLVKQMAAK
                     AAGKGPMYKIVFLGDQGVGKTSLITRFMYDTFDSHYAATIGIDFLSKTMYLDDKTIRL
                     QLWDTAGQERFRSLIPSYIRDSNVAIVVYDITNKDSFNDVQKWFDYIRAERGTDVLIV
                     LVGNKSDLEDKVITSEEGEEQAKKLGCNFFIETSSKNGYNVKKLFKKIAKLLPELQNE
                     DADQALGGGNQNVQTIDVSTDKSPQEEGIANQ"
     gene            <1095643..>1097427
                     /locus_tag="FOA43_003743"
                     /db_xref="GeneID:62197143"
     mRNA            join(<1095643..1095648,1095742..>1097427)
                     /locus_tag="FOA43_003743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923992.1"
                     /db_xref="GeneID:62197143"
     CDS             join(1095643..1095648,1095742..1097427)
                     /locus_tag="FOA43_003743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779920.1"
                     /db_xref="GeneID:62197143"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="PFAM:PF04090"
                     /translation="MHPSRLVCSQGMSYIFEPIYNILLTKRAKEIKLGRLLDESANSA
                     VAYEQDSQRNRSNPNNRARIPSNTDLRVDERTFEVWISEDEDEDNNDSTVHKRRKLNH
                     DTRIIDDESHRNDTVRRQRHIEPAQLEDEIESIRRDFRDTIDGYEPRPLVLTSDKDAG
                     RGYFSNNIRSTANIKRSRRLRFTNQINHSYTVINSLLHICMLRSDWKNALQLFSVIIR
                     TYMCDVKQCWSIGLEILNKMNEEEFLKLLKDEGHEPLSGEKLQLAAASRSIALERIFE
                     HDDESYKAITRMIALGNTKRPFRARIMRFLQFMTNTYKVNRPNFHIAKYPYQVYCPKD
                     EMTRYLTLASHSHAAYRGGTTDFVPFYVYSLLSELMLGGRFKQFEELCEELQLRAPYH
                     DDPMVRYMSAMNSYLECVSLYCRLCQEYGSILQIIDDMQSQDTKTVDKELIISKIADC
                     KTRFHELEKFPKFKVDLDKIDKDLGYFSGLVINTQKSETVDRAVASDIGKHDTEASNT
                     EASDAEASDTEANNSDTDTSGSSDFFREDEDNVAMLEEQQAEEDGDRDYQHDEPT"
     gene            complement(<1097471..>1098127)
                     /locus_tag="FOA43_003744"
                     /db_xref="GeneID:62197144"
     mRNA            complement(<1097471..>1098127)
                     /locus_tag="FOA43_003744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923993.1"
                     /db_xref="GeneID:62197144"
     CDS             complement(1097471..1098127)
                     /locus_tag="FOA43_003744"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779921.1"
                     /db_xref="GeneID:62197144"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="PFAM:PF07047"
                     /translation="MKPPILKLLPLSSIAVKLSTLFIRQISKPIANLIKAEAKNHPGF
                     KRFCVRVAQNIHFFDNRLKEKLLGHSMRPIRPLNEARAIANGANFLSEAFIFSVGSGA
                     LLLETNRQRQKEKNRREAVADDIAMLQEEIEGIKKQLADYSIKIDDYRAPANYKPFVL
                     RIAEDGTVLPGTNNHKEGDSDYQSLRKSVGQDMKQLNDNPGETVGSSDSTMASNIKFV
                     "
     gene            <1098407..>1099897
                     /locus_tag="FOA43_003745"
                     /db_xref="GeneID:62197145"
     mRNA            <1098407..>1099897
                     /locus_tag="FOA43_003745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923994.1"
                     /db_xref="GeneID:62197145"
     CDS             1098407..1099897
                     /locus_tag="FOA43_003745"
                     /note="BUSCO:EOG09343B6P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779922.1"
                     /db_xref="GeneID:62197145"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF12678"
                     /db_xref="PFAM:PF13639"
                     /translation="MDSLASRKNLFSAYLAVSSALAAYAIYGVLWSKPNLYAAGIELS
                     KGFPLVILTNWLIGWSILIGKLLQELMFGELRLIEIEHLYERSWYTVTNLIMTLAMFR
                     SQNNLLIFGMILSLLFLKIFHWILGDRLDYLFQQQQLSDYNGVKKVILNRTTAVLGIF
                     LVLDYKVISTCIDHAFLHSTDVFVVFGLDFLMVYLELLEATLKYTMNVGEIIYLRYRP
                     DDEIWEDKAWISKVGMIAISFFRLVAVGFVFVGLIYAYIIPVNFTRDVYIGVVKLVKQ
                     LKDLFYLIKAARDLDTHITDATDDDLIDQEMCIICRDDMTTDVPSKRHRNAPKKLPCG
                     HVLHFGCLKSWLERSHCCPTCRREVFSDNRGTLPEWTHHHHGVHEEGEAMLNTGTVGG
                     DTTRGNPHHTRGPREPQEPQEAPVTPLAPEGTPTTTTTNTSDFSIRLPSDSIIPTDWT
                     ILPMERTNKPNQYNVRLNRETTCNLRVVKRDRIMNREEFEQYVVRH"
     gene            complement(<1100030..>1100428)
                     /gene="HTZ1"
                     /locus_tag="FOA43_003746"
                     /db_xref="GeneID:62197146"
     mRNA            complement(<1100030..>1100428)
                     /gene="HTZ1"
                     /locus_tag="FOA43_003746"
                     /product="histone H2A.Z"
                     /transcript_id="XM_038923995.1"
                     /db_xref="GeneID:62197146"
     CDS             complement(1100030..1100428)
                     /gene="HTZ1"
                     /locus_tag="FOA43_003746"
                     /note="BUSCO:EOG09344JDK"
                     /codon_start=1
                     /product="histone H2A.Z"
                     /protein_id="XP_038779923.1"
                     /db_xref="GeneID:62197146"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR032454"
                     /db_xref="InterPro:IPR032458"
                     /db_xref="PFAM:PF00125"
                     /db_xref="PFAM:PF00808"
                     /db_xref="PFAM:PF16211"
                     /translation="MSGKIHGGKGKGGAKEHVLRFQSHSARAGLQFPVGRIKRYMKSS
                     VQNKIRVGSKAAIYLAAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELD
                     ALIKATIAFGGVLPHINKALLLKVEKSKRR"
     gene            complement(<1101031..>1102695)
                     /locus_tag="FOA43_003747"
                     /db_xref="GeneID:62197147"
     mRNA            complement(<1101031..>1102695)
                     /locus_tag="FOA43_003747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923996.1"
                     /db_xref="GeneID:62197147"
     CDS             complement(1101031..1102695)
                     /locus_tag="FOA43_003747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779924.1"
                     /db_xref="GeneID:62197147"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR036236"
                     /db_xref="PFAM:PF00096"
                     /translation="MTSIQSHSTLVDSDKGLMSDSRDSSKGASTDSEMAESNSPEETD
                     TGVKELEASTALDSSSTTASKKFTHSSKSKRKSKGRIYKCTGFPNCSMTFTRSEHLAR
                     HIRKHTGERPFKCDHCLKRFSRLDNLRQHKQTVHMYENFIMTYPGEKVNVRVKSRMAM
                     DGNRYTRRKQAHATRRGSMPQQIPKSKSIQFASGGGSVAFLDPMDLMNRQYCALPIGQ
                     LKQQSVVSPHTPTGIGADYSHLLSPPPSVSPRLTISQPEDSSLPPPRRTNLLSRACSE
                     FRPNASHKPCPIAIPRVSGSSALVTPNSGISPTPLSAISFHGDPLLATPYFAQRGAAS
                     NSNSINAVSPSIAFYSNPNSPYGPGPAFSSSPTATYYGHVSGYSPHNCIASFPPPPPP
                     RQPVQVQRVLQAQQTPQAVQSSQNQLPAIYDSLRYTPSVPQLPPLQTYSIRPAISIAT
                     SPVPSISSPMIAESRLKPLQKIAPALKASISMNSSKEASSEIASRGTNSRTSSESGSG
                     CSSRTSNRSGATSRTSDGTSEESNTDSNGQHSTKGWLKSVLNTEEH"
     gene            complement(<1104442..>1105716)
                     /locus_tag="FOA43_003748"
                     /db_xref="GeneID:62197148"
     mRNA            complement(<1104442..>1105716)
                     /locus_tag="FOA43_003748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923997.1"
                     /db_xref="GeneID:62197148"
     CDS             complement(1104442..1105716)
                     /locus_tag="FOA43_003748"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779925.1"
                     /db_xref="GeneID:62197148"
                     /translation="MTQTKFKTDLELLESQLVGPQDEAFAHTRFRDSPATICTTKIPL
                     MEPSLSEEQQKELRVSTTPCMSLFGIYLHLITGLLIVYCKDRQSFTIRKTRYELQDVI
                     NRTMRNEIWMRGKAVEGKHYVRLNTSYNMNRTRLLTQSTGSFPASSSIVNGSTSDGDD
                     NEEYPEIGWQDLSRDISIEQKRKKLYSIEEDVPIGLFSNPDVVIPMLPIYIGYKPADA
                     KGCVHVYEPVDFSQPSYKKQIKEHLGGMLFFQNIYSVIEKYRVPVNICRSEELGLIYP
                     SVDFPLKEFIADKNGAQPGQLTGFVVNWFEKVDCDQEGSESSIESVVESLSGSQPLVS
                     RNDAHSSQDDTDEFDIFCHIMDEDNGRSTAIMGARKETRWKRARQNRAADHSTLLGNN
                     REAQPDPDDISGAGSDDLDIFYKALPTPVRKP"
     gene            <1105899..>1107170
                     /locus_tag="FOA43_003749"
                     /db_xref="GeneID:62197149"
     mRNA            <1105899..>1107170
                     /locus_tag="FOA43_003749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923998.1"
                     /db_xref="GeneID:62197149"
     CDS             1105899..1107170
                     /locus_tag="FOA43_003749"
                     /note="BUSCO:EOG0934245L"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779926.1"
                     /db_xref="GeneID:62197149"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="PFAM:PF02207"
                     /translation="MAKRVIPFEKATKTSNANEDKENSSSITAEDYLENQLHLEKEAR
                     ELMPYDSNQCTYGMGPLRQEVYACLTCYEKTKKPCGICFACSINCHSKHRLAELFTKR
                     NFTCDCGTSRINSNGHCRVRMVQPDGNVDRSGLLNLQTRHSEISNLDIPSLSNTYNQN
                     YSGLFCSCCRPYNPEEDTNMFQCQFGQACGEDWYHEECIMGLRPQVIDRKRKSSAEKP
                     VIDISDSEESSVLPMPGFPDLDSFETIICWKCVLKFQHEFDTLSSLLECQRVYHVEAE
                     SVEARDALLNGRSDSDNIGIKRMKKQFPYTLLLKKDFKKHIKQIVLENKPSNFELIKL
                     LKEFPYMYNDDPIYKPPEDSDDENSSMFELGLKNLNKVPVEQALTGMEAYKKMKSRLT
                     EFLKPFAEQKKVVTEEEVKKFFSTEMSQKRD"
     gene            complement(<1107240..>1109342)
                     /locus_tag="FOA43_003750"
                     /db_xref="GeneID:62197150"
     mRNA            complement(<1107240..>1109342)
                     /locus_tag="FOA43_003750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038923999.1"
                     /db_xref="GeneID:62197150"
     CDS             complement(1107240..1109342)
                     /locus_tag="FOA43_003750"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779927.1"
                     /db_xref="GeneID:62197150"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="InterPro:IPR038609"
                     /db_xref="PFAM:PF11496"
                     /translation="MKSIEEDAPPQDPEDLIFYLPIDQTLVQRELVEIMVKLHRPSIL
                     KILGKLKVESGAPLYPVEGSFVDDSVMLEAFVSNVKQIGNHPTLLVNHFIPKNLLLLD
                     TKENIINSSLKYVKLDELLNRLTERKQPKTIIISVSNGKELDLVESILIGKNGMQYYR
                     FSGASIYYKNHGSFDFSKKTHVSDNEDSETIDSHDDNFESKSSTPSSHSFGKSRKRKV
                     RGSYEKDKSAHIRGGHRGNGRGGNNSNGKHKASDDYTPRISKNSPLYQKIQAEKHNSK
                     LSVYLILSNQLKYLTQFEELKSDLIITLDSNLKQVTPKKLQVPILKLIITNSLEYFDQ
                     QLQREVPTLRASPEIYNKFLAYLTVAYRSTVNTSDNNSPVGENLIDWMMDVRHRPFPD
                     DLRIPRFPVASLRIEDLASQCEESMENIQFEKPYDVKKYKFYDIGLNSEHKEQNGHKK
                     PKLEELEVPAVMSYRKYQILLAQMVYERCKELGNAITKKKESLAVIHTDDSKRQFTME
                     SNNAEIGIMYKKLRSDKTSNESMSKQLDRLTGDLSKLKGILEQLQNRTSEYEKKAQSG
                     TSDEDVKLKENALNDLNEQLEGLRVGLKKNNNTDEALRAQYQSKSSEAARLSTESGLL
                     DKKIEGLNKESGGLFKRLEERQVDYEIEDMQRKVDDLNRDNNFLESYIDHLDVALKKR
                     QRSGPQSLRKTSRSGTPL"
     gene            complement(<1109546..>1111960)
                     /locus_tag="FOA43_003751"
                     /db_xref="GeneID:62197151"
     mRNA            complement(<1109546..>1111960)
                     /locus_tag="FOA43_003751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924000.1"
                     /db_xref="GeneID:62197151"
     CDS             complement(1109546..1111960)
                     /locus_tag="FOA43_003751"
                     /note="EggNog:ENOG41;
                     BUSCO:EOG09341F0C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779928.1"
                     /db_xref="GeneID:62197151"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="PFAM:PF00412"
                     /translation="MSKQKTREDDLVNMSGLFSDLPTFLREPYPNVKFNSAFPPFTTK
                     VHVRGVMERAGFDVYKPQNDSRHHEHDDKYTKIGRNRLVSESGLMSPGPLFGKKGPTN
                     YSDPSLRRSGENQRSFTTPTIGRGFNSNPNLRRMNDSPHSVNSGSSKVESRSGPDTPK
                     SSSRTTMLRGANASSMLHNQRVVPDVQRGGPQPPRVPVENAKSISLKNQKTFENKSGS
                     SASIHLPMSSSDQLDSHFEFPYKPSVHPTSSNLPIPQAHMAALLERSKQQQKLNQHQE
                     PHESHERLHSDGRVERNERPVSRESVSSFMFQSPRMAIKEIDLSSGEEENFKDSREDR
                     SRKLISPFDDDDDDDDDDDDDDDDDDEGKRKREVSHHHNGSENDSSIDAFDAQFEESK
                     SNHESHLNHQRDDSVDQLLAIRKQMASPQTGENSEAFQIPDIQVGDEDERPSALQAVA
                     SASLYANAGIKRLSTMQTNDLKIYNLPEDDTDSIDEGKNSDLDHFDMSTIQEITEIDD
                     YHADGSAPTSTSETSPLNDFDVPGLRKMRVNPLESPTQIQNRSAEDLIDPSDRNLHTH
                     SISHSSVNSGNPVAKDIFNTTDSSEDSYKNDINRRSTSTKSSDNSDADGNRTGPLDLA
                     HPKKATSEEFHKSENENAKDQDNEVKYPPGQGPCRRCHKHILPGQKSIWSKDNQLSGQ
                     WHRRCFSCYACSRKFSKGQSCYVYNDRPYCETHFHELNGSLCRICGKGVEGECLQNEV
                     NEVFHMDCLKCAYCGVPIRTDYFIYNDKVMCKNDADEQLKLIREGNNGQESDKVVKRR
                     TRMMYV"
     gene            complement(<1112507..>1113181)
                     /locus_tag="FOA43_003752"
                     /db_xref="GeneID:62197152"
     mRNA            complement(<1112507..>1113181)
                     /locus_tag="FOA43_003752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924001.1"
                     /db_xref="GeneID:62197152"
     CDS             complement(1112507..1113181)
                     /locus_tag="FOA43_003752"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779929.1"
                     /db_xref="GeneID:62197152"
                     /db_xref="InterPro:IPR032816"
                     /db_xref="PFAM:PF09335"
                     /translation="MAEFSSTWNAWGWKGWMASFMMVVLISFPPLTGFNICSIFIGMV
                     YGLKGWPLLASATVVGSACAFAPFKYVLRKRAIQLMNYSENLKLFMDVFNDEDSSYWE
                     NLLVLVLLRMSPLPYSLSNGAIAAIPGISVSNFALATAITTPKLLLQLLVGIQLKGLN
                     DNKTTGLSKVLNFLGVILASGSFTAVTFIIFSKMKARIQKKNRIPDDSLDALVFESDS
                     AVRMEL"
     gene            <1113769..>1115690
                     /locus_tag="FOA43_003753"
                     /db_xref="GeneID:62197153"
     mRNA            join(<1113769..1113773,1113824..>1115690)
                     /locus_tag="FOA43_003753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924002.1"
                     /db_xref="GeneID:62197153"
     CDS             join(1113769..1113773,1113824..1115690)
                     /locus_tag="FOA43_003753"
                     /note="CAZy:GT71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779930.1"
                     /db_xref="GeneID:62197153"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PFAM:PF11051"
                     /translation="MTNENAEIKNLYFNDNPKMVVTPELVINLLEDESNKFHSEHRAK
                     FEQQLTANMLTQPRPLDFTYTDRHVDFREFMSQFVDLLNKNRLLFPHPERETTSDGKP
                     VIWDTLFLDKPFDVLSQSQLYEMMHFDPASIEDLKLKHRIVTGSLPLVKPTELYHSNG
                     YVMIGGGMYTWYAFLAIQALRKTGARLPLELIIPKQEDREGWLCDELLPVKYNVKCVT
                     FDSIFGPELLKKMGELKGYQFKSFALLGSSFRNVMYLDSDNFAVKNPDYLFESDLYKR
                     YKMITWPDFWRRTSSPSLYSVLGIKVGSLPVRRLNDMFTSPEAYYTKDDLVAVEERVN
                     YHDRSGTLMDWSTESGQFLFDKEAHFNTLLLSLYYNYDGPAGYHPLLSQGGAGEGDKE
                     TYVLAAHFLKKVHYQVYRKPDKLYGSFIKDSNWYVDSTIVQMDPVVDYNNLKQIILKN
                     QQQRQHKDSRVYSYDYTYGSFATSGNFKSVPMFYHIHAPKINPFEYVEKDLFTNMEDE
                     PIRNFGNDYPKIGYDLELMIWQTIIKSLCEDQQQFKCFEGLDIGQICNNSVVDERVDW
                     LNRTGRAALDGYLEQTFLGPTELNEEENTKLDDMIYGKFRDSLNYTMTRLPNGKINN"
     gene            <1115805..>1116470
                     /locus_tag="FOA43_003754"
                     /db_xref="GeneID:62197154"
     mRNA            <1115805..>1116470
                     /locus_tag="FOA43_003754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924003.1"
                     /db_xref="GeneID:62197154"
     CDS             1115805..1116470
                     /locus_tag="FOA43_003754"
                     /note="BUSCO:EOG09343VUN;
                     EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779931.1"
                     /db_xref="GeneID:62197154"
                     /db_xref="InterPro:IPR013640"
                     /db_xref="PFAM:PF08432"
                     /translation="MADVPPFKNCYRLRHVAEADSKSCIICYKPSPTVLITLNGKDWF
                     YVCSSHLTDKNFCLVIYQDDEGSVKDSELIDLKAEETILMRRLKHLESLQESKNSQFS
                     KIKGYLWGKKKEKEEKDAENIDDDLKPSDVKAPEDAKNLTLDQIMKKIRSLRTGEIAE
                     MKEKLESFDKAYKKFKLDTVFYRNRLLSDYRKQKQSKIQKSLQEGTLFPSVDNLPELS
                     KKE"
     gene            complement(<1116482..>1117696)
                     /locus_tag="FOA43_003755"
                     /db_xref="GeneID:62197155"
     mRNA            complement(<1116482..>1117696)
                     /locus_tag="FOA43_003755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924004.1"
                     /db_xref="GeneID:62197155"
     CDS             complement(1116482..1117696)
                     /locus_tag="FOA43_003755"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779932.1"
                     /db_xref="GeneID:62197155"
                     /db_xref="InterPro:IPR016181"
                     /translation="MPIFRKSSRSSSSLASSSTGNTCYGSDEAADRVGSDTDRRVSTS
                     HKRFKPRVEVIAIKDYKKAAKTLQIAFKDDLYVCYLTSGITDSRLKEQLDLALFEATV
                     YSTLLSGMVVAVRDVEGEKVDADAPFLAVACFDKPRPREDHSSKSLLGSLWSMYKGGY
                     LKFIWMANKETRQRVLEEQSSMLEEFRYEALGDEFASSWYMSDIGAIPKGRGKGLARA
                     LVDYVCQHFIDTYRPPSPDGDDLDEELNNLETEAAAAVGGGGAGSNLFQASEDSQLNS
                     EIESFKFGFDLDSDNFTDYSGYSSASDSDSSSAHSSWYYKEEEDILAQYDNRKNKGLQ
                     IGAPLYLESSHPRNKKIYQKLGFTYLKTVDIAQVTDKNGYLKTLTMDLMVRGVKGARW
                     VKKAERQLINTT"
     gene            complement(<1118264..>1119547)
                     /locus_tag="FOA43_003756"
                     /db_xref="GeneID:62197156"
     mRNA            complement(<1118264..>1119547)
                     /locus_tag="FOA43_003756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924005.1"
                     /db_xref="GeneID:62197156"
     CDS             complement(1118264..1119547)
                     /locus_tag="FOA43_003756"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779933.1"
                     /db_xref="GeneID:62197156"
                     /db_xref="InterPro:IPR027417"
                     /translation="MRFAILGPPRSSKSSILSIVSNDKSIENYYPTLQNSPTLIQFQP
                     KSAIARALVDVNVTLSDLEQANISENPEYQLTTRILESVADASGLVSAGDDMANRSTH
                     SILKKTLNFYDLDYTRPNYFSTEMISNLSPVSSPIASYSIDSGSGMARPYFSSVMDGG
                     HMDGSPTSSSSTSYIAPVCTPILMEVIDTPGVQSNDLIPFLEKGLDSRLASDVLRNLL
                     NEASTGSRSRVKPLITGSGMSELNAAMDGYLLCYSCIPETAEEVSPPSYDDATSSRVK
                     STSSKLPSNGCEPIEILKALYTAIMEAWKQYTTFRMGWQEGEEFDVYSLNYSFKHLWR
                     KRATSKDLSDKAITQKAKEMMPPILIAVTHVDHALASPVLIEEGRKLAELWGCGFIKV
                     SCEYENWRNVEEAFSFLVRDRLEDLKLKKSHRKAA"
     gene            complement(<1120277..>1120972)
                     /locus_tag="FOA43_003757"
                     /db_xref="GeneID:62197157"
     mRNA            complement(<1120277..>1120972)
                     /locus_tag="FOA43_003757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924006.1"
                     /db_xref="GeneID:62197157"
     CDS             complement(1120277..1120972)
                     /locus_tag="FOA43_003757"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779934.1"
                     /db_xref="GeneID:62197157"
                     /translation="MDSIDKNSSEVLVGSALRAAKNALIYGYKIRFVHAIALQLLSVK
                     KNQNYWKQFIEKVAKSVRMGLNHGKVLALFALLYKLLFGTLLTLSRETVKGRKSEEYW
                     TKVKGSIGFISGFISGLLIYGGVLNEHFGKDVLNDRILTQITLYTLSRTILAMGKYLA
                     VRIAGSGKGSRQVKKIEEVSWKVGTAAVWGTVMMFYSIDRKYYLQRAMRISMDFLYGE
                     TLYSWMDAFNYGH"
     gene            <1121337..>1123145
                     /locus_tag="FOA43_003758"
                     /db_xref="GeneID:62197158"
     mRNA            <1121337..>1123145
                     /locus_tag="FOA43_003758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924007.1"
                     /db_xref="GeneID:62197158"
     CDS             1121337..1123145
                     /locus_tag="FOA43_003758"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779935.1"
                     /db_xref="GeneID:62197158"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MEKYTDLNHPLYVPGTFSIYSSAVIRQLKKEQNRRRSSFTTNNS
                     SSKSLSSESGQMAPGVEKVTLQPHDLGLDYNYRYDSKVPLELIPELKTRYGVILLPQP
                     TNSPNDPFNWSFRRKTVHFLILMSLTALSAAITNNASTPQDSINNLTNISYDTLNNSA
                     GVLFISIAISTWLYAPLATLVGRKISFILGMLLSIAGSVWYASMAHSGDSFGSQVLIG
                     FSEGSTEAQVQLCLSSILFRHQLGSVITIYVLSYCLGTYLGPLVANYVAERSSFRWVG
                     WTNVIASVVGLLVVILLFEEDLFDYSRFKHHTTDAVFNFSLAQHGILSNEDDLTLGFF
                     DKKWGRWKRFSPISLPENRDYHNVLQFVKQYFKLLVFNLKCLWFPPVLFAGVVWGLQN
                     SILTFYLTTEDTDLGSRNFNYSSQKVALMNIPCIIGSTIGSLYSGSLTDYFILWMARR
                     KNGIVESEFRLYFSFLSGIIGCIGLVMFGIGVAKELDWRVFYVGLGFIAYMFSSACNL
                     SMLYVIDTYDQLILETLVAVALINNIMGCIFTFACSPWLNSSGTQNTYIALAVITFAV
                     MLLAVPYLIWGKTWRKATKNTYLQMVRARGGDTTTI"
     gene            <1123321..>1125054
                     /locus_tag="FOA43_003759"
                     /db_xref="GeneID:62197159"
     mRNA            <1123321..>1125054
                     /locus_tag="FOA43_003759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924008.1"
                     /db_xref="GeneID:62197159"
     CDS             1123321..1125054
                     /locus_tag="FOA43_003759"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779936.1"
                     /db_xref="GeneID:62197159"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="PFAM:PF07690"
                     /translation="MVKDKGVLNESSPLLFKGGSSECTTTIIQSHDSVETPTIPREEE
                     VIIPDNVWYIIISLWTSSFLSAADTTIVSTTANVIASSMNGSDKIAWIATSYLLTNAV
                     FQPLVGKISDVYGRRTTLLVSQVWFILGCLLCALSRTVNDFIVARAIAGVGGGGMSAL
                     SSIIVTDVIPLRKRGFFQGYANLVYGTGQFLGPIIGSIFLTANEKAGWRWMFGLQVPL
                     VSITSVLVFKNVHEFRFDAELLMKNRFRLSNIKKIDLPGSLSLAGFIVAILILFSASS
                     TFQVEAAVLCAVLSAISFYLVENYVVEERIIPPRAFQGLLRIAALIAFFGTMAMYSLN
                     FVLPLYVQIIQDFSSFQLGVFNAFGVFSSAAGSLIAGWILKEKEKVRPEIVVKKSVNI
                     SIGSCLLSFAGAFICMFFVRAVKPTIDRADINYLKMAIIALGYTLTSLGYGSFLVSLL
                     VLVVGEVGMRHQATVTGMNYMFRSMGSVGGVGISLGVYNLMLRKELYHYFVTKGREHG
                     FSIYHKLLKDSFYIRNGLPQIYVHKVLKFYRESLGDSLVLVFIMGSLALILSLLMRLY
                     NPHIGRHWTIV"
     gene            complement(<1125072..>1125986)
                     /locus_tag="FOA43_003760"
                     /db_xref="GeneID:62197160"
     mRNA            complement(<1125072..>1125986)
                     /locus_tag="FOA43_003760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924009.1"
                     /db_xref="GeneID:62197160"
     CDS             complement(1125072..1125986)
                     /locus_tag="FOA43_003760"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779937.1"
                     /db_xref="GeneID:62197160"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="PFAM:PF14519"
                     /translation="MPCKDLKRLRIVLLDFNKSLCDAWSKYLGEFERSPYSTDNLTWF
                     DQPVEISVHNGSFASLSEKLSMTPKLPYTGKPDYHKNITVNYTTTTILSPGNSVGYMG
                     GGFDKALANLFSHGDFTWKHSEHHVQEQLLNLYKGYLTPTNANLIEFHTDSFYRDSKA
                     WNLLSANSILHMPTMRVPRPLISDSNLQLYRFVFDCTWELLSTVNKANIETLKWKDDR
                     HAFIDTVILTGIGTGYGGVPMEIVGKAMIAAIVIFTNHSLLRIQKSIYCLKFLKEDYQ
                     KLIKADQMNVRVNTNPFDPCTDSLDVLF"
     gene            complement(<1126083..>1128209)
                     /locus_tag="FOA43_003761"
                     /db_xref="GeneID:62197161"
     mRNA            complement(<1126083..>1128209)
                     /locus_tag="FOA43_003761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924010.1"
                     /db_xref="GeneID:62197161"
     CDS             complement(1126083..1128209)
                     /locus_tag="FOA43_003761"
                     /note="BUSCO:EOG09340GCF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779938.1"
                     /db_xref="GeneID:62197161"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR036322"
                     /translation="MEIHRCRFIDFTPESVTSLAFTHASNAEEPTPKNLSLAVGRADG
                     SIEIWNPRHSNSRWLLENTVTGGSGRSVECLLWSVTNVFHEPRLFSTGGSTFLTEWDL
                     KRGIPLINHDCNAGVIWSCAINKSQNKIAVGCEDGSVSVVDISGGPGSIEHEAILQRQ
                     QNRVLSLCWIGDDMIIGGCADGRIRCWSYKGDDKGRLVQTLRVDKSKTESTLVWSVLA
                     LPSTGQFVSGDSTGSIKIWDLKHLALQQSFAVHEADVLCLSADASGSHFFSAGVDRKI
                     FDFSLTKAGKSISKWVNATNRLLHGNDIRAMASFQSKTHDWLASGGVERLVVVISMEG
                     FSSNIPLKFPINQLTSNVLVNRCKRFIIMWQRQEVKIWKLKEDKTKKLVAKLVLSDPE
                     SITSVDISQNGRYLVVARVSTVRLFELIELEKKVQVVKVGSSLLSQLGAKLIRFVESK
                     KLLLLCSIDNEITSVQFNSEDDEDNEEDISEFDDSQKPEEYDIPSPVSSDYRTNFTQF
                     VISKRGKYAALSNYDGSIYIMNLNTKVSSRLVKMNDSPTALNFTAIDTLLVATLAHKI
                     YEFNVNKAGTADLYTKWSKKNSELIPNQFTKLLGQPFGIFENSGKFWVYGTNWICFFD
                     SEKNFSGVIKQGKKRAANGIVTNNSSPNVEDNKDSTDRKKFWQTNDYKSLLLVDSLSE
                     YELVVVERPVEEMSSVPAFGVSRISL"
     gene            <1128891..>1130696
                     /locus_tag="FOA43_003762"
                     /db_xref="GeneID:62197162"
     mRNA            <1128891..>1130696
                     /locus_tag="FOA43_003762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924011.1"
                     /db_xref="GeneID:62197162"
     CDS             1128891..1130696
                     /locus_tag="FOA43_003762"
                     /note="BUSCO:EOG09341LP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779939.1"
                     /db_xref="GeneID:62197162"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PFAM:PF03969"
                     /translation="MSSLFTSTLLLSRGPSSYVKSLPRYCRYYSSRRSPLVPRVSKSR
                     FLATEASPLAEDTKKATEFVNSGAVSHTGFEEGVRISKNIGSETDNHSLTPLELYNER
                     VHVNQLKDDEYQRQILTSMQSLFHQLQHYHPPEVAKPNSMTPNGAYNGNTFINYFASW
                     FRSRRASTGYQPDSSEASRIPHGIYLYGDVGCGKTMLMDLFYSTIPPHLSKKRLHFHQ
                     FMQKLHKRSHELKLAYGGVHQEVDVMPILAWELSKEATVLCFDEFQVTDVADAMLLRR
                     LIDLALREDHGLVLFTTSNRAPGELYINGIQRESFVPCIERIKYKTRVIHMKSPTDYR
                     KIPSPVCSVYFSPRCDVAYNSKESLKQRKFHSDSWYSFFSQGHKMEYRVPIRIWGREL
                     VVPKCSPPYVARFSFKELCGRPYAAGDYLALASQFESIIVTDIPYLSIDSRDEVKRLI
                     TFLDAVYDSHSRIAVTAAAPFDDIFVEPEDIGEDAYTLSNVGIAKRAARLAAKGGLHT
                     SLSSSDDDPLVKTHGFDKGIADKANLFAKLDEERFAFTRALSRLKQMSTKAWVESIGV
                     MGPDMHKRPARTFPFTSTSVPGSLLSPRAQKATRV"
     gene            complement(<1130785..>1133295)
                     /locus_tag="FOA43_003763"
                     /db_xref="GeneID:62197163"
     mRNA            complement(<1130785..>1133295)
                     /locus_tag="FOA43_003763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924012.1"
                     /db_xref="GeneID:62197163"
     CDS             complement(1130785..1133295)
                     /locus_tag="FOA43_003763"
                     /note="BUSCO:EOG09341NLG"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779940.1"
                     /db_xref="GeneID:62197163"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /translation="MSILRYIDDGDLPYEQKLLKDPYNQDLWLDYIHFKRKGSVQTVL
                     ALLNRSVRKLSSSYKIWMLYINFRISLLDQGHQSLDETDKVIAIFERASLYLNKFPFF
                     WVKYLQFVILQYSYINVSFARLCFDRAIQQLPVVHHEKIWKLFLQFVDIIGGPTLFLV
                     NLRYCEFKMTVQDFNFAPFAGEETNQIEDKTLEAALDTIIDTVSTAKELDLLNQTFSK
                     IVCVPSLLTKFTKSEMELYSDYFDALISLVPAFMSDNNGNLQRLDSQVLIFHDNMNSK
                     FPDQMGKWIVKLAQYWRERKSYLQLISTFERGLATCMTLKDFSIIYESYTEFEDSRIE
                     LISRELDQIEGTSANQEDELNLKLNGCLQRYERLLSKRPFLINDVKMRRNPNDVKSWA
                     DRVLIYDPEGDQTAISLCYEKALMTIEPAKVKEPDLLAQLWIDYIDHEDKNNTGFKYR
                     SLFSTATKVPFKFVGDLEKVWSAWVDKEVEHGDMKHALAIIKQAVTLPKKIAMKYTEN
                     EIRYNDEKLSTQVRAHKSIKLWSLYLDIVQKDGAIIDVLKVYDEILRLKLASPSTILN
                     YCSFLEEHKYFERCFKIYERGVSLFKYPTVTEIWNSYLTKIVQYQQQLGIKSERIRDL
                     FEQALQNCPPEYKKALYIMYAEFEETSGLKLQSLRILSEAIIKINNNLDKLELYKLLI
                     AKTTTLKGPDSTSSVYQMALENLPVNIPGFIEDIVCGFVNIEAQQERFKRCRQILHYS
                     SELVMKYSKRQADRDQIWDVFKKFELEYGNELNYKAMLRFKRHLESSSLPIIKDNIDG
                     GLTDGIDFIHSSEQREQKASEDEPRNADQIELDLDDLA"
     gene            <1133533..>1134498
                     /gene="VMA8"
                     /locus_tag="FOA43_003764"
                     /db_xref="GeneID:62197164"
     mRNA            join(<1133533..1133552,1133616..>1134498)
                     /gene="VMA8"
                     /locus_tag="FOA43_003764"
                     /product="H(+)-transporting V1 sector ATPase subunit D"
                     /transcript_id="XM_038924013.1"
                     /db_xref="GeneID:62197164"
     CDS             join(1133533..1133552,1133616..1134498)
                     /gene="VMA8"
                     /locus_tag="FOA43_003764"
                     /note="BUSCO:EOG09343B7A"
                     /codon_start=1
                     /product="H(+)-transporting V1 sector ATPase subunit D"
                     /protein_id="XP_038779941.1"
                     /db_xref="GeneID:62197164"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="PFAM:PF01813"
                     /translation="MSGAGNRESVFATRMTLSVMKGKLKGAEQGHSLLKRKSEALTKR
                     FRDITKRIDDAKRKMGRVMQTAAFSLAEVSYATGGNISYQVQESVSSKGRFKVRARQE
                     NVSGVYLPQFEPVIDETINDFKMTGLGRGGQQVQRAREVYTKAVETLVDLASLQTAFV
                     ILDEVIKVTNRRVNAIEHVIIPRTENTIAYINSELDEIDREEFYRLKKVQENKQEGVA
                     QEEAEDAARKSRKADADAAEAEALAESIAKAKAQVAQAETDDEIKTTKNPVLYEVSQV
                     EKLEQRAEGGEQAVLQETEDDVIF"
     gene            <1134689..>1135921
                     /locus_tag="FOA43_003765"
                     /db_xref="GeneID:62197165"
     mRNA            <1134689..>1135921
                     /locus_tag="FOA43_003765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924014.1"
                     /db_xref="GeneID:62197165"
     CDS             1134689..1135921
                     /locus_tag="FOA43_003765"
                     /note="MEROPS:MER0032443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779942.1"
                     /db_xref="GeneID:62197165"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="PFAM:PF04389"
                     /translation="MQLTRDLTVQLGSLMVLFTILVVVLKNSSVYPILFNTLIDTYQY
                     PRKPDFHVSLTRSLIGDVSEERLGHRLEELSQLFPDSRYYNSESGYRSALYFYDVLQG
                     FTQRDRGRYTVRRFKHNGWRQPTLIFRIQGIHEQIVILGCHLDSMNLNPFANAPGVDD
                     NLSGIDVVLEALDIFTNESIVSDLPVLQNTLEFHFYAAEEVGSLGSQEVFKEYRKNNR
                     KVIAMLQQDMTGYTEGSNKKGIGEHFGIITDYASVTLTEFVKSLVDQYSEIPYLETRC
                     RKVCSDHVSSLMYGYPGAYALESVVDMSNPYIHSDQDTLEWINIGHVRKHAELVVAYI
                     SELAFTEDLPLASSVKDYMSFGYYDFIIMFSMTDTFRFVWCVALLATCVALGGSIYDD
                     VRGGEGVDQAYEVIAHHE"
     gene            <1136216..>1136473
                     /locus_tag="FOA43_003766"
                     /db_xref="GeneID:62197166"
     mRNA            <1136216..>1136473
                     /locus_tag="FOA43_003766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924015.1"
                     /db_xref="GeneID:62197166"
     CDS             1136216..1136473
                     /locus_tag="FOA43_003766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779943.1"
                     /db_xref="GeneID:62197166"
                     /translation="MNPTPNIASMLKQHATSFGLATSMIGPVLVTKYTMASNQPWLFS
                     ENAEGSNDGITMMQPATMIPPRLNAKDLDDMSEKAMLIIYD"
     gene            complement(<1136562..>1137878)
                     /gene="CAR2"
                     /locus_tag="FOA43_003767"
                     /db_xref="GeneID:62197167"
     mRNA            complement(<1136562..>1137878)
                     /gene="CAR2"
                     /locus_tag="FOA43_003767"
                     /product="ornithine aminotransferase"
                     /transcript_id="XM_038924016.1"
                     /db_xref="GeneID:62197167"
     CDS             complement(1136562..1137878)
                     /gene="CAR2"
                     /locus_tag="FOA43_003767"
                     /codon_start=1
                     /product="ornithine aminotransferase"
                     /protein_id="XP_038779944.1"
                     /db_xref="GeneID:62197167"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="PFAM:PF00202"
                     /translation="MTDDYNYPTPEFNLSSGKTKEYEEKYAAHNYHPLPVVFARAKGA
                     HVWDPEGNEYLDFLSAYSAVNQGHCHPRIIKALCDQAQKLTLSSRAFSCDVFGSWAKY
                     VTEYFNYECVLPMNTGAEAVETALKIARRWGYAKKGIKFDEGIILSCENNFHGRTIAV
                     ISMSTDPEARTDFGPFTKNIGPVIPGTDGKQLIRYGVIEDVELAFKNAGDRIAAILIE
                     PIQGEAGIVVPQMDYFKKVRDLCNKYNVLLIADEIQTGIARTGKMLCYQHFLSPEQKP
                     DMVLLGKAISGGVMPVSCVLSSTEIMSVLEPGSHGSTYGGNALACRASIEALEVVKDE
                     HLVERAKTLGDFFQKELRKLARESDGIIKEVRGLGLLTAIVIDHTRLQGKTAWDLCLL
                     MKNHGVLAKPTHVHIIRLAPPLVISKEDLLKGVDSIRQALKELSNA"
     gene            complement(1138290..1138362)
                     /locus_tag="FOA43_003768"
                     /db_xref="GeneID:62197168"
     tRNA            complement(1138290..1138362)
                     /locus_tag="FOA43_003768"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:62197168"
     gene            <1140821..>1141632
                     /locus_tag="FOA43_003769"
                     /db_xref="GeneID:62197169"
     mRNA            join(<1140821..1140891,1140966..>1141632)
                     /locus_tag="FOA43_003769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924017.1"
                     /db_xref="GeneID:62197169"
     CDS             join(1140821..1140891,1140966..1141632)
                     /locus_tag="FOA43_003769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779945.1"
                     /db_xref="GeneID:62197169"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="PFAM:PF01184"
                     /translation="MSGSEQVSSGDAETAAVPDYKEEMITKNKLLQKNSGRRPFPTSC
                     ASGIAVIGITLFTLGLILCEAKEVQSPAILSGCLFFASGLVELITGIWAIVDNNLFGS
                     TFMLCYGGLFLSLGVIVSDAFGTEAAYSSSDEYNNASGFYLTAWTVFTFFLWSSTFKS
                     TLAIFALMGLLFLFLLLYPIATFTGSKGVKVASGVVCFITGCGCFYGVYDGLNTAANA
                     FVRTPDDWLKMSASRHQPEDDSLIEIV"
     gene            complement(<1141823..>1142389)
                     /locus_tag="FOA43_003770"
                     /db_xref="GeneID:62197170"
     mRNA            complement(<1141823..>1142389)
                     /locus_tag="FOA43_003770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924018.1"
                     /db_xref="GeneID:62197170"
     CDS             complement(1141823..1142389)
                     /locus_tag="FOA43_003770"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779946.1"
                     /db_xref="GeneID:62197170"
                     /db_xref="InterPro:IPR008136"
                     /db_xref="InterPro:IPR036653"
                     /db_xref="PFAM:PF02464"
                     /translation="MQFPPDDIQSLVQKIADILLCRNQTLSVSEGACGGLLSAYLISI
                     PGASKFFDGGRLIYSLRSRLRLSGWNSELIKSYTGPSETVAIKFARNLRIEFGSTYVL
                     SETGYAGPSTDVGVDHVRITSDDASVGTVYLGVAGPYGDRSCTLETNVANRAENMQSF
                     AKFCLEFLLEVVLADNDTEDNGHSKEKE"
     gene            <1142637..>1143044
                     /locus_tag="FOA43_003771"
                     /db_xref="GeneID:62197171"
     mRNA            <1142637..>1143044
                     /locus_tag="FOA43_003771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924019.1"
                     /db_xref="GeneID:62197171"
     CDS             1142637..1143044
                     /locus_tag="FOA43_003771"
                     /note="BUSCO:EOG093445IB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779947.1"
                     /db_xref="GeneID:62197171"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="InterPro:IPR038633"
                     /db_xref="PFAM:PF04683"
                     /translation="MTLSLPIKFKAGRVECKENTGIYTPNPIKGEIGLKASEEGEGFY
                     SFTWSPRDKTVTGVENDELLVIAGDVTWRRVKSCTTGRVYMLLFLSSGAKYMYWMQDP
                     NDDEDDLSKETEKDEQLFNKINELFQPSGDDDD"
     gene            <1143431..>1145335
                     /locus_tag="FOA43_003772"
                     /db_xref="GeneID:62197172"
     mRNA            join(<1143431..1143437,1143474..>1145335)
                     /locus_tag="FOA43_003772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924020.1"
                     /db_xref="GeneID:62197172"
     CDS             join(1143431..1143437,1143474..1145335)
                     /locus_tag="FOA43_003772"
                     /note="EggNog:ENOG41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779948.1"
                     /db_xref="GeneID:62197172"
                     /db_xref="InterPro:IPR000210"
                     /translation="MEKGAYSDVTVLAFGNSYKLHRLFLDKSDYFRSLFLWSERQNGE
                     DDSDSDTDIENGSQKEHETIPATASKAIYTLDFEGDSRYTQASFELAVARLYGAINVK
                     EENKIPYNMIAIGQYLAISEVVCTATDYIVRNMDMSNISENLHFATVNNYGSASERII
                     QNGKGILCTDGWECGPQKWDGIPTSIITEVVGEDYFFVPTEWDRCIFTIKLIERRQAA
                     GIDDNKTLKPLNHLLNTMIHYCHMPPEQLQELEQLYDINGNHYINPQVLHNALWKSAQ
                     IQRLVLTASDTPQLENIVTNPLQPTPEIPWYKVPGKDDTTSGLPAELDELLYSSNSDT
                     FTQGVSHGQEDGKSTQGQQYLSENEKLYNWTRIPPFRFSVSFANVSDLMTDKRVYAKT
                     FWYAGSYWNLYLQKNHIPSKSTYQVGVYLHRANNGSPSPSPKNGLINPDIYIDNVNYR
                     SMPKMYSRDLHVSSSTSSTLITPPAVIAAESIPASADFPLSYIAGLEPEQTDLKENVT
                     DESLSSFNDLLISDSRIIGSSGNQMRIPKCSCGVNSSFCNYEDHRSTIRVYFVIFTPS
                     RRLKPTITSFLSVPNDFSKSQSWGWKSNSMCVFNEDGTFPVNHDPHLKFMIVLGNV"
     gene            complement(<1145411..>1146499)
                     /locus_tag="FOA43_003773"
                     /db_xref="GeneID:62197173"
     mRNA            complement(<1145411..>1146499)
                     /locus_tag="FOA43_003773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_038924021.1"
                     /db_xref="GeneID:62197173"
     CDS             complement(1145411..1146499)
                     /locus_tag="FOA43_003773"
                     /note="MEROPS:MER0061068;
                     BUSCO:EOG09342VYF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038779949.1"
                     /db_xref="GeneID:62197173"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="InterPro:IPR032466"
                     /translation=