GenomeNet

Database: RefSeq
Entry: NC_057362
LinkDB: NC_057362
Original site: NC_057362 
LOCUS       NC_057362            5586582 bp    DNA     linear   CON 15-SEP-2021
DEFINITION  Aspergillus chevalieri M1 DNA, chromosome 1, nearly complete
            sequence.
ACCESSION   NC_057362
VERSION     NC_057362.1
DBLINK      BioProject: PRJNA727462
            BioSample: SAMD00269937
            Sequence Read Archive: DRR262018, DRR262019, DRR262020
            Assembly: GCF_016861735.1
KEYWORDS    RefSeq.
SOURCE      Aspergillus chevalieri
  ORGANISM  Aspergillus chevalieri
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1
  AUTHORS   Kadooka,C., Mori,K. and Futagami,T.
  TITLE     Aspergillus chevalieri M1 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5586582)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5586582)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus chevalieri M1 genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP024416.
            Please visit our web page
            URL:https://chem.agri.kagoshima-u.ac.jp/honkaku/index.html.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Canu v. 2.0; Flye v. 2.8-b1674
            Assembly Name         :: AchevalieriM1_assembly01
            Genome Coverage       :: 357.6x
            Sequencing Technology :: MinION; Illumina NovaSeq 6000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5586582
                     /organism="Aspergillus chevalieri"
                     /mol_type="genomic DNA"
                     /strain="M1"
                     /db_xref="taxon:182096"
                     /chromosome="1"
                     /country="Japan:Kagoshima, Makurazaki"
                     /collection_date="2018"
     gene            <5192..>5956
                     /locus_tag="ACHE_10001S"
                     /db_xref="GeneID:66976958"
     mRNA            <5192..>5956
                     /locus_tag="ACHE_10001S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275186.1"
                     /db_xref="GeneID:66976958"
     CDS             5192..5956
                     /locus_tag="ACHE_10001S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131121.1"
                     /db_xref="GeneID:66976958"
                     /translation="MNINRAGHPPGPWRRYNIDPATAEPPAPQTPHPAMPGTVAGGIE
                     CRPRPTGAGVGGGLRTGAAAGGGSGSGAGAGVGSGSGSGSGYGLGLSYRCGAGADLGL
                     GSGLGSGSGSGYGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADL
                     GLGSGSGYGSGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADLGL
                     GCGSAYGSGSGVGYGSGFGLGCMSPLLCWNHTPFRA"
     gene            <6051..>6401
                     /locus_tag="ACHE_10002S"
                     /db_xref="GeneID:66976959"
     mRNA            <6051..>6401
                     /locus_tag="ACHE_10002S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276630.1"
                     /db_xref="GeneID:66976959"
     CDS             6051..6401
                     /locus_tag="ACHE_10002S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131122.1"
                     /db_xref="GeneID:66976959"
                     /translation="MVQAHTPGLMPSLMPGLITTHVPYMPLHITPITCLLVPVIPAML
                     PPVSIHCPIQIIVQYHPPAPPTCHHPHVLLHQLHLRCAQLSLILRPPRRLDNDRLAGL
                     PIPPGSPAFLCIIQ"
     gene            complement(<6553..>9479)
                     /locus_tag="ACHE_10003A"
                     /db_xref="GeneID:66976960"
     mRNA            complement(join(<6553..6783,6852..>9479))
                     /locus_tag="ACHE_10003A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277741.1"
                     /db_xref="GeneID:66976960"
     CDS             complement(join(6553..6783,6852..9479))
                     /locus_tag="ACHE_10003A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H;
                     InterPro:IPR027417,IPR014001,IPR011545;
                     PFAM:PF00270;
                     TransMembrane:1 (o763-786i);
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131123.1"
                     /db_xref="GeneID:66976960"
                     /translation="MRRGAIHGPLVAQYLARVARFKEKLAVAIHMTAGQPARAPELLS
                     VQYVNTPNNQFRNVFIEDGMVTLVTAYHKGFHASNDSKLIHRYVPRAVGELVVWYMWL
                     AMPFIGQLTAWQAGTAHGTVNGTSNGMSNGTSNGTWNGMSNGTSNGMSNGTSNGTLNG
                     TRAGTVNGTVNGTVNGMSNGTSNGTLNSTLNSTWNGTQAGTLNGTLNGTANGILNGTL
                     IGTQAGTANGTRASTVNGTSNSTLNGTWNGTRAGTVNGTLNGRANGTLNGTSNGTANG
                     ISNDTLNGTSNSTLNGTSNSMLNGTTNSIPIGTRAGTVNGTSNSTLNGTWNGTPNGTV
                     NGMLNGRLNGTSNSTSNSTPIGTPIGTQAGTSNAMSNGTTIGTPNGTANGTLNGTLIG
                     TSNGTPAWQPPSPYLWGPDPGMQRPWTPERFREVLKRETQARLGQALNIPAYRDIAIG
                     ISRRFLRASSTFTSDRQDETEQAAALDADCEDGMDADQWMAHMTDLQAGHSSHVAGMV
                     YGRQLMEQAGTTSHRRAMFRQSSVDWHQFLGFGCGTGVPGDVHADIDAGGLRAGLVDE
                     GSCPSRRPGQEQVRARLVDDPGQEWVRACLVDDPGQEWVRACLVNDPGQERVRARLVS
                     DPSQEGVRARLVDEGNRPIHHPGQERVRARLVDEGSCPIHHPGQERVRACLVNDPGQE
                     RVRARPVLGKRKRAPWQVEAEEHHMERRHQLQTMDMAAALQQMTGQAGMQFQGIQAPA
                     MAAIQQGKSPVVAVMPTGGGKSMLFMLPAWAVPGGTTIVVVPLISLRQDMQQRCRRLG
                     IPCMAWDRQQPCDEAAIVLVTPESAVTPDFHSFINRLVVMQRLDRVVIDECHIIMNQQ
                     KNFRSAMAQLGKLVRARTQMDQIDIYRARTSRGNVAYGVWRPPIPHTAPHGYGWEQDA
                     WIIQFLQAQLQWARARGEDGDICQPGPPGAGDGGGIGM"
     gene            complement(<9521..>10688)
                     /locus_tag="ACHE_10004A"
                     /db_xref="GeneID:66976961"
     mRNA            complement(join(<9521..10222,10278..>10688))
                     /locus_tag="ACHE_10004A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278852.1"
                     /db_xref="GeneID:66976961"
     CDS             complement(join(9521..10222,10278..10688))
                     /locus_tag="ACHE_10004A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131124.1"
                     /db_xref="GeneID:66976961"
                     /translation="MQEWCGPLPVYGMTARQQRKWQILWQLAMPTMARPQQAPHRARA
                     RAVHMFPGAGRILEQGGNPGSYRATEGRGVSPGDQPTAGHGVSPEHVEEAEETGNAGS
                     TEPAWMMSPMERACLEFCIELLNQRHRAHEYESPLLPPILSRMIKLARFMVVQKALWL
                     DPHVGDIIQMWQAQASTANGTVNGTVNGTVNGTPASPIAWPLASADAQLADIDEGCDS
                     ASPTRHTPTTVHDRPSFHDHVQQMVSRFMIRGTHGPMQTLLDWRTYGLKIHYNSTAPG
                     HVAWMGADELLYKDLHFTMGEFRGFIHGLVGATRELLCELLCIADGSSSAHTPSTMPL
                     PAIPWQGLYDDPTQGHPGWNFCTIAEPGGPWMAGGG"
     gene            complement(<10999..>11333)
                     /locus_tag="ACHE_10005A"
                     /db_xref="GeneID:66976962"
     mRNA            complement(join(<10999..11247,11295..>11333))
                     /locus_tag="ACHE_10005A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279963.1"
                     /db_xref="GeneID:66976962"
     CDS             complement(join(10999..11247,11295..11333))
                     /locus_tag="ACHE_10005A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131125.1"
                     /db_xref="GeneID:66976962"
                     /translation="MQQLPSPGHTCSVQAGHGSWAAGTVYARGLQEAPGHIQARRVQY
                     RAISREWHAFLGFQVSLGPRKRGWGEGKGEEPAAKRQRQQQPYVTVEMKEN"
     gene            complement(<17920..>18498)
                     /locus_tag="ACHE_10006A"
                     /db_xref="GeneID:66976963"
     mRNA            complement(<17920..>18498)
                     /locus_tag="ACHE_10006A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281074.1"
                     /db_xref="GeneID:66976963"
     CDS             complement(17920..18498)
                     /locus_tag="ACHE_10006A"
                     /note="COG:S;
                     EggNog:ENOG410Q1H7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131126.1"
                     /db_xref="GeneID:66976963"
                     /translation="MPKSNPRRDRLADKIDKEGFFSPPCLRCSEMSASNMSCECKRIS
                     SNRKCNNCVRSGVKCERDFHNERKWQNLERDRMRLAADLEDAERSNDEALARLSETSA
                     KLARLRKHKRFLEARNKAMLENDVALLEELDSQVSWPVAETASLDAQLAAVTDDPSLS
                     QMMNSPSFWENFDSAVAGGIPSPTGGNQSSSQ"
     gene            complement(<19254..>20030)
                     /locus_tag="ACHE_10007A"
                     /db_xref="GeneID:66976964"
     mRNA            complement(<19254..>20030)
                     /locus_tag="ACHE_10007A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282185.1"
                     /db_xref="GeneID:66976964"
     CDS             complement(19254..20030)
                     /locus_tag="ACHE_10007A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131127.1"
                     /db_xref="GeneID:66976964"
                     /translation="MAGLRGFVRTQVELAQVELEGLFLLHEEETREAVVPRLALVELA
                     DDPTNNRRGWNFLQDHRTRAALPTTGEQWLMDRVVATDWLRAEWVGVRPHDHQVMWHT
                     TVVDAYLGQVDQFLERLLLLMHLTAGQPARATELLGIRHSNTVCGQHRNLFIEHGVVS
                     LVTAYHKGYSMTGSTKIIHRYLPAEVSELVVYYLWLILPFARAVQALAHGTRQARSPF
                     LWPRGPNLAAGAWDSGRLRGCSSVRPTYICVTTWLLSCRT"
     gene            complement(<25827..>27699)
                     /locus_tag="ACHE_10008A"
                     /db_xref="GeneID:66976965"
     mRNA            complement(join(<25827..26618,26878..>27699))
                     /locus_tag="ACHE_10008A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283296.1"
                     /db_xref="GeneID:66976965"
     CDS             complement(join(25827..26618,26878..27699))
                     /locus_tag="ACHE_10008A"
                     /note="COG:S;
                     EggNog:ENOG410QEA6;
                     InterPro:IPR022698,IPR013087;
                     PFAM:PF12013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131128.1"
                     /db_xref="GeneID:66976965"
                     /translation="MDLFLYNDTHRLWICGPCGFAVRPAHLAAHLANRHPKHPSAATP
                     ALRRAACALMLKRPCWDPAREPDRPVPPPPAPGSPPVPGLPVHPGYRCPHPDCAYIVC
                     NPESLLRHRTRIHADRRPRGRQPPASQVSPLPLYRTVSCQRFFPSGAGSGFFQVTPPA
                     HTERARQAATMGEVEFIRRQVAGALAEDAAAAEAGAQQVPDPDAKAPTEISPWLELTR
                     WPEFLHGHAFTAVAPLAAPPDPTAEPLLTVFSASVERLIEAAYQSIKTRRINEFDQIR
                     INSFLQRPRVWDRPILIQLRPSTYRAYRQVWQRLICFAYRTSRPNAAVQLGHQLTTAQ
                     LAALDRMETAAAELLSLPSPPLCTPGPGAADHPPWTTGGGPWVVIQTPRGGDRDRDPE
                     GDRRTERRHAAYEQLDHACLDLSIALLDHPLKGDLFESAVVAFLAVLGVDVEKQTFRD
                     PYAFTSSLSGLIKMAQMLVAQRAVQMADHGQVEHPADALEAMRERFLLPGVAAPLQLA
                     HTGCARLASASRTPPPVWDISTGAMTSRP"
     gene            <33108..>34238
                     /locus_tag="ACHE_10009S"
                     /db_xref="GeneID:66976966"
     mRNA            join(<33108..34070,34218..>34238)
                     /locus_tag="ACHE_10009S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284407.1"
                     /db_xref="GeneID:66976966"
     CDS             join(33108..34070,34218..34238)
                     /locus_tag="ACHE_10009S"
                     /note="COG:S;
                     EggNog:ENOG410PK8C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131129.1"
                     /db_xref="GeneID:66976966"
                     /translation="MDEDWYGLSITVENLVKYKQVTQSLSSALDAGLCVSQSTGELIL
                     ERQVYILQALNILVEDILEAGSSSRMSRTRPRKHVEGAHVALFTLSIDPKPEKLPPVE
                     ILACAVDQKSSLEEYIDLCRTEPAFLTHVVNTWFSSRPELVPDEKGRSMPLATDKFIR
                     IAVFEVIHNAVIGAAVWGYLCSLLHALVDQPNDRFYWSTILHEIAEVSHFEHCRAQKL
                     FKRYVQMASGSKFFKRVSGVYDNGTARVAMKIKPDLLTRVDPQMHYILCLCQAKLDVS
                     QAVDWIRKLDGFHQALPTEQGNITEREFDAFCDLAVTASFIQSLSGWLKLL"
     gene            complement(<36228..>37670)
                     /locus_tag="ACHE_10010A"
                     /db_xref="GeneID:66976967"
     mRNA            complement(<36228..>37670)
                     /locus_tag="ACHE_10010A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275187.1"
                     /db_xref="GeneID:66976967"
     CDS             complement(36228..37670)
                     /locus_tag="ACHE_10010A"
                     /note="COG:V;
                     EggNog:ENOG410Q1YZ;
                     InterPro:IPR006094,IPR010031,IPR036318,IPR016169,
                     IPR016166,IPR016167;
                     PFAM:PF01565;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016899 - oxidoreductase activity, acting
                     on the CH-OH group of donors, oxygen as acceptor [Evidence
                     IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131130.1"
                     /db_xref="GeneID:66976967"
                     /translation="MVGLKLQLLLVLLHAVFSSAYRWFNWQFEVTCESDAYIAPEDES
                     AAASFLKDQYARGSLIKVVGNGHGFGNLTTCVDTARTKKPSYIVSLTNLKHLDINRED
                     MTVTFGAGWDVYDLIQELKANGLSFNNLGVEQVQNFIGAVSTGTHGTGSHVGNMATQV
                     VGLRVLDSQGSLRVIDQTTNAEELKAFRVSLGALGLITEMTIKVHPTYLVKKTTRVLN
                     ATTDYAQMYKEIAQLYKEHDRMTVWGPHFDWDSKAQDWAIEPTYFASWWEPTNYTGVR
                     NCTLNYCANGCGDCKKNYICYDEVSDAVSCGPEGVCTHQFYAEIEHFFPAEYLLEAAT
                     NYTLFQQSQTPRMKAPYNEQMVFQFRMLKGDDAYLSPVNTYNLGPESSGVFAVLEIDW
                     MQEYNNFTTLWQNQELAEEFLPRFGEAYNVRSHWNKMSPANSTYILDKFPKLPEFLAI
                     QERQDPKCQFVNDFLVQQLGITRCSGYLSM"
     gene            <39464..>41029
                     /locus_tag="ACHE_10011S"
                     /db_xref="GeneID:66976968"
     mRNA            <39464..>41029
                     /locus_tag="ACHE_10011S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275631.1"
                     /db_xref="GeneID:66976968"
     CDS             39464..41029
                     /locus_tag="ACHE_10011S"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410Q22J;
                     InterPro:IPR012132,IPR000172,IPR036188,IPR027424;
                     PFAM:PF00732;
                     SECRETED:SignalP(1-16);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131131.1"
                     /db_xref="GeneID:66976968"
                     /translation="MKFGFVEAALLSVALAQTTHKHAPIDIQSSLLRDPREVADKRFD
                     YIIAGGGLTGLTAAARLTENPNISVLVVEGGYYESNRGPIIEDVNTYGDIFDSSLDYA
                     YQTTPQASNNLSGIVRSGKGLGGSTLINGASWTRPHKSQIDSWESVFGNDGWNWENLT
                     SYMHQAEAARPPNPAEVTAGHFFDPSCHGLNGAVHTGTRNTGEKFSPMIKALMDTVKP
                     QGVPTRHDFCCGDPHGVSMILNSVNAKQIRSDAAREWLLPNYRRHNLKLLTGQLVGKV
                     LFDETNIGPKAVGVEYGVHKQFTFKAYAKHEVLLAAGSAASPLILEWSGIGLKSVLDT
                     VGIRQIVDLPVGLNLQDQTTTTVRSAITASGAGQGQAVYFATFNETLGDLAPVGIDLL
                     NMKLQQWAEETVAAGGFHNVTALMSQYENYRDWLINKNIAYVELFLDTSGKIHFDIWD
                     LIPFTRGYVHILDADPYLGRRAYNPRYYQNELDVLAQAAATQLARNLSNSGEMKQYFA
                     GEQIPGFNCHNLA"
     gene            <51165..>53082
                     /locus_tag="ACHE_10012S"
                     /db_xref="GeneID:66976969"
     mRNA            join(<51165..51461,51508..52002,52067..52287,52355..52704,
                     52778..>53082)
                     /locus_tag="ACHE_10012S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275742.1"
                     /db_xref="GeneID:66976969"
     CDS             join(51165..51461,51508..52002,52067..52287,52355..52704,
                     52778..53082)
                     /locus_tag="ACHE_10012S"
                     /note="CAZy:AA1;
                     COG:Q;
                     EggNog:ENOG410PHHS;
                     InterPro:IPR008972,IPR011707,IPR011706,IPR033138,
                     IPR044130,IPR002355,IPR001117;
                     PFAM:PF00394,PF07731,PF07732;
                     TransMembrane:1 (o531-554i);
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0006811 - ion transport [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131132.1"
                     /db_xref="GeneID:66976969"
                     /translation="MTAMSATLNYDWNVTWMTANPDGMMERPVIGINGQWPLPVLNFT
                     RGDRVIAKVHNGLGNESTSIHWHGFYQNGTNEMDGPPHVTQCDIPPGATMVYNFTVDQ
                     TGTYWYHSHSRGQYPEGLRQALVITDPKNPYAGQYDEELVLTLSDWYHDQFRYLLEGF
                     ISVTNPTGAEPVPNSALMNDTQNLTIPVEQGKTYLLRLANVGAFASQYFWIEGHTMRI
                     VEVDGVWTDAAETDMIYITSAQRYSVLVTMKNETSQNYAMVGSMDTELFDSLPPTLNY
                     NVTGWLVYNDQAEKSAPAELSSFNPYDDFNLRPADGMECLPDADYTITLDMKMDNLGD
                     GANYAFFNDKTYVMPKVPTLYSVLTTGSAATDPAIYGTDSLAYVLQKNDVVDIILNNG
                     DDGKHPFHLHGRNFQLIHRSPENAGHFDASNPPPFATVPMRRDTVTLEPLGNFVLRFR
                     ADNPGVWLFHCHIEWHMDSGLVATFIEAPLDIQRSITIPDDHLQVCNISGSMTAGNAA
                     GNTEDLYDLTGESRAPPPLPEGFTPGGIVALVFSCIAAVLGMVSIVW"
     gene            <54716..>55784
                     /gene="AOX1_1"
                     /locus_tag="ACHE_10013S"
                     /db_xref="GeneID:66976970"
     mRNA            join(<54716..54849,54910..55191,55259..>55784)
                     /gene="AOX1_1"
                     /locus_tag="ACHE_10013S"
                     /product="alternative oxidase, mitochondrial precursor"
                     /transcript_id="XM_043275853.1"
                     /db_xref="GeneID:66976970"
     CDS             join(54716..54849,54910..55191,55259..55784)
                     /gene="AOX1_1"
                     /locus_tag="ACHE_10013S"
                     /note="COG:C;
                     EggNog:ENOG410Q1XZ;
                     InterPro:IPR002680,IPR038659;
                     PFAM:PF01786;
                     TransMembrane:2 (o103-124i169-188o);
                     go_function: GO:0009916 - alternative oxidase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="alternative oxidase, mitochondrial precursor"
                     /protein_id="XP_043131133.1"
                     /db_xref="GeneID:66976970"
                     /translation="MSHQVRIARFSCITQIPYPSASKFILGSRQYTQGALQKSSWTHP
                     VYTQEQIQSVKIAHRNAKCLPDKLALETVRFLRWGMDFVTGYRANSPLSKPNRMTERK
                     WITRFVFLESVAGVPGMVAGMLRHLKSIRQMKRDYGWIETLLEEAYNERMHLLTFLQL
                     AKPGWKMRTMVLGTQCVFFTAFFMAYILSPRICHRFVGYLEEEAVITYTKAIKDLDDG
                     CLPLWKSLGAPAMAVKYWQMPEGNRCMRSLLLYVRADEAKHRDVNHTLGSLDQDRDRN
                     PFSAKFREQIGKVNDVIDSRVPDELYIRSQQRQRVKE"
     gene            complement(<56270..>56873)
                     /locus_tag="ACHE_10014A"
                     /db_xref="GeneID:66976971"
     mRNA            complement(join(<56270..56658,56708..>56873))
                     /locus_tag="ACHE_10014A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275964.1"
                     /db_xref="GeneID:66976971"
     CDS             complement(join(56270..56658,56708..56873))
                     /locus_tag="ACHE_10014A"
                     /note="SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131134.1"
                     /db_xref="GeneID:66976971"
                     /translation="MHLPVFFLLTIYGVLGSATSAFAPSHVKRGAQQNATLYAYGANT
                     PQWPIAYGQTDGLLYITQTPDDNNNNLLPMSWNLPAITDDNWIVNATFENGTSAGSLF
                     IKPEDNYCVGVLPITRISRINGTVSGFALFASQLVYNNNTQLQAQFWAKETDTNGTYA
                     LTWNPGWNMQNGSFPVVVKASESS"
     gene            <57668..>59512
                     /locus_tag="ACHE_10015S"
                     /db_xref="GeneID:66976972"
     mRNA            join(<57668..57965,58030..58325,58378..59283,
                     59339..>59512)
                     /locus_tag="ACHE_10015S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276075.1"
                     /db_xref="GeneID:66976972"
     CDS             join(57668..57965,58030..58325,58378..59283,59339..59512)
                     /locus_tag="ACHE_10015S"
                     /note="CAZy:AA1;
                     COG:Q;
                     EggNog:ENOG410PGU0;
                     InterPro:IPR008972,IPR001117,IPR011706,IPR011707;
                     PFAM:PF00394,PF07732,PF07731;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131135.1"
                     /db_xref="GeneID:66976972"
                     /translation="MFLPLFSSLVALPAVLGAALIPKDTIACVHNAANRSCWSDGFDI
                     STNYYEKVPDTGVVREYWLNIENTTAAPDGFELPAQLINGSFPGPTIIADWGDTVVVH
                     VTNSLQNNGTGLHFHGIRQNWTDQMDGVPSITQCPIAPGDSYTYKWRAVEYGTGWYHS
                     HFYVQAWDGVFGGILINGPATANYDVDLGHIFLNDWYHYTADQLDSQAATGGPPTAIN
                     GLINGTNTYNDTLGSRFKTVFNANTRYRLRLVNAAADNHFRFMIDNHTLEVIANDFVP
                     IVPYETTDLSIGMGQRYDVIVTAKDLASGNFWLRAIPQEACSETSAVDNVKGIIRYDS
                     SSTADPTTSAYSYTDSCADEDSSNLVPYLPLNASDTYTYGEDEEVAVQVTDNALLWTM
                     NKTSFRTEWENPTLKQVANGSAPFTAKQHVIQLPQANQWVSFVIHSPFAQDHPMHLHG
                     HDFLILASGYGDFDSSLITQSSLVNAPRRDVAMLPASGYLAIAFRTDNPGAWLMHCHI
                     AWHTAEGFAVQILERKSEIFIDRSQLDSTCTNWNKYVAAKDVTQHDSGV"
     gene            complement(<59749..>61702)
                     /gene="PUS1_1"
                     /locus_tag="ACHE_10016A"
                     /db_xref="GeneID:66976973"
     mRNA            complement(join(<59749..60207,60269..>61702))
                     /gene="PUS1_1"
                     /locus_tag="ACHE_10016A"
                     /product="tRNA pseudouridine synthase 1"
                     /transcript_id="XM_043276186.1"
                     /db_xref="GeneID:66976973"
     CDS             complement(join(59749..60207,60269..61702))
                     /gene="PUS1_1"
                     /locus_tag="ACHE_10016A"
                     /note="COG:J;
                     EggNog:ENOG410PGFR;
                     InterPro:IPR001810,IPR036322,IPR036047;
                     PFAM:PF00646,PF12937;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase 1"
                     /protein_id="XP_043131136.1"
                     /db_xref="GeneID:66976973"
                     /translation="MTTTSPGRDPLTALPPEIVLRILEFTSTSALASLTAVSKAWHTF
                     IDVIHQEAIYSSESKTTQPPGGARDFSYLADNTSFSEFFENPESWKDVCKRQTLLARN
                     WADSHPVTRESILQVGNDPVWRFKPDFKRRFFVSTSQAGGLNVTDMDSGRIIWRLPST
                     LYADDNAVRPFAHLEYQDGMAVFDREGDAVEVWQADQEGAERGEFRRIAILNHDCQTR
                     GFQLSHWTLCVVSSEGQGFVYDMTQRPPKLTTHLQIEHGGVGHLDQSKDAVIYSMGSK
                     GYHVHDKASGAFLGALQPSHCTEKYHIRAPAAGSPAGPSHRAFTLGPSRRDCLTPIKV
                     EKGPLTPPDDPEHVWHRENEWGAGMLHGDLFVGFSRSGRVFVCSDWRKAIHDQVSLAA
                     HSSLLECESDGATFDLGGWLSVRNHRLMFEIQDRIYIVALDDNNKVQDVDHPARASYS
                     LFTSSTSRLTVPVSFMALYDDAIMTTYATLGWHQPIPNLPGGIPQHQGPTRIIPTKTI
                     RIVSLAPDLSNPSASKPRDNTPEETPEQPSAANGILPDPNQFLPPAHNLMSRQATLLH
                     LLAMLREDADDDEDEDELGVTIADLHDFQDLHDLHDGIDEEWEDLDDPEAEPEVHQRM
                     HEDEGN"
     gene            complement(<62657..>63564)
                     /gene="NCS1"
                     /locus_tag="ACHE_10017A"
                     /db_xref="GeneID:66976974"
     mRNA            complement(join(<62657..62836,62889..63184,63242..63327,
                     63554..>63564))
                     /gene="NCS1"
                     /locus_tag="ACHE_10017A"
                     /product="neuronal calcium sensor 1"
                     /transcript_id="XM_043276297.1"
                     /db_xref="GeneID:66976974"
     CDS             complement(join(62657..62836,62889..63184,63242..63327,
                     63554..63564))
                     /gene="NCS1"
                     /locus_tag="ACHE_10017A"
                     /note="BUSCO:EOG09264RR2;
                     COG:T;
                     EggNog:ENOG410QD9F;
                     InterPro:IPR011992,IPR028846,IPR002048,IPR018247;
                     PFAM:PF00036,PF13499,PF13405,PF13202,PF13833;
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="neuronal calcium sensor 1"
                     /protein_id="XP_043131137.1"
                     /db_xref="GeneID:66976974"
                     /translation="MGKSQSKLSPSQLDELQKATHFDKKELQQWYKGFLKDCPTGTLT
                     KEEFQKIYRQFFPFGDPSSFANYVFRVFDADNSGMIDFKEFICALSVTSRGRMEDKLD
                     WAFQLYDIDGDGKITYEEMLAIVEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDE
                     NGSLDMEEFKEGSKRDETIVSALSLYDGLV"
     gene            complement(<64335..>66453)
                     /locus_tag="ACHE_10018A"
                     /db_xref="GeneID:66976975"
     mRNA            complement(join(<64335..64402,64466..64901,64957..65294,
                     65352..>66453))
                     /locus_tag="ACHE_10018A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276408.1"
                     /db_xref="GeneID:66976975"
     CDS             complement(join(64335..64402,64466..64901,64957..65294,
                     65352..66453))
                     /locus_tag="ACHE_10018A"
                     /note="BUSCO:EOG09261FH7;
                     COG:U;
                     EggNog:ENOG410PFGI;
                     InterPro:IPR004240,IPR036259;
                     PFAM:PF02990;
                     SECRETED:SignalP(1-22);
                     TransMembrane:9
                     (n7-17c22/23o272-297i347-375o381-403i423-442o454-477i508-
                     527o539-565i577-596o608-637i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131138.1"
                     /db_xref="GeneID:66976975"
                     /translation="MWFNERTSLLSTLLLSVPLSSAFYLPGVAPTSYDEGQAVPLYVN
                     HLTPGIAGQDDQLHSVFSYDYYHPAFHFCRPKDGPSDVRESLGSILFGDRIQTSPFEL
                     RMGVNETCKAVCGEVKFDSRSAKFTNRRIMQGYNVNWLVDGLPAAQRNVETVTQTEFY
                     SPGFALGIANDNGEPYLNNHYDILIDFHRVGSGGKDQFRVVGVLVQPESRHDTKALDD
                     GTAECGSDNAPVLLSEDGETAVTFTYSVYWRESPTVWATRWDKYLHVYDPKIHWFSLI
                     NSAVFVVFLVGMVSMILVRALRKDIARYNRLDAINLEDLDGTSAAVEDGIQEDSGWKL
                     VHGDVFRCPRSPLLLSVLVGNGAQLFMMAGVTVVFALFGLLSPANRGFLATAILLIYT
                     VFGFIGGYVSARVYKSFGGEAWKRNIVMTPLLIPGVIFCTFFLLNLFVWAKGSSGAVP
                     FGTMLALVLIWFVISVPLSFAGSWLGFKQRAVEGPTKTNQIPRQVPPMTGTLRTFPSM
                     FLTSLLPFGAIFVELYFIMTSLWTNKIYYMFGFLFICYGLMIITTAATTVLLVYFLLC
                     AENYRWHWRSFAGAGMTGGYVFLNALLFWATRVSFGGLTGAVLYVGYSALIGFVVFIL
                     TGSIGFFASWAFVQRIYRSIKVD"
     gene            <66819..>67976
                     /locus_tag="ACHE_10019S"
                     /db_xref="GeneID:66976976"
     mRNA            <66819..>67976
                     /locus_tag="ACHE_10019S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276519.1"
                     /db_xref="GeneID:66976976"
     CDS             66819..67976
                     /locus_tag="ACHE_10019S"
                     /note="BUSCO:EOG09263C4C;
                     COG:A;
                     EggNog:ENOG410PKD4;
                     InterPro:IPR007146;
                     PFAM:PF04000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131139.1"
                     /db_xref="GeneID:66976976"
                     /translation="MAATAMQSEAAPQDISTLLETITSCLSGTGSSLPKAAKDEPTDA
                     SIDPPQQGISLLNTKSELLLSYLHNLVFLTIFQLRGLSAEDSADGENQSLREDVVKKL
                     TELRVYLERGVRPLEGRLKYQVDKVVKAAEDAERDGRNAPGPTKTKTKKAPKSDEDED
                     EDDSGSEEASSGSEDEESEDEEDIDEMAYRPNVSAFSQGVEAQAKPTKSDITEQKAPS
                     DGIYRPPKVMPTALPTTERREREDRRPRRSNVIDEFVNAEMSSAPTMEASIGSTIRSG
                     GRHTRSQKEKDREEERRAYEETNFVRLPKLSKEEQKKQRGRRGLESTFGGEDWKGLTE
                     GADRIARLTQRGKGSGSALDKSRKRKTTEDMPGAVGQIFDKRRKKVDSWKR"
     gene            <68114..>69016
                     /locus_tag="ACHE_10020S"
                     /db_xref="GeneID:66976977"
     mRNA            join(<68114..68273,68335..68547,68607..>69016)
                     /locus_tag="ACHE_10020S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276631.1"
                     /db_xref="GeneID:66976977"
     CDS             join(68114..68273,68335..68547,68607..69016)
                     /locus_tag="ACHE_10020S"
                     /note="COG:S;
                     EggNog:ENOG410PSHK;
                     TransMembrane:3 (o12-34i140-161o206-230i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131140.1"
                     /db_xref="GeneID:66976977"
                     /translation="MTSSAVKLGQALYFLFFLSFQHILAILTILTLTISCHYLEKPYN
                     FPAITMENPVEDVPAVIQMLIESPPSLQQKAIERFFTPSAEFVHPFCRVWGYKGSRWA
                     IVKIFQWYKIMSPRIEHEIHSIAFDKDNLKLYVSMSQLFSIWLIPFHVAPVTLTTVLT
                     LTTSPGEEKHTTNGTRTHYFIAKQEDLYQTSEFIKFVVPHVGHLVIYAWQAFATLFCL
                     FGVALFWPLIWLEERGWVPGRVLRGGNLVYDIHKKIPDIKET"
     gene            complement(<69277..>70888)
                     /locus_tag="ACHE_10021A"
                     /db_xref="GeneID:66976978"
     mRNA            complement(join(<69277..70542,70601..>70888))
                     /locus_tag="ACHE_10021A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276742.1"
                     /db_xref="GeneID:66976978"
     CDS             complement(join(69277..70542,70601..70888))
                     /locus_tag="ACHE_10021A"
                     /note="COG:Q;
                     EggNog:ENOG410PIG4;
                     InterPro:IPR020946,IPR036188,IPR000960;
                     PFAM:PF07992,PF00743;
                     TransMembrane:4 (i21-38o58-77i460-480o486-503i);
                     go_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131141.1"
                     /db_xref="GeneID:66976978"
                     /translation="MSSPQDQSSLSAFIKHPLLEIFSFVYVIFQTVLNWVFAPVPPPP
                     TSSATSLPKKRVAVIGAGLTGVSSAAHCVGHGFDVQLFESRSKEKGLGGIWSRVNSTS
                     SLQIHSLMYRFHPSVRYDTAYPTQQEIRDQIIGVWKRYGLQNRTVFDTKVTSVKQAKD
                     GKWIINDNEKEYGRFDGILATVGVCGDPKMPTLPDQSKFKGGLFHSSDLDGKHVKGKK
                     VLVVGGGASAIEALEFAAKSGAREIDVLSRSDKWVIPRNIFVQSLLAMNIFGQETTLS
                     WVPEWLLHKLFYRDMQDIAPSGGLFTQTPMANSELFDLIREGHARWLRGDILQVQENG
                     ILFNHRTQGVPKGGPGRESVVTGDVIILATGFKRPSLNFLPDEVFEEPYGPPSWYLQV
                     FPPKYTSICANNSTYVDAIGTVGNMHIGIYTRFLLMFLVDPLSQPTEGRMKTWIDWTR
                     LMKRFSPTGAFDFFTYSELIYWFLFVILVNPFRWKWAPFVLFGVGRALPMEVVKREEA
                     LRKTLRKQR"
     gene            <71805..>73812
                     /locus_tag="ACHE_10022S"
                     /db_xref="GeneID:66976979"
     mRNA            join(<71805..72148,72206..72536,72595..>73812)
                     /locus_tag="ACHE_10022S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276853.1"
                     /db_xref="GeneID:66976979"
     CDS             join(71805..72148,72206..72536,72595..73812)
                     /locus_tag="ACHE_10022S"
                     /note="COG:D;
                     EggNog:ENOG410PKD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131142.1"
                     /db_xref="GeneID:66976979"
                     /translation="MATPGTSVLDRFLSSIADLVRQRDGAKLQDFLQLEPPLSDIYQQ
                     MVVELRQRYPAESPKKDAELHRRCESLVPRSKGSSSWIAFPTFMKLYFTFLRDVNVEN
                     LLETYNLLKGLLNQCVLALGDSQMGVVVLPTVLYLCKVLAKLAMGLDRRPDLIAHLLR
                     LEGRPDQDESVEKVTLVEKSANVVREAFIKCLTDRSGTPGVQGKPEGRRVGIYLMANL
                     CLKLLFQCGKLRNAEQMFASISAQSPPLTYFPASQRVTYLYYLGRYLFSNSLFYPAQI
                     ALQAAYDQCHRQALQQKRVVLTYLIPCNVIMGRFPSGLLLQRPEAQGLAEKFVPICQL
                     IARGDYIAFRDHLAFDSPANEWFARKGILLALRNRCEILVWRSLARKVFVHGGFLGDP
                     AAQRSPPPYLYLKKLETAVRWLQSRHVQSSLGAISFIPPSRALDAKAGENNAGSQIIY
                     KAPDPDFADAHDPDTSGADRIVSSKYDDYLAPDACFDALGQLQENPAHTLTDGDPSAN
                     YSQHELDPYADRAALNSEDEAQGKPTPMMREIESILASLLTQGLMRGYLTHGNPRFAI
                     PGARTRGAIPTGFPNVWQTIYARESEDDNVPGWVKPSKPAAAPVGAGGGGRVVNLSGA
                     RPVGAQ"
     gene            <74039..>75586
                     /locus_tag="ACHE_10023S"
                     /db_xref="GeneID:66976980"
     mRNA            <74039..>75586
                     /locus_tag="ACHE_10023S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276964.1"
                     /db_xref="GeneID:66976980"
     CDS             74039..75586
                     /locus_tag="ACHE_10023S"
                     /note="COG:C;
                     EggNog:ENOG410PK95;
                     InterPro:IPR006094,IPR040165,IPR036318,IPR016166,
                     IPR016169;
                     PFAM:PF01565;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131143.1"
                     /db_xref="GeneID:66976980"
                     /translation="MQHHNIAVKAIAAQVERFHQLQRPFRIYHGSTNSTRQSQHGPDN
                     TISTADLTHILDVNTSTQTALVEPNVPMDALVQATAAHNLVPLVVMEFPGITVGGGFS
                     GTSGESSSFRHGFFDATVNWIEFILPNGEVTRASKTDRTDLFWGAASAFGTLGVVTML
                     EVQLRPAKPFIELRYHSTSSMEEAMHVFRTVTNDPSTEYLDGIVYARDHVVVCAGRLV
                     DIPRTAPVRLTRPWDEWYYLRAQDRSRQSSGPALDQAAVDYIPLIDYLFRYDRGAFWV
                     GRYAYSYFFVPFIYLTRVLLDWFMHTRVMYHALHESGHAKRYIIQDVAVPYAGTSEFV
                     DWLDDKENFGAYPIWLCPLRHGPGVMERTAAAAEKSTKSEFEKKPNATTDDDYIMNFG
                     LWAPSRHPSDRSAFLAQNRRLERRVLDLQGKKWLYAHAYYTEDEFWSIYDKKQYDALR
                     EKYHASYLPDLYQKVRVDLSPQQGPQNWVDWVKSIIWEIRPVSGLYGVYKALRGGEYF
                     IHKSKTA"
     gene            complement(<75687..>77870)
                     /locus_tag="ACHE_10024A"
                     /db_xref="GeneID:66976981"
     mRNA            complement(join(<75687..77190,77237..77430,77508..77718,
                     77767..>77870))
                     /locus_tag="ACHE_10024A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277075.1"
                     /db_xref="GeneID:66976981"
     CDS             complement(join(75687..77190,77237..77430,77508..77718,
                     77767..77870))
                     /locus_tag="ACHE_10024A"
                     /note="COG:F;
                     EggNog:ENOG410PFD0;
                     InterPro:IPR029052,IPR006179,IPR004843,IPR008334,
                     IPR041821,IPR036907;
                     PFAM:PF02872;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_process: GO:0009166 - nucleotide catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131144.1"
                     /db_xref="GeneID:66976981"
                     /translation="MSVLETGGLSVTHSCQGTGCPDLRLLHYNDVYHVEPGSAEPVGG
                     VARFQSVINYYRSHPRFADQPELLTFFSGDAFNPSLESTVTKGRHMVPFLNKAGTDVA
                     CMGNHDLDFGVAQFRHLRSQGKFPWLLANVLDPALGEGVPIANCEQTVMLTASNGIKI
                     GVLGLGEREWLETINALPPDLIYKSATKTALELAPRLREQGADLVVAVTHQREPNDNK
                     LAQNLPPGTVDIILGGHDHFYAHSIINGTHVLRSGTDFKQLSYIEAWRKSDGSGWDFS
                     IDRRDMIRAIPEDPATVNLVERVTSSLKAKLEKPIGFTVRPLDGRFSTVRQKESNLGN
                     FVCDLMRYYYAADCAMMAGGTMRGDQVYPPGIIRLKDILNCFPFEDSVVLLRVKGDAL
                     FEALENGVSQLPAMEGRFTQVSNISFGFKPSAPPGSRITFANIGSKPIDYDRKYVLAT
                     RGYMSRGKDGFASLLTQSEGGEVEEIVDEESGVLLSTILRQYFLSLRVMGRWQRWSNS
                     MARHWDGVHKGLHCNGLVKPPSAGPSPVSEKVPAQPQRPGLSRTSKSYYYGRFPQIAT
                     IEEDAEAEEEAEEDVMDSDSDDDPDILTTPQPVTNYVTLPAQSAAEEEYRLRLARQVL
                     RKWMRKTGLRSSRLDALDQGEGEFEYTPAWTQGIAPRLEGRIIIEE"
     gene            complement(<78342..>80246)
                     /locus_tag="ACHE_10025A"
                     /db_xref="GeneID:66976982"
     mRNA            complement(join(<78342..80151,80212..>80246))
                     /locus_tag="ACHE_10025A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277186.1"
                     /db_xref="GeneID:66976982"
     CDS             complement(join(78342..80151,80212..80246))
                     /locus_tag="ACHE_10025A"
                     /note="COG:G;
                     EggNog:ENOG410PK79;
                     InterPro:IPR013078,IPR029033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131145.1"
                     /db_xref="GeneID:66976982"
                     /translation="MGNPPATIIIARHGARLDAADKNWHLTSPTPYDPPLSYGGWMQS
                     RALGARIIDLLTSQDDSPLNTTTATGSPRSYSSSANVSPDSSARSSPQPFSPKRKRRI
                     IIHTSPYLRCLQTAIAVSSGISQYHPSPGSDPAGASTGPDGNADTKLDGHRSLLRVDA
                     FLGEWLSPDYFEDITPPPNSERLIGAAKAELLRRSVNMVPQADISNKPPTGYFPGGWG
                     STSTPTSPIREAGPPPTKIARGQRSRADSYDALNSAHSTRPQGLLSRINTNLSSIPDD
                     NAGSYVPPTPSYAIAPSDPIPAGYVTHARNACANVDYQWDSMRAPQSWGDGGNYGEEW
                     SAMHARFRNGLESMIEWYQDNGNIQFPRQPPDGCETNNDKNEGDGDDAVDTVLVLITH
                     GAGCNAMVGALTGEPVLLDFNTASLTMAKRKDASVDAPGVKTRYRSASDPSCLLGYDL
                     KLAASVDHLRPPAKHPTRGGSSTLSSPVTLSSPWVPSYRHRATSRSQGQFIIGPSTPG
                     LSSQSLANGRPSTAPRGASGLWGSNSTSGDDSADDIVPNFGGPVVSNPSADGEESVEH
                     KSEGASASWGNNQVPQRTLSQRGLWGSAPLKTDRTDVKRRWTVTEQRV"
     gene            complement(<82689..>86577)
                     /locus_tag="ACHE_10026A"
                     /db_xref="GeneID:66976983"
     mRNA            complement(join(<82689..84008,84058..>86577))
                     /locus_tag="ACHE_10026A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277297.1"
                     /db_xref="GeneID:66976983"
     CDS             complement(join(82689..84008,84058..86577))
                     /locus_tag="ACHE_10026A"
                     /note="COG:E;
                     EggNog:ENOG410PGSZ;
                     InterPro:IPR002821,IPR008040,IPR003692;
                     PFAM:PF01968,PF05378;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131146.1"
                     /db_xref="GeneID:66976983"
                     /translation="MAEPGKITISIDRGGTFTDVHAIVPGRPDIILKLLSVDPGHYQD
                     APTEGVRQILELVTGRPHPRGKPLELDNIGCLRMGTTVATNALLERKGARSVLFTTKG
                     FRDLLKIGDQSRPNIFDLSMARPGVLPEGVVEVDERVVPCHPSADKDCFTNARVVQGV
                     TGDKFRVVQELDLDHVKSELERLKREGYQSLSVALVHSYAYPEHERRIGELAESMGFS
                     VTLSSKLQPMIKVVPRGMSAAADAYLTPVIKTYIDSISSSFEGGLENQRQCRFEFMQS
                     DGGLVDFRRFSGLKAILSGPAAGVVGFAATSYDQTEKTPVIGFDMGGTSTDVSRFDGN
                     LEHVFGSKVAGVLIQSPQLDINTVAAGGGSILTWRNGLFYVGPESASAHPGPACYRKG
                     GPLTVTDANLFLGRLLPEYFPHIFGPSEDLPLDTEVTAKLFNELTQKINTERREKNMS
                     EYSPEEVAQGFLEVADESMARPIRNLTQARGFETASHHLACFGGAGGQHACTVAASLG
                     ISRIIIHKYSSVLSAYGLALAEVVKESQEPVSTDYLSSKPSLQKQFEDISKAATEDMK
                     SQGFAEDQVRHELYLNMRYEGSDTSLMILKPEDESSDFLEQFRTRHRREFNFNSERPV
                     LVDDIRVRTTAASKVRTEKSPLVQLKEANIQDVTGAPDNTTKAYFDGHGRIDTPVYLL
                     DKLDKNARVHGPAVIIDKTQTIVVVPGAVANILETCIVIDLKETDKGSVDAGSMTSQI
                     DPIRLSIFGHRFMSIAEQMGRTLQKTSVSTNIKERLDFSCALFSPDGGLVANAPHVPV
                     HLGSMQFAVRFQHQKWLGNLKDGDVLVANHPSSGGTHLPDITVITPVFDRPGGSEIMF
                     YVASRGHHADIGGILPGSMPPKSTELWQEGAAIEGDKVVSNGVFDEERMVELLVRKPA
                     QYEGCSGARCLSDNISDLKAQIAANTRGISLIQSLFTEYGVETVQKYMYAIQATAETA
                     VRNLLKGLHEKFDGGPLEAVDYMDDGTPIRLKVTINREDGSAVFDFTGTGPEVYGGWN
                     APIAITHSAIIYCLRCLINADVPLNQGCLAPIDIHVPSPSILSPTKSAAVVGGNVVTS
                     QRITDVVLKAFRACAASQGCCNNLTFGTNKRVDPDTGKEIPGFGYYETIAGGSGAGPT
                     WDGESGVHVHMTNTRITDPEILEKRYPTLLRQFTLRAGSGGKGKHPGGDGVVREIEFL
                     APMQVSILSERRVHRPYGLEGGEDAEAGLNLWVSRDRETGEERRVNIGGKNTVPVQTH
                     DRLVVMSAGGGGWGEVK"
     gene            complement(<87056..>89568)
                     /gene="PUT3"
                     /locus_tag="ACHE_10027A"
                     /db_xref="GeneID:66976984"
     mRNA            complement(join(<87056..87525,87576..87947,87997..88081,
                     88130..88202,88255..88379,88436..88944,89000..89149,
                     89197..89240,89304..89432,89489..>89568))
                     /gene="PUT3"
                     /locus_tag="ACHE_10027A"
                     /product="transcriptional activator"
                     /transcript_id="XM_043277408.1"
                     /db_xref="GeneID:66976984"
     CDS             complement(join(87056..87525,87576..87947,87997..88081,
                     88130..88202,88255..88379,88436..88944,89000..89149,
                     89197..89240,89304..89432,89489..89568))
                     /gene="PUT3"
                     /locus_tag="ACHE_10027A"
                     /note="COG:K;
                     EggNog:ENOG410PIM7;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:3 (i230-248o277-293i300-318o);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_043131147.1"
                     /db_xref="GeneID:66976984"
                     /translation="MAQSRPRNPLLHRRSQARPGARRSMVACNRCRNRKTRCAGTPPL
                     PCPACEEAGQVCMYSEAEKRVSVPESYLRQLQSQARTPRQDDNLNASILTSSSLPGST
                     QPTPSTNSTNVERDDWWYDGTDNLFLNRSGEHHFVGASSATHLAKRLNPSSTNLAWDV
                     RPLYDDPSSLRRSVTRVLPQLPPYDFAKRLFWVQYAYIGTIFSLIHPQDFEERLNTVY
                     NQPAEFSNRESCLMYCQVLLVIAFGLMYSVNQWSGDDGPPGFKYFKHALRFLPDIHEE
                     GSIFFVDVLCYVAYYMQNLNRRDAAFLYIGLALRMAISLGLHQEVSDQTISQNERDRR
                     RRAWWSVYSLDRMLSVKSGNPITIHDEDIGTAWPPVEAPVDVPWPSVVLMHYTKLSRI
                     LGRIGEEIYRKKPRSGSNLLASVQSITNALSDWLRHVPDQLRIDFSNLDGPISRECVS
                     ISLHFYSCINMTARPLVFYVIQRRLDTEAREFATEDWKDGLSQNSAAVIDSCIRAARA
                     TTLIMDAAAKQNLIATYGYLDGEYAFSAALLLVMVNAAFPHNETNSRAMEMALDLLRG
                     MADRGNTYLRSRHSLLLELQSAMGPKASKRGEPAMAAPATPSSSQPQSPPVAPIEESS
                     IVTPMEWPLEQDIPSIHDISFNFDINDDPGLWDEVLGQIDIDMDTDWIENTLRR"
     gene            <90520..>91967
                     /locus_tag="ACHE_10028S"
                     /db_xref="GeneID:66976985"
     mRNA            join(<90520..90786,90842..91816,91866..>91967)
                     /locus_tag="ACHE_10028S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277519.1"
                     /db_xref="GeneID:66976985"
     CDS             join(90520..90786,90842..91816,91866..91967)
                     /locus_tag="ACHE_10028S"
                     /note="COG:Q;
                     EggNog:ENOG410Q2H9;
                     InterPro:IPR001128,IPR036396;
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131148.1"
                     /db_xref="GeneID:66976985"
                     /translation="MLVYATVVLLILSIRIFYNYSRLWPISGPVYACVSDLWRGYAHR
                     SPDYSRRLRKLHQKHGQVVRIGPTVVSISEPEAIVRFYGSREQEKSIHDFPLISERGQ
                     AVSSICISNGLRKGSINELSCQHTNILRYEGIIDQSASDLISALQRYRILEITGPLQI
                     FASEFVHRVLTKMPWKSSKGVAGTRPSPSMVEYLMLWSPIMRLKRERQELFSCIPSRQ
                     YSWAHPGFNPEGQNEEVNEISEDYSSVVTAGLKAISTAFVSTFPLLLQHPETMGRLVE
                     EVDTAFYNENLSESSLWEEVSRLRYLDAVFKESIRCQPTTSSIEVSVSRSDTAIAGHD
                     LPVGTVIEWHPDSFKIDEDIYGEDVENFRPERWLVADQQERRHMEQGLLAFYISRRTC
                     MASRVVFLELKKVVVMILLQFNMELLASDGNLPEWRSQGAEFLPRMVVNLVQRVH"
     gene            complement(<92234..>93268)
                     /locus_tag="ACHE_10029A"
                     /db_xref="GeneID:66976986"
     mRNA            complement(<92234..>93268)
                     /locus_tag="ACHE_10029A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277630.1"
                     /db_xref="GeneID:66976986"
     CDS             complement(92234..93268)
                     /locus_tag="ACHE_10029A"
                     /note="COG:V;
                     EggNog:ENOG410PK0D;
                     InterPro:IPR001509,IPR036291;
                     PFAM:PF01073,PF13460,PF07993,PF01370;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131149.1"
                     /db_xref="GeneID:66976986"
                     /translation="MSTETVLITGASGFVATHVVDSFLKAGYAVRGTVRSEDTAEKVR
                     RTFPQYADKLSFAIVPDIGAPHAFDEAAKGVRGVIHTATPFQIEVEDNERDLLIPAIE
                     GTNNVLDAVKKNAPEVQRIVITSSFAAIIDLGKGTRPGHVYSEADWNPLTYEVAAKKE
                     TPGAAAYTAAKTLAERAAWDFVEREKPSFDVVTICPPMVYGPNINATTNLAKLNTSSA
                     DIYRLMSPNSKSTDPVPSNAFWSWVDVRDVAEAHLKAYQVSEAGGQRFFVTGGNFSYQ
                     QFVDVLREKIPEIKDRVPVGTPGSGFGGVELYGVDNSKSQKVLGLKYHDLEQTVVDSA
                     RAFLELEKSA"
     gene            complement(<94338..>95244)
                     /locus_tag="ACHE_10030A"
                     /db_xref="GeneID:66976987"
     mRNA            complement(join(<94338..95062,95127..>95244))
                     /locus_tag="ACHE_10030A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277742.1"
                     /db_xref="GeneID:66976987"
     CDS             complement(join(94338..95062,95127..95244))
                     /locus_tag="ACHE_10030A"
                     /note="COG:S;
                     EggNog:ENOG410PRCU;
                     InterPro:IPR021833;
                     PFAM:PF11905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131150.1"
                     /db_xref="GeneID:66976987"
                     /translation="MPPESSSSDVTSPTDDDWHGIDDKIERRRRQNRVNQRAWRLRHK
                     QHPQRDGLPSRSPSANEPSALIPFVPPNHTHDGSSCSRPECFLISSETEMLLERFEST
                     AYTSYILGSPQADHLLTLVRGNIFRALFHNLSVLGLSKEWMNEDALSPLASDSQSHLV
                     RHLAMLPVSLQPTVLQRSVEHHPWLDLFPLPRMRDNMIELGDALDEYQLCEDLMGFWN
                     THQNDSMLVVWGDPWDPRNWEVTEQFLRKWSWLIKGCPELIWSTNYWRHQRGEKRIAY
                     RGYE"
     gene            complement(<95543..>96061)
                     /locus_tag="ACHE_10031A"
                     /db_xref="GeneID:66976988"
     mRNA            complement(<95543..>96061)
                     /locus_tag="ACHE_10031A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277853.1"
                     /db_xref="GeneID:66976988"
     CDS             complement(95543..96061)
                     /locus_tag="ACHE_10031A"
                     /note="COG:Q;
                     EggNog:ENOG410PPAF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131151.1"
                     /db_xref="GeneID:66976988"
                     /translation="MIAPTNQVPASESAIPVSQCFPTISEESLKENVIIIVGTCVETP
                     APTVASMSTDPFCFSPARLDSKKPQASPFIKSLNTASGPHAFPTAVYLGPDRHNLRIN
                     TICPWMTQTRITVGKNLGNRWAEEGLPISTPLDGAKVAAGVLTDDSLHGTSMYVAGGR
                     AWEIEGSSHHGR"
     gene            complement(<97063..>100139)
                     /locus_tag="ACHE_10032A"
                     /db_xref="GeneID:66976989"
     mRNA            complement(join(<97063..97200,97254..97896,97956..98139,
                     98195..99041,99108..99469,99541..99970,100050..>100139))
                     /locus_tag="ACHE_10032A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277964.1"
                     /db_xref="GeneID:66976989"
     CDS             complement(join(97063..97200,97254..97896,97956..98139,
                     98195..99041,99108..99469,99541..99970,100050..100139))
                     /locus_tag="ACHE_10032A"
                     /note="CAZy:GT2_Chitin_synth;
                     COG:M;
                     EggNog:ENOG410Q28A;
                     InterPro:IPR029044,IPR004835,IPR004834,IPR013616;
                     PFAM:PF01644,PF08407,PF13632;
                     TransMembrane:8
                     (o527-546i566-591o611-633i645-666o696-715i727-745o822-
                     841i861-885o);
                     go_function: GO:0004100 - chitin synthase activity
                     [Evidence IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0006031 - chitin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131152.1"
                     /db_xref="GeneID:66976989"
                     /translation="MGTQFPFRNSHSPQESQSSSGYSPATTPYRQSGLEETDQELSLL
                     RGQPSPQPSPFGAPFDNNYSTDSLRRYTLHDPGVTVFPNVPPYESQPDYVTSPYGTPA
                     SEGGTTSSDAWKRRQGPGTGLSRRYGTRKIKLVQGSVLSVDYPVPSAIQNAIQPEYRE
                     SEEAFTEEFTHMRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAITYYNEDKVLTA
                     RTLHGVMQNVRDIVNLKKSEFWNKGGPAWQKIVVSLVFDGIDPCDKNTLDVLATIGIY
                     QDGVMKRDVDGRETVAHIFEYTTQLSVTSNQQLVRPHRDDPNTLPPVQMLFCLKQKNS
                     KKINSHRWLFNGFSRILNPEVVILIDAGTKPGRKSLLALWEAFYNDRNLGGACGEIHA
                     MLGEGWRNLLNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAIMGRPL
                     EQYFHGDHTLSRKLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHLSYVKASK
                     GETDVPEGTAEFISQRRRWLNGSFAAGLYAMMHFGRIYQSSHNFLRMFFLHIQMLYNF
                     AQLIMTWFSLASYWLTSSVIIDLVGTPSSTNKYKGWPFGNEATPIVNNILKYGYLFCL
                     MLQFILALGNRPKGARLPYTLSFLYFSLVQFYVLICSFYLVANAFSGGTLDFNMSDGV
                     GAFLSSFFSSQGPGIVLIALVSTYGIYVVSSLLYMDPWHILTSSWAYFFGMTTSINIL
                     MVYAFCNWHDVSWGTKGSDKADALPSAQTQKDGLKSNFIEELDKPQADIDSQFESTVK
                     RALAPFEEPEEEYEKSMDDSYRNFRTNLLLLWIFSNLILSLLITAESISRMCLTNTST
                     TRTSWFFQIILWSTAALCFFRFFGSLWFLGRSGILCCVNRR"
     gene            <102652..>104679
                     /locus_tag="ACHE_10033S"
                     /db_xref="GeneID:66976990"
     mRNA            join(<102652..104599,104648..>104679)
                     /locus_tag="ACHE_10033S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278075.1"
                     /db_xref="GeneID:66976990"
     CDS             join(102652..104599,104648..104679)
                     /locus_tag="ACHE_10033S"
                     /note="COG:S;
                     EggNog:ENOG410Q2JQ;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:3 (o252-270i416-435o480-499i);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131153.1"
                     /db_xref="GeneID:66976990"
                     /translation="MRAQTECKYNASYSRGAVVTPQASNDVYPHHVDASSPVEMASAE
                     GRSAAETPYESQDPDLVLDVTGQYCGPASAHSFLGRAVQNFSHTSRPSISTALPDLET
                     SAPAVSIFSYGDRKALEVDRTRFHWPNVSVARELVRRYFDFAAPTYRILHQGTVDKWV
                     DDIDHPQSLSNPLSAATQATLLMVFATSLMFRGDPERIRDAGDDGWRHSELYYAMAES
                     SLAHEVGMPTLGSVQARFLMVLYLLCSSRANQSWFAFGTVVQLLMCLGLHRYRSLNES
                     ASMEERVTRECEKRVLWCAYTLDKYLSLILGRPRFLQEEDIDQELPAAVDDDDLGREQ
                     PDENSTPKDCIMNAPILHSLLARILSRAAKEQYAVRSISDAQQMQAIESLSEAIEVWH
                     AQLPPILSGAIQPSSLIPLFRRQLTVLQLARFHAIMFVTRPLLLRNYAVNLPGYESSY
                     RNYLITCVAAARDTISLILSFAKEEQLFPAFWYSQYIAFNALSAIYIYLIQMKRGRIP
                     PCTTQDLHENTLYELAETTQHHLAQVTVRNAPSWRYSVILQGLRGEANRVLHQDEFQD
                     RGSTQQRHTKMNRTAATRTLPVDPMLSSQPSSAAVYEEHPMIEEMAAPGYNILDPRAE
                     SLFGSFAMDGDPSLNFWPQLDCLPIMYPDLWPGFG"
     gene            complement(<105887..>106894)
                     /locus_tag="ACHE_10034A"
                     /db_xref="GeneID:66976991"
     mRNA            complement(<105887..>106894)
                     /locus_tag="ACHE_10034A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278186.1"
                     /db_xref="GeneID:66976991"
     CDS             complement(105887..106894)
                     /locus_tag="ACHE_10034A"
                     /note="COG:S;
                     EggNog:ENOG410PU32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131154.1"
                     /db_xref="GeneID:66976991"
                     /translation="MTNLTTFSLSIALFGQYEPRKDTIGLILSALPESCVNLELDLDR
                     FKYNGTGTGSEHVCEGIAGCLPRLHHLRLSMGTLCPALLLPNFARDGSIKDEAHFHAP
                     IYQSLKTCIISCHLSGDALTCNEDRSQHPNQSNGLRARLPLVKSLRELVVRGSFPQIE
                     RLWLLDGQNYNALDSRESPAWNRRDTVRNKTWVIPWINLHAKNMPFPLITRTPEGQES
                     ITTNHGALAALAEAQTWKETVMGSRLPAAILDGPERCKHVVKGAPTISLAQYREISPK
                     GSCSWWGHEKLTGIQLIWATERDGLVDRSPIHELTPPGWMREPDFEGNPGQLIRDNST
                     A"
     gene            complement(<108152..>108427)
                     /locus_tag="ACHE_10035A"
                     /db_xref="GeneID:66976992"
     mRNA            complement(<108152..>108427)
                     /locus_tag="ACHE_10035A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278297.1"
                     /db_xref="GeneID:66976992"
     CDS             complement(108152..108427)
                     /locus_tag="ACHE_10035A"
                     /note="COG:S;
                     EggNog:ENOG410PHCM;
                     InterPro:IPR018392,IPR036779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131155.1"
                     /db_xref="GeneID:66976992"
                     /translation="MSTSMPSSTTATASSTTSPVVTPSPTQPNSIASNCNQFAQAKSG
                     DVCYDFAQKNSITPNELYEWNTVLGDNGSNRGTALQANVWYCVGVTG"
     gene            <110721..>111834
                     /locus_tag="ACHE_10036S"
                     /db_xref="GeneID:66976993"
     mRNA            join(<110721..110935,110997..111502,111554..>111834)
                     /locus_tag="ACHE_10036S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278408.1"
                     /db_xref="GeneID:66976993"
     CDS             join(110721..110935,110997..111502,111554..111834)
                     /locus_tag="ACHE_10036S"
                     /note="COG:I;
                     EggNog:ENOG410Q1U2;
                     InterPro:IPR006694;
                     PFAM:PF04116;
                     TransMembrane:3 (o64-90i110-129o149-169i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0008610 - lipid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131156.1"
                     /db_xref="GeneID:66976993"
                     /translation="MDVLLDVLDTFVLDRAYAVVLPVHDNAIKPSVLYNENVGRYLEL
                     VPSQWAYLSRLPREHILRQFLSFFLITWVFGLFLYFLSATISYYFVYDHRTMQHPKFL
                     RNQIPMEIRQALSAMPVMAALTAPFFVAETQGLTKLYDFPTEAPFPLYNYIQYPLFIA
                     FTDFGIYWIHRGLHHPMIYKRFHKPHHKWIISTPYASYAFHPLDGWAQSVPYHVFPVL
                     FPLQKAAYLGLFTFVTIWTVMIHDGEYAMNSPVVNGSACHTIHHYYFNYNYGQFTTFW
                     DRVGGSYRKPNAELFDREQRMEKKEIDKQVKEMNQLVQEVEGEDDRCYSTGTEKKDS"
     gene            <112073..>113106
                     /locus_tag="ACHE_10037S"
                     /db_xref="GeneID:66976994"
     mRNA            join(<112073..112422,112470..>113106)
                     /locus_tag="ACHE_10037S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278519.1"
                     /db_xref="GeneID:66976994"
     CDS             join(112073..112422,112470..113106)
                     /locus_tag="ACHE_10037S"
                     /note="COG:C;
                     EggNog:ENOG410PFVQ;
                     InterPro:IPR018170,IPR020471,IPR036812,IPR023210;
                     PFAM:PF00248;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131157.1"
                     /db_xref="GeneID:66976994"
                     /translation="MENDKMPLPTHFTLNTGAQIPAVGFGTWQAAPHEVERAVESALR
                     EGYRHIDCAAIYRNETEVGQGIKNSGVSREEIFLTSKLWNTKHASEDVEGALDKTLSD
                     LGVAYLDLYLMHWPVAFVRGEKWFPLNDEGVFQLADIDYVTTYKAMEKLLATGKVKAI
                     GVSNFNIRHLDRLISQVDVVPAVNQVEAHPYLTQPDLLQYCRSKNILIQAYSPLGNNQ
                     TGEPRTVDDPLVHEVAGRLGMDPGVVLGSWGVQRGTVVLPKSVTPSRIASNLLVKELP
                     EDAFAQLNSLERHKRFNFPGRWGYDIFDEVGEEAVKQIAKESAESNKVKFTV"
     gene            <113441..>115302
                     /locus_tag="ACHE_10038S"
                     /db_xref="GeneID:66976995"
     mRNA            join(<113441..113727,113781..>115302)
                     /locus_tag="ACHE_10038S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278630.1"
                     /db_xref="GeneID:66976995"
     CDS             join(113441..113727,113781..115302)
                     /locus_tag="ACHE_10038S"
                     /note="COG:J;
                     EggNog:ENOG410PGSJ;
                     InterPro:IPR023631,IPR036928;
                     SECRETED:SignalP(1-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131158.1"
                     /db_xref="GeneID:66976995"
                     /translation="MFSTAIIAAASFLGLSTLTRRDEVSSLGPNPQFAYDFPIPGKNA
                     SDLFPMHLCHGFRLEEASIDDIQGLLTSRALSSVDLVSCYLDRIYQTSSYLNAILQIN
                     PDASTIAAKLDQERANGTVRGPLHGIPFVAKDNIGTKDRMETTSGSWALLGSIVPRDA
                     FVISQLREAGAVLLGKAALSEWADIRSNNYSEGYSGRGGQCRSAYNLTVNPGGSSSGC
                     GVAVGANLVPFALGTETDGSGMWTPDKHSSSWRDISNENTVINPAERNAIVGIKPTVG
                     LTSRSGAIPESLNQDTIGTFGKTVRDATYALDAIYGVDGRDNATHMQQGKTPAGGYAQ
                     FLGNKSSLQGAVFGLPWESFWKLAGPEQLSQLVELLDMIKGAGATIINGTELPHHEKI
                     VSPTGWDWDYGTARGYPNESEYTYIKADFYNHIKAYLADLDNTSMRSLEDLVAYNAEN
                     AGSEGGHPNVHPAFASGQDGFEASLATKGVMDETYWQALSFCRRTTREEGIDAALQHG
                     DRVLDGLLVPPDVAQSIQIAAQAGYPVITVPAGVNRASGMPYGLAIMHTAFAEPTLIK
                     YASAIEDLQKSTDTRWKRTLPEWRGHLTRNIPVINA"
     gene            complement(<116308..>116577)
                     /locus_tag="ACHE_10039A"
                     /db_xref="GeneID:66976996"
     mRNA            complement(<116308..>116577)
                     /locus_tag="ACHE_10039A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278741.1"
                     /db_xref="GeneID:66976996"
     CDS             complement(116308..116577)
                     /locus_tag="ACHE_10039A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131159.1"
                     /db_xref="GeneID:66976996"
                     /translation="MYQRGLPRQDHGRMTSHKLQEHLMNATSNRNLAVYTSSMNLMTF
                     PEVGDGVCHPRHRGRVCRHDLILKEFLNNQTLGYLLKVDQWADNR"
     gene            complement(<118913..>120347)
                     /locus_tag="ACHE_10040A"
                     /db_xref="GeneID:66976997"
     mRNA            complement(join(<118913..119160,119210..119485,
                     119540..119825,119876..120163,120218..120255,
                     120308..>120347))
                     /locus_tag="ACHE_10040A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278853.1"
                     /db_xref="GeneID:66976997"
     CDS             complement(join(118913..119160,119210..119485,
                     119540..119825,119876..120163,120218..120255,
                     120308..120347))
                     /locus_tag="ACHE_10040A"
                     /note="COG:S;
                     EggNog:ENOG410PH9M;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131160.1"
                     /db_xref="GeneID:66976997"
                     /translation="MHHTMDRVLIVGAGAAGLLIAQVLKRENIPCTVFEQDPSFRPRD
                     WNYGVYWAQSGLSECLPPELLDQLENCQVDHHTPAATDTLPGFNGKTGEKLVDVPAPY
                     SLRLKRRKFLQLISTGLDIQRGKRLARIESNNDIVTAFFEDGSQATGKLLIGAEGAHS
                     RVREYLMGPEKAALKPSPVVSSIATPRLPVDVASAVRELHPRYCAVFHPDGYFCWVGI
                     HNETEDPAESEFLLLMSWISENDTGLSGEAILHDLKEKASHFAEPFRSVFETLAPGTK
                     IWHSRLSYWETQPWDNHNGTLTLVGDAAHPMTFHRGQGLNNAILDAASLSREIANLQD
                     KSPRALRPALEAYEKEVLGRGREVVESSNINSVSIHNWEELQNSPLFRMGLKKDATA"
     gene            <121095..>121936
                     /locus_tag="ACHE_10041S"
                     /db_xref="GeneID:66976998"
     mRNA            join(<121095..121123,121174..121380,121432..>121936)
                     /locus_tag="ACHE_10041S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278964.1"
                     /db_xref="GeneID:66976998"
     CDS             join(121095..121123,121174..121380,121432..121936)
                     /locus_tag="ACHE_10041S"
                     /note="COG:S;
                     EggNog:ENOG410PMCI;
                     InterPro:IPR029063;
                     PFAM:PF13489,PF08241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131161.1"
                     /db_xref="GeneID:66976998"
                     /translation="MGTGTGIWAMDMADAHPEATIKGIDLSPIQPSWIPPNLKFEVDD
                     YNLEWLDHNKYDLIHARELLGTVPSWPEMYRKVLGALKPGGWFQQADPQVFLTSSYDT
                     LGPDHVYHQWNPLLIGAGKKAGLDFDSAPRMKGWLEEAGFINVTEYRVPWPIGTWPKD
                     PHQREIGAFNQVRIEQGVVDFCGRRFTNNLGVRQHSAVGRTLLIILQWSHAQLEVFAA
                     SMRAAVKNNKLLAHHYVYVVLLLFSETS"
     gene            <122500..>124399
                     /locus_tag="ACHE_10042S"
                     /db_xref="GeneID:66976999"
     mRNA            join(<122500..122830,122877..123471,123516..124132,
                     124191..>124399)
                     /locus_tag="ACHE_10042S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279075.1"
                     /db_xref="GeneID:66976999"
     CDS             join(122500..122830,122877..123471,123516..124132,
                     124191..124399)
                     /locus_tag="ACHE_10042S"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410PJ6X;
                     InterPro:IPR012132,IPR036188,IPR027424,IPR000172,
                     IPR007867;
                     PFAM:PF00732,PF05199;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131162.1"
                     /db_xref="GeneID:66976999"
                     /translation="MIARFKLACAFLATAAVATGPLYDYVIVGGGTSGLVVANRLSED
                     PNVSVVVIEAGYSVHDNENVTAANGYGKAFGTEIDYQYESVNQTYAGNSKQTLRAGKA
                     LGGTSTINGMSYTRAEDVQIDAWKELGNRGWSWNSLFPYYQKSEQLTRPSPDEIAAGA
                     SYNESAHGYDGPLHVGFNNMQEGNLTTPLNQTYDKLGIPWVEDVNDGRMRGFNVFPET
                     INHELGIREDAARAYYWPYRSRPNLIVITKTRANKILWSDDNATGGVSASGVEIQSGN
                     ITGVVKARKEVILSTGSIRTPTLLELSGVGNKDILEKHNITVRVDLPTVGENLQDQTN
                     ANTMALGNGNWTGVKALAYASFYDIFGDDAEAVAGSVLHKLADYAAKTSEATGGVVKQ
                     EDLANFFQIQYDLLFSNAVPMVEILFIPTHSPMLITEYWTLLPFSRGNVHINSADPAE
                     NPVINPNYFMVDWDLQAHIGVTKFIRNMYQTAPLSDMIKMERAPGPDVPQNATDTDWE
                     EYTKKNYRSNFHPVGTAAMMPRSMGGVVSDRLMVHGTSNVRVVDASVLPFQMCGHLTS
                     TLYAIAERASDLIKEDA"
     gene            <124911..>125890
                     /locus_tag="ACHE_10043S"
                     /db_xref="GeneID:66977000"
     mRNA            join(<124911..125019,125075..125267,125323..125642,
                     125712..>125890)
                     /locus_tag="ACHE_10043S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279186.1"
                     /db_xref="GeneID:66977000"
     CDS             join(124911..125019,125075..125267,125323..125642,
                     125712..125890)
                     /locus_tag="ACHE_10043S"
                     /note="COG:S;
                     EggNog:ENOG410PNHI;
                     InterPro:IPR036851,IPR000028;
                     PFAM:PF01328;
                     SECRETED:SignalP(1-24);
                     go_function: GO:0004601 - peroxidase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131163.1"
                     /db_xref="GeneID:66977000"
                     /translation="MKVSIVSTILSAALATASPHFGMASLDNWKPAGHGDFRGPCPML
                     NTLSNHGFLPHDGRNLTREVVIKGLSEGLNFNASLGSLMFDMALVANPEPNATYFTLD
                     NLNRHNVLEHDASMSRSDAYYGNNHVFNSTIFDKTKAYWKKPVLDATMLANGKLARQI
                     QSRASNPNYTFTSSMEEFSLGEVAAPVIAFGDIQHGRVNRSLVEYFFENERLPAELGW
                     TRPEKVISLEDISKVTEMIRNATSLITPSKSDSGSGSTKRDLHGGMFR"
     gene            <132565..>134729
                     /locus_tag="ACHE_10044S"
                     /db_xref="GeneID:66977001"
     mRNA            join(<132565..132709,132764..132816,132862..133134,
                     133182..133706,133754..133793,133847..133862,
                     133909..134198,134256..134341,134400..>134729)
                     /locus_tag="ACHE_10044S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279297.1"
                     /db_xref="GeneID:66977001"
     CDS             join(132565..132709,132764..132816,132862..133134,
                     133182..133706,133754..133793,133847..133862,
                     133909..134198,134256..134341,134400..134729)
                     /locus_tag="ACHE_10044S"
                     /note="COG:G;
                     EggNog:ENOG410PHXX;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:12
                     (i34-55o75-95i107-125o131-153i165-184o217-241i331-351o366-
                     388i395-418o430-455i476-492o498-517i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131164.1"
                     /db_xref="GeneID:66977001"
                     /translation="MGAPVDAVGVSARRAELAGNKVGWRGLVSSKKTFGIALFASLGG
                     LVYGYNQGMFAQILTMSSFIKATQGYAAEPGIGQGMLTSILELGAWVGTLLNGYLADA
                     LGRRVTVVVAVVIFCVGVIVQACTQNPDFVYAGRFVTGLGVGNLSMIVPLYNAELAPP
                     EIRGSLVAVQQLAITFGIMTSFWVSNLDIWTRDAHLTVDQIGYGTNYIGGTGATQSVA
                     AWEIPVCIQILPALLLAFGMMLFMPQSPRHLMNTGREEECLHTLARLRDTSPDDLLVR
                     IEFLEIKALRMFEVETARKKYPQYQDGSFKSRFMIGVRDYASLVTNKSMRKRTTVACL
                     IMFAQQFNGINAINYYAPQVFENLHLGENTTSLLATGIAGIFEFVFTIPAVLWVDNVG
                     RRTILIAGGVGMAVCHFIVAGIIGSYSGNFENNPGAGWAAVVFVWIFIINFAYSWGPV
                     SWIIVSEVFPLSMRAKGVSIGGSSNWLNNFAVGLFTSPFIKASDYGTFIFFGCITTLA
                     VLYVIFLVPETKGRTLEEMDEIFGANGVAEADQALKRSIEREIGLLALLGGDGSGEVK
                     EKAEVGGDEVKTEPGAIEE"
     gene            complement(<135095..>138132)
                     /gene="KLP1"
                     /locus_tag="ACHE_10045A"
                     /db_xref="GeneID:66977002"
     mRNA            complement(join(<135095..135332,135388..137804,
                     137875..137969,138029..138054,138131..>138132))
                     /gene="KLP1"
                     /locus_tag="ACHE_10045A"
                     /product="kinesin heavy chain"
                     /transcript_id="XM_043279408.1"
                     /db_xref="GeneID:66977002"
     CDS             complement(join(135095..135332,135388..137804,
                     137875..137969,138029..138054,138131..138132))
                     /gene="KLP1"
                     /locus_tag="ACHE_10045A"
                     /note="COG:Z;
                     EggNog:ENOG410PGZJ;
                     InterPro:IPR019821,IPR036961,IPR027417,IPR027640,
                     IPR001752;
                     PFAM:PF16796,PF00225;
                     go_function: GO:0003777 - microtubule motor activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0008017 - microtubule binding [Evidence
                     IEA];
                     go_process: GO:0007018 - microtubule-based movement
                     [Evidence IEA]"
                     /codon_start=1
                     /product="kinesin heavy chain"
                     /protein_id="XP_043131165.1"
                     /db_xref="GeneID:66977002"
                     /translation="MSSGPNTIKVVARFRPQNKVELASGGQPIVNFENEETCSISSQE
                     GSGDFTFDRVFPMDSLQTDIFEYSIRPTVDDILNGYNGTVFAYGQTGAGKSYTMMGSD
                     IEDDTGKGIIPRIVEQIFASILTSPSNIEYTVRVSYMEIYMERIRDLLVPQNDNLPVH
                     EEKSRGVYVKGLVEVYVSSVQEVYEVMRRGGAARAVAATNMNQESSRSHSIFVITITQ
                     KNLETGSAKSGQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDGK
                     STHIPYRDSKLTRILQESLGGNSRTTLIINCSPSSYNDAETISTLRFGVRAKSIKNKA
                     KVNAELSPAELKQLLRKAQTQVTSFENYLSALESEVHVWRSGENLPKERWTPARSETM
                     AIAKTEKPRPATPSRLQEVPRAETPRPDSRMGDRSSTPSLVLEKDERDEFLRRENELQ
                     DQIAERESHIVNVERNLREAREELKGLKENSARSGKDNDKLNTEINELRMQLEKVSYE
                     GKEASITMDSLREANAELTAELDDVKQQLLDVRMKAKETTAALDEKEKKKAEKMAKMM
                     AGFNLGGEIFSDNERKLQDLISRVDSLHSVSEAGETIAPDDILELRASLLETQGFIRQ
                     AELTMNDRGELGELQDSRRAEVERKLADLEREHESLLERNLGEGDVAEIRERLEKLHV
                     TRKEDEVQAAEKLRDEITRKDKELNKLQQSLADSQSRVSTNGAAGKNLQQQIAEFDAM
                     KKSLMRDLQNRCERVVELEISLDDAREQYNNVLRSSNNRAQQKKMAFLERNLEQLTHV
                     QRQLVEQNSSLKKEVAIAERKLIARNERIASLESLLQESQEKLTQANHRFEAQLTAVK
                     ERLEAAKQGSTRGLPTMDGSGGFSFAGSRIAKPLRGGGGSESSAPNSAVAGVQSQETT
                     GKRTSWFFDRR"
     gene            complement(<138999..>140182)
                     /gene="UBC2"
                     /locus_tag="ACHE_10046A"
                     /db_xref="GeneID:66977003"
     mRNA            complement(join(<138999..139122,139197..139421,
                     139488..139552,139690..139760,139824..140022,
                     140076..140110,140161..>140182))
                     /gene="UBC2"
                     /locus_tag="ACHE_10046A"
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /transcript_id="XM_043279519.1"
                     /db_xref="GeneID:66977003"
     CDS             complement(join(138999..139122,139197..139421,
                     139488..139552,139690..139760,139824..140022,
                     140076..140110,140161..140182))
                     /gene="UBC2"
                     /locus_tag="ACHE_10046A"
                     /note="COG:K;
                     EggNog:ENOG410PHPZ;
                     InterPro:IPR016135,IPR023313,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /protein_id="XP_043131166.1"
                     /db_xref="GeneID:66977003"
                     /translation="MKSYPSDSATRWAEVVARHTIFDQFLHRVCFSSSVFNALSNCSS
                     SPGIHFGVIAFPGLSSPGFLCLFALTGRTQLAYLSLRTPQTTPRSSSNPAAMSTSARR
                     RLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPN
                     KPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPAN
                     VEASNLYKDNRKEYVKRVRETVEKSWED"
     gene            <140257..>141670
                     /locus_tag="ACHE_10047S"
                     /db_xref="GeneID:66977004"
     mRNA            join(<140257..140412,140474..141418,141470..>141670)
                     /locus_tag="ACHE_10047S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279630.1"
                     /db_xref="GeneID:66977004"
     CDS             join(140257..140412,140474..141418,141470..141670)
                     /locus_tag="ACHE_10047S"
                     /note="COG:I;
                     EggNog:ENOG410PG5V;
                     InterPro:IPR016039,IPR020610,IPR020617,IPR020616,
                     IPR020615,IPR002155;
                     PFAM:PF00108,PF02803;
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131167.1"
                     /db_xref="GeneID:66977004"
                     /translation="MPIQTSAGLSARLFAQRTAIPASRRQFSCARPLLKEIQDAYILS
                     ASRTPTTNFNGSFASVSAPELGAAAIKSAVGKSNLPVEKITDVYMGNVLQGSVGQAPA
                     RQASIFAGLAPTVESMTVNKVCASGLKAVALAAQNIQLGLADAQVAGGMENMSRVPYY
                     LPRAGQLPPFGDLKLEDGLVKDGLWDVYNQFHMGICAEQTAKKYEVSREEQDEYAIRS
                     YERAQQAWNENKFADEIVPVTVKGRKGDTVVSRDEGFENLRADKLKTLKPAFLRDGTG
                     TVTAGNASTMNDGASALVLGSKDLAREFGKGNRALARIVSTADAAIDPVDFPVAPAKA
                     VPIALERAGITKDQVSVWEFNEAFAAVIKANEKILGLQNAKVNLLGGAISIGHALGSS
                     GSRILVTLLHQLQPGEYGVAAICNGGGAASAMVVQKLDKVD"
     gene            complement(<143983..>144466)
                     /locus_tag="ACHE_10048A"
                     /db_xref="GeneID:66977005"
     mRNA            complement(join(<143983..144175,144240..144317,
                     144372..>144466))
                     /locus_tag="ACHE_10048A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279741.1"
                     /db_xref="GeneID:66977005"
     CDS             complement(join(143983..144175,144240..144317,
                     144372..144466))
                     /locus_tag="ACHE_10048A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131168.1"
                     /db_xref="GeneID:66977005"
                     /translation="MPGVRLDKTMVWSLKNSVERAYIQQDLVPAYRELYTFRHNPLRY
                     CANHSIWDQANKKVSIIGFSLTKPMRSDHAWNEKLYAAWDLAKPPPTVKWSKPGYIHW
                     NMDKWGLYTGLGETAYYGN"
     gene            <145119..>147508
                     /locus_tag="ACHE_10049S"
                     /db_xref="GeneID:66977006"
     mRNA            join(<145119..145226,145293..146219,146267..146456,
                     146510..147250,147318..>147508)
                     /locus_tag="ACHE_10049S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279852.1"
                     /db_xref="GeneID:66977006"
     CDS             join(145119..145226,145293..146219,146267..146456,
                     146510..147250,147318..147508)
                     /locus_tag="ACHE_10049S"
                     /note="COG:S;
                     EggNog:ENOG410PMH8;
                     InterPro:IPR024764,IPR024761;
                     PFAM:PF12657,PF12660;
                     TransMembrane:1 (i351-372o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131169.1"
                     /db_xref="GeneID:66977006"
                     /translation="MLSPVTLRIFPSCYDCLSWSDDGELAVAAGEYVHILTPRSTAEQ
                     TTNDTGTAGGQWHFSRFRTNLFTASEWPVIYPQDRQTFSIGAEQSNSTIVGLKWSPPG
                     LGRHRRCVLSVLTSNLMLSFYEPAGPGKWTRVAIVNDALKSYFEPLVEEEGPRLRKST
                     IRSFSWCPPIKPARSDEPSTPYSVPDAETRWGVQLLAVTNDDNEVIFLRTQRSRLEAN
                     STNSYGFNLLSVTALGDLAGNYPMIHPGSVFSTALKSRIKASQLSCGPWLSQTSETQQ
                     DAYSVTSNVVILYGTKVRVIKLDVALTHQNDTTESDSPHKTIANAAELDAPSGLSQDR
                     HFTGPFQWLYTGRSQEVLLTAGIFGGLVVISVPAFRYLTGEIENTEIQTQEWPFHENT
                     VSGLQTDESRHWEPISGMSSTSNERDQQSTLYLSTIGGYGAAQAFNGVSDQIPFSLPP
                     WKAAIDDYTDQFDIDRDLGGMVTGRIWGLACHNGHLAVAFTVHPKDMIEYRTAAEERT
                     TVVFIRLDKQSEEESATAMSKPLADQTAELQRAKREAVLGYILHAEQRPDGYSELSKK
                     VIYAAARCAILDCENEVLLIRARKSLDWLMAITVLDFREEMARSSVVEPKSLEKLEPP
                     VKEIFEQCDICDAGIACNSISESQCANGHVFARCNLTFLSIQEPGVSKFCSDCGTEYL
                     DGDLLGSHYDEGVRTTCQTLCDAFDICIYCGGKFRP"
     gene            complement(<147579..>149025)
                     /gene="ALG1"
                     /locus_tag="ACHE_10050A"
                     /db_xref="GeneID:66977007"
     mRNA            complement(join(<147579..148720,148782..>149025))
                     /gene="ALG1"
                     /locus_tag="ACHE_10050A"
                     /product="mannosyltransferase"
                     /transcript_id="XM_043279964.1"
                     /db_xref="GeneID:66977007"
     CDS             complement(join(147579..148720,148782..149025))
                     /gene="ALG1"
                     /locus_tag="ACHE_10050A"
                     /note="BUSCO:EOG09262Z2S;
                     CAZy:GT33;
                     COG:G;
                     EggNog:ENOG410PG9S;
                     InterPro:IPR026051;
                     TransMembrane:2 (o6-23i113-131o);
                     go_function: GO:0000030 - mannosyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mannosyltransferase"
                     /protein_id="XP_043131170.1"
                     /db_xref="GeneID:66977007"
                     /translation="MIETLISLAFYASTAITFLILLLPSQYEPRRASDSKQNASSEPK
                     TRIQILVLGDIGHSPRMQYHALSVAKHGGQVDIIGYHESELHPDISFNPRITIVPIPP
                     HPAFLQTSNKLLFLVFAPLKIIFQVLSLWRCLAYQTEPAKWLLAQNPPSIPTLAIASL
                     VCFLRHTNLVVDWHNFGYSILALKLGDTHPVVRFSKRFERVFCRYATAHLCVTEAMTS
                     VLKRDFALEAPILPLHDRPASHLQPIHDTQVRQDFISSVPETSSAKSVLGTEDFRVLV
                     SSTSWTPDEDFSLLIDALCEYSKLATTSKPSLPPILTIITGKGPQKAIYLKKISDLEI
                     AGRLQKVSIRTAWLTTENYAKLLASASLGVSLHTSSSGVDLPMKVVDMFGAGLPVVGW
                     NRFEAWPELVTEGVNGRGFGSVDELVEQLVDLFGDLTKLEKLRAGALRESERRWDGEW
                     DPVAGKLLGLL"
     gene            <149537..>152289
                     /gene="MSC2"
                     /locus_tag="ACHE_10051S"
                     /db_xref="GeneID:66977008"
     mRNA            join(<149537..149910,149970..151106,151155..151373,
                     151422..>152289)
                     /gene="MSC2"
                     /locus_tag="ACHE_10051S"
                     /product="putative zinc transporter Msc2"
                     /transcript_id="XM_043280075.1"
                     /db_xref="GeneID:66977008"
     CDS             join(149537..149910,149970..151106,151155..151373,
                     151422..152289)
                     /gene="MSC2"
                     /locus_tag="ACHE_10051S"
                     /note="BUSCO:EOG092621CK;
                     COG:P;
                     EggNog:ENOG410PKY0;
                     InterPro:IPR027469,IPR002524;
                     PFAM:PF01545;
                     TransMembrane:11
                     (o227-247i267-286o292-309i345-366o372-390i499-518o530-
                     548i569-588o600-621i646-671o677-695i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0008324 - cation transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative zinc transporter Msc2"
                     /protein_id="XP_043131171.1"
                     /db_xref="GeneID:66977008"
                     /translation="MSTGTPVSSADANPPASKAGHGHSRSRGHSRSTRYGQVPNPIAV
                     PSPLPPVQPFSPQPVVGAAYSNGHASRPSWHGHHHSHSQGSMHYDQWTPSPVTTVFED
                     HRMEPNYEPDTPALLVEPEKSKGNEILTGFLITLPWIALSWFSTQYTQSTTLESPVDD
                     VDVVAASAYLEGIGSKACALTAGILVLWGCGDAALKGQGLSLAALPKLSGGIVSGAFI
                     RACSIGLPVYAGLGVGGFLVAFALSLAFASGIPTVASNSGQERFGQKKVSIGLLAIVV
                     LFSLFGSGSSLDEQPFMGYVALLVAVFVIRPPFAADLPGSTSEITPDPLSPRKSSEAG
                     LSSDTPSDNALVNLLSGVLLALATVIVSGIPSPGGVDLIYFGLTTGAFAVSFLCSLSS
                     GIRSPQKLGHAVGAGAASLFCSPSFQSDLFTVYVSRCVIAAVSVLAARFDDRHLRLEA
                     HSHNHTHHNHPAHSHSHKEPSRVTKMILNFCEPYPLLYSILKESDSRRIFYFMTLNFG
                     FMMVQLSYGFLTGSLGLLSDSIHMFFDCLALVVGLCAAIMSKWPSNSRFPYGYGKVDT
                     LSGFANGIFLMIISVEIIYEAIERLSSGSEMNRIGELLVVSVAGLLVNLIGIMAFEHG
                     HAHHGHDHGHGHSHGNENMHGIFLHILADTLGSVAVVISTILVHYSGWAGYDPIASCL
                     IAILIFASAVPLVSSTAKSLLLTLPADVEYNLRDTLGGVSAIRGVVGYTVPKFWLDDT
                     NASGDNHDHRHHGHSHSHGHSHSHGHGHGHSHGHGHGHGHHRSHSHSHDHGHHSHCAD
                     HDHHDHDHDNHDPHVLGVIHVIASRGADLEDVRQRTIDFLREKNMDITVQVEREGDGR
                     CWCGGNKTS"
     gene            complement(<155051..>156448)
                     /locus_tag="ACHE_10052A"
                     /db_xref="GeneID:66977009"
     mRNA            complement(join(<155051..156202,156257..>156448))
                     /locus_tag="ACHE_10052A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280186.1"
                     /db_xref="GeneID:66977009"
     CDS             complement(join(155051..156202,156257..156448))
                     /locus_tag="ACHE_10052A"
                     /note="COG:E;
                     EggNog:ENOG410PH2G;
                     InterPro:IPR026956,IPR029066,IPR042208,IPR001608;
                     PFAM:PF01168,PF14031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131172.1"
                     /db_xref="GeneID:66977009"
                     /translation="MAFPYYPIPSERDLKQFYIGKDIGDVPKPSVVLDVVIIKEHCER
                     MLQTVKALDVGFRAHVKTHKTPQIAQLQVGHGSEDANFVASTVLEIEWLAPLLKDLKR
                     QGRRFNTLYGIPLVPSQATRLAKIARELGPGSITVMIDHPVQVEYLKAFQVAAGFPAY
                     VFIKVDCGYHRAGLPPAMLNKNGLLEKLAEAEKEGYAVILGVYSHNSLSYAGSTPDEA
                     MEYLAAEIVSCREAIKHNSHFLSGRELVISVGATPQVVSSNNLLRSSSSSAAERLKNL
                     LHNPSESSIPVKVELHAGVYPVLDMQQFSTNARQSSGKLEEEVAISVLAEVCSIYNDG
                     ERSKPEALVAAGSLALGREPCKAYPGWGVVSDWRRGSGNSRLIVERISQEHAILAWED
                     GGSSEIPLKIGQSVRIYPNHACVTGAMYGWYLVVDSSEDQGASTVVDVWVRIGGW"
     gene            <158901..>160127
                     /locus_tag="ACHE_10053S"
                     /db_xref="GeneID:66977010"
     mRNA            <158901..>160127
                     /locus_tag="ACHE_10053S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280297.1"
                     /db_xref="GeneID:66977010"
     CDS             158901..160127
                     /locus_tag="ACHE_10053S"
                     /note="COG:I;
                     EggNog:ENOG410PV4N;
                     InterPro:IPR036291,IPR026055,IPR013120;
                     PFAM:PF07993,PF01370;
                     go_function: GO:0080019 - fatty-acyl-CoA reductase
                     (alcohol-forming) activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131173.1"
                     /db_xref="GeneID:66977010"
                     /translation="MSAPTPPSREEEVKKTGYARFFESQTVFLTGSTGSLGSCLLYKL
                     ALQLPTHKIFVLIRTSPQVAIEKWKKSMPQQAQAILSSGKIHFVIGDMRKSDFGIKEA
                     DLKRLQQEVTLVIHAAANISFTMDLKDAVEQNCLPPLELGRIASRFRRLKLFIQISTA
                     YGNSFLPDGYVGERQYSIVEDPEEELAQIISSGTSPNESRFSSTYAFAKHLTEWLFLK
                     RYPLLPLLLVRPTIFGAAMRDPYPLYGPPNSTPMRKFAEFLVAEPGTQVWHATKGYKS
                     GMNTLDEIPVDFVANSCLMHAAANTQGIVHIGSQLYHPMTFDDFLRLVDNNAPPGFPL
                     PTIVFTEDYSVPQHFLAELVKVASRNWVFDCGRSYWLKEMGGPLSLASCKHEMEGLNI
                     ARVKEVYEKHKQRAKL"
     gene            complement(<160411..>161658)
                     /locus_tag="ACHE_10054A"
                     /db_xref="GeneID:66977011"
     mRNA            complement(join(<160411..161511,161584..>161658))
                     /locus_tag="ACHE_10054A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280408.1"
                     /db_xref="GeneID:66977011"
     CDS             complement(join(160411..161511,161584..161658))
                     /locus_tag="ACHE_10054A"
                     /note="COG:S;
                     EggNog:ENOG410Q141;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (i336-355o);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131174.1"
                     /db_xref="GeneID:66977011"
                     /translation="MSTRPRRAHTKSRNGCDQCKKRRVKCDEQGPPCSNCTSRQLECT
                     YLKIPRARDRPEQPSPSPAGSQTPSVGLAPIVHLPAINGASGPFTASGLRSLELMHKF
                     STETSMSLSNDPSDFHVWQMVVPRKALEHDFLLSGILAVAALHVATSIESPAALSYID
                     TALEYHNMAFAPFRRALDHITPFNCDAVFAHSIITTIIGIALPRLTATRDESSNMTEN
                     IIIVFELLQGVKNIVWISEPWLHTKLFTSRREFWKESSVTELDPETEAALNKLATLNN
                     DTMATVDQEQHRMNRDAIALLHRCFLRHANARDAASVLTWLAAVDKDFVDCLRRRKPF
                     PLLILMYWGVLLGTLDGQMWWARNSGKALVTELLVALHPGVFQWEGAQLWPKQKLGL"
     gene            <161994..>163301
                     /locus_tag="ACHE_10055S"
                     /db_xref="GeneID:66977012"
     mRNA            <161994..>163301
                     /locus_tag="ACHE_10055S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280519.1"
                     /db_xref="GeneID:66977012"
     CDS             161994..163301
                     /locus_tag="ACHE_10055S"
                     /note="COG:S;
                     EggNog:ENOG410PZGJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131175.1"
                     /db_xref="GeneID:66977012"
                     /translation="MSRLTVRNFAARVRELPSSVEEPEQDKRAPYLDIGSRWEPCHHF
                     YKAGLPYKIWTGQDVFHFHGLYKYLDCFPDPYGFQSSDIAILVNDLEEAAAILEGSGY
                     FRTPKTSGELEKMGYSIGDQSNRKFLRLLNVSAMVRYHSQWDSFEEVTNKVVYAAGLA
                     ENPHWGPPQVAGNGVLLMLASDWNYTFNAKSASPYYHDPIPDLSEYFDSHVSMWMDAP
                     ISSPTNSIRPPSDSARLPHYASILKELICEADDAWTVEFENDIKSKHRQILYDLLEMC
                     YQWMMKGEVCMFTRLTTDADFQEYSRSVRDQIKAGSHAPVFMADFNRCRMKGVITMPL
                     PRGQANTYDEKQCKKDLPRLSWLFRAPRGDGWFLLSLNVARILENKGRDKQEKQKKRS
                     GSDRFPSRQRQPKRTEDQIKTLEYYLQDILADTENWAFQKQAF"
     gene            <165868..>166838
                     /locus_tag="ACHE_10056S"
                     /db_xref="GeneID:66977013"
     mRNA            join(<165868..166565,166614..166688,166739..>166838)
                     /locus_tag="ACHE_10056S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280630.1"
                     /db_xref="GeneID:66977013"
     CDS             join(165868..166565,166614..166688,166739..166838)
                     /locus_tag="ACHE_10056S"
                     /note="COG:S;
                     EggNog:ENOG410PMMY;
                     InterPro:IPR007568;
                     PFAM:PF04479;
                     TransMembrane:7
                     (o28-48i55-74o86-106i127-152o164-190i211-232o252-276i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131176.1"
                     /db_xref="GeneID:66977013"
                     /translation="MSGCTEVTPLCPVEASTYGYYPNLGGNIFFAVFFGICGILQMLF
                     GVYYQAWGFATALVIGAFLEVAGYIGRILMHYNPWSPPAFKLQIVCLILSPTFIAAGI
                     YLTIKHIILYLGPEHSKLKPKLFTWIFIGSDIGSLLLQAAGGGVAASAGSTDQTLLKI
                     GDDIMIAGIAFQVATMSVCGILTLDFFLRLRKNGGGLSGEKQQDGYISPRNMMLLIGG
                     EVFAYVTVLIRCIYRIPEMAGGWGNPLMQKENEFLVLDGMMVALAVLSFTVLHPAFFL
                     KSIRKGSWRKPRVP"
     gene            complement(<167324..>168331)
                     /locus_tag="ACHE_10057A"
                     /db_xref="GeneID:66977014"
     mRNA            complement(<167324..>168331)
                     /locus_tag="ACHE_10057A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280741.1"
                     /db_xref="GeneID:66977014"
     CDS             complement(167324..168331)
                     /locus_tag="ACHE_10057A"
                     /note="COG:S;
                     EggNog:ENOG410PPAK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131177.1"
                     /db_xref="GeneID:66977014"
                     /translation="MESISSLLTVVITTSPTPSSPSTELISSVIESFRLHCPELAATR
                     VIVVFDTFDRIAAQNRLKSGSASLEVAQHYSAYKENVKSLVLREYLNDSEHEHDLQQA
                     TATAEFGSPNDENNSVELSIIHTPDRHVTFIEPVARLGFGLAVRSALRVVETPYVWVQ
                     QHDWALVADIPLQPLLEVMRSSSAEANTDTPKPIKYISFPSIRMLRYAISDCVNSYPA
                     LRTLTATLKDDFPSSSQPDVRVPLTPLFFWFDKPHLASTEHYLSRVFPTRLAMRRGEF
                     IEDKIGQRARGQMKDGEWGKWATWLYYPDEGRELCLRHLMGRTRRGGEGGLVGKYHKG
                     T"
     gene            complement(<168707..>169974)
                     /locus_tag="ACHE_10058A"
                     /db_xref="GeneID:66977015"
     mRNA            complement(join(<168707..169782,169836..>169974))
                     /locus_tag="ACHE_10058A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280852.1"
                     /db_xref="GeneID:66977015"
     CDS             complement(join(168707..169782,169836..169974))
                     /locus_tag="ACHE_10058A"
                     /note="COG:G;
                     EggNog:ENOG410PFF2;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:6
                     (i36-56o68-91i164-186o192-211i275-300o312-333i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131178.1"
                     /db_xref="GeneID:66977015"
                     /translation="MSSTDCEKPPVDVTFASDKLAEPEPYIILDRTQKRLITFVVTIV
                     ASSSTLASNIYFPAIPTIAEDLNVSVELVNLTVTAYFIFQGLAPSLWGPISDAKGRRT
                     AYVGTLIVLLGARIGLAQTKDYTTLIILRCLQSTGSASTNAIGSGVIGDITTRADRGG
                     YMGFFQGVMLISIAIGPIIGGVLAGSLGWRSIFWFLTVYNGVLLMMVIFLVPETLRSI
                     IGNGSRTPSQRIAQFPLTLYQRYTTVKWDADKVPQQDPAPKRVDVLAPLRILTSKMAA
                     AIIIFFAIYFTVWQMCITAMSTLFTARYGITEIQTGLTFIANGAGSMVGTLITGKIMD
                     CDYRRVHEKFEKDERLESDGRIFPLERAWLGPVPVYASMQCLSILLFGWTVQYPDQVH
                     IAVPIVATFFTG"
     gene            complement(<171931..>172600)
                     /gene="UBC15"
                     /locus_tag="ACHE_10059A"
                     /db_xref="GeneID:66977016"
     mRNA            complement(join(<171931..172187,172257..172349,
                     172444..>172600))
                     /gene="UBC15"
                     /locus_tag="ACHE_10059A"
                     /product="ubiquitin-conjugating enzyme E2 15"
                     /transcript_id="XM_043280963.1"
                     /db_xref="GeneID:66977016"
     CDS             complement(join(171931..172187,172257..172349,
                     172444..172600))
                     /gene="UBC15"
                     /locus_tag="ACHE_10059A"
                     /note="COG:O;
                     EggNog:ENOG410PK18;
                     InterPro:IPR016135,IPR023313,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 15"
                     /protein_id="XP_043131179.1"
                     /db_xref="GeneID:66977016"
                     /translation="MATTPAGRMLSRQLQQMQSSKDIPGISCGLVDNNVFEWEVMLMI
                     SDDVQLYGGGFFRALLSFPQEYPHMPPKMKFESPLFHPNIYPTGEVCISILHPPEEDK
                     YGYESAAERWSPVQTPETILLSVISMLSSPNDESPANVEAARLWREDPKEFKRRVRRC
                     VRESLGEE"
     gene            complement(<173065..>174221)
                     /locus_tag="ACHE_10060A"
                     /db_xref="GeneID:66977017"
     mRNA            complement(join(<173065..174012,174066..>174221))
                     /locus_tag="ACHE_10060A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281075.1"
                     /db_xref="GeneID:66977017"
     CDS             complement(join(173065..174012,174066..174221))
                     /locus_tag="ACHE_10060A"
                     /note="COG:S;
                     EggNog:ENOG410PQC7;
                     TransMembrane:6
                     (o31-51i128-145o157-178i199-221o256-274i330-351o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131180.1"
                     /db_xref="GeneID:66977017"
                     /translation="MVVHSLVRRGVEMASDHFSKNPDQQQPDIQVSTWLLVLCAFTSL
                     AFVLAMWSVDYTYGSVVATLAAVEDTNPDLYVRLDADYDPSKPDSIDPIAKDVDGAPK
                     PITSKLRTTISHLRARAGRWSRFRGFAMYMTYGIARGSLFMILPVGSDQFCGQFAIQT
                     VLAVLLANLQMAWVHIVVSKPSSKRFYQRIPGFKSWVQIAPVAAFENIVVGLAFFLPL
                     LMAKAFGGWDSAMEEVSSTAPPTKAFCQMWAMTMVPSILSYLVSIPAQAIFVRVAASM
                     LPEEDEAIVPFDRSFGGKVVPAILGGSGRLSIMDAWRTFDRPARVRYLKVIGKVLLMQ
                     GALLITFTLALLAQFSLMGVETMQKVIAHSRSA"
     gene            complement(<174958..>176115)
                     /gene="CRC1"
                     /locus_tag="ACHE_10061A"
                     /db_xref="GeneID:66977018"
     mRNA            complement(join(<174958..175009,175077..175707,
                     175762..175810,175864..>176115))
                     /gene="CRC1"
                     /locus_tag="ACHE_10061A"
                     /product="carnitine transporter"
                     /transcript_id="XM_043281186.1"
                     /db_xref="GeneID:66977018"
     CDS             complement(join(174958..175009,175077..175707,
                     175762..175810,175864..176115))
                     /gene="CRC1"
                     /locus_tag="ACHE_10061A"
                     /note="COG:C;
                     EggNog:ENOG410PI0H;
                     InterPro:IPR018108,IPR023395,IPR002067;
                     PFAM:PF00153;
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="carnitine transporter"
                     /protein_id="XP_043131181.1"
                     /db_xref="GeneID:66977018"
                     /translation="MTSTSTTPTNKIQEDVQVAETKPVNKTIAQIRSFAAGGAGGVCA
                     VVVGHPFDLVKVRLQTAQRGVYSSAMDVVRKTVAREGLVRGLYAGVSAPLVGVTPMFA
                     VSFWGYDLGKTIVSSLSEVRVENNTPQFTINQISAAGFFSAIPMTLITAPFERVKVLL
                     QIQGQNPPPPGQKPKYSGGLDVVKQLYQEGGLRSVFRGSAMTLARDGPGSAAYFAAYE
                     YIKRSLTPKDERGNVTGELSMPAVLTAGGAAGIAMWIPVFPVDTIKSRMQSAEGRPTI
                     GGTIRSVYGNGGLKAFFPGFGPALARAVPANAATFAGVELAHKFMKKMFDE"
     gene            complement(<180549..>181554)
                     /locus_tag="ACHE_10062A"
                     /db_xref="GeneID:66977019"
     mRNA            complement(join(<180549..180806,180857..181239,
                     181296..>181554))
                     /locus_tag="ACHE_10062A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281297.1"
                     /db_xref="GeneID:66977019"
     CDS             complement(join(180549..180806,180857..181239,
                     181296..181554))
                     /locus_tag="ACHE_10062A"
                     /note="COG:S;
                     EggNog:ENOG410PSKP;
                     InterPro:IPR008427;
                     PFAM:PF05730;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131182.1"
                     /db_xref="GeneID:66977019"
                     /translation="MKFSLTLAIMASAGLVGAVSESKCARMCIDNMNNKAEELGCTSG
                     DQRCLCDSENYSYGVRDCTAQACPEDDSAKVVQIALSTCPSDTKSGEQANGGSGSGSD
                     SSSASAGSGSGSGSATTSGSDSDSTGSATDGAAGAGAASTGASGDSSATASGNEASAT
                     GSDSASATGSGAAGASATGSDASGSASGSDAAGASSTGSAASNSASATSSGADSSSTG
                     SASGSNASSTLSTATSTGSGASSSETGSSDSGSGSDSGSGSDAASSSSSADGAANTDN
                     AAPRVVLGSGAMGVAGLAALFAL"
     gene            <184230..>186442
                     /locus_tag="ACHE_10063S"
                     /db_xref="GeneID:66977020"
     mRNA            join(<184230..184423,184468..>186442)
                     /locus_tag="ACHE_10063S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281408.1"
                     /db_xref="GeneID:66977020"
     CDS             join(184230..184423,184468..186442)
                     /locus_tag="ACHE_10063S"
                     /note="COG:Q;
                     EggNog:ENOG410PHE8;
                     InterPro:IPR001106,IPR023144,IPR024083,IPR005922,
                     IPR008948;
                     PFAM:PF00221;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016841 - ammonia-lyase activity [Evidence
                     IEA];
                     go_process: GO:0006559 - L-phenylalanine catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131183.1"
                     /db_xref="GeneID:66977020"
                     /translation="MSGTMTLNLQAYDPKQDAAPSHGGQPLTSSLRSSIRQLRNLLKE
                     QKDITLDGESLDLSSTIAVARFGRNASFPNNGHAAQRMNTSVEQLDQKLKSNEMVYGV
                     TTGYGGSADTRTDSYVDLQRALIQHQSAAILLPSDRGLSQSSSFVDSLKSHAIPVPIV
                     RAAMLTRCNSLLRGHSAVRPDVVRHILTLLEKDMTPVVPLRGSISACGDLMPLSYVAG
                     ALEGNPDISVNCGKNQGYRVLPADQALALAGLKPLELQAKEGLGILNGTAFSAGAASL
                     VLFEANQLILLSQVLTAMGTEALLGKRGNYDPFIAIARPHPGQKEVAANIFNFLSDSK
                     LVSEADPGKIGTAQDSHVLAQDRYALRTSPQWIGPQLEDLALALKQVEVELNSTTDNP
                     LIDPDSAEVHHGGNFQAASVTSAMEKTMGAMQMIGKMLFSQCTEMINPALNKGLTPNL
                     CVDDPSLSYTMKGVDINMAGYMSELAYLAHPVSNYVQSAEMHNQGLNSLALIAARYTG
                     DAVEVLSLMSSAYLYVLCQALDLRALHLEFVKQAHQEVKRVTEDLCGPVVSKHVDGLL
                     WQEIMGHWGRTSTRNLADRADVAATTSIGLLLSLISQHGTADVHPDHAGLNDVAKGLK
                     WKESVAAVLTETYDGVRESFLHEQTTKQYLCHASKNMYSFVRETLNVPIHRGIVDHAT
                     KESGDGRSRTDKPLIGSHISKIYTALRAGELQDVLLHCFE"
     gene            <188882..>190248
                     /locus_tag="ACHE_10064S"
                     /db_xref="GeneID:66977021"
     mRNA            join(<188882..189140,189191..189677,189735..190040,
                     190092..>190248)
                     /locus_tag="ACHE_10064S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281519.1"
                     /db_xref="GeneID:66977021"
     CDS             join(188882..189140,189191..189677,189735..190040,
                     190092..190248)
                     /locus_tag="ACHE_10064S"
                     /note="COG:I;
                     EggNog:ENOG410PJYC;
                     InterPro:IPR042098,IPR003819;
                     PFAM:PF02668;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131184.1"
                     /db_xref="GeneID:66977021"
                     /translation="MSATETITRPVQPDIQYHPEYEKYKARTLRRKETESLPTTLPDG
                     FPQKLDSPLVWEGKDVEKRDDWLYHLSDAELDEIDAALRHFKSLNLPLGHINQSTFPL
                     PTLHPTLRALSKEIHAGRGFIVLRGLRIDAHTREDNIITYTGVSSHIGNIRGRQQDTR
                     LANGTSPVISHIKDLTTTTDRGKIGAPSNTPDKQVFHTDAGDIISLLCLQTAAEGGES
                     YLASSWLVYNILAKERPDLVRTLAGEWPLDGFGNPDRPYTLRPLLYHQPATGTTPERV
                     LIQYARRYFTGFLAQPRSKDIPPISEAQAEALDALHFLAEEHSASLGFQKGDIQYVNN
                     LSIFHARNGFKDEPGQERHLLRLWLRDPENAWETPKQLEHRWNTVFGDVTVEEQAFPL
                     EPALRRNVGS"
     gene            <190507..>191632
                     /locus_tag="ACHE_10065S"
                     /db_xref="GeneID:66977022"
     mRNA            join(<190507..190569,190619..>191632)
                     /locus_tag="ACHE_10065S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281630.1"
                     /db_xref="GeneID:66977022"
     CDS             join(190507..190569,190619..191632)
                     /locus_tag="ACHE_10065S"
                     /note="CAZy:CE10;
                     COG:V;
                     EggNog:ENOG410PPUD;
                     InterPro:IPR029058,IPR013094;
                     MEROPS:MER0034665;
                     PFAM:PF07859;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131185.1"
                     /db_xref="GeneID:66977022"
                     /translation="MADYTKESLHALGTPDPELTEILKKAPAPNPDLTLAQPREEFHS
                     REKYRYTNGPTLDTTESVVQIPMRDGYTSETRVFKPAEASTGTPLVVLIFGGGFINGS
                     NIQLVAFARAAAKLYGATAVTLSYRLAPEYKFPTAANDIWDGVSWLAEHASSQIGNVD
                     LAKGFVIGGVSAGGNLAVVTAHKALKDKLAAPITGIWACIPVLLSDSTVPEEYKDRWS
                     SRVQNANAPLLNAQSIEALRQLYQPDESSPDYTPFPNPADLSSFSNIPRTHVQVAGLD
                     PLRDDGLIYEKALRDRGVETKLDVYPGVPHAHFSALPGLKASYRSRRDTLVGIGWLLR
                     KEVDIKAVESVEEAWEPALLGAVR"
     gene            complement(191840..191911)
                     /locus_tag="ACHE_t10001A"
                     /db_xref="GeneID:66987307"
     tRNA            complement(191840..191911)
                     /locus_tag="ACHE_t10001A"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:66987307"
     gene            complement(<192021..>193068)
                     /locus_tag="ACHE_10066A"
                     /db_xref="GeneID:66977023"
     mRNA            complement(join(<192021..192833,192892..>193068))
                     /locus_tag="ACHE_10066A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281741.1"
                     /db_xref="GeneID:66977023"
     CDS             complement(join(192021..192833,192892..193068))
                     /locus_tag="ACHE_10066A"
                     /note="COG:S;
                     EggNog:ENOG410Q1Z1;
                     SECRETED:SignalP(1-18);
                     TransMembrane:1 (n2-13c18/19o266-292i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131186.1"
                     /db_xref="GeneID:66977023"
                     /translation="MLLRFLSILYLGACTALAIQPQNDSLAYRSDVNQIRLPCAPCAF
                     ADTACSQDRKPNAYLTLDFSMTNGTLVANDIPVFPPTTDMQLPATRHWSSKTSKETED
                     VHLTYALHTQRVPPRAQGKLYRFTMNLLDSQGRPATTDLVSLTLVRNAEERLLLSSIR
                     VEPAVHHTQRWKLKYWKSQVGGYMVTVKEAVKSRLHGASNSSDKLLIIDGHRHSTESE
                     QDLDSSTTPRIPSDDNSRFQILSFYQFTHYPSHHSSSNRHFLRLVRPIIMPALLGIMA
                     GFVACVIGFLVGRVGASIYFHARGKKQAGSAVSAVDVEEGFVSEKQKLLEIYE"
     gene            complement(<193740..>194629)
                     /locus_tag="ACHE_10067A"
                     /db_xref="GeneID:66977024"
     mRNA            complement(join(<193740..194520,194589..>194629))
                     /locus_tag="ACHE_10067A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281852.1"
                     /db_xref="GeneID:66977024"
     CDS             complement(join(193740..194520,194589..194629))
                     /locus_tag="ACHE_10067A"
                     /note="COG:Q;
                     EggNog:ENOG410PKJ5;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131187.1"
                     /db_xref="GeneID:66977024"
                     /translation="MRRTAIVTGSANGIGKAIATRLVRDGYSVCINDIPSKAADIDAV
                     VAELNATHSSDGRPKAISIPADVTSGTSVEAMVRDTVDKLGPLTLMVANAGIAQTKPL
                     FSATGEDVDKVFSVNVKGVFNCYTHAAQQMIAQGDPGTAAGVRVYKILGAASIGGFRA
                     SAPLGVYCASKFAVRGLTQAFAQECAPHKITVNAYAPGLIDTSMTDGIDENLTGMSGQ
                     KKGDMKRNYSEQVIPLRRTGTPEDVAGVVGGYLANPDSDYTTGQTSVVDGGVFFT"
     gene            <195059..>195511
                     /locus_tag="ACHE_10068S"
                     /db_xref="GeneID:66977025"
     mRNA            join(<195059..195087,195136..>195511)
                     /locus_tag="ACHE_10068S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043281963.1"
                     /db_xref="GeneID:66977025"
     CDS             join(195059..195087,195136..195511)
                     /locus_tag="ACHE_10068S"
                     /note="COG:S;
                     EggNog:ENOG410PRQD;
                     InterPro:IPR021487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131188.1"
                     /db_xref="GeneID:66977025"
                     /translation="MVKGRDTVIHEFHDLVNMSPNELWDWLQKEQSQSSGWQSESGET
                     IGHERYFPVSQFVASPASEEDGLSGRRIADILAHNPDRDPGGYTEHDIEHMRKVVSYC
                     KRHLAQEEKAKSDTASKSYRSLKNWGHDALKE"
     gene            complement(<197966..>200805)
                     /locus_tag="ACHE_10069A"
                     /db_xref="GeneID:66977026"
     mRNA            complement(join(<197966..199827,199874..200612,
                     200659..>200805))
                     /locus_tag="ACHE_10069A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282074.1"
                     /db_xref="GeneID:66977026"
     CDS             complement(join(197966..199827,199874..200612,
                     200659..200805))
                     /locus_tag="ACHE_10069A"
                     /note="COG:O;
                     EggNog:ENOG410PHTE;
                     InterPro:IPR023828,IPR000209,IPR034187,IPR023827,
                     IPR022398,IPR015500,IPR010435,IPR036852;
                     MEROPS:MER0047718;
                     PFAM:PF06280,PF00082;
                     SECRETED:SignalP(1-27);
                     go_component: GO:0005618 - cell wall [Evidence IEA];
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131189.1"
                     /db_xref="GeneID:66977026"
                     /translation="MAWVLELARGILLMQLLLLSSLIIAKAADLETGVIPGAYIVEFA
                     DHLDNHENAFFSELSTAKISARLRLSLSSSVFKGASFHLDDTHDEHDERRKIEQIASS
                     KSVKKVFPMRKYSLPYEKVSIADKYQVHSSPKRKIEQRATDDNVYSLHAMTGVDKLRE
                     EGFTGSGVRVAIIDTGIDYYHPDLGGCFGPGCKVGFGYDLVGDAYTGENEPVPDPDPY
                     DNCGGHGTHVAGIIAASSNAQDYFTGVAPNVTLGAYRVMGCNGAVTNDVLIKAFSMAY
                     ESGADVITSSLGGSGGWSEEPLDVVVSNIVKAGIPCTVSAGNSGTMGPFHSSTPAGGI
                     GATSVGSVDNKAYPMLLVPGTYIANGIDSEFGWAPGILSNISEGVYQLYALTYNTSST
                     NDACHDLPEEPADLSEYIILIRRGGCSFSQKAGNAAARGAKHIFFYNTQPGTNQAYVY
                     APGIESAGMVSQTQGYKWISLLEAGHKVHLHIRSPAHAGLVIMEEPNYTTGGHISTFS
                     SWGPSYEVQTKPQISAPGGVIASTYPLAMGGYAVLSGTSMSCPYAAGAIALLLEARGK
                     LDPATINNLLSTTATPQPFHDGISEYPFLAPVPQQGAGLINIYNAVHATTLLSVPSIS
                     FNDTTHLLKDGGFTLKNTGPAAVTYEIAHTPSATFYTFTTKGSRSHFTAGHPPELIPR
                     GAALSFSITEVTIKPGEEAFIHVSPILPFNMTTQRIPVYSGYITINATNSEDDESLSL
                     PYLGVDSALKDAPILNKRHVFLTSTSRPGVPWAGHYQFNIPPPNSNRAKYPGLLAPAV
                     FAELKMGTALLRVDVQPLDAFLLNQSHIPRSRVKRAFKYNTEKVLGQEILGSIDGFPA
                     HYVPGQNVAGAWHGKLSDGTYAPAGNYTFVVSALKIFGDPDKEEDYERVKTDVFGIWY
                     G"
     gene            complement(<201514..>203237)
                     /locus_tag="ACHE_10070A"
                     /db_xref="GeneID:66977027"
     mRNA            complement(join(<201514..203070,203127..>203237))
                     /locus_tag="ACHE_10070A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282186.1"
                     /db_xref="GeneID:66977027"
     CDS             complement(join(201514..203070,203127..203237))
                     /locus_tag="ACHE_10070A"
                     /note="COG:T;
                     EggNog:ENOG410PIFQ;
                     InterPro:IPR019826,IPR019819,IPR002018,IPR029058;
                     MEROPS:MER0030934;
                     PFAM:PF00135,PF07859;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131190.1"
                     /db_xref="GeneID:66977027"
                     /translation="MHISAASLLLVIAPACFASKLPVVDLGYELHQALSFNETYGTYN
                     FSNIRYAAPPVGELRFRAPVSPAKNRSEVQTGAQGRVCPQAQPVWSEDIAPAFLASAL
                     TGTQFNQSTNISSYPYVPQPLDPRTTEDCLFLDVIAPKKIFDRVQNKTSVPKKSLAPV
                     LVWIYGGGYTVGEKTSYDPRGLIQRSQKNGEGVVYVALNYRLGAFGWLAGDTLTANGT
                     ANAALHDQRLALEWVKENVHLFGGDSERVTVIGESAGGGSILHQITSYGGKGKQLPFQ
                     QAILQSPGWYPLPTDEQQEATLQQFLGLLNVSTVEEARKLPTAKLIAANSKQVYRSPY
                     GTYTYGPAVDGTFVPKLPGELLLEGKFHKNLSLMVGHNSNEGLLFTPPASVNSNSYAS
                     LLEADLPDIQQNVTNYISNVLYPPVYNGTYGYTNPVLRFATTLADVVFQCNTDYLNRA
                     FHNQTYAYLFSVPPGLHGSDLEYTFYNPAANSTVTSKNVALALQDYITSFAETGAPKS
                     SAGPVFEKHGKKQQILNLSVSNITTVHDSTASPRCLFWQDAPYYQHS"
     gene            <204771..>208046
                     /locus_tag="ACHE_10071S"
                     /db_xref="GeneID:66977028"
     mRNA            join(<204771..204980,205075..205340,205400..>208046)
                     /locus_tag="ACHE_10071S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282297.1"
                     /db_xref="GeneID:66977028"
     CDS             join(204771..204980,205075..205340,205400..208046)
                     /locus_tag="ACHE_10071S"
                     /note="COG:P;
                     EggNog:ENOG410PFD7;
                     InterPro:IPR006068,IPR018303,IPR023298,IPR023299,
                     IPR001757,IPR004014,IPR036412,IPR006414,IPR008250;
                     PFAM:PF00689,PF13246,PF00122,PF00690,PF00702;
                     TransMembrane:10
                     (i63-82o88-109i286-307o313-339i782-803o815-834i855-
                     880o906-928i957-978o990-1009i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0019829 - ATPase-coupled cation
                     transmembrane transporter activity [Evidence IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131191.1"
                     /db_xref="GeneID:66977028"
                     /translation="MSSEKQGGSGASPLSRPAHTLSFEAVIEELDTLVEEGLSPDEAN
                     RRLQEYGQNKLDEDKGISVVKILVRQVLILAMAVSFGIQSWIEGGFICAVILINIVVG
                     FIQEYAAEKTMESLHSLSSPTGVVSRGGQTFSIPSTDIVPGDMVELRTGDTVPADIRL
                     LEAVNFETDEALLTGESLPVQKECHSTFKEDTGPGDRLNIAYSSSTVTRGRARGVVVS
                     TGMFTEIGFIAAALRASNNKRRPVKRGPNGETKKRWYVQAWTLTGTDGIGRFLGVNVG
                     TPLQRKLSKLAILLFGVAVLFAIVVMAANLFSDNNEVILYAVGTGLSMIPACLVVVLT
                     ITMAVGTKRMVERNVIVRKLDSLEALGAVTDICSDKTGTLTQGKMVVKKAWIPSRGTY
                     SVGTSSEPFNPTVGNVTYTPLSPLHFEDEKEGSPSDNPEDLVAENRPLEDFLNVASMA
                     NLSHVYESDEGTWNARGEPTEIAIEVFASRFNWNRDRWTKGQSPIWHQKAEFPFDSTV
                     KKMSVIFTRITSQEERSMVFTKGAVERIVDACTTVVWDQDSSTPIPMTEEHRSHIFQN
                     MEELAKLGLRVLALAHRPYTDKARVLEGADLDRDDIEKDLCFLGLIGLYDPPRPETAA
                     SIQACYQAGIAVHMVTGDHPGTAKAIAQQVGILPADLSTVAADVADSMVMTASQFDSL
                     SEAEIDSLPTLPLVIARCAPQTKVSMINALHRRGRFAAMTGDGVNDSPSLKHADVGIA
                     MGQAGSDVAKDASDIILTDDNFASILNAVEEGRRIFDNIQKFVLHLLAENIAQACTLL
                     IGLAFKDLDGRSVFPLAPVEIIWIIMVTSGITDMGLGMEVAAPDIMDRPPQSKKGIFT
                     WEVIIDILVYGIWTAALCLAAFSIRMWGFGDGNLASGCNRRWSAECDEVFRARATTFV
                     CLTWFALFLAWEMVNMRRSFFRMEPKSKKYFTQWMYDVWRNQFLFWSVMAGWITMFPI
                     LYIPIINDVVFKHVGISWEWGIVFVEVVVFFAGVEAWKWAKRVYFRRQEWKQGPTSRI
                     DVAETTRSTA"
     gene            complement(<208408..>209797)
                     /locus_tag="ACHE_10072A"
                     /db_xref="GeneID:66977029"
     mRNA            complement(join(<208408..208723,208775..208944,
                     208992..209419,209470..>209797))
                     /locus_tag="ACHE_10072A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282408.1"
                     /db_xref="GeneID:66977029"
     CDS             complement(join(208408..208723,208775..208944,
                     208992..209419,209470..209797))
                     /locus_tag="ACHE_10072A"
                     /note="COG:G;
                     EggNog:ENOG410PKF5;
                     InterPro:IPR032710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131192.1"
                     /db_xref="GeneID:66977029"
                     /translation="MTQAVPLCSAPVINLGADIVLQPPLSRCGRGPGLIILRPSGLAD
                     YQKENDSLDPEPLQKWAEESYAVVQISLDLQSSGDKTRVSGLVTAGIDALVSLAECET
                     KDKFGLLVYGSQKDYAPEFVDALRAVVANSERIIATISFDSWDIAAQKDALQHLSGKP
                     GDIVKYDNLTVYTYPETSSAGFIVPGHVDFKTSSAGVAHTRSLTFIKKQLGGPCFDLE
                     KIWEEHAYYEFGDRSVEKTMSTMVQEPYVNHIPTLTGGIGRARLSKFYLNHFIFNNPD
                     DTELELISRTIGIDRVVDEFIFCFTHDKQVNWLIPGIPPTGKPLRIPMTSVVNIRGDR
                     LYHEHIAWDQATILVQLGLLPEYLPFPYALPDGKQPAPGKRFEYRVPAAGIESATKLK
                     DEHSVPSNQMFEYKVREVDDN"
     gene            <210353..>211333
                     /locus_tag="ACHE_10073S"
                     /db_xref="GeneID:66977030"
     mRNA            <210353..>211333
                     /locus_tag="ACHE_10073S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282519.1"
                     /db_xref="GeneID:66977030"
     CDS             210353..211333
                     /locus_tag="ACHE_10073S"
                     /note="COG:S;
                     EggNog:ENOG410PRGT;
                     InterPro:IPR019258;
                     PFAM:PF10018;
                     go_component: GO:0016592 - mediator complex [Evidence
                     IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_process: GO:0006357 - regulation of transcription by
                     RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131193.1"
                     /db_xref="GeneID:66977030"
                     /translation="MNAHMQSSLSTLESKLNLLITSLTTSPTAAGAPAAASAVLDADD
                     SLTSAVETLRQHQENYAKILRLRAEAEKLEERVKGIVSDVETREKEIRTICGDEENDT
                     DSDTEDDSSDYDSDEDVDMSKSRSRKKMNKEVDYRLLLDFARRISKYNHQAAADAAAG
                     TPAAQKLEDKRQQIAEQDVAMTGVNGATDTEEGAEPVSSVTKGATSWLDESANMTREI
                     YMLPYPAEDRIRMGLMGQIQLAAAEGRPGFDLDNEVERLIREAEGQGAAEAIEPAQPG
                     DESRRVDEASQAAAHAGSAATSGATSGPAPAPKPKATLDLDLYDPEDDEM"
     gene            <212390..>214299
                     /locus_tag="ACHE_10074S"
                     /db_xref="GeneID:66977031"
     mRNA            join(<212390..213462,213518..213642,213695..213807,
                     213864..213993,214055..>214299)
                     /locus_tag="ACHE_10074S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282630.1"
                     /db_xref="GeneID:66977031"
     CDS             join(212390..213462,213518..213642,213695..213807,
                     213864..213993,214055..214299)
                     /locus_tag="ACHE_10074S"
                     /note="COG:G;
                     EggNog:ENOG410Q18V;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i87-108o176-200i212-238o244-270i316-338o350-374i394-
                     414o420-443i464-482o494-514i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131194.1"
                     /db_xref="GeneID:66977031"
                     /translation="MSQPHTPFDPFFGADGSDGVDGVEKEKEKDGVPDGVPDGVGRPS
                     DSQPTACHGELDKEQQDRLGKRELQETDCYDKLGFTFPKWKKWGILSVIFIVQVSMNF
                     NAGFYASGVPLFADHFGISEQAARVGQMDFLIAYGFGSEFWAPWSEEFGRWPVMQLSL
                     LLVNIWQIPCALAPNFGTIVVCRILGGLSSAGGSVTLGMVADMWEAEEQQYAVAFIVF
                     SSVAGSVIAPVVGGFSTTFLNWHWNFWLQLILGGFVQAVHFFVPETRCSILVTREARR
                     RRKMGEEVYSGDELKGKHITVKHLLMVWSRPFIMFVREPIVLCLSMLSGFSDSLIFTF
                     LQSFTPVFKQWGFNTITIGLSFLPLLVGYVIAYFSFFPFFHKHCRVRERDPDALQPEA
                     RLYWLLWTAPLLVIGLFGFAWTSLGPPHVHWIAPMIFSSLIAIANYAIYMATIDYMVA
                     SYGPYSASATGGNALARDFLAGIAAMYSTPMYEHMGHSNPLEWASTLLGFLAIGFIIP
                     IYVFYWNGPKIREKSKFALVLASDRKKAQRRVSQCGSGEPGPEEHYFSGSGAV"
     gene            complement(<218034..>220258)
                     /locus_tag="ACHE_10075A"
                     /db_xref="GeneID:66977032"
     mRNA            complement(join(<218034..218734,218788..219024,
                     219077..220073,220133..>220258))
                     /locus_tag="ACHE_10075A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282741.1"
                     /db_xref="GeneID:66977032"
     CDS             complement(join(218034..218734,218788..219024,
                     219077..220073,220133..220258))
                     /locus_tag="ACHE_10075A"
                     /note="COG:C,H;
                     EggNog:ENOG410PG2K;
                     InterPro:IPR036188,IPR002938,IPR036249,IPR038220,
                     IPR012941;
                     PFAM:PF07976,PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131195.1"
                     /db_xref="GeneID:66977032"
                     /translation="MTRPTSHVDVLIVGAGPAGLMLANWMSRCGIKTRVVDKRGTKVF
                     NGQADGLQCRTLEIFDSFDFAQRVWQESNHMLEICLWNPDKNGILRRSDRIADTIPGI
                     SRFQQVVLHQGRIERFFLDSIKANSDITVERGVLPTSFNFNESKARDPTDYPITVTLK
                     TLSDEEATPQQQRKSANGAVVEDGLFRSNLTPDDTEDMIRSAEQSARANQTEEVKAKF
                     MVGCDGAHSWVRKQLGFSLEGDSTDYIWGVLDIVPITDFPDIRMRCAIHSANAGSVMV
                     IPRENKLVRLYIQLQSTEVGGGKADRSKITPDMILKSAQQILHPYTLTYDYCDWWTAY
                     QIGQRVGNNFSLQERVFLAGDAVHTHSPKAGQGMNVSMQDTYNLGWKLAHVVKGYSDL
                     SILKTYQSERRRIAQDLIAFDYRFSRLFSGRPAMDVMDEEGISMEEFKNAFQKGNMFA
                     SGIAVDYGASLIVAKPGSSAEQGDGTDVSSQSKHRVLSKQHLARGIPVGQRIPSYKVL
                     NQADARPWHLQELLKSNGRWRVIVFPGSLTDQTNMTRYQQFGEKLNNVNSFLRKYTPS
                     NLPIDGVIEMLTVHAGPRWDVELLDLPDIFHPYHEKMGWDYWKVFVDDQSYHEGHGRV
                     YENYGIDPGQGASVIVRPDQYVSWVGEMDDYEEMEEFFSSFMKVQPGVSQQQQTDGPV
                     ASVL"
     gene            <228044..>229449
                     /locus_tag="ACHE_10076S"
                     /db_xref="GeneID:66977033"
     mRNA            join(<228044..228089,228229..228252,228315..228431,
                     228491..228522,228577..228694,228748..228944,
                     229009..>229449)
                     /locus_tag="ACHE_10076S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282852.1"
                     /db_xref="GeneID:66977033"
     CDS             join(228044..228089,228229..228252,228315..228431,
                     228491..228522,228577..228694,228748..228944,
                     229009..229449)
                     /locus_tag="ACHE_10076S"
                     /note="COG:S;
                     EggNog:ENOG410PJJ6;
                     InterPro:IPR003388;
                     PFAM:PF02453;
                     TransMembrane:4 (i81-100o106-125i167-189o195-214i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131196.1"
                     /db_xref="GeneID:66977033"
                     /translation="MTSAGDVSYPNPNGNNAKDIFTNGPIMDNIKTEASRAGNEFRDL
                     KNSKVTPSSTASTGQPLTYYHSLLYSLLSWEQPRATATSYISVITFIFAARYLPLLRW
                     VFKLAYVALGFTAAFEIGGRLAFGQGLSSSFRPRKYYTVPKETIEAVLEDLVQLLDFG
                     LLEFQRVLFVENIAHTVAAFFGALNAYWLIKFLPFWGLSLIVVTIAYFGPLTYMNHSE
                     VIDAHIEEAQSIVNTHANQLKDLVEERAAHATGIVKQYLDDYSNKASDFITPRPRSAS
                     PELRKVSSPVIKKEPSAEPELKPSAFPEAPKEEPVYESIEQREPLLAA"
     gene            <233273..>235046
                     /locus_tag="ACHE_10077S"
                     /db_xref="GeneID:66977034"
     mRNA            join(<233273..233618,233677..233801,233854..233938,
                     233998..>235046)
                     /locus_tag="ACHE_10077S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282963.1"
                     /db_xref="GeneID:66977034"
     CDS             join(233273..233618,233677..233801,233854..233938,
                     233998..235046)
                     /locus_tag="ACHE_10077S"
                     /note="COG:S;
                     EggNog:ENOG410PJ6A;
                     InterPro:IPR036887,IPR003163;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131197.1"
                     /db_xref="GeneID:66977034"
                     /translation="MSTIQSLLNPLPDQQFPFTLPSPSLPTPRKPKPDAAPTHSHKKQ
                     KSKGLPRKKGPIRGELRYPPYEERDDGLASIHREFRMEPMGGGNIRERPWHVPYNSDK
                     KTFQHLTGRDSLEVFYYQFKLPGQAESEEPWWVMWDYNIGLVRMTHLFKSNGHSKTTI
                     GKAMKANPGLPEISHSITGGATEAQGYWVPFDAAKALAATFCYKIRHVLVPLFGPDFP
                     SLCIHPHDRTRFNRMVIDRSVIQRATQTANYYRSLELRSSPFSTSTNHTPSPNLRPTS
                     SSGSSFVARKKAIPRSRKHASSLSSSTTGTVISGYSSGYGSGVDEYSDVYCVSPVSIG
                     SYRGGNTFTPVNTPRSADVYTSSNVGIGTTTNTGAAIPTPQEVLASITAKTTTNTSTI
                     DEDSTATATSPSASTTDEETSSTAYSEISSSWSDYSFVDIDKDDREYSDSPANEPLRT
                     NRKRKAEGSGNGNRGALLVKEVKAAHALLSLHMQDASGSEYEGESDGDEDVSVPPASS
                     LVGVYQQQQQQIYSQRQSRKRRRASA"
     gene            complement(<235341..>236533)
                     /locus_tag="ACHE_10078A"
                     /db_xref="GeneID:66977035"
     mRNA            complement(join(<235341..235664,235724..>236533))
                     /locus_tag="ACHE_10078A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283074.1"
                     /db_xref="GeneID:66977035"
     CDS             complement(join(235341..235664,235724..236533))
                     /locus_tag="ACHE_10078A"
                     /note="COG:G;
                     EggNog:ENOG410Q07H;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:9
                     (o17-42i49-69o81-100i157-176o196-216i248-267o279-300i312-
                     334o340-361i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131198.1"
                     /db_xref="GeneID:66977035"
                     /translation="MIWIMASGLAPNIGAQLAFRFLAGIFGCPPLTCAGGTVADLWNP
                     LEKTLLFPMYAILSFGGPVLGPVIASWMGQGVLSWRWTSWIILIASGLVMATVILFQP
                     ETYSPLLLKWKAHQLRMRTGDRRFRAAMELEKTALVTRMAGACFRQFELTMHEPIILL
                     ISLYMTIIYIVLFTFFDGYEYIYTDVHGLSQGLTNIVWVAMYCGIMLVGLLVPLVYRW
                     TKREFQRAAAEAEPGADGKKKVHTRPENRLWFAMMGAPFIPIGLFWMGWTDYSNISIW
                     SPIIASAVFGFGTITVFISSYMYVIDSYDIYAASALGFMTVSRYAAAGGMTVVGVPFY
                     KNMGVHYTLTILGCISAVMTVVPYVFYRWGHVIRGWSRYAVNQ"
     gene            complement(<237650..>243152)
                     /gene="TOP2"
                     /locus_tag="ACHE_10079A"
                     /db_xref="GeneID:66977036"
     mRNA            complement(join(<237650..242650,242704..243018,
                     243081..>243152))
                     /gene="TOP2"
                     /locus_tag="ACHE_10079A"
                     /product="DNA topoisomerase 2"
                     /transcript_id="XM_043283185.1"
                     /db_xref="GeneID:66977036"
     CDS             complement(join(237650..242650,242704..243018,
                     243081..243152))
                     /gene="TOP2"
                     /locus_tag="ACHE_10079A"
                     /note="BUSCO:EOG0926073O;
                     COG:B;
                     EggNog:ENOG410PG8V;
                     InterPro:IPR001154,IPR034157,IPR013757,IPR013758,
                     IPR013759,IPR013760,IPR003594,IPR036890,IPR013506,
                     IPR006171,IPR002205,IPR001241,IPR020568,IPR031660,
                     IPR014721;
                     PFAM:PF16898,PF01751,PF02518,PF00521,PF00204;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003918 - DNA topoisomerase type II
                     (double strand cut, ATP-hydrolyzing) activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006259 - DNA metabolic process [Evidence
                     IEA];
                     go_process: GO:0006265 - DNA topological change [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA topoisomerase 2"
                     /protein_id="XP_043131199.1"
                     /db_xref="GeneID:66977036"
                     /translation="MDDDSVFDDSIMNDEEGSDFEPAPKPKAKAAPKKAPAKKMTQST
                     LTGKKPAAKPTASKKRAKPDSDDGISDGLPSDDDDSAMSQTPPKKAKKAPAAKKGGSK
                     PLADVENESIGNEDAPKDQNVSEKYQKLTQLEHIIKRPDTYIGSVERTTQHMWVYSTA
                     SEGMEYREVSFVPGLYKIFDEIVVNAADNKQNDKGMDEIRVTVSRESGEISVWNNGRG
                     IPIEMHSKEGIYIPELIFGHLLTSSNYDDTQQKVTGGRNGFGAKLCNVFSTEFTVETQ
                     DSRQKKKYKQTWTANMTKMGKAKITDASKGEDYTKVTFKPDYPKFGMEGMDDDFEALV
                     MRRVYDLAGTSKVAVKLNGSRIPVRSFKKYMEMFTKAIRRERGDDGPGSKDEIITCNP
                     DPRWEIGFAVSDGAFQQVSFVNSIATTSGGTHVNYIADQICNRLADEVKKKNKKGATL
                     KTAQIRNHIFIFVNALIVNPSFNSQTKEQLTTKTSQFGSKCPLEEDFYKKILRTEVMS
                     NILHFAEQKADQMLKKSDGGRRSRINNPKLVDANKAGTKDGHHCTLILTEGESAKGLA
                     MAGRAVVGPDLFGVFPLRGKLLNVRDASFDQISKNAEIQNIKNFIGLQHKKEYTDTRS
                     LRYGHLMIMTDQDHDGSHIKGLLINFLQAQFPSLLKIPEFLIEFITPIVKVWKGDPKN
                     PTKQRSFFTMPEYETWKEEHGHERGWEHKYYKGLGTSSTEDAQVYFRDLDRHLKEFHT
                     MQDHEAGLIELAFSKKKADERKEWLRQFRPGTYLDHSVAKITYTDFINKELILFSMAD
                     NIRSIPSVVDGLKPGQRKVLYTCFRRNLKKDMKVVELAGHVSGMTAYHHGDASLQQTI
                     VGLAQDFVGSNNINTLEPSGNFGSRLQGGSDAASARYIYTRLSPFARRIFHAHDEPLL
                     TYNEDDGAKIEPEIYMPVVPMILINGSDGIGTGWSSNIPNYNPEDVVENLRRMLDGDE
                     IKPMIPWFKGFNGEVTPLGGDRYKFSGVIKETGDKEVEITELPIRTWTQDFKDKLEEI
                     IKGDKTPSFIKDYKDYNTHTKVHFVIQMDEKNLQAAVNQGLEDKFKLSKTLATTNLVA
                     FDPEGRITKYATVDDILKEFYTIRLKYYERRKQYQLNEMQRELDKLTNQARFVQMIID
                     GELVVSKKKKNVLIGELKSRGFKPFPKVAEAVKAGEAEPVVEEEEEEEDAGDVEVASN
                     AYDYLLGMAIWSLTQERVDKLRKQIGEKEMEIDDLIKLSKEDIWKRDLDDFINEWRFQ
                     LEDADRRQRKISGMGRRTSMKLMTGGRAPARKRKAALGDDPDDEDFAAPKSKKSAAAK
                     KTEPKGGLLSYLQKPAAKPSPAPKSDDEGSDDDFAMEVMPKKSRGAPKAKPAPAPEPE
                     PEPEPKDEDEDMDDEPVVASKGRGASKSASKSPKDEDEDEDDDFVDAPEEAPPKKGRG
                     AAASKAQPKTKAKKAASDDDDVFEVEERPKKGRAAAKAKPKPKDDEDEDEDEDDVFEV
                     EEPPKKGRAASKAKPKPKDDDDDFLDDDDFAQITKSEASKTQPKPSRAARKPVKYAGL
                     DDSDSDFGDDMLGDVSNMVKGIGDKAGDDSRQFFSERSRPTSSSGLKGLPAKSSPRRL
                     SSEFDADETDYSKLVPQNSPRRSIQVKPKESSKLEDDDEEDEEEPVKPAPKGRGAAKG
                     KAAAAPKARGRPKKDATTAATKASATKQTTMSPAAKAYQAKQAKTTKKKQLADDSDDD
                     IDAMANDILDSPMANKGDDESEEDEAPVRKPAARPSRRTAATKKSYAVDPFSDEEGDG
                     DSGDDFDEDSE"
     gene            <244507..>247347
                     /locus_tag="ACHE_10080S"
                     /db_xref="GeneID:66977037"
     mRNA            join(<244507..244878,244934..245526,245576..245932,
                     245979..>247347)
                     /locus_tag="ACHE_10080S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283297.1"
                     /db_xref="GeneID:66977037"
     CDS             join(244507..244878,244934..245526,245576..245932,
                     245979..247347)
                     /locus_tag="ACHE_10080S"
                     /note="COG:S;
                     EggNog:ENOG410PHRQ;
                     InterPro:IPR035969,IPR000195;
                     PFAM:PF00566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131200.1"
                     /db_xref="GeneID:66977037"
                     /translation="MESSDSASAATSAPLQQTTPTTPITTTGQSNQNDGANTDSMVTV
                     PLSEVQSDSEHTQPEWRLLNIPQAPADPVSPTQSDNGAKSDAGNSSRRSQCSDRGMDD
                     EVDWAELDRTEEQEPRGEDADESTALLLARLEQENNALATNPKSGLSSHTKKRSQSLH
                     HIKRLIKDDSRRSSIRYSQLPPPPMTELEFWAALVSDYHQTAQRLPTLTTNKIRSGVP
                     PPLRGVVWPSLAGARDQNLLVEYQRLCGESSPYEGLIGKDIGRSFPNVEMFRDPNGEG
                     QQMLARVLKCFSLYDTKIGYCQGLGFVVGPLLMHMTDAEAFCVLVRLMEHYNLRNCYL
                     PDLSGLHLHVYQFQNLLARHSPTLFGHLESLHVEPVYVSQWFLSFFAVACPLPMLLRI
                     YDIIFLEGACETLMRVALSLMQRNEKRILACTEFEDVMQLLLSRSLWDTYACHADDLV
                     NDFVSLTSLVTKESLQTLEASYNQSQGVPTGISFPQMQQAASRFLGRFWAGSNGSTHN
                     SVKLSPNRISTSNSSIRRSTSKQSMTSTLNSVESASDASTAPTELSAEPTQKPRAKSA
                     MTPHKDRDLHTQIEDLLMALSDLQRQHADLSRDLQLEREEREEDQSLAKSLLHHVKER
                     SGDEEDPAITELLTKAEERFGAADNTTPKPESATNDQTKQQLRDDLHRWKEMHQVESS
                     RCLDLTRRIDEQEQEGSSLREQIREARSRIQDGYRDRQRLERMVRELRSIKTPISEKP
                     PETPVDQTPWSPASDHSPTSGGLRELKLVRSNSQKTTRRTSTFSKRSSSLGLKTVLST
                     ENNAPAPEESLLLELVNAKTAEAVAKQELEEVKGKMESLRKMVSGQQRSSGESRLSLV
                     SGVGTGPGIAKAQTEPVNSGGFWGWGRRAVSGSQGEVEAK"
     gene            <249345..>249743
                     /locus_tag="ACHE_10081S"
                     /db_xref="GeneID:66977038"
     mRNA            <249345..>249743
                     /locus_tag="ACHE_10081S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283408.1"
                     /db_xref="GeneID:66977038"
     CDS             249345..249743
                     /locus_tag="ACHE_10081S"
                     /note="InterPro:IPR025951;
                     PFAM:PF14231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131201.1"
                     /db_xref="GeneID:66977038"
                     /translation="MTIPFPILPLDYHRSRSIRRFTPSRKFLAFTTTAASKKIDPAQL
                     AAVFDQLLPVAPETLTRGSGEWRGIALNTGHKFMEQLESLHWRGAVFRSTEDVEPVAI
                     DKADGEKATTDFGGACVRLLSPLPNYAIEM"
     gene            complement(<250995..>252308)
                     /locus_tag="ACHE_10082A"
                     /db_xref="GeneID:66977039"
     mRNA            complement(join(<250995..251134,251187..252088,
                     252142..>252308))
                     /locus_tag="ACHE_10082A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283519.1"
                     /db_xref="GeneID:66977039"
     CDS             complement(join(250995..251134,251187..252088,
                     252142..252308))
                     /locus_tag="ACHE_10082A"
                     /note="COG:S;
                     EggNog:ENOG410PWXV;
                     InterPro:IPR016035,IPR002641;
                     PFAM:PF01734;
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131202.1"
                     /db_xref="GeneID:66977039"
                     /translation="MAIAEKKLNLLSLDGGGIRGLSSLYILKHVMESINPECPPKPCE
                     YFDMIAGTSTGGLIAIMLGRLKMDVNECIDAYNTLATQAFTRKAYLPITIAGQVKERF
                     DSKQLEAALKKAIADRLHDQDALLKDPDTSCRVVLCATRGGTSTTATLRSYRNERECS
                     ELYNTVKIWEAGRATSAASSFFDPITIGPNGQQFFDGATGANNPIRHLWMEAKDIWSD
                     APLEDQIGSIVSIGTGVPQMTRYETKGIAGLKTLKACVTETGYTEEEFALEHSDLVAN
                     NQYFRFNVPGGLAEIGLEKVAKIDLIVGITEKHLAENVVRERVKACAGSLSKSKGHSI
                     SKRPSSKASAWEVTGLVRAQVQNHKESYELEHITRNTHAQEQTQTTDVRQPCSRNKKF
                     FGLFGNKKTR"
     gene            <253027..>255470
                     /gene="LAC9_1"
                     /locus_tag="ACHE_10083S"
                     /db_xref="GeneID:66977040"
     mRNA            join(<253027..253104,253157..253817,253868..254532,
                     254588..255369,255419..>255470)
                     /gene="LAC9_1"
                     /locus_tag="ACHE_10083S"
                     /product="lactose regulatory protein lac9 and GAL4-like
                     protein"
                     /transcript_id="XM_043283630.1"
                     /db_xref="GeneID:66977040"
     CDS             join(253027..253104,253157..253817,253868..254532,
                     254588..255369,255419..255470)
                     /gene="LAC9_1"
                     /locus_tag="ACHE_10083S"
                     /note="COG:K;
                     EggNog:ENOG410PIUD;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (o622-639i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="lactose regulatory protein lac9 and GAL4-like
                     protein"
                     /protein_id="XP_043131203.1"
                     /db_xref="GeneID:66977040"
                     /translation="MDTTRTDNVRRTAELACHECRRRKSKCNRIIPSCLLCSKFGRRC
                     VYERQIKTPLTRRHLTEVEEELARTKILLRQLQSGRQDAGPGYAECGSDSQGIRSPNC
                     DMREKSYGTLVSPVVAPSRQVSTADETDGAIDRTDNRPPPERNPARNYKTPSQVNTRT
                     SSSGPTATSPNRPIISPASRRTPYCRTNGCPRESETHSVTTSGLSLEAPPSSGSFEWD
                     ERTGKASGDRFVDGMASLTSRSNEGGYLGVASGAALLRMTDSRSTEEVDTYCHQQQEP
                     KPPVSFVLTSLSQLEPFVDAYFQLYHCSYPIVHEATFRAQFMEVVPRPSTNAWQVLLF
                     VIAAIGAFTTATHPTDVDIGLFEAAKARLSIDVLETGNLLLVQALTLISNYLQKRNKP
                     NSGYNYMGLARRIAMGIGLHKEFPAWEANLLTIEMRRRCWYCLYIFDVGGIITFSRPF
                     DFPNDGIDVELPMNVHDSDITAGSKQRPSPAPETTIYTHLRAQSTFHLATSPIYARII
                     SSPFPSATSLVEMDDQLIGGWLASLPPFFAQDAPQKPKFRLCHSILRWRYRNFRILMF
                     RPFLVSRLMIRPSEGIQDNDPYVDVAVQRCLDAARESVDLICTFWIEDSKNMMACWYG
                     LYFLFQAILIPVICLRNDPQSPLVVSWRDQISKAMPVLESMGQLNPTALRCLGVIRSL
                     CGTYLDPSMDGLGRPTEESPQTQLASLYPLMWPTLEMAQLDGVDSILQESTIMDFMNQ
                     LPGLE"
     gene            complement(<255509..>256440)
                     /locus_tag="ACHE_10084A"
                     /db_xref="GeneID:66977041"
     mRNA            complement(join(<255509..255592,255637..256209,
                     256253..256311,256365..>256440))
                     /locus_tag="ACHE_10084A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283741.1"
                     /db_xref="GeneID:66977041"
     CDS             complement(join(255509..255592,255637..256209,
                     256253..256311,256365..256440))
                     /locus_tag="ACHE_10084A"
                     /note="COG:Q;
                     EggNog:ENOG410PKZK;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131204.1"
                     /db_xref="GeneID:66977041"
                     /translation="MVLHQPENKHVFKAFDLSGKVAAVTGGARGIGLEVSRALAEAGA
                     DVALIYNTSKTASDTAASIASENNVKTAAYKADVGNQEDIEKAVQQIATDFGRLDIIV
                     VNSGITSSIAAEDYSAEQWRDIMKVNLDGAFYTAQAAARIFKKQGYGNVIFTASVSAT
                     LVNVPQKQAAYNASKAGVVQMAKCLSVEWVDFCRVNCISPGFIATDILDIHPQEWKEK
                     WFDMIPAKRMAQSYELKGAYVFCASDASSYMTGADLVIDGGYTLP"
     gene            complement(<256749..>257873)
                     /locus_tag="ACHE_10085A"
                     /db_xref="GeneID:66977042"
     mRNA            complement(join(<256749..257387,257439..257670,
                     257719..>257873))
                     /locus_tag="ACHE_10085A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283852.1"
                     /db_xref="GeneID:66977042"
     CDS             complement(join(256749..257387,257439..257670,
                     257719..257873))
                     /locus_tag="ACHE_10085A"
                     /note="COG:E;
                     EggNog:ENOG410PJ7Z;
                     InterPro:IPR005829,IPR005828,IPR020846,IPR036259;
                     PFAM:PF00083;
                     TransMembrane:7
                     (o28-47i117-138o158-176i183-205o217-238i258-275o281-302i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131205.1"
                     /db_xref="GeneID:66977042"
                     /translation="MYYLGAIVASWTSYGTQKHLNDDWTWRIPSIVQAGFPIIQIVLF
                     WFLPESPRWLIANGHTQQAEQLLARFHTAGDVSHPLIQFEMAEIARTIEMEHSASTMR
                     WTALVDTPGNRKRTFIAVCVGTFAQWNGVAVVSYYLTLVLDTIGVTDSDTQTLINGLL
                     QVFNFVAAGSAALLVDRLGRRPLFLWSALGMLISFIIWTACSAVVNGDDSNQAVGRTV
                     IAFVFIFYFHYDIAYTPLLLGYPTEIFPYSIRSKGVTVELLAVYSSLIILAFVNPIAL
                     DRIGWRYYIFFCCFDVLVLVVTWFCFPETKGHSLEEIAEVFDGRAVDLDEEKVGKRGV
                     EHAEYVD"
     gene            complement(<258057..>258514)
                     /locus_tag="ACHE_10086A"
                     /db_xref="GeneID:66977043"
     mRNA            complement(join(<258057..258322,258370..>258514))
                     /locus_tag="ACHE_10086A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043283963.1"
                     /db_xref="GeneID:66977043"
     CDS             complement(join(258057..258322,258370..258514))
                     /locus_tag="ACHE_10086A"
                     /note="COG:E;
                     EggNog:ENOG410PJ7Z;
                     InterPro:IPR005829,IPR005828,IPR020846,IPR036259;
                     TransMembrane:3 (i28-47o72-95i102-126o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131206.1"
                     /db_xref="GeneID:66977043"
                     /translation="MKDQDIVGEALASVLPQYNKIWFRVPHLLQLNLILMIPLLSSAV
                     AGYDGSLMNGLQSITQWQKYFGNPSGEILGVVNAAQSIGSVVSLPVVGFLSDKIGRRW
                     TLLSGAVTIVIASAIQAASVQYGMFVFSRYAPFY"
     gene            <258846..>259750
                     /locus_tag="ACHE_10087S"
                     /db_xref="GeneID:66977044"
     mRNA            join(<258846..259106,259156..259410,259463..>259750)
                     /locus_tag="ACHE_10087S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284074.1"
                     /db_xref="GeneID:66977044"
     CDS             join(258846..259106,259156..259410,259463..259750)
                     /locus_tag="ACHE_10087S"
                     /note="COG:Q;
                     EggNog:ENOG410PJRP;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131207.1"
                     /db_xref="GeneID:66977044"
                     /translation="MTTIRRPNPPVSDSIFEMFSMRGRVVIITGGSGGIGYQVSRGLA
                     EAGANVALWYNQSIQAKDLAATIARDFGIAAKAYRCDVQDFNQVKSTTDAVVADFGRL
                     DVMIANAGIPSKAGGLDDRLENWHRVVDVDFSGAYYCARAAGEIFRKQQSGNVIFTAS
                     MSGHAVNVPQQQACYNACKAGIIHLSKSLAVEFAPFARVNSVSPGYIDTAISGDCPSV
                     MKEEWYSLTPLKRDADPRELKGVYLYLASDASTFTTGADFVVDGGYTCR"
     gene            <259950..>261250
                     /locus_tag="ACHE_10088S"
                     /db_xref="GeneID:66977045"
     mRNA            join(<259950..259955,260005..260164,260218..260347,
                     260403..260961,261014..>261250)
                     /locus_tag="ACHE_10088S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284185.1"
                     /db_xref="GeneID:66977045"
     CDS             join(259950..259955,260005..260164,260218..260347,
                     260403..260961,261014..261250)
                     /locus_tag="ACHE_10088S"
                     /note="COG:Q;
                     EggNog:ENOG410PFUH;
                     InterPro:IPR013154,IPR013149,IPR002328,IPR036291,
                     IPR011032,IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131208.1"
                     /db_xref="GeneID:66977045"
                     /translation="MTETNPSFVLRAVKDVVFEDRPVPTLKDPYDVRVQIAQTGICGS
                     DVHYWQRGRIGDFILESPIVLGHESSGTVVEIGPAVKNLKVGDRVAIEPGVPCRHCNY
                     CRSGSYNLCPDTIFAATPPHDGTLSKYYITQSDFCYPIPAHMDLKEGALVEPVAVAAQ
                     ITKVGNVRPNQTVVVFGCGPIGLLCQKVCKAYAANKVIGIDVSPSRLDFAKEFGVDDV
                     FLPPSKPEDVDECEWSEKVACMIKEKFGLGDGPDVVLEATGAQSCIQTGIQLCRKGGM
                     YVQAGMGKENVVFPITTACIRDLTIRGSIRYTTGCYPTAVDLIASGKVDVKRLVTNRY
                     VFEQAEDAFELVRQGKESVIKVMIEGYKG"
     gene            <261406..>261890
                     /locus_tag="ACHE_10089S"
                     /db_xref="GeneID:66977046"
     mRNA            join(<261406..261468,261532..261643,261703..>261890)
                     /locus_tag="ACHE_10089S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284296.1"
                     /db_xref="GeneID:66977046"
     CDS             join(261406..261468,261532..261643,261703..261890)
                     /locus_tag="ACHE_10089S"
                     /note="COG:S;
                     EggNog:ENOG410PU0X;
                     TransMembrane:3 (n8-19c24/25o48-66i78-95o101-119i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131209.1"
                     /db_xref="GeneID:66977046"
                     /translation="MSLNPLKATAAGWLFIALGHTLNAKDWQTLPQFRQLPRLAYTCG
                     TIGWYQGSLFFIMNALINYTWAENPALLDIPLNRVIAGLMTGIMWVSSGWYAKNGVYV
                     TGAVVAAMGGVQAWSVFC"
     gene            262206..262279
                     /locus_tag="ACHE_t10002S"
                     /db_xref="GeneID:66987308"
     tRNA            262206..262279
                     /locus_tag="ACHE_t10002S"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:66987308"
     gene            <263034..>265037
                     /locus_tag="ACHE_10090S"
                     /db_xref="GeneID:66977047"
     mRNA            <263034..>265037
                     /locus_tag="ACHE_10090S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284408.1"
                     /db_xref="GeneID:66977047"
     CDS             263034..265037
                     /locus_tag="ACHE_10090S"
                     /note="COG:P,Q;
                     EggNog:ENOG410PJDJ;
                     InterPro:IPR013112,IPR017927,IPR013130,IPR013121,
                     IPR039261;
                     PFAM:PF08022,PF01794,PF08030;
                     TransMembrane:8
                     (o50-73i129-151o171-189i210-232o252-270i282-302o322-
                     348i474-495o);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131210.1"
                     /db_xref="GeneID:66977047"
                     /translation="MLSPRHGSSGSGGGIMQHHWGYFTRELPCTSDPGNCAYLDAVYG
                     GHDLSMIYSAILWAVIGGVLLVCAVVNYFPVSRRVTGAGTKEVEQPNERQSTVYRVWR
                     FVTAASNRYLLPESLTPVFGHTTRLNILILVILIGYLTIFTFVGITYKTWYSPVEGTK
                     LQTTRVGLGPWADRIGVMAYALTPLSLLLSSRESLLSLITGIPYHHFNFLHRWLGWII
                     YIQSALHTIGWTVVEGRLYQPQPQKWNEFISQQYIISGIVAMICITFLVLHSTKWCIR
                     LTGYEFFRKSHYVIAMVYVGTCWGHWDKLRCWMIASLIVWMLDRTIRFVRVFVVHCAG
                     SAGLNYSLCGSVLVPKAKMISFHNGQDGDVVRLDFQHDYPSWEIGQHFYLCFPELSVW
                     QSHPMTPSSVPVQNPQGQGQSHSYIIRAKKGLTKDLAGIARETQTESGSSLDGGRTTE
                     ILLSGPYGQSIADTDLIRTDDINLFCVAGGTGITFILPVLMSLAASNQLCCRKGLTEF
                     VWVIRRKADMQWISTELDTLREAAEIFPSLRIRIFITREELSSDGTSSESTNANLMDK
                     GFSDKTVENSCCGQPSPNEDDQPFMVQHIKNSDTAHPNLAPILGNFVSRTVAGPIRVM
                     ASGPPGMISDLRKAVALSNDPGRVWTGDERCDVQLVYDDRVEW"
     gene            complement(<265270..>266219)
                     /locus_tag="ACHE_10091A"
                     /db_xref="GeneID:66977048"
     mRNA            complement(join(<265270..265976,266033..>266219))
                     /locus_tag="ACHE_10091A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284519.1"
                     /db_xref="GeneID:66977048"
     CDS             complement(join(265270..265976,266033..266219))
                     /locus_tag="ACHE_10091A"
                     /note="COG:S;
                     EggNog:ENOG410PZ02;
                     InterPro:IPR011011,IPR001965,IPR019787,IPR019786,
                     IPR013083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131211.1"
                     /db_xref="GeneID:66977048"
                     /translation="MNMLRTPTDLNPNYNAPGHAGQGRLLNNPTAPATSRLTSADPVH
                     GALTLSETDRSNIYYEWIRLGKPHNIVCSQCRRPDQLLLCETCCRSYHTGCIPSSEVT
                     AFSGKFHCPSCRNKNWDRLPPQFSGRSSPNASRSTTPSGRDRSRRNSPSRLAKPSGHI
                     SPIASGTPLTGLPGSSGHTSPMEWQGVHGAGQQSDKLSQARSFLIENGAASQEHNPMI
                     LYQIAHMMEQLESQQRLLQETQELREENVRLHHINRELRAHAHSRSPHDSAVNSPIPN
                     IPRPVADTSGKSWDRIVMDLL"
     gene            <266540..>268852
                     /locus_tag="ACHE_10092S"
                     /db_xref="GeneID:66977049"
     mRNA            join(<266540..266596,266651..266806,266857..267398,
                     267448..>268852)
                     /locus_tag="ACHE_10092S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284630.1"
                     /db_xref="GeneID:66977049"
     CDS             join(266540..266596,266651..266806,266857..267398,
                     267448..268852)
                     /locus_tag="ACHE_10092S"
                     /note="COG:S;
                     EggNog:ENOG410Q2PD;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131212.1"
                     /db_xref="GeneID:66977049"
                     /translation="MPGVPSNKACERCKKRHLKCDEARPSCQRCVNAGVECPGYVQTR
                     KFIDQGATIRRRYAPYQEHHQRSGAHKENEVPAVVEAENPLQEQTPVDQHGNDLQTIT
                     PMTEVPRVEGRDSDASQGAQGTPDASRQGVAQDSQIQTGTAVLPNRPAVTIPSIDQSI
                     LNTGFSPAGHELNTRSLLENPNLPTSGSSHPSNTPDTDFSQAPGVPSSEMPESSETQN
                     DAEGFNDVFSELMTGTEHEVAFLTRYFSEYLGPWLDLSDSSKFFAVYAPIRALNKYFL
                     KYSMAALAAKHLGRMKGQKPAAGGIFTSPATMEIYPNAAQTDWTLKGANYYYLAFAYM
                     RHSITVSYAAPSSSAILESPIEMVNGYLGQQPGFVRMDISDADTFLRDIEGLLATCVI
                     LTMYRLLDVPGDDWQTCVSDIRCVILWRLTDYRHLAGIESLFDLLLQLHTTSPALPPM
                     FSQGERAAFWNFARQDYLASYFNRIPTHFKHSNLSLWKTAGIQVNELELLDDTIRLTP
                     EDLAANTLIWLMNKMVNFLADYRRSQLAQWTESDEHAQPSTTMWLNLCFEFQSWFEKI
                     PETFRPSLRIERPRDMSNLSDISYLPFPEIFFSLTSCAAAMQHYHFGRLGLLLNRPPD
                     VMSAPGTAFDRLASLREVTKEVDYRCREICGIALSRPHGEVRIYMVPLLFAVGQCLET
                     QETRQVIVDLLRGVEADLGWATVSTVEKLQVVWSQQS"
     gene            <269862..>271206
                     /locus_tag="ACHE_10093S"
                     /db_xref="GeneID:66977050"
     mRNA            join(<269862..270687,270740..>271206)
                     /locus_tag="ACHE_10093S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284741.1"
                     /db_xref="GeneID:66977050"
     CDS             join(269862..270687,270740..271206)
                     /locus_tag="ACHE_10093S"
                     /note="COG:S;
                     EggNog:ENOG410Q2SW;
                     InterPro:IPR001810;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131213.1"
                     /db_xref="GeneID:66977050"
                     /translation="MSLESLPTELRIHILHSLDKQSLHNAVLASPTYHHTYLLARRAL
                     LHDLVRCHYGLVDLAEPVAAVRSEGLYADVSANKQKIISLLDRRRRHRELELSRKDPF
                     AGAPVSIEESIKLLHLYNKLDTIVQAYCRRAPCPPWMDQDTWKQQCLPLQLTETERAR
                     ILRALCRLQTYYNIVGAREWVPENETGQSRFRKSSTWYRNFTTNEIWNLFFGTMAPWE
                     IEEFGSVWMFVRDQYQGMFDEIACEFPRSDPRWKALRPNSLPAEMMDLYPSEGDDEPA
                     NYSYSDYCNHLVSLGPCFLYKALKQPTYEYRRNLLAHNAIASKSSFMDVVEVIKDPCP
                     LLYPADKYEVSDIARVLPTMPAMQQPTHGWKQHWHRDGIVERVVFATRPRVTVDEDTL
                     EAWLGETDLERTIGYFDGWEWGYPILESMRFPVGYMMP"
     gene            <275140..>276160
                     /locus_tag="ACHE_10094S"
                     /db_xref="GeneID:66977051"
     mRNA            join(<275140..275232,275291..>276160)
                     /locus_tag="ACHE_10094S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284852.1"
                     /db_xref="GeneID:66977051"
     CDS             join(275140..275232,275291..276160)
                     /locus_tag="ACHE_10094S"
                     /note="COG:Q;
                     EggNog:ENOG410PJFA;
                     InterPro:IPR020946,IPR036188;
                     PFAM:PF13450;
                     go_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131214.1"
                     /db_xref="GeneID:66977051"
                     /translation="MDDYVDLAIYEKNADVGGTWFENRYPGLACDSPAHIYTFPFEPN
                     PDWSALYASGPETWQYIRRTTTKYNLDEHVRFNSTVTSTIWDDNTSRWKIKVQSSEGI
                     VAEDTADILINGSGILNRWRWPDISGLHSFKGTLVHSARWDTNLDWTGKRVAVIGNGS
                     SAIQILPQMQRTAKHIVTYIRSPTWISPGLATTNLESDDGQNVTYTEEEKKRLRENPD
                     ELRTLRKTLEHELNSFFGNVILNDGPQQAVAQAAFTAEMKRRLGGDKNAHLLEKLIPE
                     WTVGCRRLTPGDGYLEALTEPNVTIEMSPIQRITDKGIVSGSFF"
     gene            <276303..>276775
                     /locus_tag="ACHE_10095S"
                     /db_xref="GeneID:66977052"
     mRNA            join(<276303..276430,276481..>276775)
                     /locus_tag="ACHE_10095S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284963.1"
                     /db_xref="GeneID:66977052"
     CDS             join(276303..276430,276481..276775)
                     /locus_tag="ACHE_10095S"
                     /note="COG:Q;
                     EggNog:ENOG410PJFA;
                     InterPro:IPR036188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131215.1"
                     /db_xref="GeneID:66977052"
                     /translation="MPNYFIFNGPNCPIGHGSVLSPMDWMADYILRWCRKIATEDIRS
                     VQVRSDATHDYNVYTQKFMKGTAWSSGCRSWYKNGKIDGRVTAMYAGSVIHYKEMLES
                     FRTEDFILHYRSSNRFRFMGNGKTIREKNGGDLAYYIQ"
     gene            <276975..>279110
                     /locus_tag="ACHE_10096S"
                     /db_xref="GeneID:66977053"
     mRNA            join(<276975..277225,277282..277719,277788..278026,
                     278075..278209,278255..278345,278393..>279110)
                     /locus_tag="ACHE_10096S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043285074.1"
                     /db_xref="GeneID:66977053"
     CDS             join(276975..277225,277282..277719,277788..278026,
                     278075..278209,278255..278345,278393..279110)
                     /locus_tag="ACHE_10096S"
                     /note="COG:T;
                     EggNog:ENOG410PWEM;
                     InterPro:IPR036864,IPR007219,IPR004507,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131216.1"
                     /db_xref="GeneID:66977053"
                     /translation="MADNLYPYDTGLVRELLKNKRKVRGIRSCFPCRHRKVRCDGQVP
                     CSSCVKRNHPELCRVPNSGPEEGIQQQPSPSGRLDIEASLNRIIEDRQVQYSTDNNLL
                     ISRLEKIEEQISSLKADLRTASVPAPSRVRESSEGQVSSRTSTRLASKSPGRYYVEDA
                     TGATIYLGSRSDAPLVLGCRQPATTGDVMLQSAMMDQFVPRAYPFTNLWGMDAAAQNV
                     CETLPDDSDIIRYWQTYQSAVYPFYPTLVTADQFSQSLFAFLDQRASARETNRHVEEP
                     NSSWLALLFAVLASGVQFSDDLIKERDLRSRVFVCSSFQCLRLSNFFNNTNLDQIQAM
                     ALIGHCLRNNLDTNSAWILMGATIRLAQSIGLHEPSLSLSASEQHQRNRLWWMLIWQD
                     TFLSLTYDRPPSSITGICPIPLTPYTEGLTFQESVFTICKIILDRTQLENSGDSHPPM
                     ESALESRRELESIWHTVAPFLRDKSRCISLQQHLERLALGIHLGYTICRFTWMYLDSA
                     RQEFSVLPDTIQDCVQQAIRPIESFLDLHRFSSSVCRSWAFVHNAVSCAITLKTAEQM
                     LPEETNRSKIIIQRLIVVLEKEERDSEWVDTDTNVRHFGPYSRALKALREIYHETEA"
     gene            complement(<279187..>280896)
                     /locus_tag="ACHE_10097A"
                     /db_xref="GeneID:66977054"
     mRNA            complement(join(<279187..280709,280764..>280896))
                     /locus_tag="ACHE_10097A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043285185.1"
                     /db_xref="GeneID:66977054"
     CDS             complement(join(279187..280709,280764..280896))
                     /locus_tag="ACHE_10097A"
                     /note="COG:Q;
                     EggNog:ENOG410PFCN;
                     InterPro:IPR001128,IPR002403,IPR036396;
                     PFAM:PF00067;
                     TransMembrane:1 (i343-367o);
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131217.1"
                     /db_xref="GeneID:66977054"
                     /translation="MLQCQFYLVGDDIATAKILEIDSRWKFEDLQRAVGVVFNIAQPT
                     GISFHNAQNETFTSVQDALTAQAPVGLRIDGNAVQSPQGPPGLPLVGSYYEIYPDHLG
                     NHYRLFRKYGPVIKTTNMGKTIYLTDDPKVAAVAFAESAYMTKKINESHPLWGVKDNT
                     AIFIGDTETENWRLAHKFLPPAMGPKAVRHYTSLMQNCARKSLPVFDELDSREESWNV
                     YQYMVKLASQTISSFSLGTDFGHFDSVDSPLHPIVTNIASLLSLNKKITSRGEWYRHL
                     PWGDPARLRQVQHTIYSLLQEAIDEVAVTSTTKDAPMNEAALSASCVVDYLHHALDEK
                     GERLPKGLILANMLIVTGAGFTTTSALMSWLIYCLATYEGTQERLYQELVEFGIVGPN
                     GERNQTTWTPDLAHSMPYLDKFVKETQRLHNASFQPGRTTKTEVILPGGYRLPPDSVI
                     VPALYAIHTNPKVWRDPLRFDPDRWDTQEAKDRHRCAYVPFATGPRGCIGFNFALLEV
                     KVLLSELVSRYELVREGLDAVDYDPEFQLIRPLNFYVRAKRRV"
     gene            <281323..>282844
                     /locus_tag="ACHE_10098S"
                     /db_xref="GeneID:66977055"
     mRNA            join(<281323..281398,281450..281610,281666..>282844)
                     /locus_tag="ACHE_10098S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043285296.1"
                     /db_xref="GeneID:66977055"
     CDS             join(281323..281398,281450..281610,281666..282844)
                     /locus_tag="ACHE_10098S"
                     /note="COG:C;
                     EggNog:ENOG410PV4R;
                     InterPro:IPR001834,IPR008333,IPR001433,IPR001199,
                     IPR017927,IPR001709,IPR036400,IPR018506,IPR017938,
                     IPR039261;
                     PFAM:PF00173,PF00175,PF00970;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131218.1"
                     /db_xref="GeneID:66977055"
                     /translation="MPSFTYEQVQQHTKPDDVWIVLHNKIYDVTKYLDDHPGGKDVLL
                     EAAGTDATEAFEDVGHSDEAREQLDPYYIGDLPTEEQAEAVEIYRPNFEQVSQSAVID
                     VKKSSYASSTLHAIVKLGLTGLVGSLAVSCYRNGWSFDKALQSLLSISLPKGTPGSTS
                     GQFWTGACIATVAQLSVTLGLGVWASSKLDVQQEFTHYVPRRHAQTAQFIQLPRTNVP
                     LKKPNVLDPRQWRSFTLTRKDEVAPHVYRFVFALPNPDDILGLPTGQHIALRATINGQ
                     TVSRSYTPVSNNSDTGRIELLIKVYPNGAMTRYLEDMKLGETIEIRGPKGAMQYSRQY
                     AKHIGMIAGGTGITPMYQLIRAICEDPSDNTQISLLYANNTENDILLRAELDTFARKC
                     PEKFQVRYVLSHADDKWTGYKGFINDDIIEKHLAPVAKDNRVLLCGPPPMLAAMKKAL
                     QGMGWRMPGAVAKGGDQVFLF"
     gene            <283511..>285365
                     /locus_tag="ACHE_10099S"
                     /db_xref="GeneID:66977056"
     mRNA            join(<283511..284079,284135..>285365)
                     /locus_tag="ACHE_10099S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043285407.1"
                     /db_xref="GeneID:66977056"
     CDS             join(283511..284079,284135..285365)
                     /locus_tag="ACHE_10099S"
                     /note="COG:I;
                     EggNog:ENOG410PW7X;
                     InterPro:IPR006176,IPR008927,IPR006108,IPR036291,
                     IPR000033,IPR011042,IPR013328;
                     PFAM:PF02737,PF00725;
                     go_function: GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131219.1"
                     /db_xref="GeneID:66977056"
                     /translation="MTTPSKERPIVLLGAGVLGRRIAAVFLAGGYNVHIRDPSKQALS
                     DAESFIHTQLPSFTAVLSQQGKISPGSLRIFTEIAPAVKNAWLVVEAVPEKLELKQAT
                     FAEVVASAPADCILASNSSSFKSRLMVEGLDKKRREMTLNMHFTMPPAIRTVELMTDG
                     ETKQELFGILSEVLRVCGMVPVTARKESTGFIFNRLWAAVKREILTILAEDVSTPEEI
                     DLLWENMFQLPTSKPPCRLMDQIGLDTVAFIEDNYIQERGLEGKQTVDWLRENYIQQG
                     KLGLKSENGGLYPAAKKDNTADETIYLLDVGLGANNPDISAIPTAGRILKFTPSSNSV
                     EALVSGQSLPDGIDISQRTSRIFWTNMGRATSTHDGSVHSANLDGSGVQTIVPFGAVH
                     TPKQLVVDDANQHVYFCDREGMGVHRCNYDGSDHCILVQTGSTSDPAERDDMTRWCVG
                     ITVDPACGYIYWTQKGPSKSGKGRIFRAKMEIPCGQTAANRSDIELLLDNLPEPIDLE
                     LDRENQVLYWTDRGEHPTGCSLNSISVAGNKVRPENKNILARQFHEPIGLKLNAKKEV
                     IVADLGGSVYRVGRGKTVIMQDQGSYTGVSLYS"
     gene            <285876..>289985
                     /locus_tag="ACHE_10100S"
                     /db_xref="GeneID:66977057"
     mRNA            join(<285876..286054,286112..286202,286270..289014,
                     289074..289364,289416..>289985)
                     /locus_tag="ACHE_10100S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275188.1"
                     /db_xref="GeneID:66977057"
     CDS             join(285876..286054,286112..286202,286270..289014,
                     289074..289364,289416..289985)
                     /locus_tag="ACHE_10100S"
                     /note="COG:S;
                     EggNog:ENOG410PM8T;
                     InterPro:IPR039130,IPR005635;
                     PFAM:PF03941;
                     go_process: GO:0000070 - mitotic sister chromatid
                     segregation [Evidence IEA];
                     go_process: GO:1902412 - regulation of mitotic cytokinesis
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131220.1"
                     /db_xref="GeneID:66977057"
                     /translation="MASAGARGQKPVGSAAWISTEKENVSQLVEQELEEVEYPVSHEM
                     DWLNEHMAEIFNNNQFNFTEAFKTPGKLRGKTPRTARKRNFEESRVPLSEIFSTAHNQ
                     KENKSIASPTGKRSPAKPAAPIPTTNAKPTTENAPQPHYPDLSQNLNSLPQYNTDSGY
                     HGMTDDDGDDDDDVVLTQTQPESQTSTQASTHPLQEKKPTPEPPQTHDLVDRRTTESS
                     FHSAQEDNRQRGETMEPADDAPKTLQKVEVHPPKLQLKEKKPEEKPVSRKSESGQKQD
                     PERVPEKKVAEEPEWKHEQKPEPKSKQKQEREPQPEQDLESKSEEEPETEQQPEPEPE
                     PQPGPVQNTKSSPVHTPATQPSRSVQEDDAAEMEKEDMALDNLDDHDDIGSPSDGSTP
                     ERPPIRKSSLTFASLPAREPLTKKSLGGARVSRTSHIGSGFLGRQTGGHRTTQAALEE
                     NASQAQGEKMDVDDDVELTRDGTDAETRASKQHNKSSTQRLHEKISMLGKLQPSRPTK
                     SIPSVSGLSSAQVTYPDLPKTEAKPEASDRKSRETPAPEPMATDEDEWIKPSVNTPQR
                     PNLAKSRTMDIMEKSNQAFEKDDTARSPDMGGNRMAKPYEDHTAEMSRPKSTTPLYTP
                     PQHPNHQKSVSVSNLTGGGSTTPAGSPKPQDAPLSASKWKLQSIMKSAKGLFSTAGSV
                     SAAARVEASSPTESLKQPEERIKPQSLSRQEPQPAQESTPPRPEGRRTRSSTEREEKR
                     RQQEVEEREREEQEERAREQEKQKAIQLKAAREKASLEREERAASVAPSPKKIPQPQK
                     HASKEPEPTYETASKPAAPSSIPQQKQNERRPVKPTRETLQKPKPQPVSIRVGSALSR
                     QIPMASGSNAQESVAAAPTPASASKPSTIKKKASNNSLHTASSNNSLKSSVSSNSQRK
                     VQLASERKREQEEREARRKEEQRRELERKRAAQQQEEARRQELRSRAEAERRERQASV
                     DPKKAAHMQAIEKRRLENQRRLERQGSQQPGDTGMLQQPERPASQASRSASRLGSIQP
                     FGRSINTPQPNPAKPPKRAMDDEASHRPAPPKPSIIPQPGDPKRRRTEDEHNPPPSVR
                     PAMAPPIRQSNIRKEPTKPSIFNGQRTSTAPQSGSSILKTAQPQRPAHPLDMSKYASG
                     KIPFAEPSNAAQPKPGPSSAQKAANKQSPKYPSGENIALPEIATDSEDEDSDAEMLPV
                     PKWAQPRELENLLRQQEGMEVDSIFGPVAPFSLEETFKADKKIKKFRERTSSANWSGA
                     DRLTQDEIRKDLAERQRLRLNGGWTFDTN"
     gene            complement(290249..290319)
                     /locus_tag="ACHE_t10003A"
                     /db_xref="GeneID:66987309"
     tRNA            complement(290249..290319)
                     /locus_tag="ACHE_t10003A"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:66987309"
     gene            complement(<296475..>298127)
                     /locus_tag="ACHE_10101A"
                     /db_xref="GeneID:66977058"
     mRNA            complement(join(<296475..297547,297598..297947,
                     298021..>298127))
                     /locus_tag="ACHE_10101A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275299.1"
                     /db_xref="GeneID:66977058"
     CDS             complement(join(296475..297547,297598..297947,
                     298021..298127))
                     /locus_tag="ACHE_10101A"
                     /note="COG:S;
                     EggNog:ENOG410Q2I0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131221.1"
                     /db_xref="GeneID:66977058"
                     /translation="MPKKGGKNKAKSKAKAAAGAAAAAPKNVATDVKETLTPGHQVEE
                     NVAKAEGEVEKTKEAKDAPASATADSTATVAPDTTSKIPTAAPESAEVEPVKEAEKTV
                     SEPAPEPIAEPEPEVAEVAKRDSIQEAVEKVQASKEGHIGSLDGGDSEGAVVLPEATA
                     KESTLISAPDETITKPTETVETPSAPVAEETTAPVTTLPERPRDTTQPPTDNIEAIHT
                     KRPYETPLFTKEEQKPPKMPKVEGEPEAEPAGQVVSGLTSDETKDLHKESKEIATGNK
                     DVADVNATKEAPAAAPVVAAPAAAPVAAEPAAAAAETKAAEAPVTEAVPAQPEKVAEP
                     EIAAPAAAPAAEPAVAPVTTAPEAAKEKAAEAPKEAPTEAAPSKEAPKEAVPETKPET
                     KPEAKPEAQPETKPEPKAEATKSEAAAAAAPGIAAPADKAAIAATADQKAAQAPEPVI
                     QKPEQAKVAAGKAEQSARDNLAKVQQEGKDKAEQLKAEKAEKRKSGFFGWLKKKVKGD
                     K"
     gene            complement(299383..299454)
                     /locus_tag="ACHE_t10004A"
                     /db_xref="GeneID:66987310"
     tRNA            complement(299383..299454)
                     /locus_tag="ACHE_t10004A"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:66987310"
     gene            <300350..>301031
                     /locus_tag="ACHE_10102S"
                     /db_xref="GeneID:66977059"
     mRNA            join(<300350..300692,300745..>301031)
                     /locus_tag="ACHE_10102S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275410.1"
                     /db_xref="GeneID:66977059"
     CDS             join(300350..300692,300745..301031)
                     /locus_tag="ACHE_10102S"
                     /note="COG:S;
                     EggNog:ENOG410PZNX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131222.1"
                     /db_xref="GeneID:66977059"
                     /translation="MPLRDRVKRVFRRSSLPAPKTNRNGVKIEYYRRSEVPKSKFKGP
                     FDPEHQKQLAAWSFQTAMAERPRSQDLSLSPCTSLPDYMRLPQQSRPQQNEEIAPDQM
                     TEEPAPNADVMDTSPTVTQVEDTQRQADGGSQSSTMVDPDSYSGSMMTLLPENHRDGS
                     ICNIKETIRYTSPVLRTASPPPMSPKGAGTYMPFSPEDLTRALNAVQIY"
     gene            complement(<302001..>303132)
                     /locus_tag="ACHE_10103A"
                     /db_xref="GeneID:66977060"
     mRNA            complement(join(<302001..303010,303066..>303132))
                     /locus_tag="ACHE_10103A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275521.1"
                     /db_xref="GeneID:66977060"
     CDS             complement(join(302001..303010,303066..303132))
                     /locus_tag="ACHE_10103A"
                     /note="BUSCO:EOG0926400M;
                     COG:J;
                     EggNog:ENOG410PFAQ;
                     InterPro:IPR018978,IPR019783,IPR036786,IPR039100,
                     IPR037188;
                     PFAM:PF09377,PF01172;
                     go_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131223.1"
                     /db_xref="GeneID:66977060"
                     /translation="MPINQPSNQIKFTNVSVVRLKKGKKRFELACYKNKLLEYRSGAE
                     KDLDNVLQVPTIFLSVSKAQTAPSAELAKSFGPDIPQDEIRQEILRKGEVQVGERERK
                     EIQERVEKEMLDIVSGRLVDPGTKRVYTSGMISKALDQLSSASGQQAQAQSAEAESAS
                     EEGRPQQPRKPLWRGVDPNKSAKSQALEAMKALIAWQPIPVMRARMRLRITCPVNLLK
                     QAIKAAPGAANGGANKKEEPSNGGGPSKPKNKKGGKGNKKSRKGDSDDELDAPAPPAK
                     ESKQSAKDSDAETPTKTPGTVKDKILSYIESVETQEVVGGDEWEVVGFADPGAYKGLN
                     EFVGNETRGRGRVEVLDMTVTQEE"
     gene            <303638..>305325
                     /locus_tag="ACHE_10104S"
                     /db_xref="GeneID:66977061"
     mRNA            join(<303638..304112,304160..>305325)
                     /locus_tag="ACHE_10104S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275565.1"
                     /db_xref="GeneID:66977061"
     CDS             join(303638..304112,304160..305325)
                     /locus_tag="ACHE_10104S"
                     /note="COG:O;
                     EggNog:ENOG410PFU0;
                     InterPro:IPR029058,IPR018202,IPR008442,IPR001563;
                     MEROPS:MER0002010;
                     PFAM:PF05388,PF00450;
                     go_component: GO:0005773 - vacuole [Evidence IEA];
                     go_function: GO:0004185 - serine-type carboxypeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131224.1"
                     /db_xref="GeneID:66977061"
                     /translation="MRLLPATMLVGAATAAAPFQQILSSPKKASESFSETLSKPLHNF
                     QEQLENLSDEARNLWDEVSAKFPETMGHNPLFSLPKKHTRRPDSHWDHIVRGADVQGV
                     WVANEKGEKEREVDGKLEAYDLRVKKADPASLGIDPGVKQYTGYLDDNENDKHLFYWF
                     FESRNDPENDPVVLWLNGGPGCSSLTGLFLELGPSSIGENIKPIYNDYAWNSNASVLF
                     LDQPVNVGYSYSGSAVSDTVAAGKDVYALLTLFFKQFPQYAKQDFHIAGESYAGHYIP
                     VFASEILSHKKRNINLQSVLIGNGLTDGLTQYDYYRPMACGDGGYPAVLDESSCQSMD
                     NALPRCKSLIETCYNTESSFLCVPASIYCNNALIGPYQRTGQNVYDVRSKCDPGTDLC
                     YKGMDYVSEYLNKAEVREAVGAEVQGYDSCNFDINRNFLLHGDWMKPYHRLVPDLLEQ
                     IPVLIYAGDADFICNWLGNKAWTEALEWPGQEKYAAASLEDIEVVDHEHKGKKIGQVK
                     SHGNFTFMRLYGGGHMVPMDQPEAGLEFFNRWLGGEWF"
     gene            complement(<306120..>306853)
                     /gene="RPS18"
                     /locus_tag="ACHE_10105A"
                     /db_xref="GeneID:66977062"
     mRNA            complement(join(<306120..306417,306530..306695,
                     306850..>306853))
                     /gene="RPS18"
                     /locus_tag="ACHE_10105A"
                     /product="ribosomal 40S subunit protein S18B"
                     /transcript_id="XM_043275576.1"
                     /db_xref="GeneID:66977062"
     CDS             complement(join(306120..306417,306530..306695,
                     306850..306853))
                     /gene="RPS18"
                     /locus_tag="ACHE_10105A"
                     /note="BUSCO:EOG09264YEG;
                     COG:J;
                     EggNog:ENOG410PG18;
                     InterPro:IPR010979,IPR001892,IPR018269,IPR027437;
                     PFAM:PF00416;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S18B"
                     /protein_id="XP_043131225.1"
                     /db_xref="GeneID:66977062"
                     /translation="MSLVPDEKTNFQYILRLLNTNVDGKQKIMVALTQIKGVGRRYSN
                     LVCKKADVDLAKRAGELTTEELERVVTILQNPTQYKIPTWFLNRQRDIADGKDSQVVS
                     NSLDSKVREDLERLKRIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKG"
     gene            <307591..>310203
                     /locus_tag="ACHE_10106S"
                     /db_xref="GeneID:66977063"
     mRNA            <307591..>310203
                     /locus_tag="ACHE_10106S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275587.1"
                     /db_xref="GeneID:66977063"
     CDS             307591..310203
                     /locus_tag="ACHE_10106S"
                     /note="COG:S;
                     EggNog:ENOG410PUIC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131226.1"
                     /db_xref="GeneID:66977063"
                     /translation="MNPNIPLILRPNPPLNHPPFNLSTLPDPPRPIFLWGTTPEEVSR
                     NIPRPVLDAVFTFHFWGMNPCIYGRTTSARMLRALMKLFHHMDERHKPKSWAEACDFT
                     RDAGPRLLSCAVAVGVVPISRWYPDPPALDAETGVGFVRPGYALGLLPDVYVERMLVS
                     SWNVQGDSNAGQDGNSNGDNVDGNGNGDADGDAQMQDVTMADPTSSSTDVGSFIHLPP
                     VQHHPVFEAVERAVMQFAYADLERDPTAAPRSPRPQLLATSEDDLYKSIVASVPATSK
                     VALGDTMTNGVSFSPTGNPFPYRGRGPVWANNSCAVDCAIVVGMFLDAGSTVYDRKEL
                     GWQTRLSRAGKAFIDATDANWDVLSRDESASLRDSLWNVLAKESPAVRVGRFNSVWSV
                     WAAATANIRQFQFSCVETITHCPCRGTNSTSSSSSTSFLSSFVTPPVHPHDKDGVSLQ
                     EVIARPFAPGSLSPCRNCNLPDVVTRERRITTLPLRMVVTLDERVTINNHTQDFSLTY
                     LDANGVPQAATYRWLGGIYMHSNHFRVCWTDENCGEAGKGAVKIYDGMQNAGAIVGGV
                     GPYRADERVPPDWFRGSTIPLLVYERVLDPAPEVLNGAMQAVCGMMNASVTGVPVLKG
                     HVPWAKSGEGNVQGKVWNPILPTFGDRFQVIPTPYNPPITIDDIAITSTYFQEPQIQD
                     QDQPHPPLPSIEEATTLSLPLPLPLPLSPPNDPFSIDPQATLTTSTPPFQISTILPVS
                     IPITQRLNLSNSAFLPSADPELTGIAGPAGRAPGPGWYAPGGFLWIPTPPEAEGPQRM
                     TGEMERERKASPEWDTWIRMSPFGGDTQPRVVRISPGRETGGKSGKVVVGRVVQGRVE
                     KKGRASPGKGKERG"
     gene            complement(<310369..>311343)
                     /locus_tag="ACHE_10107A"
                     /db_xref="GeneID:66977064"
     mRNA            complement(join(<310369..311176,311234..>311343))
                     /locus_tag="ACHE_10107A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275598.1"
                     /db_xref="GeneID:66977064"
     CDS             complement(join(310369..311176,311234..311343))
                     /locus_tag="ACHE_10107A"
                     /note="CAZy:AA2;
                     COG:C;
                     EggNog:ENOG410PIDX;
                     InterPro:IPR019794,IPR002016,IPR010255,IPR002207;
                     PFAM:PF00141;
                     go_function: GO:0004601 - peroxidase activity [Evidence
                     IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131227.1"
                     /db_xref="GeneID:66977064"
                     /translation="MSAPGDYDAVRKDIVAQLKKPDYDDGSTGPVFVRLAWHSSGTYD
                     LATDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKQKHPWITYSDLWTLAGVVAI
                     QEMGGPAIAWKPGRTDLVDDSKVPPRGRLPDGAQGAEHLRFIFYRMGFDDREIVALAG
                     AHNLGRAHIDRSGFQGAWVNNPTRFSNQFFKLLLKLKWTRKTLPNGVSQFVYADPDLE
                     EGEEPLMMLPTDVALIEDPSFRTWVEKYAEDKDLFFEDFAKVFAKLIELGIRRDEKDA
                     IVNTDNVKGGYVSAPKKSDTATGPVRAKL"
     gene            complement(<312154..>314565)
                     /gene="GAP1_1"
                     /locus_tag="ACHE_10108A"
                     /db_xref="GeneID:66977065"
     mRNA            complement(join(<312154..313216,313271..313467,
                     313584..313804,313929..314195,314289..>314565))
                     /gene="GAP1_1"
                     /locus_tag="ACHE_10108A"
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /transcript_id="XM_043275609.1"
                     /db_xref="GeneID:66977065"
     CDS             complement(join(312154..313216,313271..313467,
                     313584..313804,313929..314195,314289..314565))
                     /gene="GAP1_1"
                     /locus_tag="ACHE_10108A"
                     /note="COG:E;
                     EggNog:ENOG410PJCY;
                     InterPro:IPR004840,IPR004841,IPR004762;
                     PFAM:PF13520,PF00324;
                     TransMembrane:12
                     (i175-196o202-228i249-269o281-299i311-333o353-373i394-
                     415o435-461i496-513o525-546i567-588o608-628i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0006865 - amino acid transport [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /protein_id="XP_043131228.1"
                     /db_xref="GeneID:66977065"
                     /translation="MMAFSRSNNVLHCLHCIASLLWRNTVPDVVIWFRRGTSLTADRV
                     NFQRRNTVCVREGRKFKRCVTSPRMGSGQTTFIPELSLALQLFHLYNLADRIMADDTI
                     HKVTTKSSSESASDYGEAKVHQSNIGRRIWDSFKPNPNSLTNTAPGADVENAAENTAN
                     SPLERRLKGRHMQMIAIGGSIGTGLFVGSGSVLATGGPASSLIAYGLIGFMMYCTVHA
                     LGEMAVLYPVAGSFSHYATRFIDPAWGFSMGWNYVMQWLVTLPLEIVAASITVDYWHP
                     NVSNAAWVAIFWTLIVLINLFGVKGYGEAEFVFSLIKVIAVVGFIILGIILNCGGGPQ
                     GEYIGGRYWQNPGAFNNGFKGLCSVFAKAAFAFAGTEFVGLTAAETANPRKSLPTAIK
                     QVFWRIVLFYLVSLTIVGLLVPYNDPKLMSGDSDADASASPFVIAIKNAGISVLDSVM
                     NVVIMIAVLSVGNSSVYGSSRTLAALAEQGQAPRFLAYIDRKGRPLWSLLVVSAFGLL
                     AFLAASDKQAVAFEWMLAISGLSSIFTWASVCLCHIRFRRSWKLQGHSLNELPFRSQP
                     GLIGSYAGFILNCLVLVAQFWVGFAPVAYGDMTASERVYNFFSVYLAAPVVLAFYIPY
                     KIYYRTPFIRAKDMDLHTGRRDLDIQYLIEEERAEQAAWPMWKKVYKVFC"
     gene            <315314..>316215
                     /locus_tag="ACHE_10109S"
                     /db_xref="GeneID:66977066"
     mRNA            join(<315314..315863,315917..>316215)
                     /locus_tag="ACHE_10109S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275620.1"
                     /db_xref="GeneID:66977066"
     CDS             join(315314..315863,315917..316215)
                     /locus_tag="ACHE_10109S"
                     /note="COG:E;
                     EggNog:ENOG410PVD9;
                     InterPro:IPR028939,IPR036291,IPR000304,IPR029036,
                     IPR008927;
                     PFAM:PF03807,PF14748;
                     go_function: GO:0004735 - pyrroline-5-carboxylate
                     reductase activity [Evidence IEA];
                     go_process: GO:0006561 - proline biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131229.1"
                     /db_xref="GeneID:66977066"
                     /translation="MPSLQESKLAFIGGGNMASAIITGLVGQGANKQNITVSEPWDVN
                     REKIATIGVQTTTSNVEAGKEADLVVIAVKPQVAKGVCKELGEAWSQRTTLPVVVSIA
                     AGITLGSLEEWLKTSDGRTPHAVRVMPNTPALVNEGASGAFASKDVTDDERALVDALL
                     GSVSKTIEWLNEEKLLDVVTSLSGSGPAYFFAMVEHLITSATQLGLTEEQATRLATQT
                     CLGAGKMLVESSDEPAQLRKNVTSPNGTTHAALQTFESLGFKDIVDKSVKAAAARAEE
                     LGNSLG"
     gene            complement(<316786..>317271)
                     /locus_tag="ACHE_10110A"
                     /db_xref="GeneID:66977067"
     mRNA            complement(<316786..>317271)
                     /locus_tag="ACHE_10110A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275632.1"
                     /db_xref="GeneID:66977067"
     CDS             complement(316786..317271)
                     /locus_tag="ACHE_10110A"
                     /note="COG:S;
                     EggNog:ENOG410QE8V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131230.1"
                     /db_xref="GeneID:66977067"
                     /translation="MPRQKSLSPGSCTLRLTHITSLPSSQKTALISSIANDMKATFIY
                     IAKQSEAGNLDSQNTAPLDNVVATIRDTAVSERRMLEKKLEKAERRVRKLKREQKWMH
                     NEVGEVLKRVEVVGGKWKEKVERLRGKVEGLQRELVSGREGVVEQMEETMEQNEGEDK
                     A"
     gene            complement(<317637..>318835)
                     /gene="LEU2B"
                     /locus_tag="ACHE_10111A"
                     /db_xref="GeneID:66977068"
     mRNA            complement(join(<317637..317844,317894..318314,
                     318364..>318835))
                     /gene="LEU2B"
                     /locus_tag="ACHE_10111A"
                     /product="3-isopropylmalate dehydrogenase B"
                     /transcript_id="XM_043275643.1"
                     /db_xref="GeneID:66977068"
     CDS             complement(join(317637..317844,317894..318314,
                     318364..318835))
                     /gene="LEU2B"
                     /locus_tag="ACHE_10111A"
                     /note="COG:E;
                     EggNog:ENOG410PMDY;
                     InterPro:IPR019818,IPR024084,IPR004429;
                     PFAM:PF00180;
                     TransMembrane:1 (o304-322i);
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0003862 - 3-isopropylmalate dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0009098 - leucine biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase B"
                     /protein_id="XP_043131231.1"
                     /db_xref="GeneID:66977068"
                     /translation="MSKTFNILILPGDGIGPEIMTEAIKVLKAFETPTTQFTLRNELI
                     GGCSIDAHGKSITDGVKEAALNSDAVLFAAVGGPKWDHIRRGLDGPEGGLLQLRKAMD
                     IYANLRPCSADSPSRSVAREFTPFREEIIEGVDFVVVRENCGGAYFGRKVEESDYAMD
                     EWAYSESEIQRVTRLAAEVALRHDPPWPVISLDKANVLASSRLWRRVVEKTMTEEYPN
                     AKLVHQLADSASLILATNPRVLNGVILADNTFGDMISDQAGSIVGTLGVLPSASLNGL
                     PGNKQVERSYGLYEPTHGSAPTIAGKNIANPVAMILCVALMFRYSLNMEAEAQKIENA
                     VRTVLDSGIRTGDLGGKASTSEVGDAIVAALQ"
     gene            <319274..>320692
                     /locus_tag="ACHE_10112S"
                     /db_xref="GeneID:66977069"
     mRNA            join(<319274..319556,319641..319913,319971..>320692)
                     /locus_tag="ACHE_10112S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275654.1"
                     /db_xref="GeneID:66977069"
     CDS             join(319274..319556,319641..319913,319971..320692)
                     /locus_tag="ACHE_10112S"
                     /note="COG:O;
                     EggNog:ENOG410PIDA;
                     InterPro:IPR011990,IPR044059,IPR019734,IPR013026;
                     PFAM:PF18972;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0051879 - Hsp90 protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131232.1"
                     /db_xref="GeneID:66977069"
                     /translation="MPQIEELPDDFDESIDLNKQPKPAADLPGMPPGADQIPFPINEE
                     RMKELEAMDPLAPKMPPNMASVKSHTKEELLDMMNKTPLFMTDISQAGDENGENWMLD
                     ALHALQNEGTRGEVAQNFREQGNEAAREKRWIDAKEFYTKAIAVILVKEDKWDKPEDP
                     EEEAKLLRQAEEASYINRALCHLELRNYRSCTLDCASALKLNPRNTKAFYRSSTALYA
                     LDKIPEAEDAASRGLELDPENKPIQATAKKIAERKAALERIAAKKKAEADRIRKETQL
                     LSVALKAREIRTRKTGQPPEMEDAGIRLSPDPLSPESTLEFPAVFLYPTDAQSDFIKA
                     FSEMHSIEDHLDYIFPLPWDTKKEYTIDNVECYMQTVTGGLIKAGKKLPLLQILSGGK
                     VEVVDELVTIYVVPSSKTGRFISEMKARKESGS"
     gene            <321459..>322688
                     /locus_tag="ACHE_10113S"
                     /db_xref="GeneID:66977070"
     mRNA            join(<321459..321514,321571..321974,322031..322621,
                     322669..>322688)
                     /locus_tag="ACHE_10113S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275665.1"
                     /db_xref="GeneID:66977070"
     CDS             join(321459..321514,321571..321974,322031..322621,
                     322669..322688)
                     /locus_tag="ACHE_10113S"
                     /note="CAZy:GH10;
                     COG:G;
                     EggNog:ENOG410PKIH;
                     InterPro:IPR017853,IPR001000;
                     PFAM:PF00331;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131233.1"
                     /db_xref="GeneID:66977070"
                     /translation="MVHLSFIATALAASLLPQLTNAAGLNTAATAKGLDYFGTATDNP
                     ELTDNTYMTQLNNTDDFGQLTPGNSMKWDATEPSQNSFSFEKGDAIANLAEANGQKLR
                     CHNLVWYQQLPSWVSGGSWTNETLTEALKNHITKVVSHYKGRCYAWDVVNEALNDDGS
                     YRENVFYQHIGEAYIPIAFEAAAAADPDVKLYYNDYSIEYGGDKANAAGNIVKLVQSY
                     GAKIDGVGLQGHFTVGQTPSKKDLASNLKSYTALDVEVAYTEMDVRMEMPSSSDKLSQ
                     QSTDYASLVGACAETEGCVGITIWDWTDKYSWVPDTFSGYGDACPWDEKYEKKQAYDG
                     ILNALGGSSSARKSRKMRRNLA"
     gene            <323425..>324916
                     /locus_tag="ACHE_10114S"
                     /db_xref="GeneID:66977071"
     mRNA            join(<323425..323683,324072..>324916)
                     /locus_tag="ACHE_10114S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275676.1"
                     /db_xref="GeneID:66977071"
     CDS             join(323425..323683,324072..324916)
                     /locus_tag="ACHE_10114S"
                     /note="COG:S;
                     EggNog:ENOG410PT80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131234.1"
                     /db_xref="GeneID:66977071"
                     /translation="MDPNATTTSAPTAANTGYPVLQSHRQQQTQHQQQHYGQQFPFHP
                     GAFPQTKTPSQQHSFGAVPFSQPGGPGGAIMPAAGGFPQHSSAGPHANFTAPFVQPPV
                     PSSMNHFLPPQVSSSTPNPPSTVAQTFSQNMASMSANNMISAQQQRPFQQQPQQPQPQ
                     QQPQHPQQPQQPQQPQQQTQQAQPQPQPQQQQQQQQSAAPFQGTPQQTATQSGPAAAR
                     EKARVAVLLELNSMLLQEVVNLQVAGKAGAPPQQQGSQESNPSPGSDQGASPAQKPSP
                     EYIECMRRLQANLAYLATIADRAKKSGGVPPPAPAIMTPPPNMPSMVEVYNKLNELFP
                     RPNKGGIGTPQPSPQGLPGNGKPSPSPAAESVV"
     gene            <325674..>329282
                     /locus_tag="ACHE_10115S"
                     /db_xref="GeneID:66977072"
     mRNA            join(<325674..326507,326556..329060,329112..>329282)
                     /locus_tag="ACHE_10115S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275687.1"
                     /db_xref="GeneID:66977072"
     CDS             join(325674..326507,326556..329060,329112..329282)
                     /locus_tag="ACHE_10115S"
                     /note="COG:O;
                     EggNog:ENOG410PGCA;
                     InterPro:IPR009003,IPR036034,IPR001940,IPR025926;
                     MEROPS:MER0003297;
                     PFAM:PF13365,PF12812;
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131235.1"
                     /db_xref="GeneID:66977072"
                     /translation="MSYALHSSCKKSLSVATVPQSSHHRHHHLRPLRHFNNSPRLFSL
                     SSSGSSRYSSHSSTFPTNITQSWASPRSPRRPLTKKKILQSTGYNSSVSSYTLTTASP
                     ARYSSALAYPPRRPSALSLTAPPNRPLPRPTQHQAMNGADDFSAKRKRSSAAAPTSAD
                     ADTRPAKHLKPELSTSTDGAPPNGTICDYETEEDASRLHAIGSTSADSPEWQATIENV
                     VKSVVSIHFCQTCSFDTELSMSSQATGFVVDAERGYILTNRHVVCSGPFWGYVIFDNH
                     EECDVRPVYRDPVHDFGFLQFDPKKIRYMKLTELKLQPAAARVGSEIRVVGNDAGEKL
                     SILSGVISRLDRNAPEYGEGYSDFNTNYIQAAAAASGGSSGSPVVNIDGHAIALQAGG
                     RADGAATDYFLPLDRPRRALECIQRGAFVTRGTIQTQWILKPFDECRRLGLTPEWEAA
                     VRRTTPSETSMLVAEIILPEGPGDGKLQEGDVLLQVNGSLLTQFIRLDDILDSSVGGS
                     VKLLVQRGGQNVEVECGVGDLHAITPDRFVSVAGGTFHDLSYQQARLYAIATRGVYVC
                     EAAGSFKLENTLSGWLIDSIDKQPTRNLDEFVEVMRNIPDRSRVVVSYRHIRDLHTRG
                     TSIVYIDRHWHPKMRLAVRNDDTGLWDFSDLADPIPAPAPVPRKADFIQLDGVKQPAA
                     AEIVRSFVRVTCTMPLKIDGYPQSKKTGFGLVLDAERGLVLVSRAIVPYDLCDINITV
                     ADSVIVAAKVIFLHPLQNYAIIQYDSKLVQAPVKSAKLSTECIKQGQETIFVGFNQNF
                     RIVVSKTTVTDITTVSIPANASAPRYRAINLDAITVDTGLSGQCTNGVLIGEDGVIQA
                     LWLNYLGERTASSHKDVEYHLGFATPSLLPVTNKITQGIIPKLRILNMESYVVHMSQA
                     RIMGVSEEWIQRVTETNRSRHQLFMVRKVDVPPPSFNPPPGTEPLQEGDIILTLDGQL
                     ITRVSELDIMYDKEILDALIVRNGQELRIQVPTVPTEDLETDRAVVFCGAVLQKPHHA
                     VRQQISKLHSEVYVSARSRGSPSYQYGLAPTNFVTAVNGISTPNLDTFVKEVSKIPDN
                     TYFRLRAVTFDNVPWVVTMKKNDHYFPMSEYIKDPSTPSGWRTVSHDKHKHKDGIAPD
                     SSNLNPDAMDEGLEDVSDIEPDE"
     gene            complement(<331308..>332370)
                     /gene="GRE2_1"
                     /locus_tag="ACHE_10116A"
                     /db_xref="GeneID:66977073"
     mRNA            complement(join(<331308..331574,331651..332239,
                     332297..>332370))
                     /gene="GRE2_1"
                     /locus_tag="ACHE_10116A"
                     /product="methylglyoxal reductase (NADPH-dependent) gre2"
                     /transcript_id="XM_043275698.1"
                     /db_xref="GeneID:66977073"
     CDS             complement(join(331308..331574,331651..332239,
                     332297..332370))
                     /gene="GRE2_1"
                     /locus_tag="ACHE_10116A"
                     /note="COG:V;
                     EggNog:ENOG410PJT2;
                     InterPro:IPR001509,IPR036291;
                     PFAM:PF01073,PF16363,PF13460,PF07993,PF01370;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="methylglyoxal reductase (NADPH-dependent) gre2"
                     /protein_id="XP_043131236.1"
                     /db_xref="GeneID:66977073"
                     /translation="MARVLLTGGTGFIGAHILNELLARGHTVLAAVRSQLKGQQLLCR
                     YTPDVAKRISTIIVEDITKEGAFDQALQAAPLDVVIHCASPFYYRPNNPEEDMLRPAI
                     RGTVGILESVKKRAPSVKRVIITSSFAAIINFNSHPPVYSEKVWNPVTYEQALNPALS
                     YPGSKKLAEEAAWAFMRDEQPSFALTTICPPLVYGPVANRLDSLDNINTSQLPHPGYH
                     PRQAIDIPEAANERFLVTAGHYDNKVIVEIIREEFPQLKERLPSRDLAGDLPTDVYKF
                     DNSKSVNLLGVNYQSLRVSVRDTVATLLEQGNV"
     gene            <332652..>333710
                     /locus_tag="ACHE_10117S"
                     /db_xref="GeneID:66977074"
     mRNA            <332652..>333710
                     /locus_tag="ACHE_10117S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275709.1"
                     /db_xref="GeneID:66977074"
     CDS             332652..333710
                     /locus_tag="ACHE_10117S"
                     /note="COG:C;
                     EggNog:ENOG410PMCP;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131237.1"
                     /db_xref="GeneID:66977074"
                     /translation="MAAQKAVVITAPNQATVVSNRSLPKLRHDCILVKTVSVALNPTD
                     WKSIEHRSATGVLVGCDYAGIVEEVGKGVNKTFKPGDRVCGFVHGCNAVQPEDGAFAE
                     YIVAIGDLQLRIPDHVSFQEATTLGLGAVTVGQGLYQSLKMGFPTPTPTPRPNETTPI
                     LIYGGSTATGTLAIQLAKLSGYKVLTTCSPHNFDLVRGLGADAVFNYHDPDSATAIKE
                     HTQNRLKLVFDTVSTESSAEYCERVLSTEGGDYSTLLPITIERENVNSRLTVAYTAFG
                     KGFKFGDRDIPASSVDREFADNFYATVERLLGEGKLRAHPPRVCLGGLNGVLEGLRLM
                     KEGKISGEKLVYNVAETL"
     gene            complement(<333753..>334703)
                     /locus_tag="ACHE_10118A"
                     /db_xref="GeneID:66977075"
     mRNA            complement(<333753..>334703)
                     /locus_tag="ACHE_10118A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275720.1"
                     /db_xref="GeneID:66977075"
     CDS             complement(333753..334703)
                     /locus_tag="ACHE_10118A"
                     /note="COG:S;
                     EggNog:ENOG410PUHW;
                     InterPro:IPR000073,IPR029058;
                     PFAM:PF12697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131238.1"
                     /db_xref="GeneID:66977075"
                     /translation="MQPFKLNLPNGAQLTGIHNIPPCSSSLLKYRPLIVGLHGSTYDC
                     QYFDANASHSASITSSALGIPFVAIDRPGFGGTTSLPPTPAISSFFQETGSWLHHYTL
                     PALWTEFGVPNECNCIALLCHSLGAMGGIVAAALHSQDTKQNRTSLYPLGGIIVSGIG
                     EQLLPEMKENPVPYDLHHLPTHVTFPLEMKDSLMFRPGTADPGILTKSEQLNSPTPFG
                     EIDSLRTGWVGRWQKEWACFVVAPVMFGIAEHDCFFESGQAHLRECIGAFENSGRVDG
                     SVIKGAPHCMELSYWSQGWYARCFGFAVECAVSLEADKGS"
     gene            <335003..>335459
                     /locus_tag="ACHE_10119S"
                     /db_xref="GeneID:66977076"
     mRNA            join(<335003..335036,335161..>335459)
                     /locus_tag="ACHE_10119S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275731.1"
                     /db_xref="GeneID:66977076"
     CDS             join(335003..335036,335161..335459)
                     /locus_tag="ACHE_10119S"
                     /note="COG:C;
                     EggNog:ENOG410PFYI;
                     InterPro:IPR015590,IPR016161,IPR016162;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131239.1"
                     /db_xref="GeneID:66977076"
                     /translation="MAFHTWNQNTVRQIHNAVTPSNDQPNPRVPLSSKHDLDTAVDAA
                     RRAFTTVDERKCRIRPFLCDLEINKDALAELLSLEQGKPLSQAKTEIQRTKDLVRNMI
                     EVDIPARN"
     gene            <337163..>337761
                     /locus_tag="ACHE_10120S"
                     /db_xref="GeneID:66977077"
     mRNA            join(<337163..337316,337367..337650,337747..>337761)
                     /locus_tag="ACHE_10120S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275743.1"
                     /db_xref="GeneID:66977077"
     CDS             join(337163..337316,337367..337650,337747..337761)
                     /locus_tag="ACHE_10120S"
                     /note="COG:O;
                     EggNog:ENOG410Q5DC;
                     InterPro:IPR001841,IPR013083;
                     PFAM:PF12861,PF00097,PF13639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131240.1"
                     /db_xref="GeneID:66977077"
                     /translation="MHPFSSVVSTIYTMSDPDVYVPSKTEKGPLHARDVEQARMPCFL
                     GLDYPEDNGQFPETCPLCFDDMTHDSIFRRLPCNHLIHKQCIDKWLCTKDGSCPFCRE
                     TFYHLRRPIVVRKSLPEPIDDEDKDELEIGRAAFVLWWKKMLCLKECP"
     gene            <339495..>339761
                     /locus_tag="ACHE_10121S"
                     /db_xref="GeneID:66977078"
     mRNA            <339495..>339761
                     /locus_tag="ACHE_10121S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275754.1"
                     /db_xref="GeneID:66977078"
     CDS             339495..339761
                     /locus_tag="ACHE_10121S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131241.1"
                     /db_xref="GeneID:66977078"
                     /translation="MQEFDPTSIFIATFPHMAEQGDRTEKEFEWHSVGCGDSLNCKVQ
                     NASHQAIVTYINGQQDIRIPHLQVLKEMEPVGMSQWMNMESLNE"
     gene            <340655..>341698
                     /locus_tag="ACHE_10122S"
                     /db_xref="GeneID:66977079"
     mRNA            join(<340655..341202,341272..>341698)
                     /locus_tag="ACHE_10122S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275765.1"
                     /db_xref="GeneID:66977079"
     CDS             join(340655..341202,341272..341698)
                     /locus_tag="ACHE_10122S"
                     /note="COG:S;
                     EggNog:ENOG410PZ3X;
                     InterPro:IPR036875,IPR001878;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131242.1"
                     /db_xref="GeneID:66977079"
                     /translation="MPTYEAPTISDHEESALSAEPETTDSQETPSTMSQSNDSNSVHQ
                     RPRQILPDPEVFKGDIASYQNFKHLLKAKLHVDRKALGGPYECLWYAYGRLSGNAASH
                     ILPWMIANADSPTMVNDDTVTKLFEHLDFNYMDKELQRKAMYNLSTLKQGNKTINELL
                     ATFDRYLMEAGQQNQPDNMKIFCEYCVQLQGIYDRHQKYQQRSAEHRRPPNRRTTTPM
                     FPPPATSPTATSTQGDPMDWEPTISRARNPQRKRARWVSGKEIERRKQEGCCFRCGSA
                     GHQISQCPFLPAQRPTPRVAEFTAEDVTDAVLDDTQATPVPDVPSGKA"
     gene            complement(<346105..>350130)
                     /locus_tag="ACHE_10123A"
                     /db_xref="GeneID:66977080"
     mRNA            complement(join(<346105..348030,348084..348115,
                     348545..349647,349712..>350130))
                     /locus_tag="ACHE_10123A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275776.1"
                     /db_xref="GeneID:66977080"
     CDS             complement(join(346105..348030,348084..348115,
                     348545..349647,349712..350130))
                     /locus_tag="ACHE_10123A"
                     /note="COG:S;
                     EggNog:ENOG410QEFM;
                     InterPro:IPR015943,IPR036322,IPR027417,IPR007111,
                     IPR018391,IPR031348,IPR019775,IPR001680,IPR020472,
                     IPR017986;
                     PFAM:PF05729,PF00400,PF17111;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131243.1"
                     /db_xref="GeneID:66977080"
                     /translation="MDPLSGAASVIAVVQLAAAITQICGTYLNKVKDAKRDIQRFQKE
                     VIALSCVLQSLHELLHGPNSAKITAAEDLVNNITTCSSTLTKLKEKIEPETMQRRMRR
                     WGLRAFKWPLNRSEVDDAISEIERYKTMFNLSLLVDQMTSTNRIDQKIGLGRLQIAKG
                     AAFDSYDNQHAECLLGTRVDLLQEVEDWAKSPDGKCIFWLNGMAGTGKSTISRTAAGC
                     LKQQHLLGASFFFKRGEEDRGTAKKFFPTLVEQLVTSIPHMLPKVQEAIEDDPHISDK
                     VLREQFEKLLLEPLLRIEQSEGMKTRVIVIDALDECDSEDDMRVILRLLPRVQKSTSM
                     RLRFLLTSRPELPIRLGFTEITDTHHELALHEIPTPVIEHDISLYFEDQFFHLRQDRS
                     FPPDWPGDTTVKILIERAIPLFIAAATLCRFIGDPKWNPKKRLEAILTDQSVYVSKMD
                     STYIPVLKQLLTGQDEEESKQILEDFKEIVGAVVNLATPLSINALSQLLDRGRDDLKL
                     TIRRLESLIQGDKYSEISGFLYDARRFVLKNRQIADSAPLQLYSSGLIFAPKGSTIRK
                     QFHSELAAWDRLPQVEENWSAELLTLEGHSKWVQSVAFSTDGLLVSSSHDNGIKLWDP
                     STGDLRQTLKGHSESVQSVAFSPDGQLLASGSNDKTIRLWDASTGDLRQTLEGHSSSI
                     RSVAFSPNGQLLASGSDDTTVRLWDPSMGNLCWILDGHLDTVLSVAFSPDGQLLASGS
                     NDGTLRLWDPCTSDLRQTLKDDFGSVLSVAFSPDGQLLASGSDDMTVRLWDSSTGDLL
                     QILAGHSNWDQSVVFSPDGQLLGYGSTCRGISFWDFGTGEQHNIPEVNPESVLSVTFS
                     PDGQLLASGSDDKTIRLWDLSTGDLRQTLEGHSSSVWSVAFSPNGQLLASSSDDTTVR
                     LWDPTTADLHQTLEVNSESVLSVIFSPDGQLLASGSDDTTVRLWDPSTGDLRQTLKGH
                     SESVQSVAFSPDGQLLASGSDDTTVRLWDLSTGDLRQTLKGHSSSIQSVAFSPNGELL
                     ASGSGDKTIRLWDPNKGDLCQVLEGPSWVWSVAFSSDGQLLASGFDDKIIRLWDLSTG
                     DLRQTLKGHFEPVWSESNIQLSILESQWICFRGRRVLWLPPHYRPTCLAFRAGMVGLG
                     HSSGRVSFISHFA"
     gene            complement(<352743..>352976)
                     /locus_tag="ACHE_10125A"
                     /db_xref="GeneID:66977082"
     mRNA            complement(<352743..>352976)
                     /locus_tag="ACHE_10125A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275787.1"
                     /db_xref="GeneID:66977082"
     CDS             complement(352743..352976)
                     /locus_tag="ACHE_10125A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131244.1"
                     /db_xref="GeneID:66977082"
                     /translation="MAQELATFKREEQESSNELREEIAAIVRDVKVLKSESPYFQRNK
                     HQPDRRLPGEVDDQRSQSRGDNNIVENGEWLLV"
     gene            <353499..>355201
                     /locus_tag="ACHE_10124S"
                     /db_xref="GeneID:66977081"
     mRNA            join(<353499..353758,353805..353832,353883..355048,
                     355096..>355201)
                     /locus_tag="ACHE_10124S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275798.1"
                     /db_xref="GeneID:66977081"
     CDS             join(353499..353758,353805..353832,353883..355048,
                     355096..355201)
                     /locus_tag="ACHE_10124S"
                     /note="COG:E;
                     EggNog:ENOG410PJVE;
                     InterPro:IPR015424,IPR002129,IPR015421,IPR010107;
                     PFAM:PF00282;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004351 - glutamate decarboxylase activity
                     [Evidence IEA];
                     go_function: GO:0016831 - carboxy-lyase activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0006536 - glutamate metabolic process
                     [Evidence IEA];
                     go_process: GO:0019752 - carboxylic acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131245.1"
                     /db_xref="GeneID:66977081"
                     /translation="MVHLAQIKKNQPSDQDAAGRLANIQLDTPVHDGGVRDGDNYASS
                     VYGSRFAIQQMPGLEMPEREMPRDVAYRLIKDELSLDGNPMLNLASFVTTYMEDEVEK
                     LMSESFSKNFIDYEEYPQSAEIQNRCVNMIARMFNAPTTSENEHPMGTSTIGSSEAIM
                     LGTLAMKKAWQNKRKAEGKDTSKPNIVMNSAVQVCWEKAARYFDIEERYVYCTEERYV
                     IDPQQAVDLVDENTIGICAIMGTTYTGEYEDVKGINDLLIERGLDTPIHVDAASGGFV
                     APFVKPDLVWDFRLERVVSINVSGHKYGLVYPGVGWVIWRSPEYLPQELIFNINYLGA
                     EQASFTLNFSKGASQVIGQYYQMIRLGKHGYRSIMLNITRIADYLAAQLEEQGFRIIS
                     QRSGNGLPVVAFRLPADRSGLYDEFALAHQLRERGWIVPAYTMAPNSNQLKLMRVVVR
                     EDFTMGRCQALLTDIQLGMKTLQEMDEKMVDKYTSYIRTNSHKSQHNHPDYKGEKHSL
                     QGQTGKTHGVC"
     gene            <355430..>357674
                     /locus_tag="ACHE_10126S"
                     /db_xref="GeneID:66977083"
     mRNA            join(<355430..356462,356515..>357674)
                     /locus_tag="ACHE_10126S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275809.1"
                     /db_xref="GeneID:66977083"
     CDS             join(355430..356462,356515..357674)
                     /locus_tag="ACHE_10126S"
                     /note="COG:S;
                     EggNog:ENOG410PJ4M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131246.1"
                     /db_xref="GeneID:66977083"
                     /translation="MPFFKRKKHQPEASALTIHSAEQLSTVSFQQNTRSGSSNPDFYR
                     FSDSRSRDLRTDRQQPLHRPSQSHSYSQAQALQEPIPEPATIRRTQTAHLLQDPEPVR
                     PSTISPVSTIQMLTRQRNADHDDRRKLQKHQTTKKPPSTASSPPSSTAKDIPSFLGRT
                     LSKSHRSRPATITTAPRGARRSAPKDDVSLNSQSIPEISTTATDSQQLAAAAREGDTV
                     SIQHRTSTSTADSDKLQVQASKHGSNQTQTQPQSPHQSIRPPSQLSLATSLISAHSDT
                     ASLQAMAADRAGPAGQSNQTGRQSPYLADSKNNSSTSQDQGRSTPGPAQGRREEEGDM
                     RSLVQKHEELLAKYSKVKRYYFEKDAQVQHLQNTVAHQRMAVSRTVLDDNEYANRFGR
                     LDGAIKDLAFSIRKDWKSLPHWLIGYVNDDAHTVGMKEMTAIGRAFISRWLVEEIFHR
                     HFHPSLESTFSQQLKSIENNLRQQHGSKSVITEEDKENAIAKISNWRRTTFDGLGDAQ
                     LHGRTADENRAKLVDHLVTKLVASLEMHLNTPPPVGMDNGARLIVENAVGVAEKIPLE
                     SRDICVEYPLPGSILDDRQMKPETGVPPLTNVKPENVRRPDLESTDPAGQGQSTDTDP
                     TASTDPDSPSSQSPSPTSSPAPGTAGPEKKKTSMLGSLMGKRNTPAAPATQAKESKDD
                     NNNNNNNNNNNGAVVGPTRIRFASFVSAEVRGKGPVNVLAKAPVYALE"
     gene            complement(<357889..>358585)
                     /locus_tag="ACHE_10127A"
                     /db_xref="GeneID:66977084"
     mRNA            complement(join(<357889..358015,358106..358326,
                     358412..>358585))
                     /locus_tag="ACHE_10127A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275820.1"
                     /db_xref="GeneID:66977084"
     CDS             complement(join(357889..358015,358106..358326,
                     358412..358585))
                     /locus_tag="ACHE_10127A"
                     /note="COG:S;
                     EggNog:ENOG410Q02K;
                     TransMembrane:4 (i21-42o54-71i92-110o122-143i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131247.1"
                     /db_xref="GeneID:66977084"
                     /translation="MKMRLPLPLPTPIPTPALKKNLYITIASLILLTFVLIIARIADK
                     GTPSTRTNTWGIAVCIKAALFLLYQTLTTYHHKLRKWASLKANMTLDIIDTVFWFVLF
                     VISIMGAVGGRSASSQALGAVVAGLALVLCGIVGFLSVVCVREYSVWKRGGNANVDVE
                     AGVEGDYKAGDTV"
     gene            <361210..>363188
                     /locus_tag="ACHE_10128S"
                     /db_xref="GeneID:66977085"
     mRNA            join(<361210..361420,361475..361552,361613..361737,
                     361808..361971,362022..362105,362158..362334,
                     362394..362477,362537..362820,362884..362986,
                     363053..>363188)
                     /locus_tag="ACHE_10128S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275831.1"
                     /db_xref="GeneID:66977085"
     CDS             join(361210..361420,361475..361552,361613..361737,
                     361808..361971,362022..362105,362158..362334,
                     362394..362477,362537..362820,362884..362986,
                     363053..363188)
                     /locus_tag="ACHE_10128S"
                     /note="COG:S;
                     EggNog:ENOG410PGQC;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690,PF05978;
                     TransMembrane:8
                     (i88-106o112-131i138-157o211-231i261-281o301-319i331-
                     349o434-455i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131248.1"
                     /db_xref="GeneID:66977085"
                     /translation="MTDTKTASPNVRNEDPASPADTTNHSHGVDMELYRATVPLWKRV
                     WQHSLTQMMILSVQSFCGPAMSDAITGLGGGGLATPQVSNIANAIRYAMLALVCFFGG
                     PIVNKLGVKWALVIGSMSFPIEGSAYYCNSKFGNQWYLILSGAIAGIGTGCWYVAEAG
                     AIMTLAPTGARGKYLALWIVARNLGQLVGGAINLSKNHVKGASASVTPDTYIAFVIIE
                     CIAFPFALMITPFERVVRDDGTQIVMAETLTTKKEVRRIAKTITSKLIVLSALWALWS
                     FFYSGSWSTYLGTYFSVRARALSSLVSPFFCIIGCFGLGFILDMKYLGQRRRAQVGLY
                     TVVILNIGVYIWSIIMQTRFKRHDPGKIDWDDGLYPSSFLPYFFVQTTGPLSQSYMYW
                     LLSSFATDAQENVRNGAAFRCIEAIGQAIAYGMNTQTESDPLTGFCVTFALLGAAILP
                     MIMLVNTTPERIPADVIAEQQNATSRKGDEA"
     gene            complement(<365533..>366706)
                     /locus_tag="ACHE_10129A"
                     /db_xref="GeneID:66977086"
     mRNA            complement(join(<365533..366273,366323..366607,
                     366662..>366706))
                     /locus_tag="ACHE_10129A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275842.1"
                     /db_xref="GeneID:66977086"
     CDS             complement(join(365533..366273,366323..366607,
                     366662..366706))
                     /locus_tag="ACHE_10129A"
                     /note="CAZy:GH109;
                     COG:S;
                     EggNog:ENOG410PVIV;
                     InterPro:IPR004104,IPR000683,IPR036291;
                     PFAM:PF02894,PF01408;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131249.1"
                     /db_xref="GeneID:66977086"
                     /translation="MDRRLKIGVVGLGRMGKRHVHTLLYRTPRAQVVAVCSTTPHEIA
                     WAKENEEYKEFGIEAYGDYNEMLSHPGLQAVWISTSTDVHASQSLAAIEKGVHVLCEK
                     PLSTDLEEAQSVVDAAKSKPSLKVMAGFSRRFDASYRDTSDKIFSQQAIGSPFMVRSN
                     TCDLRDDSGFFVKYASRNGGIFVDCAIHDIDLSLWFLGNPIPKACWAAGTLQHHPELK
                     GLSDVDNAVGIVEFWGGKIAYFYCSRTQAHGHDVCTEITGTDGKVMVNVVPRKNNVVL
                     ADKLGMRHEVQPEYWERFEDAFAREANEFVDAVVNDGPVPVALETGIKVMKIGRGLQQ
                     ALLTGEVVRFDERGEQVQASRL"
     gene            <368034..>369127
                     /locus_tag="ACHE_10130S"
                     /db_xref="GeneID:66977087"
     mRNA            join(<368034..368191,368257..368434,368492..>369127)
                     /locus_tag="ACHE_10130S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275854.1"
                     /db_xref="GeneID:66977087"
     CDS             join(368034..368191,368257..368434,368492..369127)
                     /locus_tag="ACHE_10130S"
                     /note="COG:E;
                     EggNog:ENOG410PVQJ;
                     InterPro:IPR036526,IPR044149,IPR000132,IPR003010;
                     PFAM:PF00795;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131250.1"
                     /db_xref="GeneID:66977087"
                     /translation="MDQKVRVAAVQAEPVWNDLEGGVQKTISIIEEAATNGAQVLGFP
                     EVFIPGYPWSMYAKSPFDNSGFMLEYMQNSMSRDSPQMARICAAVKRASLFVVLGYSE
                     RDKCSMYISQAFISPSGEIIHNRRKIKPTHIERAYWGTGEGDSLQTVIPTPLGKIGAL
                     NCWEHSQPLLRYYEYSQDVDIHVASWPAMWDALGSIKQKGSYQASGTMSRTLSQTMAF
                     EGACCVLVCSQIMTGSNAEMNGVDGWGYPMFPGGGFSQIFGFDGEPLCEVLGAGEEGI
                     LYADVDLRGKLKAKQFLDVVGHYSRPDLLSLRADTRASRPVHYANEP"
     gene            <370420..>371910
                     /locus_tag="ACHE_10131S"
                     /db_xref="GeneID:66977088"
     mRNA            join(<370420..370648,370711..371117,371188..>371910)
                     /locus_tag="ACHE_10131S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275865.1"
                     /db_xref="GeneID:66977088"
     CDS             join(370420..370648,370711..371117,371188..371910)
                     /locus_tag="ACHE_10131S"
                     /note="COG:L;
                     EggNog:ENOG410PN5C;
                     InterPro:IPR036397,IPR013520,IPR012337;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131251.1"
                     /db_xref="GeneID:66977088"
                     /translation="MSRPRKTTTTTKTDPKKPNPVPTPTPAPVPVAYSDAYFTKMRAF
                     VMTPESLKIEGYKLENLGKDEILGFRRCRDCHARIRTRKSVKKDEKKKAEDGDGDGEG
                     GGGEGNEKRDRRRGKSRKESGEKDKGENAMQEIDGSTVTDEKTDDAENDEDNEDRKDG
                     GVRVTVTVREVTDETGKGEKSEAAGDKQGKEKGGKKRKTAVCQFHTGRVMDKHFTCCQ
                     EHVSTPGCVEMDRHTPVEYAKGELETEWMLYATPTKPMKWWDPRMAVALDCEMGVSIY
                     GEPELVRISLVDFFTGEILIDSLVYPRVRLQHLNTRYSGVTRGMLETARKRKQCIMGG
                     RDAARALVWRYVGRETIVVMHGGQSDMMALRWIHDRVIDTFVVEGWRRSAAAAAAAEA
                     KKSEAEPEKKEGTPGGRSLKHLTETILGAQIQQGRGGHDSVEDAMACRWLADWYVRTG
                     LG"
     gene            <372822..>374628
                     /locus_tag="ACHE_10132S"
                     /db_xref="GeneID:66977089"
     mRNA            join(<372822..373232,373285..>374628)
                     /locus_tag="ACHE_10132S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275876.1"
                     /db_xref="GeneID:66977089"
     CDS             join(372822..373232,373285..374628)
                     /locus_tag="ACHE_10132S"
                     /note="COG:P;
                     EggNog:ENOG410PKN7;
                     InterPro:IPR025863,IPR017785,IPR017850,IPR024607,
                     IPR000917;
                     PFAM:PF12411,PF01663,PF00884;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0008484 - sulfuric ester hydrolase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131252.1"
                     /db_xref="GeneID:66977089"
                     /translation="MAAKKPNILYIMADQMAAPLLAFHDKNSPIKTPNLNRLAEEGVT
                     FDSAYCNSPLCAPSRFVMVTGQLPSKIGAYDNAADLPADTPTYAHYLRREGYHTALAG
                     KMHFCGPDQLHGYEQRLTSDIYPGDYGWSVNWDEPKIRPDWYHNMSSVMEAGPVVRTN
                     QLDFDEEVIYKSQQYLYNHVRQRTDQPFCLTVSMTHPHDPYAMTKEFWDLYEDVDIPL
                     PETPAFDQDQQDPHSQRVLQCIDLWGKEMPEERIKAARRAYYAACTYVDTNVGKLLKV
                     LDDCGLSDDTIIVFTGDHGDMLGERGLWYKMTWFENSARVPFIVHYPKQFAPKRVSQN
                     VSTMDLLPTFVDFVGGELVHELPLDGVSLLPHLTDDHSGPKTDTVLGEYMGEGTQSPV
                     VMIRRGRWKFVYSLIDPPMLFDLESDPHERVNLVAGMTEPSVTPKPAKPTQSAAAALP
                     TPDETPRVSPIPQRNTSSFPFPSPPRTPSPAKLPGPLPDTTDPARLLAYFSEETHARW
                     DLAKIKDDVLRSQRRRRLVYSALIKGTPSIWDYEPRVDPSTTYIRNQGKGALDDVELI
                     SRWPRVLQQAANAMGAAV"
     gene            <375076..>376496
                     /locus_tag="ACHE_10133S"
                     /db_xref="GeneID:66977090"
     mRNA            join(<375076..375590,375691..376080,376133..>376496)
                     /locus_tag="ACHE_10133S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275887.1"
                     /db_xref="GeneID:66977090"
     CDS             join(375076..375590,375691..376080,376133..376496)
                     /locus_tag="ACHE_10133S"
                     /note="COG:E;
                     EggNog:ENOG410PJ40;
                     InterPro:IPR017144,IPR002933,IPR011650,IPR017439,
                     IPR036264;
                     MEROPS:MER0014418;
                     PFAM:PF01546,PF07687;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131253.1"
                     /db_xref="GeneID:66977090"
                     /translation="MTIRSSPTSNEIKTTIDSALDILTPALRTLNHHIYSNPETAYNE
                     HHAHDSICTFLESLPTTHPTLFPDITITRHAYSLPTSFEAIAGTGTGGRMVNFNAEYD
                     ALPGIGHACGHNLITTSSVAGFLGLAALLKKFGGEGRVQLLGTPAEENGGGKARLVEE
                     GAYEGVAGSLMAHPGPKELYPGIISDGIAGPLMNARKELHVTFTGVTAHAGGNPWDGV
                     NALDALVSAYNNVSVLRQQIKPDERIHCAFLETPEAANVVPGRTRAYWQVRSPSLKGL
                     NALLGRVRGCIEAGGLATGCEVEIVEKELYADIKSNSPLCALYKTHMESYNHTVLHSH
                     PSNQVLTGSSDIGNVSYIVPTLHAMFAIPAEEGVFMHHPRFAEAAGTEGAFGEAVTVG
                     RVLGLVGWAVLRDGGFYEGVKGAWEEAVRE"
     gene            complement(<378149..>379034)
                     /locus_tag="ACHE_10134A"
                     /db_xref="GeneID:66977091"
     mRNA            complement(join(<378149..378689,378748..>379034))
                     /locus_tag="ACHE_10134A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275898.1"
                     /db_xref="GeneID:66977091"
     CDS             complement(join(378149..378689,378748..379034))
                     /locus_tag="ACHE_10134A"
                     /note="COG:S;
                     EggNog:ENOG410PK2V;
                     InterPro:IPR000791;
                     PFAM:PF01184;
                     TransMembrane:6
                     (i70-91o111-130i142-161o173-195i202-225o237-259i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131254.1"
                     /db_xref="GeneID:66977091"
                     /translation="MADNPGPSSPPNIPSPSTNIPPGPDSQIPAELKEQNRGQQAYGP
                     ANLHPTQSSRHGALVSQVPAPQYMKLANPGPLGLLSFALTTFALGLYECGAGLPHSNP
                     QGNVGPNQAIFGLAVFFGGTAQLIAGILEFRVGNTFGSTVHCSYGAFWLSYAMFLLPY
                     LGIEAAYKGDHRAYTFALGIFLILWCFLTLLFLIAALRTNAAILLVFFFLTLAFFFLS
                     LANFLATEHPTASLRTNKAGGAFTVICAFFAFYASASGLMLPETTFVRFPLGEIPVG"
     gene            <379780..>380205
                     /locus_tag="ACHE_10135S"
                     /db_xref="GeneID:66977092"
     mRNA            <379780..>380205
                     /locus_tag="ACHE_10135S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275909.1"
                     /db_xref="GeneID:66977092"
     CDS             379780..380205
                     /locus_tag="ACHE_10135S"
                     /note="COG:J;
                     EggNog:ENOG410PXK1;
                     InterPro:IPR006175,IPR035959;
                     PFAM:PF01042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131255.1"
                     /db_xref="GeneID:66977092"
                     /translation="MPSSKELHATTSPFEDKFGYYRAVRHGSSIFVSGTTAVDPYSPP
                     SAPQIFYPGDARQQTRVARNECIKAVQALGGQGAESVVRVRMFVAHHEDCGPVGEGFR
                     EVLGKDSGEQVGTAATMVVVGGFVDEGMLVEVEVDAVAE"
     gene            complement(<381937..>384245)
                     /locus_tag="ACHE_10136A"
                     /db_xref="GeneID:66977093"
     mRNA            complement(join(<381937..381955,382014..382687,
                     382736..384081,384161..>384245))
                     /locus_tag="ACHE_10136A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275920.1"
                     /db_xref="GeneID:66977093"
     CDS             complement(join(381937..381955,382014..382687,
                     382736..384081,384161..384245))
                     /locus_tag="ACHE_10136A"
                     /note="COG:U;
                     EggNog:ENOG410PI2V;
                     InterPro:IPR004240;
                     PFAM:PF02990;
                     SECRETED:SignalP(1-24);
                     TransMembrane:9
                     (n12-19c24/25o306-327i405-432o438-458i479-499o505-528i567-
                     589o595-620i632-656o668-697i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131256.1"
                     /db_xref="GeneID:66977093"
                     /translation="MALKCFLRPWQWTLWLLLASYCRAFYIPGYSINRYNDGDSIPLL
                     VNKIFSDFTQLQYAYFDLPFVCPPSGRTHGGSPFGSGQSISLNLGEILRGDRIMTSDF
                     ELAMGRNVECQPLCTQEVGRKDVQWGRELIRDGYVAEWIADNLPGATSFVTVDRSRKY
                     YSTGFKLGYQEISPEDGKRRYFLNNHVTIVIRWRQASDGQGKVIVGFEVYPKSITASD
                     HEESGCPKQVHDPHAGFELNIPPNLSKLKEKYPGSSYLPEYDEDLEDGATLKIPYTYS
                     VYFREENGVDWNNRWELYFNNQEEGSTTHWLAILNSLTISGVLGVAVYVIWSRTIQGD
                     IKGRGDGAMDDTKIKLGSSKGKIQGEGLLEQGTDVERDADAGSDDDESIEDVSGWKLL
                     HGDVFRVPEYSGLLAPLVGSGMQLMFVVSGLLLLSCLGILNPSFRGGFVSVGMGLFIF
                     AGLFSGYFSGRLYKTFGGSNWRRNTLITALLFPGLTFSLVFILNLFTWAQASSTAIPF
                     GTLVSLVALWLLIQVPLVYLGNWLGYVRASPWEHPTKTTSIARQVPIQPWYLRSVSGT
                     LLTGLIPFAVLFIELLFLFRNLWQDKSGYYYVFGFLSSVSLILLVTIAEVTIIATYSQ
                     LCAENHHWWWQSFLTGGSSAFWIFAYCIWYYLFKLNVTGFVSGLLFFSYSFLACAVYG
                     LLTGTVGFLTAYAFVKRIYSSVKVD"
     gene            complement(<384973..>386436)
                     /locus_tag="ACHE_10137A"
                     /db_xref="GeneID:66977094"
     mRNA            complement(join(<384973..385917,385975..>386436))
                     /locus_tag="ACHE_10137A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275931.1"
                     /db_xref="GeneID:66977094"
     CDS             complement(join(384973..385917,385975..386436))
                     /locus_tag="ACHE_10137A"
                     /note="BUSCO:EOG09264JQ1;
                     COG:O;
                     EggNog:ENOG410PHFJ;
                     InterPro:IPR009060,IPR006636,IPR015940,IPR000626,
                     IPR029071;
                     PFAM:PF00240,PF11976,PF00627;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131257.1"
                     /db_xref="GeneID:66977094"
                     /translation="MADDSATADETPVTFHIKAAEAKFTLTLPLSTQVSQLKEKLSTS
                     EYADTPADRQRLIYSGRVLKDNETLATYKIKEGHTVHMVKSAASNQRQNPPAPSASTS
                     APTDAAAASTAAGVPTNLAAGTGNNPLAGLTGARYAGFAQLPGAGMFGPDGGMGPPPD
                     EDSMLNMLENPQVQSSLNEALQNPAMIDMMIQQNPMLRDMGPAARQMMQSPEFRRMLT
                     DPGSIRQMMQMQRSLGLGRPGGGGGAFPAPGVTNTTPEENRGPESTQNNDGAAPPPAF
                     NPFMPAGLGAGNPFAALFGTNPNMGANPSAGATTAGGDQPASAQRATGSASAADTTTG
                     EGQNQQNAQNPFSFLMNPAMFGGPQGQGGVNPFNPQQNPFLRDPAMMSQMMQAMGGQG
                     GAGGPDLNSLAALLGGGGLGAAAAPPDNRPPEERYEQQLHQLNEMGFFEFERNVEALR
                     RAGGSVQGAVEYLLSNPS"
     gene            <386959..>391034
                     /gene="RSE1"
                     /locus_tag="ACHE_10138S"
                     /db_xref="GeneID:66977095"
     mRNA            join(<386959..387202,387413..389486,389672..390956,
                     391008..>391034)
                     /gene="RSE1"
                     /locus_tag="ACHE_10138S"
                     /product="pre-mRNA-splicing factor rse1"
                     /transcript_id="XM_043275942.1"
                     /db_xref="GeneID:66977095"
     CDS             join(386959..387202,387413..389486,389672..390956,
                     391008..391034)
                     /gene="RSE1"
                     /locus_tag="ACHE_10138S"
                     /note="BUSCO:EOG092607OQ;
                     COG:A;
                     EggNog:ENOG410PGD2;
                     InterPro:IPR018846,IPR036322,IPR004871,IPR015943;
                     PFAM:PF10433,PF03178;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor rse1"
                     /protein_id="XP_043131258.1"
                     /db_xref="GeneID:66977095"
                     /translation="MATTSHMFMYSLTIQPPTAITQAILGQFAGTKEQQIVTASGSKL
                     TIHRPDPTQGKITPLYTQDVFGIIRTLAAFRLAGSSKDYIIIGSDSGRITIIEYVPSQ
                     NRFSRIHLETFGKSGVRRVVPGQYLVADPKGRACMIASVEKNKLVYVLNRNSQAELTI
                     SSPLEAHKPQTLVFAMVALDVGYENPVFAALEMDYGESDQDPTGQAYEEAEKSLVYYE
                     LDLGLNHVVRKWSDPVDRTANMLFQVPGGADGPSGVLVCGEDNITYRHSNQDAFRVPI
                     PRRSGPTENPERKRTITAGVMHKMRGAFFFLLQSEDGDLFKVTIDMVEDDNGQLTGEV
                     KRLKIKYFDTVPLASHLLILKSGFLYVASESGNHQFYQFEKLGDDDEEMEFTSDSFPA
                     DPTIPYEPVYFNLRGAENLNLVDSINSLNPLIDSKVINMFEDDAPQIYAVCGTGGHSS
                     FRTLKHGLEVSEIVESELPSVPSAVWTTKLTRTDEFDAYIILSFANGTLVLSIGETVE
                     EVTDTGFLSTAPTLAVQQLGEDSLIQIHPRGIRHILADRRVNEWPAPQHRSIVAAATN
                     ERQVAVALSSGEIVYFEMDVDGTLAEYDERRQMSGTVTALSLGEVPEGRVRSSFLAVG
                     CDDSTVRILSLDPDSTLENKSVQALTSAPSALNIMSMADSSSGGTTLYLHIGLYSGVY
                     LRTVLDEVTGELSDTRTRFLGVKPVKLFRVSVKGQTAVLALSSRPWLGYSEIQTKGFM
                     LTPLDYVGLEWGWNFSSEQCVEGMVGIQGQNLRIFSIERLDNNMLQESIPLTYTPRRF
                     LKHPEQPLFYVIESDNNTLAAATKQRLVEDAQSRDADVSVPPPEDFGHPRATGHWASC
                     VQVVDPVVTKSVISSIDLEDNEAAVSIAAVPFTSQDDETFLVVGTAKDMSVSPPSSSG
                     GYIHIYRFQEDGRELEFIHKTKVEEPPLALLSFQGRLAAGIGPVLRIYDLGMKQLLRK
                     CQAPVVPKMIVDLQTQGSRIVVSDIRESVTYVVYKYQENVLIPFVDDSVPRWTTATTM
                     VDYETTAGGDKFGNIWLVRCPRKTSDESDEDGSGAHLLHERGYLHGTANRLELMVHVY
                     SQDIPTSLQRSQLVAGGRDILVWTGFQGTIGMLVPFISREDVDFFQSLEMQLAAQDAP
                     LAGRDHLIYRSYYAPAKGVIDGDLCERYFLLPNDMKMMIAAELDRSVREIERKISDMR
                     TRVAY"
     gene            <392198..>393715
                     /locus_tag="ACHE_10139S"
                     /db_xref="GeneID:66977096"
     mRNA            join(<392198..392363,392430..>393715)
                     /locus_tag="ACHE_10139S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275953.1"
                     /db_xref="GeneID:66977096"
     CDS             join(392198..392363,392430..393715)
                     /locus_tag="ACHE_10139S"
                     /note="COG:S;
                     EggNog:ENOG410PJ77;
                     InterPro:IPR022794,IPR014752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131259.1"
                     /db_xref="GeneID:66977096"
                     /translation="MVNLDLRRRPKIQIALKNQQPNLVNTYTTGDRIDGAATITVDHD
                     IPFDNLDITFEGTSRTTVERASVPGQSGAHQTFLKLRQPIDHYPSPRILQPGHTYVFP
                     FTFVVPDRLLPQACNHPKDHGHLEHAHTLLPPTLGDTMVTLRNGKSALVDDLCPEMCR
                     VAYFIRTAVLKKDGSGKRKVLGSGTQKVRITPVVEEQPPLNIPDHEVDGYCVRKEKDL
                     RRGWTRAKRGRLVVSTAQPKPLVSNHGGEESVNSVATLDLRFEPVTEDEAPPQLGTVW
                     TKVTASTFYGAQPWRDFPAGIRASSWAQLGRGVYIESVPLSTRCVASASWTKHSRRDS
                     FSSSSSTSSASTASTSASSTTGSYYTASVIIPITPPTSKTLVPTFHSCLLSRTYSLDL
                     SISYHAPHTSRLLGSAVSLKVPIQVTCSPQNIPAKNAAEVVNVSEMDVDVEAFFTPRD
                     VTGLAVAPPAYGDYRPRVVGAGTEESQRRSVCV"
     gene            complement(<394241..>396819)
                     /locus_tag="ACHE_10140A"
                     /db_xref="GeneID:66977097"
     mRNA            complement(join(<394241..394453,394518..395080,
                     395144..395633,395678..395728,395775..395961,
                     396021..396204,396259..396445,396492..396549,
                     396599..396662,396714..>396819))
                     /locus_tag="ACHE_10140A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275965.1"
                     /db_xref="GeneID:66977097"
     CDS             complement(join(394241..394453,394518..395080,
                     395144..395633,395678..395728,395775..395961,
                     396021..396204,396259..396445,396492..396549,
                     396599..396662,396714..396819))
                     /locus_tag="ACHE_10140A"
                     /note="COG:P;
                     EggNog:ENOG410PHHN;
                     InterPro:IPR001734,IPR038377,IPR031155;
                     PFAM:PF00474;
                     TransMembrane:15
                     (o20-44i65-92o98-120i141-159o165-194i201-220o300-325i346-
                     371o377-397i409-431o437-459i466-485o505-525i600-619o631-
                     656i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0015204 - urea transmembrane transporter
                     activity [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA];
                     go_process: GO:0071918 - urea transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131260.1"
                     /db_xref="GeneID:66977097"
                     /translation="MTGLQARAGGASITPPLPQAAGYVVVVVLGLVVAVVMMYVTKIL
                     KNTTGEDNKKTEMFMTANRTVRTGLTASAVISSWLWTTAILGSCFTGYDYGVSGPFWF
                     AAGCSPMIVFFALLGISCKRKIPEAHTSLELVRIRYGKIAHAVFMILCLVNNIFASAN
                     MLLGAAAVIAAVSGMHIIAATFLIPVGVTVYTFVGGIKATFLTDYFHTVIILAICCYF
                     SVKAFTNDQVGSVGDLFDLIQKAGQAHPVSGNSQGSYLTMTSKSGILFGILHTCSNFG
                     LVIMDTSYFIKSFSATPRAVVPGYAIGGILYFAIPWGLGTVMSSLAIGLESHPSFPTY
                     PRRMTSSEVSGGLVLPYAAIAIAGKGGATAVLLMTFMAVTSTLSAQVIAVSSILSFDV
                     YRLYFKKGASDRDIIRASHLGVIFFAAFAAGFSTMLHYVGIDLGWTLYMLGVVTCPGV
                     FPMVFTVLWKHQSKAAAILSPILGIATGIAVWLGTAHHFYGSVSVSATGGLLPCVYGT
                     VASAFSPILYSVLITLVKPQNYDWSNFRQEKLALEKVESDLTNVHHGENDSPSVAREQ
                     ENRVEVEQHRNEEDGAQPAPQASTAKELKRWTRIAAFWSAATFLGHWVIWPLPMYGSK
                     YVFEKKFYYAWVIVAIIWLWITMLVTTFYPILDGGWQQIREVYNGWKNNKRAAIDGTV
                     PASPPSPEEVEVEGKETK"
     gene            <397752..>399458
                     /locus_tag="ACHE_10141S"
                     /db_xref="GeneID:66977098"
     mRNA            join(<397752..397959,398013..398236,398282..398341,
                     398391..398947,399005..399182,399240..>399458)
                     /locus_tag="ACHE_10141S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275976.1"
                     /db_xref="GeneID:66977098"
     CDS             join(397752..397959,398013..398236,398282..398341,
                     398391..398947,399005..399182,399240..399458)
                     /locus_tag="ACHE_10141S"
                     /note="COG:C;
                     EggNog:ENOG410PGED;
                     InterPro:IPR011251,IPR016215,IPR036661;
                     PFAM:PF00296;
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131261.1"
                     /db_xref="GeneID:66977098"
                     /translation="MTANETPANGRKSLILNAFVEMCSGHQSPGLWQHPEDESWRFND
                     VDHWVELAKLLESAKFHGIFIADVLGGYDVYKGPRNLEPAIVSGAQWPVNEPLAVVPA
                     MAAATQNIGFGVTVTTTYEPPYHLARRLSTVDHLTKGRVGWNVVTGYLDSAARNMGYA
                     HQPNHDDRYAVAEEYIKVAYKLWESSWRSDAVVLDRQRGIYAEPSRIREINHVGKYFE
                     VPGPHLCQPSPQRTPLILQAGTSKAGKTFAAQHAEAIFVGGHSPSVVKKNIAEIREMA
                     KTQFGRDPASIKFLALLCPILGKTEEEAKEKFAYYRSLGSIDGALALFGGWTGIDLDT
                     YGDNQELRTVESNAIRSAVEGWSKATPEVPKWTKKTVGEHITVGGLGATAVGTPQQVA
                     DQMEKWVDEADVDGFNIAYAVKPGTFKDVIDLLIPELRRRGLFHEDYAVPKGTYRENV
                     YRKKGQSGPPADHPASKYRWDAGVEEHKIPE"
     gene            complement(<399676..>405202)
                     /gene="UTP10"
                     /locus_tag="ACHE_10142A"
                     /db_xref="GeneID:66977099"
     mRNA            complement(join(<399676..400121,400173..404758,
                     404826..>405202))
                     /gene="UTP10"
                     /locus_tag="ACHE_10142A"
                     /product="snoRNA-binding rRNA-processing protein utp10"
                     /transcript_id="XM_043275987.1"
                     /db_xref="GeneID:66977099"
     CDS             complement(join(399676..400121,400173..404758,
                     404826..405202))
                     /gene="UTP10"
                     /locus_tag="ACHE_10142A"
                     /note="BUSCO:EOG0926051U;
                     COG:J;
                     EggNog:ENOG410PFH1;
                     InterPro:IPR016024,IPR040191,IPR012954,IPR022125;
                     PFAM:PF08146,PF12397;
                     TransMembrane:2 (n2-9c14/15o946-962i1408-1429o)"
                     /codon_start=1
                     /product="snoRNA-binding rRNA-processing protein utp10"
                     /protein_id="XP_043131262.1"
                     /db_xref="GeneID:66977099"
                     /translation="MASSLAAQLSQIAAKSTNQLNLKAQRIAHSQSLIFDRKVAGSQD
                     FDTVFEICYEGFQELCQLDSRYTAFERTIFSEQSKAEDRTEMTAAQNQELDTVIEAFL
                     ALVGGRLLLSPAVKAMDWLIRRFRVHEYNTGAVILTFLPYHTTPLFLNLLSILPETLP
                     PTFKVLNPYKRGMINPPRHPLVHSATTNRAFLTDLSNYVLQTSRIRAHHHALLSFWAG
                     IMTEAVAGMLDAARSGRRGVEKEKHEDIILRVLPVLNDAFTMKDVSELVIGCYMVTVV
                     LAQKAALQDEVLDTLMEAVVGSWTKETMNSGLVCVAVLAQQKSNTTIPKKVFKEILRL
                     DKPVKELAEIRTQYPSSNLLLGVVAKCVEDLTKQKDSARLDMLSVIFQNQLLEESDMS
                     KGMSMVLHAASNAHKDGAMPLDIQTRLSDIVQVFGQSESLQPIFQRAIAESNLDKTAL
                     EHNLQTVIESAPEPKAIEDVEMGDAEEEQDNFTPALESLSKESSDGASFLSAQSVPLF
                     DALVQTFALAAGSPEKLDSFTNLPVLDRSNATKSPRFLSFFARVFTGPYPIGTKVAAL
                     STVSSVLESASDLDWQALLPFLLIALADPSERIRRDTAGVLAIAGGASKKGKKDDGKI
                     WAQDSIYGQNKSKSIQWIAGRDMQKIFERAFLPGLEEYVLDPGHVSKVFESTLRSTGK
                     ESGASDLKKPVRLSLFTFLCSHAVNVPLFAPKVALLKLLNNIDRAGGTTRTKELQPVL
                     EMWRDLNETDAKRICEKERLAVSEVEEQIILTVTPKEKDAVTLLLSYVTTGSESPRTS
                     LVVAIFNRMKDIWSRIPEDRQFEAAEKLFEISLGLSAAEKSLASYCRDVLRSVGLSGG
                     ILLNFLHQIPVSLTDVESLGPAPKRRRTSQSNMVAMTVKDEAGLSKLMDKMTFILELV
                     DSSTPEAHPELADGLFQTIAALLQFKSQIQSGMSYLLSLALGSLLAIVNRSRQSGKPQ
                     FDTSVIRADLVVDCVRTTESPQVQNAALLLVAGLSSIAPELVLHSVMPIFTFMGSSVL
                     RKDDEYSVSVIDQTIDQVVPALIQSLRNQKRDVVSGTSELLLSFTAAFEHIPSHRRLR
                     LFHALITKLGTQDFLFAVLAMLANRYAADKDVLTLMTGLVSDATPTVELTTYSKYLNL
                     VTDSLSSKPSISQVLLGIGGDDGREPPKVAVDLLRDLSYLFKHSSLKVKMAKTFASEE
                     DNAPAQIRGLFSRILEQTLSIGDSAQNMKPVSQAGGDVLGALFGTLSLIDFLDTIQVL
                     LERPSDDLRRKVLQLLEGRLRQNPERDGASQTRMLDFLPTLVRIIESSPDTLLKHAAV
                     SCVDRITDKYGRKDPSKVIDAARVVASGACIGQEDGRIRIMGVLCLASMAEVLGEAMI
                     PALPETLTRSLALLESSLEEGKENLRLHDAVFSLFSALFVHLPFMISASHLDKVFLLS
                     FKSAEAGIEESSDESRQEALRLMARKVDVAATFGAIDRNWSQAVAAGPDATRETLESL
                     SLAIEKHPKSAIMKNLPVLSNVLFKAFDLRREQLTFAGKTSFDLSDLDEIEELLNDLT
                     IKMIYKLNDTTFRPVFTKLLEWATAGLSKKDAQGNLARLTTFYKFLQVFFGTLQSIVT
                     GYASYIIENIITVLQTAKPTDKNTKPLWLATMRMLQHAFEHDQDEFWQSPSHLNQIIS
                     PLISQLSHATTPSTATVIATEAIPAITELATAADSTDNHKEINTILMQYLRPSSGLNA
                     KKKAGGENPHTRVAALKAEQALTEALGEEWLALLPEMLPYISELMEDEDEGVEREVRK
                     WVKQIEGVLGEKLDDMLT"
     gene            <405444..>409025
                     /locus_tag="ACHE_10143S"
                     /db_xref="GeneID:66977100"
     mRNA            join(<405444..405458,405518..407968,408018..>409025)
                     /locus_tag="ACHE_10143S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043275998.1"
                     /db_xref="GeneID:66977100"
     CDS             join(405444..405458,405518..407968,408018..409025)
                     /locus_tag="ACHE_10143S"
                     /note="COG:S;
                     EggNog:ENOG410PHZK;
                     InterPro:IPR013633,IPR011990;
                     PFAM:PF08424;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131263.1"
                     /db_xref="GeneID:66977100"
                     /translation="MDFGQEKKPIPRFASFKFPQAPPPEADRSSERHNRESARRTERS
                     RHHSSRHRSHLERSRSRERRREQREHRHSHRRDGHRGDVASEPQTDSQPVVKENKDED
                     TDLFVIDRKGDRYNLVYGTIHRYNVPHYRRFGRGGVLGLPRNHRIDRDTSEGSALVIR
                     TTAEFADSGKLKSKNILAGLRKQKGKLLRVRPQPISESTADEQDYLSLNISSHRGDRD
                     HLREVESDDEKFAYRSIHGKAKPEDHIPSEVEAVSDTDSDGEGFRVDLNDEIKQTNAE
                     LTRKTQENPTDVGAWLRLIDHQSAVLSGAEESRPLTYAERIGLADIKMSLYEKGLKQI
                     GQNSGRERLLLGLLEEGAKLWDTKELLQRWQTTLKANSQFISLWVRYLDFRQTQFLDF
                     TYERCLATFIECLKLNKSSPDGPEKVYVQNYLFLRMTLFMRESGFAEHAVALWQAILE
                     LTFFQPEGSNVHTDREKVLSEFMEFWESEVTRIGEPGARGWKSGSSASIDPKGPSTTE
                     SVSQKSVFKSWAVSERERIGKARLPARSLDELDDDDPYRVIISSDLWEILSIFWDPTT
                     PHIAEVLLDSFLYFCHLPPFTSPSNVQTTKRWVGDNFLRNEFMSGVESRLEDWFPRET
                     NTDSSTAAPFSFPHTNFIQTIDTLFGNQQTWFSSFDSWVKAAVNTQSDIDPDWVRRAL
                     RLLVEINPAKDDLAEYALGLEFACNNKEAKKFAKSLLKKRSSNLRLYNAYAVMECRSG
                     NTSAAEHVWATTLSMSKSFSDQDRVDNGLLWRTWIWECLEAHDNARASHLLLALPQQG
                     VHLKSLAEVPLLTFGATNLLKMHNFLSDAQEHALAARKANVYVAYTDCLTILSYLTHS
                     LDLEKSLEPYNVAFIRLSTLPANDSSFKSFTLELLHQSRAKLLYHHIRQGNAYKPSHI
                     RSLLTESIMLHPHNTIFLSLFAWNESRNRIEERVRGVIRDITTIATTQATKHDNILNT
                     QVPITSHLFSIYTELNRPVYAGSTLHSVRAAFEKAIADPTSDSSNPDRPTNTSNTGAH
                     SNLTLWKLYILFELSRDNINRAKAIFYRALRACPWSKELVMLAFTHLRADVVKHHRTS
                     MGGKAKVKEEGMGFEELRRVYNVLVEKELRVHVDIEGVLDEIVARKEEGVVNLPIDMP
                     EDATSDEEMQV"
     gene            complement(<409176..>411006)
                     /locus_tag="ACHE_10144A"
                     /db_xref="GeneID:66977101"
     mRNA            complement(join(<409176..410080,410135..410544,
                     410593..410847,410897..>411006))
                     /locus_tag="ACHE_10144A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276009.1"
                     /db_xref="GeneID:66977101"
     CDS             complement(join(409176..410080,410135..410544,
                     410593..410847,410897..411006))
                     /locus_tag="ACHE_10144A"
                     /note="COG:P,Q;
                     EggNog:ENOG410PFUK;
                     InterPro:IPR017938,IPR017927,IPR013130,IPR013121,
                     IPR039261,IPR013112;
                     PFAM:PF08022,PF01794,PF08030;
                     TransMembrane:5 (i19-41o61-82i103-121o141-163i175-193o);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131264.1"
                     /db_xref="GeneID:66977101"
                     /translation="MAVTTEQPFWGTHFTSAKLLFYSLFWSVHIALLPAGWYIQASDS
                     RLSALNTLRYSVWISRGSALVLSLDATLIMLPMCRNILKHIRPRIRWMPLDESIWFHR
                     QVAYAMLLFTVIHVAAHYVNFFHVEKHQIRPETAVEIHFTQAGGITGHVMLICMMLMY
                     TTAHHKIRQQSFETFWYMHHLFVPFLLALYTHATGCFVRDTKNPVSPFAGQKFWNHCL
                     GYEGWRWELVGGGLYILERLYREIRSRRETEITKVIRHPYDAMEIQFRKPSMNYKAGQ
                     WLFLQVPEVSSTQWHPFTITSCPFDPYISVHIRQVGDFTRSLGDALGCGPAQAKDLEG
                     LDPMGMYEVALQNGQSMPRLRIDGPYGAPAEDVFENEIAVLIGTGIGVTPWASILKNI
                     WHLRSAPNPPRRLRRVEFIWVCKDTSSFEWFQALLSSLESQSATAAAHQGSAEFLRIH
                     TYLTQHLDDDTAANIYLNSVGQGLDPLTELRSRTNFGRPDFERLFTAMRDGIVDQTYM
                     SGLSGNGKGGGGSTDIGVYFCGPNMAAREIREAARGCSSREVKFKFWKEHF"
     gene            <413301..>413771
                     /locus_tag="ACHE_10145S"
                     /db_xref="GeneID:66977102"
     mRNA            join(<413301..413358,413422..>413771)
                     /locus_tag="ACHE_10145S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276020.1"
                     /db_xref="GeneID:66977102"
     CDS             join(413301..413358,413422..413771)
                     /locus_tag="ACHE_10145S"
                     /note="COG:S;
                     EggNog:ENOG410PP7I;
                     TransMembrane:3 (n12-23c28/29o52-71i83-101o107-133i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131265.1"
                     /db_xref="GeneID:66977102"
                     /translation="MGRLIKNHWARLIILTAAAFQIGSAVEGFIWPKILWDFMTKNLN
                     GAVKPAPILQILNLLMGLLGLAWEWPLKFVAGTFPHRSIETRLVVYPLSAMFAALLYQ
                     GTHPALYYLVGMGVYFWAYTEGEVCISSWFLDC"
     gene            <417585..>418673
                     /locus_tag="ACHE_10146S"
                     /db_xref="GeneID:66977103"
     mRNA            <417585..>418673
                     /locus_tag="ACHE_10146S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276031.1"
                     /db_xref="GeneID:66977103"
     CDS             417585..418673
                     /locus_tag="ACHE_10146S"
                     /note="COG:L;
                     EggNog:ENOG410PVGU;
                     InterPro:IPR015637,IPR036895,IPR005122;
                     PFAM:PF03167;
                     go_function: GO:0019104 - DNA N-glycosylase activity
                     [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131266.1"
                     /db_xref="GeneID:66977103"
                     /translation="MTVDAQTGHRNEKHGDNDVPVNKITSFNGRLNQYFHNTKNVVAS
                     NGSSTVKDTLKRDSSSQEQSENDLLDNDNGSDGSSRSKRRKGPRLATATPTPEESPAR
                     ITRSRSASLLQTQSPQTFPITRSQSTTTVATTTTTKRGRGSRTASQTSASRSLLRDTI
                     PRNLTLLLVGVNPGILTGTTGHAYAHPSNLFWKLLHWSRITDIRHPPSDTYRLPELYN
                     IGNTNIVERPTRDASMLSRAEMDAGVPVLEAKVADKKPEVVCLVGKSIWEAVWRVKHG
                     RGIKKEEFKYGWQGQGENMGVCEGWGGARVFVATTTSGLAAGMSIGEKRAVWEELGSW
                     VVRKREEGKQGRIVTGVGEEGCEFYSTD"
     gene            complement(<419192..>420223)
                     /gene="GSP1"
                     /locus_tag="ACHE_10147A"
                     /db_xref="GeneID:66977104"
     mRNA            complement(join(<419192..419323,419376..419581,
                     419634..419787,419871..419963,420155..>420223))
                     /gene="GSP1"
                     /locus_tag="ACHE_10147A"
                     /product="GTP-binding nuclear protein gsp1/Ran"
                     /transcript_id="XM_043276042.1"
                     /db_xref="GeneID:66977104"
     CDS             complement(join(419192..419323,419376..419581,
                     419634..419787,419871..419963,420155..420223))
                     /gene="GSP1"
                     /locus_tag="ACHE_10147A"
                     /note="BUSCO:EOG09264LKR;
                     COG:U;
                     EggNog:ENOG410PFRI;
                     InterPro:IPR005225,IPR001806,IPR027417,IPR002041;
                     PFAM:PF00025,PF08477,PF00071;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA];
                     go_process: GO:0006913 - nucleocytoplasmic transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="GTP-binding nuclear protein gsp1/Ran"
                     /protein_id="XP_043131267.1"
                     /db_xref="GeneID:66977104"
                     /translation="MAEGAQAPPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLG
                     VEVHPLTFTTNLGTIQFDVWDTAGQEKFGGLRDGYYINGQCGVIMFDVTSRITYKNVP
                     NWHRDLVRVCENIPIVLTGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKP
                     FLWLARKLVGNPQLEFVAAPALAPPEVQVNPELLEQYQKEMADAAQMPLPDEDDADL"
     gene            complement(<420845..>421770)
                     /gene="NAS2"
                     /locus_tag="ACHE_10148A"
                     /db_xref="GeneID:66977105"
     mRNA            complement(join(<420845..420979,421062..421411,
                     421462..421534,421597..>421770))
                     /gene="NAS2"
                     /locus_tag="ACHE_10148A"
                     /product="putative 26S proteasome regulatory subunit"
                     /transcript_id="XM_043276053.1"
                     /db_xref="GeneID:66977105"
     CDS             complement(join(420845..420979,421062..421411,
                     421462..421534,421597..421770))
                     /gene="NAS2"
                     /locus_tag="ACHE_10148A"
                     /note="COG:O;
                     EggNog:ENOG410PGUB;
                     InterPro:IPR041489,IPR035269,IPR001478,IPR036034,
                     IPR040815;
                     PFAM:PF18265,PF17820,PF00595;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0070682 - proteasome regulatory particle
                     assembly [Evidence IEA]"
                     /codon_start=1
                     /product="putative 26S proteasome regulatory subunit"
                     /protein_id="XP_043131268.1"
                     /db_xref="GeneID:66977105"
                     /translation="MGISMEDNIHAPTVSSGDTSGGATPPKSNMFKLSVPDLTLKKEL
                     IEHKLSTLSRVLESHGVNMDTPLTTEDGFPRNDIDIAQIWTTRAQIIHLRNDHKEVMA
                     HIEQRVYEHFKQYEQTHFTSPPAYTTIAATAPRAILLDDATLTAGPAFAKVTSVVSGS
                     PADQAGLEVGDTIKNFAGVNWTNHENLSKIAQVVQKNEGCVMNIKVSRKDESREGQTK
                     DELMQIVPRPGWGGRGLLGCHIVPI"
     gene            <422350..>425079
                     /locus_tag="ACHE_10149S"
                     /db_xref="GeneID:66977106"
     mRNA            join(<422350..422958,423018..423323,423374..423574,
                     423625..423843,423903..424128,424178..>425079)
                     /locus_tag="ACHE_10149S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276064.1"
                     /db_xref="GeneID:66977106"
     CDS             join(422350..422958,423018..423323,423374..423574,
                     423625..423843,423903..424128,424178..425079)
                     /locus_tag="ACHE_10149S"
                     /note="COG:T;
                     EggNog:ENOG410PIJ2;
                     InterPro:IPR000219,IPR035899,IPR011993;
                     PFAM:PF00621;
                     go_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131269.1"
                     /db_xref="GeneID:66977106"
                     /translation="MESDDNDGSQNPLVVIEDTESDANLVDAPEVQEPEPVNTTWSPS
                     TFKKFIDYLRNKKPPRPQTRKYVEGWHDDPPTKPRDNDSRDHSFDHVLSPYHAIQDQQ
                     WEQLSGYSSQLGTVKTNSLSAMSQSAVRSRRTTQSTVNRSSSSERRRSIERRSTDIEG
                     LRPVRSPSIYDDVQRRAVKRRQVIQEILTSESDYVLGLKALTDILSLLETRPAVYHNV
                     QKLREVHEHLLAQLQNVSPPKSATTDAELTNLISGGLSKHSSLRGFRSLQNRSLRTRN
                     LKQKFNLRVKLIAADPTEARDVARVMQNLSTAAGAYVKFCNNKELLKQDISLLRESIS
                     NWALFDQGIEALSRSVTPMESRRPKENRSMTLDDLLIKPIQRFCKYHLMLKQLSDCTP
                     SSDCPSSDHDIRQALGIIRALGDQVNSATGDVAYEGRIRKTIELQKKLGPFQSDTLRD
                     IYKQLGPMVMCGVLHVTYQSGDHIKGTYMVCSLFDHYILLAKYAEESRELQPVACLYV
                     WDLKIDCLRNGKGLSCYECLFSWKLVFHHQNDHYEFVLSASTAAEERQWTSEIVKSTQ
                     KVEPIPEPRKYSVLTLDVEPFEHSNDPLGRKSSVHSLSTSRTNHNSQHVIIERTHHPN
                     SSEVVPPAEGEIERPRVMPPQGALTLVTRRQDRIRLEQFISDEYTRDVLPFPGMALGY
                     QDKRHKKIKGSVHATYTKRSASLSKIVNTPTGTDDHLTNSLSKGMGDIVPQPLQDLFP
                     YDDEKGVVLLEASPEAKLPATLKLGKVSRRTTSATRTASQGSKSYGVLGSPTWKSFGS
                     LFHTISPRRHKRTGSSLSRSDA"
     gene            <425636..>426117
                     /locus_tag="ACHE_10150S"
                     /db_xref="GeneID:66977107"
     mRNA            join(<425636..425799,425876..425999,426058..>426117)
                     /locus_tag="ACHE_10150S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276076.1"
                     /db_xref="GeneID:66977107"
     CDS             join(425636..425799,425876..425999,426058..426117)
                     /locus_tag="ACHE_10150S"
                     /note="COG:S;
                     EggNog:ENOG410PRJB;
                     InterPro:IPR036786,IPR039100,IPR019783;
                     PFAM:PF01172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131270.1"
                     /db_xref="GeneID:66977107"
                     /translation="MTRGNEANSKVFYKGANDDFVVFVDDVAALNNWRNDRSIPLAQV
                     VNGWKIFVTHRHGAQGLLDGASKGLLESEFGTSNEDDVMVKILERGEYQTSVNSAHQA
                     DKNVNKGPSVIGR"
     gene            complement(<427103..>427981)
                     /locus_tag="ACHE_10151A"
                     /db_xref="GeneID:66977108"
     mRNA            complement(join(<427103..427301,427362..427706,
                     427767..>427981))
                     /locus_tag="ACHE_10151A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276087.1"
                     /db_xref="GeneID:66977108"
     CDS             complement(join(427103..427301,427362..427706,
                     427767..427981))
                     /locus_tag="ACHE_10151A"
                     /note="COG:S;
                     EggNog:ENOG410PVGK;
                     InterPro:IPR039020;
                     TransMembrane:7
                     (o36-56i68-84o96-111i123-142o154-174i186-206o218-239i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131271.1"
                     /db_xref="GeneID:66977108"
                     /translation="MAENFALANRVRHLIVQPSDAALDPPESYLFVQDGLIISCGVIY
                     AMCYLFCMIRAYSDRTLPGKDWGSIQFLAGCMAYEFFYAFTTTTTQNEKLCFLAWFEL
                     DIAFTSLVLRRIYGPEQRKKILRNMVFMFTAGVAGLYGLTKLYPDEREQVTAYWTGLA
                     LQLPIGYACLYFLWRDQDTAGHSLEIWLTKYIGCYTAYGVFFWRYWNIPQNWEYVGSP
                     LSVGIIILTLIPETIYPFVYIKIHNEKEKKEKLQ"
     gene            <428784..>429248
                     /locus_tag="ACHE_10152S"
                     /db_xref="GeneID:66977109"
     mRNA            <428784..>429248
                     /locus_tag="ACHE_10152S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276098.1"
                     /db_xref="GeneID:66977109"
     CDS             428784..429248
                     /locus_tag="ACHE_10152S"
                     /note="COG:S;
                     EggNog:ENOG410Q26K"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131272.1"
                     /db_xref="GeneID:66977109"
                     /translation="MTADPTDYSTTTFRTINNIDNSAQTAYTGDTTYGTYEDDAITDY
                     GLRGASDPKPYSTPATATASGIRGYDPSDYSNIAVQDGGGHTAYDPVTGAYDEHYDYR
                     AENSTKHHRERMLPDGTYQLREVDRFDDGTAKVHREYSNPNTGTNYIKDYQK"
     gene            <430625..>432412
                     /locus_tag="ACHE_10153S"
                     /db_xref="GeneID:66977110"
     mRNA            join(<430625..430930,430984..431105,431161..431732,
                     431784..>432412)
                     /locus_tag="ACHE_10153S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276109.1"
                     /db_xref="GeneID:66977110"
     CDS             join(430625..430930,430984..431105,431161..431732,
                     431784..432412)
                     /locus_tag="ACHE_10153S"
                     /note="COG:P;
                     EggNog:ENOG410PHR0;
                     InterPro:IPR003370;
                     PFAM:PF02417;
                     TransMembrane:10
                     (i122-148o168-187i199-217o223-242i324-343o355-380i392-
                     417o423-451i463-483o520-540i);
                     go_function: GO:0015109 - chromate transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0015703 - chromate transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131273.1"
                     /db_xref="GeneID:66977110"
                     /translation="MLVVLIADRTFRMIRNNMLLPPPLSRCLSSLTSLIRKLNNRRES
                     RECDGMRKSLLSRLVDVFLRTWDLGFTAFGGPPVHFQILHARFVEGQGGKEKWVDEQT
                     YQELFAICQGLPGPGSTKMIFCLALLHAGFIPAMLVFFIWSLPGAIGMYALSLGVQNI
                     SETLPEAAYSLLSGLNAATVGIVALAAVQLAEKAIRDQLSRILVIFGACAGLCYNALW
                     YFPVLMIMGGFLTALWDGWLYQQIGRAKIAWKNRHVHPQGPELTNSNPTDVESVPLEE
                     TRVQRSETTRSRKTDPGNGGLPQTSVEATRPTQSNENPSQQHIIRIRVGLVIMGLFFA
                     SFIGILVARDQLANPPLTMDLFANMYLAGTVIFGGGPVVIPLLRSYVVDPGWVSSRDF
                     LIGLAIIQAFPGPNFNFAVFLGALALQNSRFPTILGAILGGLGIFFPGITLAVAIQSF
                     WRVLRRRKYVIDFLRGVNATAVGLVFTAVYRLWEIGYLTPERSDGQSLAKEPWWVVVA
                     AVTYSGSAWFKVPPAIAIIMGAVLGLCWFGVVGR"
     gene            <433942..>435407
                     /locus_tag="ACHE_10154S"
                     /db_xref="GeneID:66977111"
     mRNA            join(<433942..434048,434114..>435407)
                     /locus_tag="ACHE_10154S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276120.1"
                     /db_xref="GeneID:66977111"
     CDS             join(433942..434048,434114..435407)
                     /locus_tag="ACHE_10154S"
                     /note="COG:G;
                     EggNog:ENOG410QDAG;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i38-63o83-107i114-133o145-165i172-192o204-224i327-
                     348o360-380i401-419o434-456i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131274.1"
                     /db_xref="GeneID:66977111"
                     /translation="MTEMKAKTPVELQDDRGEPSENIANRERAQLKHGKWRYVMVVAA
                     GFLVMFTTCALIFTFGVWQSLYEEMTAQANTPFTGTSTALINLIGTLAIALMSMGGPF
                     TMVWAKLYSPQAVIIVGGWVFGIAFILASFSKQLWHFTLTQGVLLGIGTCMAYVPTMA
                     VAPTWFDKRRGLAMGVIISGTGVGGMVWPPVLSAIIDSIGFRNALRIAGCVSVTLVSL
                     AGYSLGWEPDFQNQVRVQTQGISRVNGWMKIPLINWRVARTKRFVAQASGCFLQSAGY
                     STPLFFYAAYARALGYSNTTATNFITVSNASNFVSRIIVGYGADKYGRINALAFTTLL
                     STIAVFAFWLPSMFKESTIAGSSADGLFITFTVLYGAFASAYISLFPASLIELFGAQN
                     YTSVNGSLYLIRGIGALIGTPLTGLLIPESKALVSSIIYERAGITVGVLLFAATVACF
                     IVRIEAMMGSPWRWKM"
     gene            complement(<435495..>436501)
                     /locus_tag="ACHE_10155A"
                     /db_xref="GeneID:66977112"
     mRNA            complement(join(<435495..435873,435927..>436501))
                     /locus_tag="ACHE_10155A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276131.1"
                     /db_xref="GeneID:66977112"
     CDS             complement(join(435495..435873,435927..436501))
                     /locus_tag="ACHE_10155A"
                     /note="COG:S;
                     EggNog:ENOG410Q110;
                     InterPro:IPR001279,IPR036866;
                     PFAM:PF00753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131275.1"
                     /db_xref="GeneID:66977112"
                     /translation="MQLHPCNENNPAETVNMRLQTYHHSSSTRGLSSITTLIVGVTES
                     VLIDPPFLIQDAESVVRWVKATTTTPLKAVFVTHHHPDHFFSANPILDAFSSAKFYAA
                     PFVLAGINREYDDKVKYWPSIFGKESVPETPRKPEAFHFTFFVLQGNPESPVMLLGPL
                     QGDSVDHTIFWLPAERTVICGDTVYGRSTHVWVEEVETPALLEAWNKSLDVISSLNPV
                     KVIPGHLEPGWELDAQADLAHTKKYLSLFANKVTYAPSKPKVQELYEYFQNEFNQCKE
                     NLNFFLGHLSNQFGEGGRVWEENRHHAVDKRRIEDLNGFCF"
     gene            <436937..>437949
                     /locus_tag="ACHE_10156S"
                     /db_xref="GeneID:66977113"
     mRNA            join(<436937..437000,437055..437359,437410..>437949)
                     /locus_tag="ACHE_10156S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276142.1"
                     /db_xref="GeneID:66977113"
     CDS             join(436937..437000,437055..437359,437410..437949)
                     /locus_tag="ACHE_10156S"
                     /note="COG:Q;
                     EggNog:ENOG410PPAF;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131276.1"
                     /db_xref="GeneID:66977113"
                     /translation="MAQFIPNVTPESLADKVILITGGANGIGASLVELCCENGAYVCF
                     GDTAATAGDQLAQKLSASSSSKPRTLFRQTDVTDYKSILSLFDAALEIYGHIDHVVAA
                     AGIQEIGNWFDPALTLEDVREPATTKVLDVNLRGCLYVSRIASVYLRQNRPSGTDRSI
                     TLISSIAGFKESPGLFVYQASKHGVLGILRSLRQYLSFTPHQLRINAVCPWMTTTGMV
                     KGIQNDWLEAGLPTNSPLDVARITAGLVVDEKLNGTSMYVEGGRGWEIEANLDRLEPQ
                     WLGEEPSKSLAKGQAVLGSGSNWTNY"
     gene            <438312..>438470
                     /locus_tag="ACHE_10157S"
                     /db_xref="GeneID:66977114"
     mRNA            <438312..>438470
                     /locus_tag="ACHE_10157S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276153.1"
                     /db_xref="GeneID:66977114"
     CDS             438312..438470
                     /locus_tag="ACHE_10157S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131277.1"
                     /db_xref="GeneID:66977114"
                     /translation="MRVGTAGITDKFARRLVAHLLENDNITTIKGYCYIPAKLPEALR
                     LSPKLKLI"
     gene            <438520..>439187
                     /locus_tag="ACHE_10158S"
                     /db_xref="GeneID:66977115"
     mRNA            join(<438520..438524,438555..438922,438976..>439187)
                     /locus_tag="ACHE_10158S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276164.1"
                     /db_xref="GeneID:66977115"
     CDS             join(438520..438524,438555..438922,438976..439187)
                     /locus_tag="ACHE_10158S"
                     /note="COG:S;
                     EggNog:ENOG410Q26W;
                     InterPro:IPR036291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131278.1"
                     /db_xref="GeneID:66977115"
                     /translation="MYTVDGQKLLVDACDDEPSVTRYVANYWALDYTNLEPGQLFPKD
                     PMIHVKAYLETKQNVAGLHILAGGFMEPVFSPFFNIFDPESNTFRYWGEGDEITEGIT
                     YDDVARFIAAVVANSKASGILKFAGGCANIREIAQFFDPSRRFTECPRLSSDSVLWMF
                     FTSICMNCGPATRRMSMDTCHCKSLIPFYDENAD"
     gene            complement(<440783..>441425)
                     /locus_tag="ACHE_10159A"
                     /db_xref="GeneID:66977116"
     mRNA            complement(join(<440783..440890,440947..441325,
                     441415..>441425))
                     /locus_tag="ACHE_10159A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276175.1"
                     /db_xref="GeneID:66977116"
     CDS             complement(join(440783..440890,440947..441325,
                     441415..441425))
                     /locus_tag="ACHE_10159A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131279.1"
                     /db_xref="GeneID:66977116"
                     /translation="MSLPIPQQLPTNEADSNAAARNSAVTRSNRVTIAQSHSSTASSP
                     DPGRAPRRKKRPLKAELISRLKRLEDEIKGLKESTEVANRVNWCLCSWNAVRLEENGA
                     GGQRERLIFGGGFSRYVMHDALVNVEDQIQELHDDIEDSPEQLVEGNGEETCSAFIFW
                     IFIQR"
     gene            <441831..>442800
                     /locus_tag="ACHE_10160S"
                     /db_xref="GeneID:66977117"
     mRNA            join(<441831..442082,442137..442508,442561..>442800)
                     /locus_tag="ACHE_10160S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276187.1"
                     /db_xref="GeneID:66977117"
     CDS             join(441831..442082,442137..442508,442561..442800)
                     /locus_tag="ACHE_10160S"
                     /note="COG:G,M;
                     EggNog:ENOG410PNHV;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF13460,PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131280.1"
                     /db_xref="GeneID:66977117"
                     /translation="MAAVLITGATGKQGGSLIKNLVSRNSPFEILAVTRNKASGSAQR
                     LSRLSPNIRLVEGNLNDPAGIFKNARSLTKNLIWGVFSVQVAIGNSASEEPQGKALVD
                     ESLKQDVKFFIYSSVDRGANSFENPTKVPHFINKHNIEHYLVEKTKNTEVQWTILRPT
                     AFYENLVPGFFGKVFMTSFDMALKGKPLQLVATSDIGYFAADAFLKPEAKQVFEANTG
                     QSVPRTFRFLCSMFMASMKDMGYMFKWFHDEGYKANISELKKVHPGLKDFAEWLKTES
                     ASLDVAVCEVV"
     gene            complement(<442927..>444966)
                     /locus_tag="ACHE_10161A"
                     /db_xref="GeneID:66977118"
     mRNA            complement(<442927..>444966)
                     /locus_tag="ACHE_10161A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276198.1"
                     /db_xref="GeneID:66977118"
     CDS             complement(442927..444966)
                     /locus_tag="ACHE_10161A"
                     /note="COG:E;
                     EggNog:ENOG410PGT4;
                     InterPro:IPR002937,IPR036188;
                     PFAM:PF01593,PF13450;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131281.1"
                     /db_xref="GeneID:66977118"
                     /translation="MKSPLHHALLGLGLSSLTLGAVVRRDVEVLRFSNPVGVTPDSLN
                     NIHVDIVDKTFEGHVRLVYGDCGIEHAGQGHHDIGSVFIERDAHPERLVWITPSDAPH
                     LQCLHAFSESVLVGRSSPISVESPVDKRESLADLADMEGPWFDGVAYMKSKQQDAAVV
                     SKAKNTSVAIIGGGMSGLMTSHLLESVGIHDWHIIESSERIGGRIRTKYLNNSSPEDY
                     TYQEMGPMRFPVSITYADMNETLQIMDHRMVFQLAGVLNKLNAKSNRTDLHVNFIPWI
                     QSSPNVPADSGGVRLPDGRIPSAADVAANSSLVYTAASSNATAADDAEAAVDGYTDMN
                     NRSTIRNFASNMYKMHKQAVDKGLFHWSEAGYLRYALGYDANISDYVAGTTDTPMWLY
                     EDVYFAATEWRTIDKGLESLPRAFYPHVSDRLTLNRTIDGLVYNEASGKIAVAWRDDP
                     LSMTPFTEEYDYAVVAAPFSKVRLWSLPQYSSLLSRAISTLNYGQSCKMALMYKTRFW
                     EHLPKPIYGGCGTVDIAGVGNVCYPSYKMNTTGPGVILASYISGTEARSTAALTDEEH
                     VALIQRTMVEVHGPIAAEQFTGIYDRQCWEVDRHQAGAWASPLVGQQELYLPAYYQTE
                     YKSIFIGEHTSYTHAWIFSALDSAVRGTVQLLLDLGLVDEAKGIVEEWMGRWIKL"
     gene            <449665..>451263
                     /locus_tag="ACHE_10162S"
                     /db_xref="GeneID:66977119"
     mRNA            join(<449665..450917,450969..>451263)
                     /locus_tag="ACHE_10162S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276209.1"
                     /db_xref="GeneID:66977119"
     CDS             join(449665..450917,450969..451263)
                     /locus_tag="ACHE_10162S"
                     /note="COG:G;
                     EggNog:ENOG410PKV4;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:12
                     (i12-34o64-81i93-114o120-138i150-169o181-204i269-292o312-
                     333i340-362o374-395i416-433o439-456i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131282.1"
                     /db_xref="GeneID:66977119"
                     /translation="MLSGHFLQLAQVILVVFPCFFLFGYNQVGVGGLLGFDSWTGLFP
                     QIDTVNATGETESQKSVMQGVYVSCFTLGGAVGSLICTSIGDFLGRRKAIFIGALLTF
                     IGELLSCTSFSFAQLLVGRIITGIGIGFTSTIVPVWQSECSPAADRGAHVVIDGIFIT
                     SGYAISQWINYGFSYIDHHSVSWRVPMAIPCVFSLMPIGSIFFLPESPRWLVRAGHAT
                     QAALILARIKEIDSEHLEIRHEIAGIEASLEESVQNAASVKDIFTMKDGKLFYRFMLC
                     IGLQFWVQMTGANAISTYCTTIFQDSLGLTADLSRVLAAGMLTWKFVASFVAFFTIDR
                     FGRRKLFLFSGAGITLCMMSIAITNRYANESHGAAIGTTFFIFLFAFFFPIGFLGPSF
                     LYCTEVAPLRLRVAMTSISTANHWLWNFVVQMITPIAMTNIGYQYWIVYTVLCFAFPV
                     TVFFFYPETMGQSLERLEELFQQDLSIFQTVRVANELASTTQGSDEMVGEKGEKLEQS
                     GNESPAP"
     gene            <451732..>454061
                     /locus_tag="ACHE_10163S"
                     /db_xref="GeneID:66977120"
     mRNA            join(<451732..451794,451846..451934,451990..452387,
                     452442..452960,453016..453406,453458..>454061)
                     /locus_tag="ACHE_10163S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276220.1"
                     /db_xref="GeneID:66977120"
     CDS             join(451732..451794,451846..451934,451990..452387,
                     452442..452960,453016..453406,453458..454061)
                     /locus_tag="ACHE_10163S"
                     /note="COG:S;
                     EggNog:ENOG410Q1VR;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131283.1"
                     /db_xref="GeneID:66977120"
                     /translation="MPKRQSLGRASAACTFCRQKKLKCDAVKPTCGNCTAKGIDCQQG
                     PAQHKPRPTNERIARLESENAFLRQRLQTGDTPVSGYGAPAPGPSVEQASPQPPCSVD
                     SPMPGPEGSIRKLANIGTRGSHIPVEPPTGDLRSNVSLYHGPTSTAYYETPSPQQRNG
                     QNNDFYATNEWSQNLLFAQTAKQRQLEPLNLIAGRLDFDGVDPSIGMELLSIYWSRQV
                     YTAQIIHRPVFMRDMACGGPYFSKLLLNSIFFVVSKHSLRPEVRTDPDDINTAGLIYR
                     ERFVELLREKFDKSEITTIQALLIMSNALFSRCDERSLSWLYAGNAFNMIIDLGLHVL
                     PSANNTSAEELEIRKRVVWGAYSIDKIQCLLQGRPSLLRKRDFNTPLKFLDEYDELEQ
                     FDSISYTTNRHQLGIPSLNVTLLTKLCELSVIIEHLMCEVYSESTPNTQLSQKMSVCE
                     RIKSDLSQWRKTLPPQMDYIAYSGDPGSVLPQAHCLLALCNTLVILSERPFITDSHSS
                     SIVAHESITASTAAANQTVQILRDYAQHYSIGSAPYVLSYATYVSATIHARIVAHKGK
                     GSVSFQSLIFCLKTLEDQTDIYTAAVKARQNLDRLMDHLGVSIAVNGSMNGNMVGDSA
                     QLQTVQYESVSTPDKTQAVGTTFAENGFSQTSWELSNLDLDAILQGFLLDRDGQFPMY
                     PLGTF"
     gene            <455275..>456535
                     /locus_tag="ACHE_10164S"
                     /db_xref="GeneID:66977121"
     mRNA            join(<455275..455441,455497..455918,455975..455989,
                     456048..456175,456230..>456535)
                     /locus_tag="ACHE_10164S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276231.1"
                     /db_xref="GeneID:66977121"
     CDS             join(455275..455441,455497..455918,455975..455989,
                     456048..456175,456230..456535)
                     /locus_tag="ACHE_10164S"
                     /note="COG:S;
                     EggNog:ENOG410Q1HK;
                     InterPro:IPR022185;
                     PFAM:PF12505;
                     TransMembrane:1 (i38-61o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131284.1"
                     /db_xref="GeneID:66977121"
                     /translation="MSGPELGQKSNNSRTNVTETPLKPPFFQRFKTHMKRWWWAYVIG
                     FCVVVLVTVLPLVYVGVPNFANKYINDYQYNYNDLSITNPTPNSFHVHQKQNLNAGGF
                     SGSGHLSAFNATIRASGSDIPFAVFPVQEIEFGGNSDFTIDQDLNIACVECLSRLAAD
                     AVAKKEISVLVTGKPDLKVGGLPTAHLDVHKTMAMKGYNVEEYLDAPGSFNVTSVNLL
                     KPPTSEGYNVNATVAFRNPSPFIVEIGSVSFNLSISGTSMGYVDIPNLYLQKDITETT
                     VLGDIDIDVLVRKALGNGSPNDDFGDVTIDISGNKVYYKGEEIPYFSAAMQAIKAPVK
                     VNLLDYASEFL"
     gene            complement(<457447..>459170)
                     /locus_tag="ACHE_10165A"
                     /db_xref="GeneID:66977122"
     mRNA            complement(join(<457447..457671,457724..458097,
                     458148..458755,458806..>459170))
                     /locus_tag="ACHE_10165A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276242.1"
                     /db_xref="GeneID:66977122"
     CDS             complement(join(457447..457671,457724..458097,
                     458148..458755,458806..459170))
                     /locus_tag="ACHE_10165A"
                     /note="COG:P;
                     EggNog:ENOG410QE36;
                     InterPro:IPR005829,IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:14
                     (i57-77o97-116i128-154o160-180i187-210o216-236i248-
                     267o279-297i318-341o353-374i381-401o413-436i448-466o486-
                     506i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131285.1"
                     /db_xref="GeneID:66977122"
                     /translation="MGIFKSDKEAKAPQVTVTSSPQSSAPGTPPIESALLSAEQNAIK
                     LEKRPQFGRLASWRGSLILLVTSGAQFLDNVFMTSANMALSSMQEEFHESSTNLQWII
                     SAYTLTFGGFLLLAGVLSDRYGRKTILCAGLAWLSLWTLVIGFGTSFIQLAIFRGLQG
                     MGAAMTVPSAIGIISSYFTGLDRTRALSIYASSGTIGFCAGLLIGGFLTSSLGWRYIF
                     YLIVIITGSLGILGAIVIPKDVPVAEKPKMDYAGSILSTAGLILLQFVLSSGGDYGWS
                     TPFIIALLVVAVLLLVAFVVLQHYISYPIMPLSLWKLRNFAGLWIAGFTCYGSYQNVI
                     YYIVLMAQQVDNLNAGDTALRFLPMGAIGFVASMGTGKLLEYVNGKYTLLAGLILTVV
                     APIPSALTATNQEPDFWVNVLPASLISITAVSLIFVTTSTLILTTVPVNVKSLCGGML
                     NTAFQIGSGVALAISAAVTDAVDISKGHSIAQQYSTGLWCSAGLAGLGLIIAFFSVRR
                     KGIGPNDRTDADIAV"
     gene            complement(<463793..>467540)
                     /locus_tag="ACHE_10166A"
                     /db_xref="GeneID:66977123"
     mRNA            complement(join(<463793..463807,463863..465323,
                     465378..>467540))
                     /locus_tag="ACHE_10166A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276253.1"
                     /db_xref="GeneID:66977123"
     CDS             complement(join(463793..463807,463863..465323,
                     465378..467540))
                     /locus_tag="ACHE_10166A"
                     /note="COG:K,L;
                     EggNog:ENOG410QDFW;
                     InterPro:IPR001841,IPR027417,IPR000330,IPR038718,
                     IPR001650,IPR014001,IPR013083;
                     PFAM:PF13923,PF00176,PF13920,PF00097,PF13445,
                     PF00271,PF04851;
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131286.1"
                     /db_xref="GeneID:66977123"
                     /translation="MADPSNDASIEDIMEDLQLHEVILQSLDEQRPDAVEERQEILDT
                     IKSLQSQLARRRGEPSPKPSPNNNSATPAPPASAMLSAAQLDGAYDVSPFDDSAPPPP
                     RWGRDQSPSFTPAQRSHDLSIRKRRYTDESSDGMRPRNKRIQSDAYLPPTSSQLDQST
                     QDDSDEYDGADDLRQLLGLDDEDTMLAFQDEQRKAEQWLKERKEQERRDEEYARMLHD
                     GLFERPRERTQEQLRELPRPASAQSSTCTYYSGSSLPFPASPAPTPAPAQAQAPTLPA
                     IDLTRLFHPAHESSSAFLRSVSDHQPRHLMSSFNSNKAPPTNPQLPSLKQENDDSDIQ
                     EITPSDFWACPRGSSFARNEPPGMWTPSMGLSPMPPYKQMSQAYNSVYQPAPGPSAFE
                     AGSGPGPMYGPNVLQNTMARLNAGRQLLDQAGRSVYGGFPGTPFKTEDAISRTLDYGF
                     NNPTFDSLGFNDLYGDGADPKKTAEEIKQLLENIRPDMELSKQNREGTPEALKVTLLE
                     HQKLGLAWMKSMEDSETRGGILADDMGLGKTIQALALMVSRQSSNPECKSNLVIAPVA
                     LMQQWKREIERLLRPGRHQLSVFVLHGEKRSTSFRDLKEYDVVLTTFGTLASEYKRKE
                     HYEQLHKQSGSNEPLPTAIVNQLPCLGPKSKWHRVIIDEAQCIKNRNTKAALAACQLD
                     STHRWCMSGTPMMNNVEELHSLLRFLRIRPYSNLERFNREFTRPLIKGPESARNKAMR
                     QLQVLLKAVLLRRTKYSKIDGKPILQLPPRVSEKVYGIFSEDERELYTSLETQTQVTF
                     NKYLKAGTVGRNYSSILVLLLRLRQACCHPHLMSDFSVNVETNANTNEVDLVANAKAF
                     PSEVVIRLKDNQELECPICIDAVDNPIIFFPCGHSTCAECFSRISDPSQAVRHGVDGS
                     IEVKCPNCRGKVDTKKITDHVTFNKVHFPDVSDETEEVAPEKSVAEEDPDETDSESES
                     DGEDLSKFIVKDNGFGYSDKDKGKGKGRKTKKPKKTLAELKKEGMRNQKAKRKYLRRL
                     EKNWVSSAKIDKTMEILQAIEDRQEGEKTIIFSQFTSLLDLLEVPIARRGWNYRRYDG
                     SMRPPDRNAAVLDFTDQPDCKIMLVSLKAGNSGLNLVAASQVIVFDPFWNPYIEEQAI
                     DRAHRIGQQREVQVHRILVEKTVEDRILELQDKKRELIEGALDENASKNVSRLGTREL
                     GYLFGVNT"
     gene            complement(<469254..>469774)
                     /locus_tag="ACHE_10167A"
                     /db_xref="GeneID:66977124"
     mRNA            complement(join(<469254..469429,469483..>469774))
                     /locus_tag="ACHE_10167A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276264.1"
                     /db_xref="GeneID:66977124"
     CDS             complement(join(469254..469429,469483..469774))
                     /locus_tag="ACHE_10167A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131287.1"
                     /db_xref="GeneID:66977124"
                     /translation="MAIPEVKSDQPSIIPQKRSASASDSAPIPKKPDVTTRTTQKKSY
                     KKKDDFAESKVSNSTENLTESEVFRRLEAVGAEMATISWYMDLPEKLRIPEILLDFSI
                     LNMPKWPDQDTIDKWLAQGHRKPDEDNNIDTRNEGPEDKEDKKYENKKRRMRN"
     gene            <472543..>474266
                     /locus_tag="ACHE_10168S"
                     /db_xref="GeneID:66977125"
     mRNA            join(<472543..472748,472802..472915,472974..473122,
                     473188..>474266)
                     /locus_tag="ACHE_10168S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276275.1"
                     /db_xref="GeneID:66977125"
     CDS             join(472543..472748,472802..472915,472974..473122,
                     473188..474266)
                     /locus_tag="ACHE_10168S"
                     /note="COG:G;
                     EggNog:ENOG410PM6W;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i50-67o94-113i120-137o143-169i181-203o215-237i290-
                     309o321-340i352-369o381-399i411-430o442-461i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131288.1"
                     /db_xref="GeneID:66977125"
                     /translation="MSDDKSEIQPDNGTLEKGEAVHEDVVKDPVQLTALTPEELVLEK
                     KLVRRIDILIMPLIILVYLMNYIDRNNYAAAKLQGLEQDLHLNDQQYQTGLSILFVGY
                     ILMMTPSNLLLNYVGHPSLYLGFFVCAWGLVSALTSQVKGYGGIVACRFIMGFVEAPF
                     FSGVLFYLSKWYTKKELGLRMSIFYSGSLLSGAFGNLIAAGILDGMDGKRGITAWQWL
                     YIIEGAITVTFGLIITVVLPDFPENWKMLSEEMRSVAARRLAVDAAEVDIDDSGSKGQ
                     IQGLKDALCDIKTYMLAIAFHCIVGASGFQNYFPSLTEQLYDDKIISLVLVAPPYIFM
                     VFFSLAHSHFSDRFNNRFWFFIYPIPITIVGYVLYMETTSFGSRYASFFLMIFVFTQF
                     GTFFSWIANAIPRPPAKRAAAYGFINAIGNSASIWTPYTYRDQDQPGYKPAMGVCIAL
                     QILAAIMAIALDQYTRHQNRQLARMEDMEVELSGRDRRKLEKTAQMNNIGLEQARQLQ
                     RGFRFML"
     gene            <475151..>475402
                     /locus_tag="ACHE_10169S"
                     /db_xref="GeneID:66977126"
     mRNA            <475151..>475402
                     /locus_tag="ACHE_10169S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276286.1"
                     /db_xref="GeneID:66977126"
     CDS             475151..475402
                     /locus_tag="ACHE_10169S"
                     /note="COG:S;
                     EggNog:ENOG410PVF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131289.1"
                     /db_xref="GeneID:66977126"
                     /translation="MTYFDEDGDEMYHNLLDVLYNVAKPEQIGRGKPPRDGFRVIAKE
                     LRGEEPERLHHLSILQDEFRDLVKLVLVMQFDFRGLGDH"
     gene            complement(<488909..>492637)
                     /gene="MCD4_1"
                     /locus_tag="ACHE_10170A"
                     /db_xref="GeneID:66977127"
     mRNA            complement(join(<488909..489741,490315..490568,
                     490618..490805,490854..492409,492469..>492637))
                     /gene="MCD4_1"
                     /locus_tag="ACHE_10170A"
                     /product="glycosyl phosphatidyl inositol anchor synthesis"
                     /transcript_id="XM_043276298.1"
                     /db_xref="GeneID:66977127"
     CDS             complement(join(488909..489741,490315..490568,
                     490618..490805,490854..492409,492469..492637))
                     /gene="MCD4_1"
                     /locus_tag="ACHE_10170A"
                     /note="BUSCO:EOG09260KDB;
                     COG:G;
                     EggNog:ENOG410PGMQ;
                     InterPro:IPR007070,IPR037671,IPR017852,IPR017850,
                     IPR000917;
                     PFAM:PF04987;
                     TransMembrane:16
                     (i7-30o455-484i496-513o519-537i558-576o582-601i608-
                     629o635-656i677-696o716-734i741-758o764-780i860-879o899-
                     922i934-953o965-985i);
                     go_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0008484 - sulfuric ester hydrolase
                     activity [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_function: GO:0051377 - mannose-ethanolamine
                     phosphotransferase activity [Evidence IEA];
                     go_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycosyl phosphatidyl inositol anchor synthesis"
                     /protein_id="XP_043131290.1"
                     /db_xref="GeneID:66977127"
                     /translation="MARLGRIGFLGIAIVFHVAYIYSIFDIYFVSPIVDGMRAYKVDT
                     PEPPARRLVLYVGDGLRADKAFQFFPDPSRPTNDSSAQDVVPMAPFLRSRVLKHGTFG
                     VSHTRVPIESRPGHVALIAGLYEDVAAVTTGWKLNPVNFDSVFNRSRHTWSWGSPDIL
                     PMFSAGAVPGRVEDQMYEAEFEDYSKDATELDHWVFDRVKKLFEDADTDEELNARLRQ
                     DRIVFFLHLLGLDTTGHAHRPYSQEYLRNIQIVDQGVQKITEIVNQFYGDDKTAFIFT
                     ADHGISDWGSHGDGHPDNTRTPLIAWGSGVAKPRTVKSGKAPGHEDGFSSDWQLDHVY
                     RHDVAQADIAALMAYLAGLEFPVNSVGELPLSFLGATDEQKAKALLVNAKEILEMYHV
                     KEREKVAEVLHYKPYSGFAKTNIENRLASIEELIREQDYTTAMKQSDELIKIALQGLR
                     YLQTYAWLFLRTLVTAGYLGWIAFAFTTAVDVYVLDGKIDVQRPPGLIITFASILVGL
                     YSLLIFQASPITYYAYAFFPVLFWEEVFARSRALAEGKKKLFSQFSKSDTVKFALNTA
                     AYLALLEVMVQSYYNRQVYTIVYLTATAWPLLHGTDFVKTNFFLCTTWALSCAAMSVF
                     TLLPANKLEDITLISVGGILILLVGFLYIAFEKRLLVQTLPSKDGLSAADADGVSRAI
                     LGLQVGLVALAMLVTRSSVASLQTKQGLPLGTQIAGWATLVASLVLPFAHVLRPRKHY
                     LHRHMIIFLALGPLFIILTISYEGLFYFAIAITLFSWVQLEHRIHQRSKNGSTRNIMS
                     SDDSRPPGNARNAAANGYAFNTKKALNEEISTPLATAAEAAKQREKAAEGNYRSLILS
                     DVRVSLFFLFLLHSAFFSTGNIASVSSFSLDAVYRLLPIFDPFSQAALLIFKILAPFA
                     LVSANLGFLTKRLKLQSGSLFTVVMGIGDYMTLRFFWVVRDEGSWLEIGESISMFIIA
                     SALCVFVAGLEALSEVFVRGVEFQDDM"
     gene            complement(<493798..>496071)
                     /locus_tag="ACHE_10171A"
                     /db_xref="GeneID:66977128"
     mRNA            complement(join(<493798..493907,493965..494401,
                     494451..494755,494862..495595,495657..>496071))
                     /locus_tag="ACHE_10171A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276309.1"
                     /db_xref="GeneID:66977128"
     CDS             complement(join(493798..493907,493965..494401,
                     494451..494755,494862..495595,495657..496071))
                     /locus_tag="ACHE_10171A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131291.1"
                     /db_xref="GeneID:66977128"
                     /translation="MAAAITSWVLNPIQSLTMSRPRTRELWCALSDDLQKSFPVECVA
                     DQDNINTLKKKIWEEIREKIKNTIPHYSDLKLYSPVVQLNHEEKFRIDDGEFLRPRRM
                     ITTNPLFPESKDPDVDIVVVSGGATPQKQKCSESQNANIPQTLSIAEHQLICPRERTV
                     SKLAAILDDMNIVHVRGTPASGKTRLSELLRDYYRKEGRRAFLIKRWEGLNFKNPWGS
                     LVELVEKWNDEAQEAPTTTSQSEQDLSWVLTSNTVIIVDEAQATYSDDTLWNTIFKER
                     LTPNVYKFRLCLFCSYGSPATGPDPTFFTPVKFSDEQRISLTPQNQQDSPPIGLFYDK
                     EEFRDVISRLLTFHYEETFDFDEGALEYIFAVTNGHPGAVTSIVDVIYEAYRHDIKRG
                     CIRTLTEDHVIWFLEDTATVFDKLRSKPVNRSFPDISRATNGISVILSKITEGSIPFD
                     INDASIKFCYQKGWIHRVALDGGDVAVLPSRLHEKYVEYWIGKMSMPLPARFDSLPKL
                     CKEVLGEFSIMILRHSAEGKKISTASQPRPVEAQYQDEFHRGFVHLAGLGVPISSEWS
                     RTKDGRVDFYIPEKKWAIEILRDHNRVDEHISRFKEGGKYHPWLKENMIKDWIIIDCA
                     TSLPTKEFSEPRLWHAVFINDYSELRLYNHQKALIMSVHLHI"
     gene            complement(<497740..>498643)
                     /locus_tag="ACHE_10172A"
                     /db_xref="GeneID:66977129"
     mRNA            complement(join(<497740..497793,497851..498072,
                     498131..>498643))
                     /locus_tag="ACHE_10172A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276320.1"
                     /db_xref="GeneID:66977129"
     CDS             complement(join(497740..497793,497851..498072,
                     498131..498643))
                     /locus_tag="ACHE_10172A"
                     /note="COG:S;
                     EggNog:ENOG410Q2SP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131292.1"
                     /db_xref="GeneID:66977129"
                     /translation="MEPARDLLARPLPHILYDGGTKSPSIDSSPVSATFFAPWPSFYE
                     DVRVALQSMDLDGQVSLIESRNGERYLTGNEPGLTTRFVRNLCDPVSEALSVTHLRQV
                     MFGDVYSIRKTTMEIPDLVMVKLVNPEQPNRETTILVLVGEMKTWWTLELELFPVSSP
                     AEDLQNSSVQLVIRYMRKFNLKYGFLSTYRSTIFIRRAADYKFEISPPVDYRATRPSL
                     RECFMAFAALADNDRIYTETPGFNARLHNEALHVRHCRPSEFDA"
     gene            complement(<501804..>502253)
                     /locus_tag="ACHE_10173A"
                     /db_xref="GeneID:66977130"
     mRNA            complement(<501804..>502253)
                     /locus_tag="ACHE_10173A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276331.1"
                     /db_xref="GeneID:66977130"
     CDS             complement(501804..502253)
                     /locus_tag="ACHE_10173A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131293.1"
                     /db_xref="GeneID:66977130"
                     /translation="MSSVEDLAAKVRDRRSNNGSEDHDGQKEVLQQIQSMLNKQTEEM
                     KALQHSTQTPKVINSPPSYTPSGHAKSYRNAALASHLTSTKSPLISGWMQGHTHGSIG
                     TNERPSTSPSSPATPFPLKADLEIHIRGTDHQIIDPLRHQKEARVVE"
     gene            complement(503071..503165)
                     /locus_tag="ACHE_t10005A"
                     /db_xref="GeneID:66987311"
     tRNA            complement(503071..503165)
                     /locus_tag="ACHE_t10005A"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:66987311"
     gene            <505370..>506042
                     /locus_tag="ACHE_10174S"
                     /db_xref="GeneID:66977131"
     mRNA            join(<505370..505414,505470..>506042)
                     /locus_tag="ACHE_10174S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276342.1"
                     /db_xref="GeneID:66977131"
     CDS             join(505370..505414,505470..506042)
                     /locus_tag="ACHE_10174S"
                     /note="COG:S;
                     EggNog:ENOG410PYU2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131294.1"
                     /db_xref="GeneID:66977131"
                     /translation="MSGILLFCTAPVPASVINRLMQDSSIPEHGRNIFSLVRTPDQTT
                     LDNFNSNPPINPFSTGFLSTPDTELRRYTRKRISDLERERSISLFSKWVAVLDERSIT
                     DNTVVIHRYETKSEWEQLQREAEEEWVGTPGMAEINEDEDSIWWKWRVPFDAVFHLYN
                     HVETFSWRGVALWARPEYLGENGVVMVRFPVGIISGGMEDPLGLM"
     gene            <506701..>508137
                     /locus_tag="ACHE_10175S"
                     /db_xref="GeneID:66977132"
     mRNA            <506701..>508137
                     /locus_tag="ACHE_10175S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276353.1"
                     /db_xref="GeneID:66977132"
     CDS             506701..508137
                     /locus_tag="ACHE_10175S"
                     /note="COG:S;
                     EggNog:ENOG410PMB2;
                     InterPro:IPR011009,IPR002575;
                     PFAM:PF01636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131295.1"
                     /db_xref="GeneID:66977132"
                     /translation="MQKRMRFDDVAWEQSETISDAWVAELFKIDTLRAIGDFIVKHRK
                     GVPSELCQPRAGAFNVSFRMKFEDGGSALIRFPKPGATMFAEEKVRNEVAVIRYIQEY
                     TSIPVPFILHWGTKNESPLNLGPFILMEYIDHDTDLGTALNTPTLNIEDRPILDPSID
                     IDKLEMLYGQLADILLQLSQLSLPWIGSLAQIDDFTWDVRRRPLSIGMNELVRLGTLP
                     RSTLPTSTFKTTSSYFNALAELHRAHLSHQRNDAVNSANDCRRKLVARQLFSKLAREG
                     RLTQSTNDHGPFKIWCDDLRPSNVLVNKNLQIVGVIDWEFTYAAPVEFSHAPPWWLLL
                     EQPEYWPDGIEAWVEAFESRLQTFLKVLTEREETAIQRGRLRQEQRLSGPMRQSWVNG
                     DFWVTYAARKNFAFDTIFWKNLDHRFFGSCTVAEENRWAKRIGLLSEEESQCMEQVVS
                     LKLGQMEKRALAWEPEEVYTVETHHFVT"
     gene            complement(<508449..>509009)
                     /locus_tag="ACHE_10176A"
                     /db_xref="GeneID:66977133"
     mRNA            complement(<508449..>509009)
                     /locus_tag="ACHE_10176A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276364.1"
                     /db_xref="GeneID:66977133"
     CDS             complement(508449..509009)
                     /locus_tag="ACHE_10176A"
                     /note="COG:S;
                     EggNog:ENOG410PKVH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131296.1"
                     /db_xref="GeneID:66977133"
                     /translation="MRTHHMKALVKYVEQGGILETHDNVPDTIRDQLYAEERQRMDKR
                     QKSPNPPTGSMYPPININVAPTQSPQPSNNTHDRTETTAFGQADLDIPGPIEEAVEEY
                     TNWHLEKVDTENFKENIWKARDIVLENCLDLGQLDNPKIGAEFFVKEGVKIGVACRFV
                     SDTGKWLKQRKRKRVTEDDDYEPISD"
     gene            complement(<509547..>509870)
                     /locus_tag="ACHE_10177A"
                     /db_xref="GeneID:66977134"
     mRNA            complement(<509547..>509870)
                     /locus_tag="ACHE_10177A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276375.1"
                     /db_xref="GeneID:66977134"
     CDS             complement(509547..509870)
                     /locus_tag="ACHE_10177A"
                     /note="COG:S;
                     EggNog:ENOG410PKVH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131297.1"
                     /db_xref="GeneID:66977134"
                     /translation="MPDVINFRILGGIFCLEDMSSYPLNGDVSNQVSGWEQTPSYAPT
                     PGNFGREPTPSVFCPSPAYTYGDPSFPSHRPASYCLGFLEYTGLNRRGTHNGDTPESI
                     AYLIE"
     gene            <512366..>513954
                     /locus_tag="ACHE_10178S"
                     /db_xref="GeneID:66977135"
     mRNA            join(<512366..512582,512638..513457,513507..>513954)
                     /locus_tag="ACHE_10178S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276386.1"
                     /db_xref="GeneID:66977135"
     CDS             join(512366..512582,512638..513457,513507..513954)
                     /locus_tag="ACHE_10178S"
                     /note="CAZy:GH15;
                     COG:G;
                     EggNog:ENOG410Q2DX;
                     InterPro:IPR011613,IPR000165,IPR008928,IPR012341;
                     PFAM:PF00723;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0004339 - glucan 1,4-alpha-glucosidase
                     activity [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0005976 - polysaccharide metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131298.1"
                     /db_xref="GeneID:66977135"
                     /translation="MLLKSVFFANAIASAVASPASFQKRQDVDSYVEAEKPIALQGIL
                     NNFGPNGNLSRGAAPGVSIAGNSETNPPYIYTWTRDSGLTMQSLIQEFLTGNTSLEPL
                     IQQYITAQAKIQTITNPSGTLSDGSGLGEPKFNINLTAYTGPWGRPQREGPAVRASAL
                     IAYGNHLLEQGQRDKAVQNVWPVVRNDLAYVGQYWNQTGFDLWEEVNGTSFFTTAVHH
                     RALVEGQTFAKALGQTCEGCTVAPALLCHLQEFWNGTAIVSNYPTANDAKGRSGIDIN
                     SVLTAIHVFDPAARCDDVTFQPCSARALSNHKVFVDSFRAIYGINQGKTAGKAVAVGR
                     YPEDVFMGGNPWYLATLASAEMLYDALHQWDHQHAIHITNLSLPFFTDLLPGIKPGVY
                     PSATPTYQKITSAVRTYADGFLSVVQEYTPADGGLSEEYDRDTGVQVSAPDLTWSYAS
                     FLTAVARRDGYVPSSWGSSAALKVPGKCNGASVKGSYAAAKPSW"
     gene            complement(<514115..>514616)
                     /locus_tag="ACHE_10179A"
                     /db_xref="GeneID:66977136"
     mRNA            complement(join(<514115..514278,514337..514546,
                     514601..>514616))
                     /locus_tag="ACHE_10179A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276397.1"
                     /db_xref="GeneID:66977136"
     CDS             complement(join(514115..514278,514337..514546,
                     514601..514616))
                     /locus_tag="ACHE_10179A"
                     /note="COG:S;
                     EggNog:ENOG410PQ08;
                     InterPro:IPR036527,IPR003033,IPR039543;
                     PFAM:PF14864,PF02036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131299.1"
                     /db_xref="GeneID:66977136"
                     /translation="MTLKNDEFPSSAAFDVINATLQADENERKDAISKAKAVVAFNIK
                     NDAGKEEAWHLDLKEKGVVAKGAAPAGGKADVTLNLSDKDFQDLVTGKANAQRLFMGG
                     KLKIRGNIMKATKMEPVLKKAQGKAKL"
     gene            complement(<515327..>517817)
                     /locus_tag="ACHE_10180A"
                     /db_xref="GeneID:66977137"
     mRNA            complement(join(<515327..515801,515852..517031,
                     517077..517535,517583..>517817))
                     /locus_tag="ACHE_10180A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276409.1"
                     /db_xref="GeneID:66977137"
     CDS             complement(join(515327..515801,515852..517031,
                     517077..517535,517583..517817))
                     /locus_tag="ACHE_10180A"
                     /note="CAZy:GH55;
                     COG:G;
                     EggNog:ENOG410Q1N1;
                     InterPro:IPR012334,IPR011050,IPR024535;
                     PFAM:PF12708;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131300.1"
                     /db_xref="GeneID:66977137"
                     /translation="MRATFFATTWLLLTGLSAQLPQRPSDTVVCQAPETTSIAAPGDA
                     SYWLADIEHQGVAAFNPNPSGYKVFRNVKDYGAKGDGQTDDTEAINRAISDGNRVSPE
                     SRRTSTTTPAIVYFPEGTYVVSRSIVDYYFTQLVGNPNARPVIKATAAFEGLGVIDGD
                     VYQNDGNQGWTSTNVFFRQIRNFVIDLTDISPNKGATGIHWPTGQASSLFNIKIVMSS
                     APGSQHQGLFIENGSGTVLDDVEIIGGLYGANIGSQQYTTRNLRISDSATCISQIWNW
                     GWTYQGVELNNCGTAISMVNGGPGSQTVGSVTVIDSDIKNSHVFVDTVWQESPWSNGS
                     LILENVALENTPVAVQASNKTVLEGGSKTITAWGQGHSYTPAGPKNFQSAMTPGDRPR
                     GLLAKDSNRYYTKSKPQYEKLPVSSFVSVRDGGAKGDGSTDDTKALQSVIDNARREKK
                     IVFFDQGVYKVTNTLQFPPGIRIVGEALPVIMASGGPWTDINKPVPVIQIGQPGDTGF
                     FEWSDMIVSTQGSTPGATLIEWNLDAEQGSGMWEVHTRIGGFAGSQLQVPDCPTVSQV
                     STKCQAAYMSMHITKSARNVYLENNWFWTADHDLDDPHDTRVSVYTGRGLLVEGKNVW
                     LYGTSSEHHSLYQYQLTNTDSVFIGFVQTESPYYQPNPDAPHSPYKPNPTLNDPDFTH
                     CLSGNCNSLGLRLLNTRDTVIYGAGLYSFFNNYDTTCSANDNNQVCQSEVFSIEGETS
                     GLVVYALSTIGTEWMVVRDGEGVVRAGDNRATFADTVAWFKL"
     gene            <519734..>523808
                     /locus_tag="ACHE_10181S"
                     /db_xref="GeneID:66977138"
     mRNA            join(<519734..519855,519968..>523808)
                     /locus_tag="ACHE_10181S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276420.1"
                     /db_xref="GeneID:66977138"
     CDS             join(519734..519855,519968..523808)
                     /locus_tag="ACHE_10181S"
                     /note="COG:U;
                     EggNog:ENOG410PSJ1;
                     InterPro:IPR000156,IPR011993;
                     PFAM:PF00638;
                     go_process: GO:0046907 - intracellular transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131301.1"
                     /db_xref="GeneID:66977138"
                     /translation="MSKRGNEGPQGDKDSLNEFLMASTPEEKPQRASAAQLANRKIKD
                     VRRRRPGTAAASPAPPQQPFSSPFGSLNQNALNQNANPPAPTNGFSFGQSQSFPGPAP
                     SSSQPGTNGASSPFSFGGGSGGPSFNFAAGPSTTASNPFATVSTAAPSQPTDGGGFGG
                     FKGNIFNLAPTSPAPSGGLFGATSGPSAGVTPATSGTGLFGQTSVSSPAPTPAASTNI
                     FGQPTSDKPTIFSQSTGSDDSMQTSPDAKSSTASKPSIFGNGTTPAPPPTFGGFGGNN
                     LFSKPESSAPSPSPTKPLFGAKPDEKSTPATPCTFEAKPAEQSGAASPSIFGATTQTS
                     SAMTTSTAAPSLFGASTTSQNPFQSGNLFSGVPAATEKPQEEKKPSDSAPFQFTPSAS
                     TGASLFSKSETTPAAGGLFGQKPSFGASQPPSTGNLFAPKPPASTEEKAPAVNPFGGI
                     FAPKPAQPATESKPEEGKQQPAAQSSFSGGLFAPKPSEPAKPITTPSFSASTPAASTA
                     KPPSAFQPSTSLFQLPPTAAPAPAPQRLETMQPKGLSVDLNKHLKDDVELLNRVRILN
                     ESFKREITRLDPSKDDFDLVILYYMRVRDTIGAPTGGEHAPKRKTRDEDGDQGVPAQK
                     KVKPFGEAPSPPPPQMNIGPSSITSTPSKLFGASEIASPSKRKADEEDGEPSSAKRSQ
                     GDSATASIFAQTFSNSKSAESEKEETSRVPVSSPFKPSTPESKKVAPVSTTPTASPAK
                     TLFPTSAVSKEPSAPTSLFGQPSSASKPASEAPKTDAAPANPFTLKPTEIKSAEPTAA
                     PSFSIPKFGSGGGTNFFAQFKTQADKQAEKEKAKRKEEDFDSEEEDEAEWERKDAEQQ
                     RKKREELEAQSQRRAKFIPGQGFSFEEDDSTNTQDSTNTQDSKKSDETNGVSFASSAT
                     SVFDTKSETEEKPSNIFSHLSATPTEVEENDGNDTEEASDNEDEGPGPKAATASRDDG
                     SNDSEDGDFGKALKKSKTSDKPAAATETTSESTPAKPAGGSLFGSDQEKEGESKSGEA
                     TPKNPFASLFSTPKPAALSSGTPSLFAPTTSTSGSTSIFGASTNATGGSLFGASSTGT
                     GSLFGAGQNGVKNDQTWKKDSPIKFASDSKPDSTSSSEAPKPFSTLFGAPPAPKPSAS
                     GDSKPTLGFTFGAPSTQTSSIFSSAAASAATSTASTPGTSDAGAGESGDGEAAEALPQ
                     VDLARGGAGEENEDVLIETRARGLKMAKEGWDSQGVGFVKILKNRETSRSRVVLRADP
                     SGKVLLNASLMKDIKYTVNGTGVFFAVPQPDGSLEQWAIRTKKEDIGRLGSTMEEAKA
                     "
     gene            complement(<524698..>525021)
                     /locus_tag="ACHE_10182A"
                     /db_xref="GeneID:66977139"
     mRNA            complement(join(<524698..524810,524867..524931,
                     524987..>525021))
                     /locus_tag="ACHE_10182A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276431.1"
                     /db_xref="GeneID:66977139"
     CDS             complement(join(524698..524810,524867..524931,
                     524987..525021))
                     /locus_tag="ACHE_10182A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131302.1"
                     /db_xref="GeneID:66977139"
                     /translation="MYYQNRPTAVTRYPCVCPFWPRNARDSNNTVHYDPARKQEINLE
                     NQPIDNMDVTHCTLAPFTPDDERDTE"
     gene            complement(<527556..>528337)
                     /gene="RPL31"
                     /locus_tag="ACHE_10183A"
                     /db_xref="GeneID:66977140"
     mRNA            complement(join(<527556..527762,527828..527902,
                     528251..>528337))
                     /gene="RPL31"
                     /locus_tag="ACHE_10183A"
                     /product="60S ribosomal protein L31"
                     /transcript_id="XM_043276442.1"
                     /db_xref="GeneID:66977140"
     CDS             complement(join(527556..527762,527828..527902,
                     528251..528337))
                     /gene="RPL31"
                     /locus_tag="ACHE_10183A"
                     /note="BUSCO:EOG09265EOF;
                     COG:J;
                     EggNog:ENOG410PP8V;
                     InterPro:IPR023621,IPR000054;
                     PFAM:PF01198;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="XP_043131303.1"
                     /db_xref="GeneID:66977140"
                     /translation="MSNVQTQKKQRSAIADVVTREYTINLHKRCHGVTFKKRAPRAIK
                     EIRNFAEHSMGTKDVRLDPQLNKKVWECGIKGVPFRLRVRISRKRNDEEGAKEKLYSY
                     VQAVNVKEPKGLQTTVVDDE"
     gene            complement(<530536..>533225)
                     /gene="VPH1"
                     /locus_tag="ACHE_10184A"
                     /db_xref="GeneID:66977141"
     mRNA            complement(join(<530536..532901,532954..533032,
                     533100..>533225))
                     /gene="VPH1"
                     /locus_tag="ACHE_10184A"
                     /product="H(+)-transporting V0 sector ATPase subunit a"
                     /transcript_id="XM_043276453.1"
                     /db_xref="GeneID:66977141"
     CDS             complement(join(530536..532901,532954..533032,
                     533100..533225))
                     /gene="VPH1"
                     /locus_tag="ACHE_10184A"
                     /note="COG:C;
                     EggNog:ENOG410PGDY;
                     InterPro:IPR002490,IPR026028;
                     PFAM:PF01496;
                     TransMembrane:7
                     (o427-452i464-484o551-569i581-604o647-667i759-779o791-
                     812i);
                     go_component: GO:0000220 - vacuolar proton-transporting
                     V-type ATPase, V0 domain [Evidence IEA];
                     go_component: GO:0033179 - proton-transporting V-type
                     ATPase, V0 domain [Evidence IEA];
                     go_function: GO:0015078 - proton transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:1902600 - proton transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit a"
                     /protein_id="XP_043131304.1"
                     /db_xref="GeneID:66977141"
                     /translation="MAPRDTFFRSADMSLTQLYIANEIGREVVSALGELGQVQFRDLN
                     PDTNAFQRTFTKEIRRLDNVERQLRYFHTQMEKADITMRSSTEFSDTLAAPLASEIDE
                     LAERSESLEQRIASLNDSYETLKKREVELSEWRWVLREAGGFFDRAHTQTEDIRQSFD
                     NDEAPLLRDVEQQQPQRGVNGDAGQQHSFQEMNIGFVAGVIPRDRIGAFERILWRTLR
                     GNLYMNQSEIPEPVVDPATNEETRKNVFVIFAHGKHIITKIRKISESLGASLYGVDEN
                     SELRRDQIHEVNTRLGDVGNVLRNTKNTLDAELRQIARSLAAWMIIVKKEKAVYDTLN
                     RFSYDQARKTLIAEAWCPTNSLGLIKATLQDVNDRAGLTVPTIINQIRTNKTPPTYMR
                     TNKFTEGFQTIVNAYGIPRYSEVNPALYTVVTFPFMFAVMFGDLGHGFLMTLAASAMI
                     LWEQKLLKTKLDELTYMAFYGRYIMLMMGLFSMYTGFLYNDIFSKAFTFFPSQWQWPE
                     DLQQGQAVEATLKDGYRFPIGLDWNWHEAENSLLFSNSMKMKMSILLGWAHMTYALCL
                     QYVNARHFKSKVDVIGNFIPGFIFFQSIFGYLVLTIVYKWSVDWAAKGQSPPGLLNML
                     IFMFLSPGTVEEPLYPGQSGVQVFLLLLALVQVPLMLFFKPFYLRRENQRARAQGYRG
                     LGEPARVSALDDENGRDSLASDGDGTTEGTAMIAQDLDADDPEHEEFDFSEVMIHQVI
                     HTIEFCLNCISHTASYLRLWALSLAHQQLSIVLWDMTIGGAFEQEDPNTRVVMIVVTF
                     FMWFTLTIAILCVMEGTSAMLHSLRLHWVEAMSKHFQGEGIPFVPFSFKTLLEEEPVD
                     "
     gene            complement(<533754..>539753)
                     /locus_tag="ACHE_10185A"
                     /db_xref="GeneID:66977142"
     mRNA            complement(join(<533754..533816,533873..539276,
                     539335..>539753))
                     /locus_tag="ACHE_10185A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276464.1"
                     /db_xref="GeneID:66977142"
     CDS             complement(join(533754..533816,533873..539276,
                     539335..539753))
                     /locus_tag="ACHE_10185A"
                     /note="COG:O;
                     EggNog:ENOG410PFXY;
                     InterPro:IPR016024,IPR032372,IPR021843,IPR032430,
                     IPR035309;
                     PFAM:PF16547,PF11919,PF16507;
                     go_function: GO:0016504 - peptidase activator activity
                     [Evidence IEA];
                     go_function: GO:0070577 - lysine-acetylated histone
                     binding [Evidence IEA];
                     go_function: GO:0070628 - proteasome binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131305.1"
                     /db_xref="GeneID:66977142"
                     /translation="MANSGPKAIPTAENFHNMPRATSAEQPAVLNGKGEPKARVRPRT
                     YPYFKYLPYTTEDEPVRERNLREILDHLYIAVEAGDFSPGAVHWTRELRAWLSLKFDP
                     TRTERINLVKLYYELSMAPGIDPNIAERFASMFMFLTKRKHYLKPVKDLVLDWKPLYK
                     ELKAFVLPTESGLVHSTNLKRNVKTLTKLCAFIQLYIDPCEVPAMLDEFLPHYTTSFS
                     EGAFVVVGLINLMLPTSPPPADREDLLPHHYLPTYFHLWSLVGRSRTFDTTFLDFFSR
                     LARDCLSADHVPLSEYGLFTKEQSSLIFTAILRLLEIPVGQSTSPYSALVDISSGLGI
                     MLDRDSRKHPVAHHIARWVVMSLSPACLESEESILSQLEGLIQAVETFFHPSNSGGWS
                     KTLSQLVYYLADFFVMRWNREQSGEMEMPPERRLTEPLKRRFVLALRDVIFMGIYSKS
                     STAMSYSLSTLQSLAYLEPHLILPGALQRIYPSLQGLVEVHRTASSLRALQVLSRIIT
                     RTKGYRCHMTTLLGLALPGVDANDLEKSLHALTFIQTACYSIPLADLTRGRDDVNCNM
                     LAMQWITGEMERMEEQGVEVQLNYDTDLDDETEEMILRSSTCGFGDFIVSFLGRVFTL
                     LENLPDVSRVRNGSPEENIVNTLPATFMPLLSSLEPEYYDIALTKIIDFAANHVIHQA
                     RDAMAFICNAACKVNPQKALKRFIPLLTQSIRTEIDDNGAGSTRTTGADVLPRDRGLV
                     WNISMLSMCIVHVGDAVLPHKKELFDIAVYMQQKCRGIPTVHISNFIHHLLLNLTGTY
                     TTDYSLYEPSVVAQGIGPDLWSYKQDPHDMNVKWHIPKREEIEFAVELFQNQAETALK
                     QLTALTNETSSIKRDGTGKDWSDEVTRNLVLLRLILSGISVLFDSKAASTTKKGAANG
                     SAVPDGDVDMADAENATLANGAGDEDTDIALDSSDDATIRETFTYPTGYPLQEDDPLY
                     TRIHDLRERAGWILHDVHRFLADKQEDDVPSFGALYSAYRSWFVDVGIERSAHVLDRV
                     TRLLAADIYPYKMSGIRKDYPRPLLARRSYVYHLQRLRHNAAPRPRSRLDEILLLDIA
                     ESCVSLYTETRRNAQSAGESALKAVWGSRLLVIPPLIEALQKGVKENDHARIKGALFS
                     LLLSSVAKTAGRHWKFAPTLIRTFIDASAVDKPSVQRICSSALFQIMDYGRAMERMAV
                     LNQDIIEAIAPKGDVSEEINKLRKNINGKRVAIEKKKADLSEELVNLARVSHWKIASR
                     AATIVITMGLRFDYVASDNFIELVTQGSIDDHPGLRGMYSQALIALFTMIDVRAICSH
                     DYQNYIFGHQNFPSKIQVATKRDEKNWTEEYLASFAKPEAEYYIDHDFPGWLVWSDSM
                     PAYKSNVARDIEYDETEWKVRSYMGKLFDRAWFQKFFMYLKQEPRDPSADKFRMPCAM
                     MLLYAFELMIRDGLTAATFEDIKEEIEAVFEDGSDKHQHRATSEILGALISSVTDGGV
                     EKRTQIWEYAFPIVRKIFSEGLTPENSGYWTTFLHMILQCRDPRRAWPLVDWLASFRL
                     DLATNAAFKESSKINMLHQCIIDAGWHFQLEKPIVEDFLAHLDHPYKGVREAMGQTLA
                     TVYRTRYHESYPDVKHLLEAQEKESSVGTFPYLPDENFNKMLRSIFSQIEQWRHQRTP
                     GQQTPSSYTSGCKTVLLWLDSTLSSHECTQLVPFFPDVFTGQLLHMMDVKEDPELQSL
                     AYHVFRHLPNIPYPAEKNSGFISSLIQIGRTSPSWHQRLRVMINIQIIYFRRLFLVSP
                     DDRDRLFECIAEMLQDTQHEVRVGASATLSGMIRCSPVSLRDIMVSRLLERFTKILVD
                     NPVPKRRRSGPASAVPSGSGTPTPEHTKLVIARHGAVLGLGALIQAFPYNSPPPKWMP
                     EALTTLSIRAANDPGIVGSSVKGIISDFKKTRQDTWHIDAKAFTPDQLEDLSGVLWKS
                     YFA"
     gene            complement(<540512..>542014)
                     /gene="GPI18"
                     /locus_tag="ACHE_10186A"
                     /db_xref="GeneID:66977143"
     mRNA            complement(join(<540512..540950,541006..541618,
                     541669..>542014))
                     /gene="GPI18"
                     /locus_tag="ACHE_10186A"
                     /product="ER membrane glycoprotein subunit of the GPI
                     transamidase complex-like protein"
                     /transcript_id="XM_043276475.1"
                     /db_xref="GeneID:66977143"
     CDS             complement(join(540512..540950,541006..541618,
                     541669..542014))
                     /gene="GPI18"
                     /locus_tag="ACHE_10186A"
                     /note="BUSCO:EOG09262GLP;
                     CAZy:GT76;
                     COG:G;
                     EggNog:ENOG410PH12;
                     InterPro:IPR007315;
                     PFAM:PF04188;
                     TransMembrane:9
                     (i21-41o129-153i165-185o191-208i262-285o335-354i381-
                     402o408-427i439-461o);
                     go_function: GO:0000009 - alpha-1,6-mannosyltransferase
                     activity [Evidence IEA];
                     go_function: GO:0004376 - glycolipid mannosyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ER membrane glycoprotein subunit of the GPI
                     transamidase complex-like protein"
                     /protein_id="XP_043131306.1"
                     /db_xref="GeneID:66977143"
                     /translation="MIMSSVKQIDRPSLLNPLRPLWSLTVAFVLWKSLLFLVVTACPG
                     PGYDTSTSLLPYLNRSPTRPAADVGVGSTLPLKFVRWDPIYFVHIVQHGYVYEQEWAF
                     GYGFTSIWRFVASFLNPSEEVGNVAQVAWTGVGLSHLAHYLSVLALYKLSANVFGRET
                     STQRLICFLSAALHIIAPAGAFLSAPYPEPIFSFLNIFGLYLYSSSFLDDGAGRKLPR
                     DAKLLGAAVSFAVATTVRSNGILSGFLFAYDAIWQLRMVLLHGLSWNVVVRLGVIVLG
                     GCVVALGMVLPQWVAYTTYCTTDSRPWCQWTLPSIYGWVQKQYWNVGFLRYWTVSNTP
                     LFLLAAPMLVLLCCASLWALKMPWAAIKERPTTVIDRTMSPEDTDSLLIRLAVPQGLL
                     ALMAFTSYHVQIINRISSGYPLWYWYLVCLVVDHVGESPSAAKSNRLFAIVLQAMVVY
                     GLIQAVLYGSFLPPA"
     gene            <543519..>545261
                     /locus_tag="ACHE_10187S"
                     /db_xref="GeneID:66977144"
     mRNA            <543519..>545261
                     /locus_tag="ACHE_10187S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276486.1"
                     /db_xref="GeneID:66977144"
     CDS             543519..545261
                     /locus_tag="ACHE_10187S"
                     /note="COG:S;
                     EggNog:ENOG410PR4E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131307.1"
                     /db_xref="GeneID:66977144"
                     /translation="MLFNLGLTADAAAAHESDLVGPQSPPNPPTRASSPLTALSSLPS
                     LGTIYNKYKTMEPQATHGAALRDMTRSPVESVLSSDGEHSVVDTGFRASRVGRSHSVR
                     KSLRPKTSYQLAHPASHAHHRCFKIRPKLLLQLQQVSHTPRPLPILDVLPSTVFLPRL
                     ARKFPTIFRGKNGLGPNDLIIVTSDLYDADPRDRTSQGDDSEDDEQQEVVATICQLLN
                     EEDLSKGKAEICFNRGPAWEATPLPNGAYEFVARTAQGVQTLRWVPRGSKSRRVSAPP
                     GSPVQPESKRFTFSVINPNTRRHPVLASMTRNNLEVFDQYSMPTAAPSSLPTSAMSMI
                     SDGSDDTPVDRNLIAVDDDLRLLIIITSIWVAFREGWSHNFRYNDSALVLNSKMSSPV
                     VSRHASPTTIKHAPDYFSVDKEGQTVENPPRKHRVSMSNVPLSSERLKSLASARLAKR
                     SNSTGAAFIERSNRRSSGSKRPQRHSFLPPSDLSRDGVAGLEAIPSESITNGSGQAKN
                     GNPHSENTVKFANPEPTSEKPRRKASQRVPQPEPTTSRGLDGQTSESSPPAPKSKRRH
                     RISGFFDCIFRRHH"
     gene            complement(<547617..>549905)
                     /locus_tag="ACHE_10188A"
                     /db_xref="GeneID:66977145"
     mRNA            complement(<547617..>549905)
                     /locus_tag="ACHE_10188A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276497.1"
                     /db_xref="GeneID:66977145"
     CDS             complement(547617..549905)
                     /locus_tag="ACHE_10188A"
                     /note="COG:A;
                     EggNog:ENOG410PFU8;
                     InterPro:IPR022783,IPR000467;
                     PFAM:PF07842,PF12656,PF01585;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131308.1"
                     /db_xref="GeneID:66977145"
                     /translation="MEPPSNSSFGGQKRKIADMSSDEDDARPATSFRGFKRASSRSES
                     PPTSGLGARRNPMMQAATPAPRGGNATGGLKGANSFAARMMAKMGYKEGQGLGSSGQG
                     IVNPIEAQARPQGIGLGAVREKTKQAREEEKRAAALRGEEVEEDSSDEERRRRQKKKE
                     ARKRAGERSETGTPVPRVAKPKFRTAREIEEDMDGLEVPNVLKSLIDATGKEQKVLTS
                     TAGLMAQQEFVSSGEGEAAKIARRARHDLEAFADEWKGLTERKKYIEMEEAQLVDQLD
                     TNQQKIDQFTELVTTVGQLEIFQDESIAGKFEEVTSKLEALQVKYNDHIDEYRLSETA
                     VAAIHPLFRQAMEEWEPLQDPTFLLSHLRRLQPLLSRKGEDEHRTRSSTSPYETMIYT
                     LWLPRVRSALLNDWDVFDPGPATTLVVSWKEALPSFVYANLLDQQIVPKLSGGLKQWK
                     PRSSRRHPSSEHSSRFPWWLFTWLQYLDEKHTNPKQPTGLMSDAKRKFRVVLDTWDFR
                     KGVVSGVELWKAALGREFDVCLRNHLLPRLGHHLRENFEVNPQDQDLTPLEDIFKWKD
                     WFAPNVLGLLLVAEFFPKWHYILYIWLTNDPNYEEVGEWFSWWRSQIPREVNELVIVD
                     DEWKKGLQTMDLASRLGDRAVTELPPPTQPSAVPEPQPQAKPTQPPAETRKPRVVEEV
                     AFKDILEGWCAEQGLLIIPLREAHPQNGQPLFRITASATGRGGVVAFIQGDVVWVQNK
                     KAKEIWEPVGLEEGLVEKAEGR"
     gene            <550221..>551226
                     /locus_tag="ACHE_10189S"
                     /db_xref="GeneID:66977146"
     mRNA            join(<550221..550347,550556..550962,551021..551088,
                     551139..>551226)
                     /locus_tag="ACHE_10189S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276508.1"
                     /db_xref="GeneID:66977146"
     CDS             join(550221..550347,550556..550962,551021..551088,
                     551139..551226)
                     /locus_tag="ACHE_10189S"
                     /note="COG:P;
                     EggNog:ENOG410PUNZ;
                     InterPro:IPR036314,IPR019833,IPR019832,IPR019831,
                     IPR036324,IPR001189;
                     PFAM:PF02777,PF00081;
                     go_function: GO:0004784 - superoxide dismutase activity
                     [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0006801 - superoxide metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131309.1"
                     /db_xref="GeneID:66977146"
                     /translation="MAASLFRTSTRAALRSGASATPRAGVAGLTFARGKATLPDLSYD
                     YGALEPAISGQIMELHHKAHHNTYVNNYNAAVEQLQEAQHKGDISAQIALKPAINFNG
                     GGHLNHTLFWENLAPKSAGGGEPPSGALATAIDNTFGGLDKLQAQINTALAGIQGSGW
                     AWLVKDKQTGQISVRTYANQDPVVGQFQPLLGIDAWEHAYYLQYQNRKAEYFKAIWDV
                     VNWKAVEKRFS"
     gene            <551556..>553022
                     /locus_tag="ACHE_10190S"
                     /db_xref="GeneID:66977147"
     mRNA            <551556..>553022
                     /locus_tag="ACHE_10190S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276520.1"
                     /db_xref="GeneID:66977147"
     CDS             551556..553022
                     /locus_tag="ACHE_10190S"
                     /note="COG:S;
                     EggNog:ENOG410PJ10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131310.1"
                     /db_xref="GeneID:66977147"
                     /translation="MSVESPGDRQGFRAFFANALRPKRSRRVLRKANASTPDLRSTAL
                     AQKLDNDIPPVPKLAPLQAHQEKYRAAAGQIDSQLGENRDYTTIIHSLGIHGTGNHEQ
                     DAEDWEYDPRRPGEPLIASLSMTLWGMVAENLDPADRASLAFASKTLFNRLGPGPWIE
                     LDHPENREYRAEFLVSQDRFLPHHLLCFPCAKFHRRTQEGREKLQPATVINPLFECPN
                     ARNAALPAPRHRITHGRTLYFAFVQLAMRAYRFSPYYGITVESLSRRWQRDGWSHHSR
                     YLVSKGRLLMRVVSSTFAPPDLPPSSQRLLLYSREDYWPFFSACAHWRDGELMNVCKC
                     ALSHIPKPRPTAGLQGVEHRAKDLAHGRIYNPNAITTLCGKCRPMRRCPDCPSEYLVE
                     IKLTEDRANPKSIHFRHAIVVTRWCDLGDGTSPKSSPEWAAINGEGERYDSFKLLGKR
                     TISGTFESALTDDTIPGQRVLNMNPKGKRLGEAGTNWY"
     gene            complement(<554162..>557184)
                     /locus_tag="ACHE_10191A"
                     /db_xref="GeneID:66977148"
     mRNA            complement(join(<554162..556315,556372..556652,
                     556710..556958,557064..>557184))
                     /locus_tag="ACHE_10191A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276531.1"
                     /db_xref="GeneID:66977148"
     CDS             complement(join(554162..556315,556372..556652,
                     556710..556958,557064..557184))
                     /locus_tag="ACHE_10191A"
                     /note="COG:S;
                     EggNog:ENOG410PP8G;
                     InterPro:IPR012943;
                     PFAM:PF07989;
                     go_component: GO:0005815 - microtubule organizing center
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131311.1"
                     /db_xref="GeneID:66977148"
                     /translation="MDKKQRHGSFSVSSCLADPSPYPLHHTSRCRSESLKNLPNDTPE
                     SPRPASLVRVKGQELAMQTPPKKSGMLAANSTIYPTTRDGVDNRSEMVWANDQSPTKS
                     PSKRTPGRPGTPGTPGTPRRAGTPEASSTLVNPSSALLQDLLKEQRACRGVRASTEEM
                     DAQVPRTPDRPSARSRSQSQSQSQSQDDTSDKQKKFNSALSAGLRQPREMGVREMDQY
                     VSKMNKQNFDLKLEIFHRAQQVSALEKRMERMEELEGEVKRIGALEDELQELRHAEED
                     NQRLRESNEQLRQELDKRDQAVTEAVDLICQLEAKVAELEAANPSRPSTAPSEGTDVA
                     TPKQPTFDNLERTTPKCVTKLDQHRDASPERPHLQSAPSFLRDENRTPALRGLYIPSG
                     NQSQSAMSVITKSESLNSMNETAEPASPRLSALSECSDLIPEEVPVLEEEADQPENGS
                     RGEESEAGSSDTFGRKFQVRSQERKREHINQWIRPMPGVYSNQNGSPRQKKRSNDSMD
                     PRQRVRMDGLFGGSRLPPTPDTMSTAPRNNRSNGSIQAAKGRKQQLDRPRSFDELTSR
                     RSSDNSARTGSMGTNMSDTSGRELQAIERHETPAIAPLNSISTKHRRHASCQESTTSW
                     DGTDHHGENENKSKRHTVNLPSSSPQLTPQDWVEAANSTPEEKAGYHKPSKYYQNSAS
                     MGTRYPAKTSFDVRRHSMDSAIRRSTTEPTLDPHSLEFAPHPAVRPPAPAPEPARRRI
                     SFRPPFFSLFGNSRRLQQSATQDSRSSEEHAPAPVVPKARTSGLKSTPKLIEYRPTSS
                     RAELGPPLPTYADPAQRALIHSSTESNVMNNGTRPITSNSKEHKRRSSLSIIGWMKGA
                     TGKKSEPSSPITPTQSNNAVRSRRSSLRMTPDISDSAKDMAANTSTHAFTGSPNPNPD
                     EAGRRLRYIERRGRRGSLMR"
     gene            complement(<558513..>559368)
                     /gene="PSF3"
                     /locus_tag="ACHE_10192A"
                     /db_xref="GeneID:66977149"
     mRNA            complement(join(<558513..558586,558662..558770,
                     558837..559026,559083..559141,559206..559274,
                     559327..>559368))
                     /gene="PSF3"
                     /locus_tag="ACHE_10192A"
                     /product="DNA replication protein"
                     /transcript_id="XM_043276542.1"
                     /db_xref="GeneID:66977149"
     CDS             complement(join(558513..558586,558662..558770,
                     558837..559026,559083..559141,559206..559274,
                     559327..559368))
                     /gene="PSF3"
                     /locus_tag="ACHE_10192A"
                     /note="BUSCO:EOG09264O2D;
                     COG:L;
                     EggNog:ENOG410PNMZ;
                     InterPro:IPR038437,IPR021151,IPR010492,IPR036224;
                     PFAM:PF05916"
                     /codon_start=1
                     /product="DNA replication protein"
                     /protein_id="XP_043131312.1"
                     /db_xref="GeneID:66977149"
                     /translation="MSYYDVDSILTDAQKLPCTFELEVPGLGILEGNPGEDLKPGTRI
                     DLPLWLGEMLSIGARLGTSRLVSLDLPSALSERVMNALKADPRTVDLRALAPHFYNLS
                     ERILELFEEEEMVDVLSNTFRKRAAEIADHAHNPRGAMGDGVEFLRGLDETERQLFRI
                     AHDSAKQMRIWSGEAKKPKT"
     gene            <561191..>563767
                     /locus_tag="ACHE_10193S"
                     /db_xref="GeneID:66977150"
     mRNA            <561191..>563767
                     /locus_tag="ACHE_10193S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276553.1"
                     /db_xref="GeneID:66977150"
     CDS             561191..563767
                     /locus_tag="ACHE_10193S"
                     /note="COG:S;
                     EggNog:ENOG410PJ8E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131313.1"
                     /db_xref="GeneID:66977150"
                     /translation="MTYNAVSQDDPEVASNASDSDASRSSSPALSQQRHGFQQLPSDA
                     DSLGAGNHLEPARAADDISVGNLVSMIRSMSSASYDMVEEDDDYEQPIEPESNSSRRG
                     PPPIDTATINAAASPNESQFQSRSASCNVSPDEPTLRSPASDKPVPLSHPTPDLQSLQ
                     GAYLGNVERLERSAEQMSAGSSDIASEIRKMDLEQKRRSSTASVANSAIASNINLQSP
                     RGSVRSATRMPSSQLALLTEDGYEGQSSNVQTQGAPVILQPPAAIQYDHQYYPGHYDI
                     ERPSSAASGDTYQQARILFSDFDGVHYVPQDKGHGLERQASLARPPMAKRSRPYRAES
                     MVYYPAPVPATLKLPPRLSDKPAPQRETRRAHHRLSSVFLGHRRSTPGLSDRFATPRG
                     TDTTQSSPIATLDRMLDDSVHAPVTAPVYHPNPSPGMHRKLHRRMPSPNLTGQKKKRS
                     SLNLFRFHKKSPSPDDRPCTSTPSYLSQGHLPQPTEAEVAEAHENTALQSDASEQERD
                     TVGMVHSEEDIRDYMGPPNTLMAELEVRKHELKDRNRPAADRAGLRSTLLQLDAVAQV
                     QSEHRRQRPATIALDHHDAHNGGNGHDDEDVPLGMLYPEKPYIPAEPRPLGLLEKKQL
                     EEDEPLSRRRARLRGEQPADQSPRLSQHASTVYLPDTLNNASPESGDEEETLAQRLKR
                     LRAKNRNITAGNSDFASEIFAEISQLKEDGKEDGEASGEETLAQIRARLRQQDRKKPQ
                     SGRYANIPRNRRSMGSISLMRPVTAQRQSSASHHTALPYAQHAYAGSRMSLQQMPPNY
                     GHPQHVGYSLQDAYGNGMVHPNMAYRNCMGSGAPQHTTIGVSTPDLPQRDMIDRWRQS
                     VI"
     gene            <564516..>567674
                     /locus_tag="ACHE_10194S"
                     /db_xref="GeneID:66977151"
     mRNA            <564516..>567674
                     /locus_tag="ACHE_10194S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276564.1"
                     /db_xref="GeneID:66977151"
     CDS             564516..567674
                     /locus_tag="ACHE_10194S"
                     /note="COG:S;
                     EggNog:ENOG410PHUE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131314.1"
                     /db_xref="GeneID:66977151"
                     /translation="MPPSTVFSYWRRDHRRSSASPVPQQQHQQQPTSSSPSSKYNENP
                     PQLPVIPNTLDLSMGLGESDGSGSHTAQRASEENNHWEQSQTQADRLNVVAPSGSSRA
                     PSSSATNLTVPSSSLEKQTRPHSSPEERERAASVLTAHSSNSQLSCPGPRAEFGESDS
                     SSSKQNSPFRLSFGKGNTSSSDGQKQPPTSAPGTAVSGSSRSNVQIKTSPDVSPAEKT
                     TLSRKESKLERSNSRRHADRDGSSEHHHKSGKAMLHLLNPMSLLARRRSSRMASSKAD
                     DVKIGVPNLVPAIPDDYDPRIRGNIVHDFSAPRPRRNISTAPVLAQDAVGVNDSPQNG
                     HAPEPSNRTSEQKTKHNEHPPAFTEHFEDEQNALQVENKGYLQSPLLMNPMHQDNEHS
                     LPVFARNLPSKIPEHKEEQPVEQQQKEQQPQQPPQQPHEEAVLDPEPAPDSVKKGELP
                     PVHEEEDTVVEMPQQPSGLPRHLKSNASRFSFDMTGMESSVQEKLLEEKHKEKEAERR
                     AKYGSDDEEYSDDDFDEDLLDDMDGLEEKIPGVNTDADEDELVSGSGTMMMNKSWLSP
                     GLSPIIGSPASPVAPNPATFPMQGAPVPAELLQNPSHSHSPSLYENTTPGNNDINQRQ
                     QQMNARSSTGPGPVPLGANPGTSQVLEDDDDLYFDDGEFGDLDADVGDAGEKFDESIF
                     DDETSHLYDRKKKAAPDTSGEQQVARLEESSEEEGLGNLACRTGALGHAPSMASNYRA
                     GLQTSGSLSERARDAGSAKVHGGVLSEHNLEALHNALTKAATGNDRFERTDSMSDRSV
                     DQESAAQTAQTAESHPGLISDNSRLSQAIEPFGSEEVLEDFDYDDCDALYDDPIIAAA
                     NAEALENDDDGFYGQEFGFYAHAHGNGESELTNGGYFGPRGVEGISRSFSSRGKFREP
                     SLTPITERSERSTRNSVISLTAAHAPGHSNASMSSPGLAQLVDLGNLDDEMSLSALMR
                     LRRGAWGGSNGSLRSSSASPPPLAHQPHSSSNRGSFTALSDASPTIPTIPADVIWPGS
                     GSATGSPVQELERNGSSTASPV"
     gene            <568541..>571931
                     /gene="KGD1"
                     /locus_tag="ACHE_10195S"
                     /db_xref="GeneID:66977152"
     mRNA            join(<568541..568768,568874..570918,570970..571343,
                     571393..>571931)
                     /gene="KGD1"
                     /locus_tag="ACHE_10195S"
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /transcript_id="XM_043276575.1"
                     /db_xref="GeneID:66977152"
     CDS             join(568541..568768,568874..570918,570970..571343,
                     571393..571931)
                     /gene="KGD1"
                     /locus_tag="ACHE_10195S"
                     /note="BUSCO:EOG09260AZA;
                     COG:G;
                     EggNog:ENOG410PFJN;
                     InterPro:IPR005475,IPR011603,IPR032106,IPR029061,
                     IPR001017,IPR031717,IPR042179;
                     PFAM:PF02779,PF00676,PF16078,PF16870;
                     go_function: GO:0004591 - oxoglutarate dehydrogenase
                     (succinyl-transferring) activity [Evidence IEA];
                     go_function: GO:0016624 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, disulfide as
                     acceptor [Evidence IEA];
                     go_function: GO:0030976 - thiamine pyrophosphate binding
                     [Evidence IEA];
                     go_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="XP_043131315.1"
                     /db_xref="GeneID:66977152"
                     /translation="MLRTTAVKAASGSLSRGSTCSSCRRSFSLASNVARNSNGSKFGV
                     ATRRPLAVVDRLAGGYGRRQYAASAEDLEKGVDPNDSFLSGNTANYIDEMYVAWKNDP
                     SSVHISWQAYFKNMEDGNMPVSQAFQPPPTLVPTPTGGVPQQMPGEGLGLSGSPEVTN
                     HLKVQLLVRAYQARGHHKAKIDPLGIRGEAEAFGYSKPKELELDHYGFTERDLDQEFT
                     LGPGILPRFSTPDRKKMTLREIVATCEQIYCGSYGVEYIHIPDRKPCDWIRDRFEVPQ
                     RYQYSVDDKRRILDRLIWSHSFESFLATKFPNDKRFGLEGCESLVPGMKALIDRSVDY
                     GIKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGSTEPSDEGSGDVKYHLGMNFERP
                     TPSGKRVQLSLVANPSHLEAEDPVVLGKTRSIQHYNNDETEFNSAMGVLLHGDAAFAA
                     QGVVYETMGFHSLPAYSTGGTIHIVVNNQIGFTTDPRFARSTPYCSDIAKSIDAPVFH
                     VNGDDVEAVNYICQVAADWRAEFKRDVIIDIVCYRKQGHNETDQPSFTQPLMYKRIAE
                     QKSQIDKYVEKLIAEGSFTKEDIDEHKKWVWGMLNDSFDRSKDYQPTSKEWLTSAWNG
                     FKTPKELATEVLPHLDTAVEPELLKHIARVVSDGPDSFTLHRNLKRILSNRQKVVEEG
                     KGIDWATAEALAFGSLVNEGYHVRVSGQDVERGTFSQRHAVLHDQATEATYTPLQHVS
                     ENQGSFVISNSSLSEFGALGFEYGYSLTSPNAFVMWEAQFGDFANNAQCIIDQFIAAG
                     ESKWLQRSGLVLSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVYPSQDKLDRQHQDCN
                     MQVVYMTSPANMFHMLRRQIHRQFRKPLIMFFSKSLLRHPIARSELSEFTGDSHFQWI
                     IPDPAHGTAIDEPEKIERVILCSGQVYATLLKHREANNIRNTAITRIEQLHPFPWAQL
                     KENLDSYPNAQNIVWAQEEPLNAGAWSFTQPRIETLLNATEHHNRRHVLYAGRAPSAS
                     VATGLKSVHIKEEQEFLEDAFSIHQDRLKGE"
     gene            <576780..>577396
                     /locus_tag="ACHE_10196S"
                     /db_xref="GeneID:66977153"
     mRNA            join(<576780..577074,577137..>577396)
                     /locus_tag="ACHE_10196S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276586.1"
                     /db_xref="GeneID:66977153"
     CDS             join(576780..577074,577137..577396)
                     /locus_tag="ACHE_10196S"
                     /note="COG:S;
                     EggNog:ENOG410PQHQ;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131316.1"
                     /db_xref="GeneID:66977153"
                     /translation="MQLKNVILAATAAATVSAAPTDGQKPFGVLAIHSGSGVQNSGFN
                     AAKSSLFAGLPSQNASCARPEDGQTATFYIKDSELYLYDQSATPQKFYVDRSGMGQGK
                     IGYTTGAQQPPKNAEQKGWSVSEQNYLQFGGKSLIACPNSIDGAWSIWASAGVDNPAG
                     NENCVGIASRVIESTNPNGCKYTE"
     gene            <577684..>578136
                     /locus_tag="ACHE_10197S"
                     /db_xref="GeneID:66977154"
     mRNA            <577684..>578136
                     /locus_tag="ACHE_10197S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276597.1"
                     /db_xref="GeneID:66977154"
     CDS             577684..578136
                     /locus_tag="ACHE_10197S"
                     /note="COG:T;
                     EggNog:ENOG410PKCM;
                     InterPro:IPR000719,IPR011009,IPR017441;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131317.1"
                     /db_xref="GeneID:66977154"
                     /translation="MTPYRGHETGDPVGIGEVLDVRYRIFEKLGSGWYSTVWLARDQT
                     YYTAVKILDQDCYGGEHSIFELEILQRLRDSDPNHPRYRHVSIRLDYFMYERHMRLVM
                     ELMAEDMNGFCFSFEEVKIPNVTMKRITKQLLLAVDYARSLGIIHTVS"
     gene            <581987..>582493
                     /locus_tag="ACHE_10198S"
                     /db_xref="GeneID:66977155"
     mRNA            join(<581987..581992,582101..582106,582272..>582493)
                     /locus_tag="ACHE_10198S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276608.1"
                     /db_xref="GeneID:66977155"
     CDS             join(581987..581992,582101..582106,582272..582493)
                     /locus_tag="ACHE_10198S"
                     /note="COG:S;
                     EggNog:ENOG410PVGN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131318.1"
                     /db_xref="GeneID:66977155"
                     /translation="MVMRHKSQSPFLFCRDKGKAVLNEDEPSDDISDDEGQLPPEHYL
                     AQAKSLNVSQLRQQRYSDGTQEKLDETRMYWDR"
     gene            <585002..>585972
                     /locus_tag="ACHE_10199S"
                     /db_xref="GeneID:66977156"
     mRNA            join(<585002..585079,585133..>585972)
                     /locus_tag="ACHE_10199S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276619.1"
                     /db_xref="GeneID:66977156"
     CDS             join(585002..585079,585133..585972)
                     /locus_tag="ACHE_10199S"
                     /note="COG:S;
                     EggNog:ENOG410PPPA;
                     InterPro:IPR000719,IPR011009,IPR002575;
                     PFAM:PF01636;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131319.1"
                     /db_xref="GeneID:66977156"
                     /translation="MPGLDENVPSRAPDGPGDTTFTPTIDARSKDDTNIFPLDGVDIE
                     SVSNKELVRLGETAPVLYQIGSSKVLQICHDLVLKCGPLVLPSEGRALEFVRARTSIL
                     VPRVYRTFQVDDPFEYYGTRGYLVMDYVKGQNLGDCWKYLTKHQKDDVICQTAAIIKQ
                     LQSIPIPTAGPLGGDPCRGKFFTDYGAGPFNSGSEMEAWFNHKLKICKDYNQAPQNIP
                     SFDFQKFVLVHQDISPRNMILDAAGKVCLIDWAHAGAYPPAFERAAIAEQYRFPEFNK
                     MILHVMPEYDVEVRQLQSIWYGLSVASLA"
     gene            complement(<589777..>592065)
                     /locus_tag="ACHE_10200A"
                     /db_xref="GeneID:66977157"
     mRNA            complement(join(<589777..589886,589939..590375,
                     590422..590729,590829..591586,591648..>592065))
                     /locus_tag="ACHE_10200A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276632.1"
                     /db_xref="GeneID:66977157"
     CDS             complement(join(589777..589886,589939..590375,
                     590422..590729,590829..591586,591648..592065))
                     /locus_tag="ACHE_10200A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131320.1"
                     /db_xref="GeneID:66977157"
                     /translation="MAAAITSWVLNPIQSLTMSRPRTRELWCALSDGLQKSFPVECVA
                     DQDNINTLKKKIWEEIREKIKNTIPHYSDLKLYSPVVQLNHEEKFRIDDGEFLRPRRM
                     ITTNPLFPESKDPDVDIVVVMSGDTTTRKRKHSESQSVNIPQTQSIAVDPLICPREHT
                     VSKLAAILDDVNIVHVRGTPASGKTCLSQLLRDYYHKEGRKAFLITDWEKLDSENPWG
                     SFIELVKKNNKELEGAFTTSYTTTSLQSEQDLSWVVTSDTVILVDEAQKTYSDTVLWN
                     TIFKARQKSVCAYDFRLCLFCSYGSPGTGPDQTFFTPVTLANKQRISLTPQSQPGSPS
                     IGLFYSNEEFKDVVSRLIRFLSKQKQQFSFDEDALDYIFVLSGGHPGAVESLVNVIFQ
                     NYRHDIKHGIIRTLTEDHVIRFLEDTAKVFDKLSTESVDRSFPHIKRCTSKISNILNK
                     ITEEGSVPFNLNDADIRFCYQNGWIHRVALDGDDIAVLPSRLHEKYIEYSIGMISKPL
                     PARFDSLQKLCKEILSKFSIMNLRNSAEGKKMSTASQPRPVEAQYQAEFYRGFVHTAG
                     QGVPISSEWSRTRDGRVDFYIPEKKWAIELLRDHIEVNEHISRFKEGGKYHPWLEEKM
                     VKDWIIIDCATSLPTKEFSEPKLWHAVFANDYSVLQLHNHQKALMMSVHLKN"
     gene            <596792..>598060
                     /locus_tag="ACHE_10201S"
                     /db_xref="GeneID:66977158"
     mRNA            <596792..>598060
                     /locus_tag="ACHE_10201S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276643.1"
                     /db_xref="GeneID:66977158"
     CDS             596792..598060
                     /locus_tag="ACHE_10201S"
                     /note="COG:Q;
                     EggNog:ENOG410PUIW;
                     InterPro:IPR001128,IPR002401,IPR036396;
                     PFAM:PF00067;
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131321.1"
                     /db_xref="GeneID:66977158"
                     /translation="MHKKHPIIRIGPNSLSYGDLNAIRDIYGHGTKCYKDVFYQTEAG
                     LHFNLGNVIDKQDHARKRKMLAGAFAMKNVQAWEFKVAENVAHFIEACDKHCTAPLPE
                     SCQPPDPKDLTFDFRTWTNFFTIDAIANIALSEKLGVLRTGNDLVSAQTVDNVQYEVK
                     FRDCLHASKIAHTRIAYADKWYWFNSKYATRLLPSYRELWRLSQGWNDFVNHQARKRL
                     ARSFEDGKVDDFFQCLMNSKDGSPRSLEWGEIASEVGVLLDAGSATTAIALNNVMFWL
                     LRSPSCLARLQEEIDAALDVDTIVAPYDKVKHLPYLRACLDESLRLTPPFSYNLPRRT
                     PPDGAVILGTLIPGDTTVSMSSYVAHRDERIFPAPEKIIPERWLCLSAVVLKHALDGT
                     SLTWSKLLCLLALYTGMDLHSHIRNGTRIG"
     gene            complement(<598902..>600137)
                     /locus_tag="ACHE_10202A"
                     /db_xref="GeneID:66977159"
     mRNA            complement(<598902..>600137)
                     /locus_tag="ACHE_10202A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276654.1"
                     /db_xref="GeneID:66977159"
     CDS             complement(598902..600137)
                     /locus_tag="ACHE_10202A"
                     /note="COG:C;
                     EggNog:ENOG410PN58;
                     InterPro:IPR003421,IPR036291,IPR011128,IPR008927,
                     IPR013328;
                     PFAM:PF02317,PF01210;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0046168 - glycerol-3-phosphate catabolic
                     process [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131322.1"
                     /db_xref="GeneID:66977159"
                     /translation="MTAEIFDATSSVTIIGAGPCGCAFAADLASRGKSVMLYGHPDHR
                     GAIPMIEKNDGWLNAKGDDVNGRYQIKTTSDLYLAIRHSPFLVSTVPSYGQDTILQIL
                     SQFNLRNHTLIINVGNFFYLAARQKVNCHAILETDISPYAVRITGDTVFVKGVKKSLT
                     IWAEPPTTQAKRHSHQAELTLRRQIESIFSQRLVWCQNLLQVGLNNINPVVHCPAALM
                     NAGWIEATKGDFFFYAQGMSPSVSKVTEKADQERVAIGRAYGFDLVDITTYMNQNYQH
                     DREFHDYHDFAIGSVIHNKTKSSPSSLKHRYLLEDILYGMVIWYELGQKCGLASPTIR
                     ALIEMASVVSGFDYFEHGRTLKAAGLADATKEQILMALGGPLENATNVLAPLSGPLVN
                     ANGSTLESHAPLQKPQVAV"
     gene            <601668..>603222
                     /locus_tag="ACHE_10203S"
                     /db_xref="GeneID:66977160"
     mRNA            join(<601668..601868,601936..>603222)
                     /locus_tag="ACHE_10203S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276665.1"
                     /db_xref="GeneID:66977160"
     CDS             join(601668..601868,601936..603222)
                     /locus_tag="ACHE_10203S"
                     /note="COG:G;
                     EggNog:ENOG410PFF2;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i22-42o54-77i89-106o112-135i147-172o178-197i264-285o305-
                     330i365-386o398-418i430-451o457-478i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131323.1"
                     /db_xref="GeneID:66977160"
                     /translation="MNPESSAVPRPYSSFSNLQKKYIVFTAAGAGFFSSLSAQIYFPA
                     LNALAQDLGVSSSLINLTVTSYMIFQGIAPMFLGSFADQTGRRPAYIICFVIYIASNI
                     GLALQENYPALIVLRCLQSSGISSSVALSAATVADVSTKEERGSYMGIVMAGNFSGPA
                     IGPIIGGLLAQYLGWKSIFWFLTIASGVFLVPLLLFLPETARNVVGDGSYPAQPWNQP
                     FVHYFYRNNASKQPSSPAESLNQSDSSDLPEKPQHKLRFPNPLKPLVIVFHPNSIIVL
                     LVTGVIMGGNMTVLSSITEMYTTEYNLSILQIGLCYITLGTGSILASVVTGRLLDWNY
                     RRSAAKRAGPDATPEQIQSQKESVPVEKARSAITIPLVIMGSLTVLAFGWVVNYGVHL
                     AAPEVLLFFIGMGQTGGFISTSTLLVDLHTSHPAAATAANNMVRSFFSAAASAAIDPM
                     LNAMGRGWAFTLVAFILLGTIPFLLLLCGMGSRKEKNNAAGRSND"
     gene            complement(<604169..>605323)
                     /locus_tag="ACHE_10204A"
                     /db_xref="GeneID:66977161"
     mRNA            complement(<604169..>605323)
                     /locus_tag="ACHE_10204A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276676.1"
                     /db_xref="GeneID:66977161"
     CDS             complement(604169..605323)
                     /locus_tag="ACHE_10204A"
                     /note="COG:G;
                     EggNog:ENOG410PMMT;
                     InterPro:IPR013022,IPR036237;
                     PFAM:PF01261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131324.1"
                     /db_xref="GeneID:66977161"
                     /translation="MSKPLPSSIVNEFGIATLSLGNWREHRLQPRLEAAAKAGYRWID
                     LFDECWEKYLEEHGLPGYQLWEATPANLQVARKLGNLVKSLGMRIACTQPLRKIEGIK
                     NPVERRATLDLVAKRFPFMRAFDTDLVFMCANIRTDNGVTSDLNTVAKDLAELGDMAA
                     AFSQADGGPILKIGYEGLSWAVRNTWSSSWEAVRFANRPNVGLIVDAFNILAVEFADP
                     HNPDGHGRIFPTLEESIQVLTASLAAMVATVPGDRIFFFQCSDAELVNPATILPTEPD
                     TPARLPWSRGHRLFPLEQSRGGYIPVELVAAAVLATGYRGPISLEVFNHSLNQPGECI
                     PEVHATRGICGLHKLIAAATALPPFWSGWLEARKTEDMVVGRLRSDTSRL"
     gene            <606041..>607328
                     /locus_tag="ACHE_10205S"
                     /db_xref="GeneID:66977162"
     mRNA            join(<606041..606054,606115..606455,606508..606631,
                     606698..607009,607061..>607328)
                     /locus_tag="ACHE_10205S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276687.1"
                     /db_xref="GeneID:66977162"
     CDS             join(606041..606054,606115..606455,606508..606631,
                     606698..607009,607061..607328)
                     /locus_tag="ACHE_10205S"
                     /note="COG:C;
                     EggNog:ENOG410PVNJ;
                     InterPro:IPR003953,IPR036188,IPR027477;
                     PFAM:PF00890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131325.1"
                     /db_xref="GeneID:66977162"
                     /translation="MLPQNPCAPGSRINGAIIRRVRSSGRSTSYYEIKAKAVVLATGG
                     FQGSPSLTAKYLGQGGDNIFVRSNRGSVGDGFNLAIGAGAGTSRGMNTYYGHLMAAPL
                     RADEVGPKDYLPLAQYQSRYCLLLNQGGRRFADETTGDEIINQYLAKQENRRGFLLFN
                     EKTRLQHCVSALFPNAGNVDRPQKAREHGCNVGSASTLAELIEILTQWGVDCVNAKRT
                     IEEYDRVVRQRENGLALDVPVGRGGLPPASLVEGDGPFYAMEVQPSITFTYGGINIDK
                     QGHALTADKTILPGLLVAGVDAGGFSNLGYAGGLALAFVTGIWAAREVARELGLPLPR
                     LPVPDTRDSKTKPSKGRL"
     gene            complement(<607940..>608232)
                     /locus_tag="ACHE_10206A"
                     /db_xref="GeneID:66977163"
     mRNA            complement(join(<607940..608051,608138..>608232))
                     /locus_tag="ACHE_10206A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276698.1"
                     /db_xref="GeneID:66977163"
     CDS             complement(join(607940..608051,608138..608232))
                     /locus_tag="ACHE_10206A"
                     /note="TransMembrane:1 (o25-46i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131326.1"
                     /db_xref="GeneID:66977163"
                     /translation="MTSSALTLFPRDGEKPVSNFTKSGVPGIIIGVVVFIALCICCFF
                     LYRNRRRDAREAKSARTWNDDGYA"
     gene            complement(<611303..>612598)
                     /locus_tag="ACHE_10207A"
                     /db_xref="GeneID:66977164"
     mRNA            complement(<611303..>612598)
                     /locus_tag="ACHE_10207A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276709.1"
                     /db_xref="GeneID:66977164"
     CDS             complement(611303..612598)
                     /locus_tag="ACHE_10207A"
                     /note="COG:T;
                     EggNog:ENOG410PKRQ;
                     InterPro:IPR004839,IPR004838,IPR015424,IPR015421,
                     IPR015422;
                     PFAM:PF00155;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131327.1"
                     /db_xref="GeneID:66977164"
                     /translation="MTESNISQRAGQAAESAKQVPWDVMSDTWSPTTNPNGYVNVGVA
                     ENMLMHDTLLEYINTKLSLPAKYLTYNDGATGSDRLRRAIAGFLNKHFQPAHPVVSDH
                     LAVTNGVSSAIEHVSWAFADPGEGILLGRPYYGTFIPDMSLRPSTAVIPVEFQDCDPF
                     SLEAVDRYEQALLNFQNKSGRRVRALMLCHPHNPLGRCYPRETLIKLMRLCQKYQMHF
                     VSDEIYALSMWENTVDELKIPPVRFESALSIDATGIINPGLVHVLWGMSKDFGANGLR
                     LGVIISQNNADLHMALKGVTLYSYSSSVSDHLASIILEDHDFTGRYIQQNRQKLSESY
                     AFAVQLLKSNGIEHAAGGNAAFFLWINLGRKYRDVHPDDPEDSDVSDKVMKALMKKKV
                     FVSSGALFGSEHSGWFRLVFSQPREYIEEALRRIMLAME"
     gene            <620957..>623109
                     /locus_tag="ACHE_10208S"
                     /db_xref="GeneID:66977165"
     mRNA            join(<620957..621352,621427..622106,622155..622987,
                     623051..>623109)
                     /locus_tag="ACHE_10208S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276720.1"
                     /db_xref="GeneID:66977165"
     CDS             join(620957..621352,621427..622106,622155..622987,
                     623051..623109)
                     /locus_tag="ACHE_10208S"
                     /note="COG:B;
                     EggNog:ENOG410PJWH;
                     InterPro:IPR028651,IPR019787,IPR019786,IPR011011,
                     IPR024610,IPR001965,IPR013083;
                     PFAM:PF12998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131328.1"
                     /db_xref="GeneID:66977165"
                     /translation="MSAAISSVVNPQSQSARQSARQTRTNPSRTSKTLGRSSFAYGHG
                     SMSDAPPTPTIPHGFYPALTHFTDAITALPREFRRHNSLLKEVDAKAWALEENLLQLL
                     KVSSESQAVQHPPNPAPIVAGVIREDVMRQDPSQPPESPESKNRRLLFDRVRHTLSDL
                     MMTADEKNHVISNANDELDRQVARLDTVFPFIAGEISDESRLGSLTHWAYSNRNTATK
                     TTTNERPRREVAAAKELAEAEAFSRSEARREAVLARKHRRGHADSEFDDTRSGSRKGH
                     SSKARSGAATGEHAADNAVSGSTATTKRRKVERPTPAESSTPMERTASGAGSTAGRAG
                     SKDAQDLAKKRSRAPNSGTAAARKRNTTGITAAESPILEPPPVIGTFNAPRKTSPVST
                     TSRPQSSRAPQNGAQSVNGRNRPSSATSNRVTDSTFPGPGPTLELALSNAGLAVDKGI
                     EAKPSSRDTPAKMDPVVPGLVGADVQRRETECDAGNGTTSRMPVSGTKREDSDRPAES
                     VETGESPAPPQSNSGSKGRSSKTSTPVLQSYEPAQPRVRPTRSTNPAPTTSAKRSHKK
                     NGGAAVVPPPPSEEEESMHEGDDEDEEGEPRYCYCNEVSFGEMVACDNDACPREWFHL
                     SCVGMTKPPGKNVKWYCNECKDSMRRSRSGR"
     gene            complement(<623480..>624369)
                     /locus_tag="ACHE_10209A"
                     /db_xref="GeneID:66977166"
     mRNA            complement(join(<623480..624034,624103..>624369))
                     /locus_tag="ACHE_10209A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276731.1"
                     /db_xref="GeneID:66977166"
     CDS             complement(join(623480..624034,624103..624369))
                     /locus_tag="ACHE_10209A"
                     /note="BUSCO:EOG09264W1U;
                     COG:S;
                     EggNog:ENOG410Q12X;
                     TransMembrane:4 (i12-29o49-76i88-112o118-140i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131329.1"
                     /db_xref="GeneID:66977166"
                     /translation="MYTSGLTNTPITKNLLIYTIASSILLSILDSKHLASIHVSPHLW
                     QYGQFWRAAVWQVAGFANSTEALFAAVLVYHLRVVERGWGRRKLLSFIISTLPYTTLL
                     PPLLLALVIRPLSFNMINYLPSGPVSTLFALLAQYHALIPHTYRYRIGTSTTTTESPS
                     KGITLLLSNKTTTYLLALQLALSQFPYMLLPSVTGWFVGLAWRAEVLPGVSVNWRVPA
                     WAVGERERVSRRGEEGRFEDLRRRLEGEVAAAGAASGVASENGDGERRQRQRGSQ"
     gene            complement(<625019..>627013)
                     /gene="TFB1"
                     /locus_tag="ACHE_10210A"
                     /db_xref="GeneID:66977167"
     mRNA            complement(join(<625019..626799,626872..>627013))
                     /gene="TFB1"
                     /locus_tag="ACHE_10210A"
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /transcript_id="XM_043276743.1"
                     /db_xref="GeneID:66977167"
     CDS             complement(join(625019..626799,626872..627013))
                     /gene="TFB1"
                     /locus_tag="ACHE_10210A"
                     /note="BUSCO:EOG0926315C;
                     COG:K;
                     EggNog:ENOG410PKJY;
                     InterPro:IPR011993,IPR027079,IPR013876,IPR005607;
                     PFAM:PF03909,PF08567;
                     go_component: GO:0000439 - transcription factor TFIIH core
                     complex [Evidence IEA];
                     go_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /protein_id="XP_043131330.1"
                     /db_xref="GeneID:66977167"
                     /translation="MAPPSGSATYKKKDGTLTMSQDHQSVSWIPAAGGASGTITLPVG
                     HITNLQQTPASNPKVMLKIFVQPPNASVPEQYVFSFTAGANARPEADAIKDALSSAIQ
                     ATKTAPQPSGSTPTPTPGGTPAPPPRDGSMSAAMAMANAVSAGTGRNAWDDDNRLKAD
                     AELQQSLLRADPNLKRMFFESLDTKPESLTTGQFASQFWSTRLHLLRAHAIERGQLRG
                     SYNVLSTLKPRTEENVTKLNISKEQIQLIFSQHPLVKRVYDENVPKLTEQQFWSRFFQ
                     SRLFKKLRGERVSENDATDAVLDKYLLEDENVGQRDAHVPQFLNLAGNEVNHSQRRGN
                     RPDLDMRPSGVDKVPIIRTLNSLSEKIMAGVAPADRDPTAPVGMDEETYNELQLRDLQ
                     GDEEQGRVLLNVRDQSRFFTQAKDAAEEQSRLISQQDPEKVLGGLRTQLQQQLPDDGT
                     AQLGRLVQPDEDEDEDETRSRQQVGSKPNLHQASAQILSAIRDRRAQTESSSTEGTYG
                     LTPPLYDRLTLTHATSTEFLHQFWQAFLSGNADRAGEVASLVESLNRALQRIKAVAAD
                     AEADRQKEVERWKQHARDMLEKTGRKKRLNLAGVAGGEKVVNQLLGPTIRALEMALGK
                     YKEALAEEMKDAPAPA"
     gene            complement(<629767..>631959)
                     /locus_tag="ACHE_10211A"
                     /db_xref="GeneID:66977168"
     mRNA            complement(join(<629767..631217,631274..631663,
                     631722..>631959))
                     /locus_tag="ACHE_10211A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276754.1"
                     /db_xref="GeneID:66977168"
     CDS             complement(join(629767..631217,631274..631663,
                     631722..631959))
                     /locus_tag="ACHE_10211A"
                     /note="COG:S;
                     EggNog:ENOG410PK83;
                     InterPro:IPR032675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131331.1"
                     /db_xref="GeneID:66977168"
                     /translation="MSSSAAPSATVAPACDSHHHKPSFSRYTTAPTGYSAAQESVPHS
                     PRDESPQTSNCSSPDGSRSSSCRRDSFGSIKEDVDGVAQSFVDTHIDHPPNEEPPKPN
                     VSEMLQQAPDFCCPCGGFLGWKQIRLGGKSLSRSYSDLRALGNLHTRGWAWENPPALS
                     DARPSFSKELKPPQRQQPQQLQPVQQLEPQEPQPPRRTSALERLPPEVLDVIISELAL
                     DIPPNGYTPRNVDLVACLLTSRTLHAATLGVLYRNMTFPHSIVFSKGLNHLTQYPALG
                     TLVRRLDFSHFTSVGLGRTKQMNAEIQNLTSRTLLQCLNLLPNLRECLLQEHVEGDIS
                     VEILQKLFFGLPNMNAIDFCGCSTQSFSTLFLEALTTASPLPPTLPNLKRLSLHECSS
                     LSAEAFELLLPRLVNVTHLDLTHTLVTEEALLSIPKTARITHLSLSRCTRLRGNTLVH
                     FLTTHPAVRGSLVFLNLLTDATRYRTLDEDHLHALLPKLPSTLRSLNLGGAKVSSEHT
                     RLLLPLTKHLDELGLSSADLTAKDLNTFFTPPSPPPPSPLTGEQDDQMAIDQPPAPPA
                     SEWAPPSLAYMDLNKVPQLTIGTIFNTNACSLLSQQSYPLQVIEFGDKIIAPLRERTK
                     NTKSSSGWMIRELGRRGWYVRDPDSMPSRLSDDGSRSWKMGARWWGMRKIPVAVGDVG
                     GIYGHYMFKK"
     gene            <636499..>638138
                     /locus_tag="ACHE_10212S"
                     /db_xref="GeneID:66977169"
     mRNA            join(<636499..636541,636661..637075,637134..637551,
                     637602..>638138)
                     /locus_tag="ACHE_10212S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276765.1"
                     /db_xref="GeneID:66977169"
     CDS             join(636499..636541,636661..637075,637134..637551,
                     637602..638138)
                     /locus_tag="ACHE_10212S"
                     /note="COG:S;
                     EggNog:ENOG410PKVM;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131332.1"
                     /db_xref="GeneID:66977169"
                     /translation="MSQKSRKLQRVSKACDFCNRRSIKCSQREDPLGRCQNCADFDVP
                     CTFDRPAKRRGVKAGTQASGRDAQFVRASVNHGIHTAAATVSGGRAYGSSTSRSSYRP
                     SISGDPWSGWSAAEGDDDDGALHNSWKAFAIACDRQIRNLVQVYFEIVYPIFPLFHMP
                     SFIEQVNSKEHLRNQGLFASVMAVCSLVSGRVRDGALYSNRWHREELIDPPSEAFFAA
                     ARDSIPRDLVAVKGIDYMRACAILAIASIQNGQIRNMQKYSGLYHTLTSMDGLYDEKL
                     WPKDLSPIETEERRRLFWSIYTLDIYSTIVWGGVIRYREAHSLVRYPSEVDDEFITHH
                     GYGVPPVTPQSNPLPPSNVTVVSRQPMTWLRGWNFTTDLYRILEHVVDGNRRHFSSAN
                     GTTQVWPLFNPLSMSEPAVMDQVLTMYSALPSHFRETPPTTGDMSKDLFGFQSANIQA
                     TLQLLRMVLLSAEEIGVERK"
     gene            <638305..>638767
                     /locus_tag="ACHE_10213S"
                     /db_xref="GeneID:66977170"
     mRNA            join(<638305..638354,638422..>638767)
                     /locus_tag="ACHE_10213S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276776.1"
                     /db_xref="GeneID:66977170"
     CDS             join(638305..638354,638422..638767)
                     /locus_tag="ACHE_10213S"
                     /note="COG:S;
                     EggNog:ENOG410PKVM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131333.1"
                     /db_xref="GeneID:66977170"
                     /translation="MEGNLSEASYTRVRTLLLEMADLLQRLETGLHRASGTGERLRSQ
                     VDRIDGYMHTSLPLDLTAPSNAMQVIDAKPEPAVPSAYAQGNPAVETSLGAGLDQMSQ
                     FQLPPELLTDWPWSLDSYNTEGFLPLASE"
     gene            <639201..>639458
                     /locus_tag="ACHE_10214S"
                     /db_xref="GeneID:66977171"
     mRNA            <639201..>639458
                     /locus_tag="ACHE_10214S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276787.1"
                     /db_xref="GeneID:66977171"
     CDS             639201..639458
                     /locus_tag="ACHE_10214S"
                     /note="COG:I;
                     EggNog:ENOG410PMT4;
                     InterPro:IPR029063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131334.1"
                     /db_xref="GeneID:66977171"
                     /translation="MSLGICRRRTCHSRLLAEIRRILKPGGILPTRDAADQQFYPRSV
                     DPERLDSGITEDEIQQTLLAVGKCVEMEPALYAAIQCAMLA"
     gene            complement(<639736..>641158)
                     /locus_tag="ACHE_10215A"
                     /db_xref="GeneID:66977172"
     mRNA            complement(join(<639736..640409,640477..640900,
                     640950..641024,641078..>641158))
                     /locus_tag="ACHE_10215A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276798.1"
                     /db_xref="GeneID:66977172"
     CDS             complement(join(639736..640409,640477..640900,
                     640950..641024,641078..641158))
                     /locus_tag="ACHE_10215A"
                     /note="COG:O;
                     EggNog:ENOG410PJZS;
                     InterPro:IPR005338,IPR043129;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016773 - phosphotransferase activity,
                     alcohol group as acceptor [Evidence IEA];
                     go_process: GO:0006040 - amino sugar metabolic process
                     [Evidence IEA];
                     go_process: GO:0009254 - peptidoglycan turnover [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131335.1"
                     /db_xref="GeneID:66977172"
                     /translation="MVSNMVNGTASHSLDLTVLGLNSGTSMDGIDCALCRFCQETPES
                     PMHFELLRYGEIPLEPVIKKRVMNMILRNQTSPSELSEVNVILGETFALAVHQFCKDY
                     HVDIDSIDVLGSHGQTIWLLSMPEPGETRSALTMAEGSFLASRTGITSVTDFRVSDQA
                     AGRQGAPLIAFFHASAAPPDQVARLPEHRRHSQRNVFIDAVVRHYTNGEREYDKNGEM
                     GARGTVDQELVDDFLRHPYFALDPPKTTGREVFRDTLAHDLITKAEAKRLSPDDVVAT
                     ITRVTAQAIVDHYRRYAPKDLEIAEIFMCGGGAYNPNITAFIQKYYPNTRIMMLDDAG
                     IPAGAKEAITFAWQGMEAVVGRSIPVPTRVETRQEYVLGKVSPGKNYRKVLRQGMLFG
                     AGRDHLSPVKELVNYVDGKVFNNKW"
     gene            <641585..>643573
                     /locus_tag="ACHE_10216S"
                     /db_xref="GeneID:66977173"
     mRNA            join(<641585..641978,642036..642125,642179..642588,
                     642647..642838,642892..642986,643047..643203,
                     643252..643312,643368..>643573)
                     /locus_tag="ACHE_10216S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276809.1"
                     /db_xref="GeneID:66977173"
     CDS             join(641585..641978,642036..642125,642179..642588,
                     642647..642838,642892..642986,643047..643203,
                     643252..643312,643368..643573)
                     /locus_tag="ACHE_10216S"
                     /note="COG:G;
                     EggNog:ENOG410PGM3;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:11
                     (o67-86i93-112o118-141i153-178o190-208i282-301o321-
                     340i347-367o387-407i419-437o449-468i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131336.1"
                     /db_xref="GeneID:66977173"
                     /translation="MGYTTLWKRLSPRQLNVTIHVFSLISIFFEGYDQGVMGGVNASP
                     KYVTEVSIGKPDGTVTDTTHQGGIVSVYYLGAIFGCFAGGWLADRVGRINGLLMGALF
                     ALVGGALQSAAQNSDFMICARVVTGIGTGALTGITPVLVSETSSADHRGGLLGYVFIA
                     NYLGISVAYWISFGLAFINNGYSDVRWRLLLAFQCFPALILACCIKVLPDSPRYLASV
                     GRKEEARELLEHICKHRASPKEINREYLEIVTLAEKSQRSSPIQFAKILLGKGGRQHP
                     NLGRRAWLCAWLQIMASWTGITAVTTYSPVLLHQAGYSTIKQNGLAGGINTVGIVGTI
                     ISAQIVDRLGRRVCLMVGAAVLFAVNLIAGAVYEGSLYNPGKAAQYAPGAITMLFLFN
                     IGYAATWGTVAFLVPTEIFPSDLRAQGNGFGITGWAIGVGMTTLVNPIMFEAMTSRTY
                     FLFAGLNLIWIPIIYLFYPETSNRSLESIEALFSTSSPFYWKMEQAYKMHGDVLVEHG
                     VSKSDSLDASQNELTSYEKPKEHSIA"
     gene            complement(<646872..>648639)
                     /locus_tag="ACHE_10217A"
                     /db_xref="GeneID:66977174"
     mRNA            complement(join(<646872..647750,647818..>648639))
                     /locus_tag="ACHE_10217A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276820.1"
                     /db_xref="GeneID:66977174"
     CDS             complement(join(646872..647750,647818..648639))
                     /locus_tag="ACHE_10217A"
                     /note="COG:S;
                     EggNog:ENOG410PVG4;
                     InterPro:IPR004875,IPR006600;
                     PFAM:PF03184,PF03221;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131337.1"
                     /db_xref="GeneID:66977174"
                     /translation="MPTERENIEEQIKNAIATYERDKSQKIRPLAEAFDVPYQRLLRR
                     VKGLPGRNSTKPVNYALDKHQENALKHWIERLDQAGVPPTAKRIEKSANLILQRAHTD
                     PTIPPKKVSKEWPYRFLERLGPEYTRLKQRPRDPKRLQSQDLGIIQNWYDRLEILLKQ
                     YQIQPQDLYNFDEIGFMEGQGRGEVVITKYPSRAQHPGASFSRGLISVVECISADGSV
                     LPPCIILPGKGHLEDWYTHSDMPGNWILGVSPNGYISDEIAFEWIKHFDKHTKQRCAG
                     VYRLLLMDNHGSHLTYEFIEYCEKNRILLYSFPPHATHFLQPLDGKPFKQYKHYHGQA
                     VTEAAILGWSDFEKREFLTVLPGIRKETFKTHTIQSAFRDCGIFPFDPSPVMDDLEKQ
                     AEPIPDLQIWDGDSTSSGSAQSSPKTIRQLRKEISKARASLDKIDGHLSALSPGLNRR
                     LERIFSGGLTQAESSDQTAMELDRYLKAAAHQSKPKSRRQVPGLSHSGVLSVQDANRR
                     IGARKKAEEKKEGRRLGQSIRTSLATTHRRYDRLELWMMGIDENADQETIDSILNKNR
                     "
     gene            <648885..>650956
                     /locus_tag="ACHE_10218S"
                     /db_xref="GeneID:66977175"
     mRNA            join(<648885..648989,649037..>650956)
                     /locus_tag="ACHE_10218S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276831.1"
                     /db_xref="GeneID:66977175"
     CDS             join(648885..648989,649037..650956)
                     /locus_tag="ACHE_10218S"
                     /note="CAZy:CE10;
                     COG:O;
                     EggNog:ENOG410PH95;
                     InterPro:IPR001375,IPR029058,IPR002470,IPR011042;
                     MEROPS:MER0018170;
                     PFAM:PF01738,PF00326,PF07859;
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131338.1"
                     /db_xref="GeneID:66977175"
                     /translation="METPSTKVPYGHWTSPLTAEQLAHSRVSLHEVVVNESTGTIYSI
                     ECLPTENGRYTIIEHHDGKSRNILPKESGLSAQARVHDLGGGSMAIRPDGKITFSDEK
                     SYHVYQLDPAVADGDNGSHSGATLVHAADQDIRYADFCHHPTEFQWVLAIREDQRNAT
                     PETQAYDVHNVLVAINTDTGEEKVIAAGDDFYAHPKFNLSGRYVSWIQWSHPDMPWTG
                     TVLYLADWDGNGGLANVRKIAGKAMSESIAQPKWGLDGALWFASDRTGFWQLYSIRPD
                     DEDCQVRPLMLKGLEGAEMAIAEWDLGISTYTSLDESTIVAAAVTHATSRVVLVNTAT
                     ASFQDLDLQYLDIDGIYRVSPTSFAIVGSSADSPPELALISLTPDTHAKAQARKAVLK
                     STASAFTLPPEYISHATSRTAPQLHGPLRNNSVHFFFFPPRNPHFHNNNNIPPPCLVY
                     VHGGPNGNASPAFDLETQYYTTRGFAVAAVNYTGSTGFGREYRERFSGHWGLADVADT
                     VSVVDYLVQNGTIDKSRVGIYGGSAGGYLTLRALHMYPDTWAAGISSYGISDVRALQA
                     DSYKFESQDVDRLLLSLTQGAEEREAELTRRSPCYFAKDIKAPLLLLQGTEDVVVPVA
                     QARMMAAAMRECGNVAEVVEFPGEGHGWVGKEAIFESLRKKEVWWRTHLG"
     gene            complement(<651705..>653108)
                     /locus_tag="ACHE_10219A"
                     /db_xref="GeneID:66977176"
     mRNA            complement(<651705..>653108)
                     /locus_tag="ACHE_10219A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276842.1"
                     /db_xref="GeneID:66977176"
     CDS             complement(651705..653108)
                     /locus_tag="ACHE_10219A"
                     /note="COG:I;
                     EggNog:ENOG410PHQT;
                     InterPro:IPR036412,IPR006357,IPR006353,IPR023214;
                     PFAM:PF13242,PF13344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131339.1"
                     /db_xref="GeneID:66977176"
                     /translation="MSDIPPEAAPSPREHRGSGSLPIPNDSGNTVEIPATRSSISDAA
                     QYMHNLSFTPSTRDRRGSRNSFGTSLPIPRSPRVSRLSSVVTAGEPSVSRDILASQVQ
                     DMSKEKVAAAKNMAFAFDIDGVLAHGNDPIPPAKEALKMLNGDNELGIKIPYILLTNG
                     GGKTEEARCEQLSQILEVPVSTDQFIQSHTPMQALAEYYDTVLVIGGDGQNIRPAAEN
                     YGFKNVVHPKDIQAWDPTICPWSHITEEERAIAKPRDFSKLKFDAILVFNDSRDYQLD
                     FQLIVDLLLAEDGLLLTRAKDPVSSRIPLYFSQGDMVFPTDHKGPTRLTLGAFRIALE
                     AQYKALTGIELERVVYGKPEKATYTYADEVLKSWMEQIHNENKLPQNIYMVGDNPASD
                     IIGGNMYGWNTCLVRTGVFQGGENDPNNPANFGVFDNVLEAVKAAVRKELGQDFKFKW
                     NPKVNPVLHGDAGSAVE"
     gene            <654185..>655218
                     /gene="GLD2"
                     /locus_tag="ACHE_10220S"
                     /db_xref="GeneID:66977177"
     mRNA            join(<654185..654592,654649..>655218)
                     /gene="GLD2"
                     /locus_tag="ACHE_10220S"
                     /product="glycerol 2-dehydrogenase (NADP(+))"
                     /transcript_id="XM_043276854.1"
                     /db_xref="GeneID:66977177"
     CDS             join(654185..654592,654649..655218)
                     /gene="GLD2"
                     /locus_tag="ACHE_10220S"
                     /note="COG:C;
                     EggNog:ENOG410PFQG;
                     InterPro:IPR018170,IPR020471,IPR036812,IPR023210;
                     PFAM:PF00248;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycerol 2-dehydrogenase (NADP(+))"
                     /protein_id="XP_043131340.1"
                     /db_xref="GeneID:66977177"
                     /translation="MSSGQTFKLNNGVTIPGVGFGTFASEGSKGESYNATLHALRTGY
                     RHLDCAWFYQNEEEIGDAIRDFLKENSSVKREDIFVCTKVWNHLHRYEDVIWSIENSL
                     KRLQLDYVDLFLVHWPIAAEKETQEQPKIGPDGKYVILHDLTENPEPTWRAMEKIYED
                     GKARAIGVSNWNISDFEKLFKFAKVKPQVNQIEIHPFLPNDELVQYCFNHDVLPAAYS
                     PLGSQNQVPTTGERVSENKTLNDIAQKGGNTLAQVLIAWGLRRGYVVLPKSGNPARIE
                     SNFKSINLSDEDYEAVNAVAKGRHFRFVNMKDTFGYDVWPEETAKQLSA"
     gene            <659398..>660382
                     /locus_tag="ACHE_10221S"
                     /db_xref="GeneID:66977178"
     mRNA            join(<659398..659720,659779..>660382)
                     /locus_tag="ACHE_10221S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276865.1"
                     /db_xref="GeneID:66977178"
     CDS             join(659398..659720,659779..660382)
                     /locus_tag="ACHE_10221S"
                     /note="COG:I;
                     EggNog:ENOG410PK7T;
                     InterPro:IPR001753,IPR029045,IPR014748;
                     PFAM:PF00378,PF16113;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131341.1"
                     /db_xref="GeneID:66977178"
                     /translation="MAPPESYHALPFQEISISHVPATSPTPTSVVLLTLNRPQRLNAV
                     TAQMIEELVAVYEYFKADDRIKAVVVTGAGKGFCVGADLGIGFGKLLQQLKENPSKMM
                     DEYRDGGGRVALAMYNCHKPIIMAINGPAAGFGITMTLPATIRVASADAKISFAFSRR
                     GLVMEACSSYFLPRLVGLSRALHLVTTGESYEASDPSLNQLFSEVLPSPEKTVERALQ
                     IAADIAKNTSTVSTTVMRDMMYRGPSSAEETHLLDSKVFLGMLMSKDSQEGIKSFSQR
                     REPEFKGSMARDAPCGWPWWDATHTEGGKTKL"
     gene            complement(<660448..>662082)
                     /locus_tag="ACHE_10222A"
                     /db_xref="GeneID:66977179"
     mRNA            complement(join(<660448..660551,660608..661772,
                     661834..>662082))
                     /locus_tag="ACHE_10222A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276876.1"
                     /db_xref="GeneID:66977179"
     CDS             complement(join(660448..660551,660608..661772,
                     661834..662082))
                     /locus_tag="ACHE_10222A"
                     /note="COG:S;
                     EggNog:ENOG410PR3H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131342.1"
                     /db_xref="GeneID:66977179"
                     /translation="MTTENKHNLLKLLSARSYLPVDEKPSAARDSASSSTSAVEIITS
                     PEQSHLLPMDSTRVTRQRRSSRNVGRPRLDAQGTAVLSESRRKQIRQAQKTYRLKKEA
                     ALQNTQARLAELEQKINGIFEAFSDLYDIALDSDLKSTHPALFDHFHGVKRLFTTDVG
                     RFPTSSSGPSSTSRQGNAQKCATLVPEGDSSCGRSTSQQNVFGYCPLPSISSQSMETT
                     PETVSLSPDDHNEEDSQPDSNNSAWQSFGNFIYTYCFQEAEFSRRLQRYCLEYAFRLF
                     SDPRSHPNRIYQVFRLVPCIQNKAKMYPYFKRLVMAASGESLEIQALPFYCIGGAGTH
                     YPLFDDTGNPIYPPKMRLPKRLLGVLPVVRCASDVESNWDTDRLLEVCGFGGQWLDCR
                     DVEGFLSARGVQLEESSLFPRVEGLLERECQSVSAEPSHSEQSTASGGDQSEQNEPAS
                     NISSPPKSLHQYTLDIERFFLYLLQGMVILGRVPGFRQSDVVAAFSASLQLQVSS"
     gene            <662688..>665903
                     /locus_tag="ACHE_10223S"
                     /db_xref="GeneID:66977180"
     mRNA            join(<662688..663063,663118..>665903)
                     /locus_tag="ACHE_10223S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276887.1"
                     /db_xref="GeneID:66977180"
     CDS             join(662688..663063,663118..665903)
                     /locus_tag="ACHE_10223S"
                     /note="COG:S;
                     EggNog:ENOG410PP66;
                     InterPro:IPR036673,IPR011058,IPR010730;
                     PFAM:PF06985,PF08881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131343.1"
                     /db_xref="GeneID:66977180"
                     /translation="MLCDRCAAVFQNPKISISPFHLRQRFDDDDLQVLHPNFASLEAA
                     IKERCGFCHRISHALSSKGDSQIFTDFQLSPDVDPDSFSIRYRLVYESDNGKVVSYMA
                     VCLAQRADEELREHCSEYLVISPEQVPLTGESVIETENGSTTASINTITSWIENCNRN
                     HSLCSREEGPRLNHQFARILDVGDVPDAPEVKLCLPKNLKFDTKYVTLSHCWGGITSE
                     PPSLTTATYDEYLQRITVADLPQAFQDAIQLTRKLGIRYFWTESLCIIQDCPKDWLDQ
                     AGVMGEVYQGSYLNIAADISLDPNGGLFTIRNSVLATPLRISVRGNISQDDLPPLRLE
                     GASLFVAEATPQVLETEIDLNTRLGNRDGNFDLKDKDFAFTARSVELVETTLYAELRT
                     ISGEWRCRCVDVRELLEGPSDRSSFRLVGGSTLFISEPQEIDLNECLANRDGAVNADG
                     TDFAFTARNISLDGSTLRAELRKINGEWRQDSIDLASCVSWSSGRLRPKKFVETFYDV
                     VTDGYAKRSKQTLESKSNAKEWVFQESLLAPRLVHFMDRQLIWECTTSKTLDERSNEK
                     SDDRQGVIKWSEPEDPYSVNLLHEPKTRELGLDYIWSSLRAMHGRSKFTFRRKTLSQN
                     SDLLRQAKQMCYGESEFETTHSLIKYWSDIAVNHSAAYPRQIDRLIAVAGLAKILSTR
                     TSFRYVAGLWEVQLPRQLLWTPSHLKEMPTEKSTAPSWSWASYPGGITDRGIKPGPIL
                     ETNGVMDLVKCLSIDIEGLSEKDDMPFGQVKDGRLLVRGRLLPISLDLSVWPEGATRE
                     DTLVQSWTGSTSEAPCGETFLVPILFTCCDDGFSDSIPNSLLLESTEEKGVFHRIGTA
                     RLRDCCDLKNITPQLYTAEYIDHEFEDDDESEASAEDDGFVIIPTPDAVKPNPQQDAS
                     NNATSHHASNDTQYTFLDEASEIATERETDPDSERTMTPEEIISSTEREISRWNTLFP
                     KLPKTEEEFEIDINTDELEREMMGFYNNDSARSSRTRTQAGHKRKVQKLTPKDAIAGH
                     YYIGYIEDDKDTNRYGHFVFEIR"
     gene            <666181..>667577
                     /locus_tag="ACHE_10224S"
                     /db_xref="GeneID:66977181"
     mRNA            join(<666181..666471,666528..667111,667169..>667577)
                     /locus_tag="ACHE_10224S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276898.1"
                     /db_xref="GeneID:66977181"
     CDS             join(666181..666471,666528..667111,667169..667577)
                     /locus_tag="ACHE_10224S"
                     /note="COG:S;
                     EggNog:ENOG410Q2VT;
                     TransMembrane:1 (o24-44i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131344.1"
                     /db_xref="GeneID:66977181"
                     /translation="MLDPNPKMNQLMQTIPLAIPIDGYGKIAITTALLTLYAMLVRYY
                     RYQRCTAIQSRFQTPKRPLSSMTVKEAHQVVRELRELEFPYSLHNAMKISLLKTGSIP
                     TMTKLFTATGQLNERNAPKRAADTEVLLTEVHDRHPGSNEHLLAISRMNYLHSRYRKA
                     GKILDEDMLHTLGSAVVDIFRSVDENEWRVLSATEKCAIGVFHKALGDAMEIDFRFLE
                     SCGTGWRDGAHFARELCEWTVEYEKSVAKPTESTRKIGRRLMELAQWNLPGVLRPVVE
                     RVIATKVDEHVRVSMDFADPGILITAMMKTLITTRKFLLRYFALPRPESKAVRTLNGS
                     PDPTTGLYTTNLWIAQPWYIEPSFKNRWGLKAMFARLFGDGAVPTRDGPYKEAGYDLR
                     TIGPAAQEKRGHEEMEVIFEGLRGMNFAGGCPFHA"
     gene            complement(<667823..>670087)
                     /locus_tag="ACHE_10225A"
                     /db_xref="GeneID:66977182"
     mRNA            complement(join(<667823..669405,669474..669838,
                     670041..>670087))
                     /locus_tag="ACHE_10225A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276909.1"
                     /db_xref="GeneID:66977182"
     CDS             complement(join(667823..669405,669474..669838,
                     670041..670087))
                     /locus_tag="ACHE_10225A"
                     /note="COG:S;
                     EggNog:ENOG410PX8R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131345.1"
                     /db_xref="GeneID:66977182"
                     /translation="MRNNAGPSAFLPPQICSTQKQSQSEDRFRFTPVKRASTLPRLWD
                     RKPSTSFLSQQSRPRKVWKRFRTSFNSMKSLQQMPGADRPLEETLLDTEINVSRGASV
                     LRGVKRRCLGVDAGEMEGRGRSFLETKWEGEVRRRRKLPTSYTPPLVDGSQPESDRET
                     GQESSTSDIEADLTQDPIEMDESVDIEPNSPIAFNQDTAYPEMLHGTSSCQEVESEES
                     DIDVQPRDGQSTLNTAREVSKEISKGSETTMDQSEPEKETAPAQEITSAQQESTLVRS
                     ALRSSLDGEDAELLNNFLTKARAKRAAKAAMQENVVEEVTKEEQIPDMPTPRSRRALE
                     ELDTNSPSPSPQKVRLPSPKKPENPPASPIRKEIANNHEEQTGDEKQQSSPVTRRSTR
                     VRVPPRTTTTAIRNTLSLRRAKGTEFVFLQKTEAQELALATRKNTRQNKGSAVFPKYV
                     LKNLAQKQSKEESPKPVPSANKKGNRVCWNDARLVEFEDGEEPQAAPAEREPSHEPSD
                     VDSTQPTKKGSEKRKMTGGSSGRTRSQRAQKGNETAPSTGTLAPPKTTATPPAGRVRK
                     LGGSATPTKPKPASSPANSSSKSTTDTPAGKRKKLTPKSPSLLSPAKNTSSAPTTTTP
                     ASKVPKPTSRASTTSAAKSKSIFKANAGSTPMPKRVRARA"
     gene            complement(<670749..>671376)
                     /locus_tag="ACHE_10226A"
                     /db_xref="GeneID:66977183"
     mRNA            complement(join(<670749..670801,670907..671185,
                     671367..>671376))
                     /locus_tag="ACHE_10226A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276920.1"
                     /db_xref="GeneID:66977183"
     CDS             complement(join(670749..670801,670907..671185,
                     671367..671376))
                     /locus_tag="ACHE_10226A"
                     /note="COG:S;
                     EggNog:ENOG410PZDS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131346.1"
                     /db_xref="GeneID:66977183"
                     /translation="MPTDYDGDSQMASSPESGARTPTMTNPPGIHSSELSPPGSQQME
                     RTADLGVFERRNSAATAQGKQQKVKPGEWKSKRAEDEAQRAMEFVVDRDFSLKEFGDP
                     FDERDMEEKLP"
     gene            <671683..>672685
                     /locus_tag="ACHE_10227S"
                     /db_xref="GeneID:66977184"
     mRNA            join(<671683..671742,671826..671932,672013..>672685)
                     /locus_tag="ACHE_10227S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276931.1"
                     /db_xref="GeneID:66977184"
     CDS             join(671683..671742,671826..671932,672013..672685)
                     /locus_tag="ACHE_10227S"
                     /note="COG:S;
                     EggNog:ENOG410PPBA;
                     InterPro:IPR024771;
                     PFAM:PF12752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131347.1"
                     /db_xref="GeneID:66977184"
                     /translation="MSASTAGHNVWDDDWEKQADTLDEQPPPEKKVSSKVTKAQRRAQ
                     QAEFNRQLWAEAEQPQTFHFLEAQSDVPLKQEFKPTVTVLSRKPQASASRSAATPNTA
                     TAGMARLALVADDKVEESDEEDEKKKQPEPTPEERQAIAMRSLEERQRKYEEVRERLF
                     GSPSANTSGTSTPRSATPPNRQNEGRGKGKSRGGGRDNNRDNNKEKRDSSSTSSKSRQ
                     FYDPGNAPRSNSNYVQRKDNQSPGERAGGSQQQSPRQPYRHPRGPDANGRGGFRPRGA
                     KTT"
     gene            complement(<672834..>675386)
                     /locus_tag="ACHE_10228A"
                     /db_xref="GeneID:66977185"
     mRNA            complement(join(<672834..672895,672948..673293,
                     673347..673430,673485..673662,673729..673859,
                     674230..674800,674863..>675386))
                     /locus_tag="ACHE_10228A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276942.1"
                     /db_xref="GeneID:66977185"
     CDS             complement(join(672834..672895,672948..673293,
                     673347..673430,673485..673662,673729..673859,
                     674230..674800,674863..675386))
                     /locus_tag="ACHE_10228A"
                     /note="COG:O;
                     EggNog:ENOG410PIWC;
                     InterPro:IPR036249,IPR040079,IPR036282,IPR010987,
                     IPR004045;
                     PFAM:PF13409,PF13417,PF13410,PF02798;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006749 - glutathione metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131348.1"
                     /db_xref="GeneID:66977185"
                     /translation="MDTPDTQRIGQLQPITLPAFADDAASLAAQQSLGVGDPADATHT
                     FHPLQSDIENLQHQHRHHPQNAISTDTRAFLRPPRTGEPANNLLITDTPHHTPTQQYQ
                     QIRDNDTDNGRLGHLNPQLQQQNESNFALTADMAIKQTDNGKDMKCIPHPPDLDSWRE
                     RLFNVDGTITLSEEQFLTYFPHIDNVYSHRSTQRYKRKPLVSHYWDCRLKGRPPGTPK
                     SNDPNKKKRKRTARQRDLCDVKIKITEYFPGFVPGLTPNDIDPSFPSELLPGVHALLD
                     HSGNENGNDRESQPFGILTPNPSPPDGHDGFAGERFFTIQRVNGNGANGKNDGVGGGH
                     RHTLEESDRVKKNSVQRRVLSQARERKRSSPIKTMARQHQTSQKTYHTEATGTAALTA
                     LNHKNECDLKLFGSCFCPFVQRVWIALELKGIPYQYIEIDPYKKPQSLLEVNPRGLVP
                     ALRHGDWGCYESTVLMEYLEDLNAGTPLMPKDDAKLRAQSRLWADHINRHIVPNFYRV
                     LQEQDQEQQISKAQELREGFTKLIDAAHPQGPFFLGPHISFVDIQVAPWILRLRRVLK
                     PYRGWPDPEEGSRWATWVNAIESNEHVRTTTSTDELYLDSYERYAQNRPNTSQVANAI
                     NSGRGLP"
     gene            complement(<683726..>684896)
                     /locus_tag="ACHE_10229A"
                     /db_xref="GeneID:66977186"
     mRNA            complement(join(<683726..683824,683881..684120,
                     684171..684789,684850..>684896))
                     /locus_tag="ACHE_10229A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276953.1"
                     /db_xref="GeneID:66977186"
     CDS             complement(join(683726..683824,683881..684120,
                     684171..684789,684850..684896))
                     /locus_tag="ACHE_10229A"
                     /note="COG:C;
                     EggNog:ENOG410PFMM;
                     InterPro:IPR006140,IPR036291,IPR006139,IPR029753,
                     IPR029752;
                     PFAM:PF00389,PF02826;
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131349.1"
                     /db_xref="GeneID:66977186"
                     /translation="MADSRPKILLLGKIVHAHSTWHSLSELGELVAPTATNREGFLKE
                     CRDGKLDGVVAAYRTFDSVTITGKIDEEIVNALPRSLKYLAHCGAGYDQVDVHACSAR
                     NPPIRVSNTPTAVDDATADVNMFLIIGALRNFNTGMAALREGRWRGQPVLGHDPQGKV
                     LGILGMGGIGRNLKRKAEVFGMKVVYHNRRQLSEELSEGAQYVTFDELLSTSDVISLN
                     LPLNKNTHHIISKSEFAKMKNGVVIVNTARGAVMDEAALVEALDNGKVYSAGLDVFEE
                     EPKIHPGLVRNPNVLLIPHMGTWTVETQTAMEEWAIGNVRDALQTGKLKSPVPEQADL
                     "
     gene            complement(<687065..>689234)
                     /locus_tag="ACHE_10230A"
                     /db_xref="GeneID:66977187"
     mRNA            complement(join(<687065..687886,687939..>689234))
                     /locus_tag="ACHE_10230A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276965.1"
                     /db_xref="GeneID:66977187"
     CDS             complement(join(687065..687886,687939..689234))
                     /locus_tag="ACHE_10230A"
                     /note="COG:S;
                     EggNog:ENOG410PHHX;
                     InterPro:IPR040194,IPR006768,IPR006767;
                     PFAM:PF04677,PF04676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131350.1"
                     /db_xref="GeneID:66977187"
                     /translation="MTLEDFEKALAEEGRERQEKGDREKRHRDRDRDRSRDRSSRHHR
                     HRHHRHSSRSGERGLGRRDRESRHSDENGHRHKRSRHSTDHGDDRDRSHKRRHRHESR
                     DDGSAGTRESVKEVVQEEPSRPKRDAWMEAPSALSVDYVNRRDSTRLQEPQPKMLQAD
                     FDLKIHNREINNHLHDLKDGKALEEVEEEPAQHEVDYEFGDAGSQWRMTRLKAVYREA
                     EESGKSVEEIAFNRFGDLRSFDDAREEEAELDRRETYGEGYVGKVKPSGELFQERKLD
                     NNVRRDSHEHVRSPGREHQAQGQGKPMETEPPANTTQHLDLTALNRLKAQMMKAKLKG
                     APDATELEERYNTAAASMANRKESDVVVLGVMENRMLAGKRNEVKQVETRRGRERGHV
                     EENEDMSIEDMVQEERRSRGQFGGDGRRLADRIAKDSKFENDLEYMDDNASKLARRVH
                     RSEIDIKNTAINDFQKMNRILDNCPLCHHEDTNTPPIAPVVSLATRVFLTLPTEPELN
                     EGCATIVPIQHRTNLMECDDDEWEEIRNFMKSLTRMYHEQGRDVIFYENAAQPQRRRH
                     AAMEAVPLPYSLGETSPAFFKEAILSADSEWSQHRKLIDTLAKSRQGLGRSAFRRSLV
                     KEMPYFHVWFELDGGLGHVVEDEHKWPKGDLFAREIIGGMLDIGPEIIKRQGRWQRGG
                     DRRVEPFRRRWRKFDWTRVLVEG"
     gene            <689477..>690746
                     /locus_tag="ACHE_10231S"
                     /db_xref="GeneID:66977188"
     mRNA            join(<689477..689519,689584..>690746)
                     /locus_tag="ACHE_10231S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276976.1"
                     /db_xref="GeneID:66977188"
     CDS             join(689477..689519,689584..690746)
                     /locus_tag="ACHE_10231S"
                     /note="BUSCO:EOG09263QH4;
                     COG:L;
                     EggNog:ENOG410PFDS;
                     InterPro:IPR004130,IPR027417,IPR030230;
                     PFAM:PF03029;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131351.1"
                     /db_xref="GeneID:66977188"
                     /translation="MATTPVSVVCVGMAGSGKTTFMQRINSYLHSQKNVPYVLNLDPA
                     VYSVPFESNIDIRDSINYKEVMKQYNLGPNGGILTSLNLFATKVDQIIALLEKRAAPN
                     PSTPSAKPIEHILVDTPGQIEVFVWSASGTIFLETMASSFPTVIAYIIDTPRTSSTST
                     FMSNMLYACSILYKTKLPMILVFNKTDVQDAEFAKEWMTDFDAFQQALREEEETGAFG
                     TEGGAGGFGAGSGYMGSLLNSMSLMLEEFYRHLSVVGVSSMTGDGVEDFFKAVEEKRQ
                     EFERDYKPELERKKKEREEAQANRREEELGKLMKDMNMSGPSGQRRFQDTEPETVSEA
                     EEEEEEDAKAEVEDDDDTDDESAGAPRAGDDDGISQRYRSALSDSQKGPDHEDYSFTR
                     YLRANNING"
     gene            <691117..>691763
                     /locus_tag="ACHE_10232S"
                     /db_xref="GeneID:66977189"
     mRNA            join(<691117..691122,691182..691299,691354..>691763)
                     /locus_tag="ACHE_10232S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043276987.1"
                     /db_xref="GeneID:66977189"
     CDS             join(691117..691122,691182..691299,691354..691763)
                     /locus_tag="ACHE_10232S"
                     /note="COG:S;
                     EggNog:ENOG410PP0W;
                     TransMembrane:4 (i12-34o46-69i90-113o119-142i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131352.1"
                     /db_xref="GeneID:66977189"
                     /translation="MDVFYTYTYTTAGWLSIQSAALTLAPQIIITSLLDETRPPTPLE
                     IYFARTLGFSLLTLAVLVVMLTGSVPLSTTVTEAVTTDESDPKAPYAVPTLMVSTVFQ
                     GVCAFYAYTWYTFNGQAAFAIGVLGYALVASIGLWCLLFASSHGKISRKTGADKRTTG
                     FPFSNREAERKHTGKSS"
     gene            <693251..>694734
                     /gene="ALP1"
                     /locus_tag="ACHE_10233S"
                     /db_xref="GeneID:66977190"
     mRNA            join(<693251..693580,693631..694078,694130..694218,
                     694267..>694734)
                     /gene="ALP1"
                     /locus_tag="ACHE_10233S"
                     /product="basic amino-acid permease"
                     /transcript_id="XM_043276998.1"
                     /db_xref="GeneID:66977190"
     CDS             join(693251..693580,693631..694078,694130..694218,
                     694267..694734)
                     /gene="ALP1"
                     /locus_tag="ACHE_10233S"
                     /note="COG:O;
                     EggNog:ENOG410PK08;
                     InterPro:IPR023828,IPR000209,IPR034193,IPR010259,
                     IPR022398,IPR015500,IPR036852,IPR037045;
                     MEROPS:MER0000344;
                     PFAM:PF00082,PF05922;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="basic amino-acid permease"
                     /protein_id="XP_043131353.1"
                     /db_xref="GeneID:66977190"
                     /translation="MQFFKRALLLFGALLPAALGHPMVQGRHRSPEMIPGRYIVTFKH
                     GLDTAKVDAHTAWATDLHKRHLEQRDQTNDASMPIGIQKSYRFTSFSAYYGSFDDATI
                     EEIRKHEDVEYVEQDQIWYLDATISQNNAPWGLGSISHRGQPSTTYVYDDSAGEGTFG
                     YVVDTGINVDHREFGGRASLAYNAVDNSDHVDTVGHGTHVAGTIGGATFGVAKKANLL
                     SVKVFAGESGRTSDILDGFNWAANDIATKRRTGKAAINMSLGGGFSFAFNRAVENAYD
                     SGVLSIVAAGNENMDARFTSPASAENAFTVAAIDRNNSRASFSNYGSVVDIFAPGVNI
                     LSSWIGNDTATNTISGTSMATPHVVGLAIYVMGLENLADANAVSKRLKELGTRDVVTR
                     TSGSPNLLAFNGAQGGAGTGSGDGHGRVDEDDEDEDENWDWPFEMKRAVRRW"
     gene            complement(<695621..>695884)
                     /locus_tag="ACHE_10234A"
                     /db_xref="GeneID:66977191"
     mRNA            complement(<695621..>695884)
                     /locus_tag="ACHE_10234A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277009.1"
                     /db_xref="GeneID:66977191"
     CDS             complement(695621..695884)
                     /locus_tag="ACHE_10234A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131354.1"
                     /db_xref="GeneID:66977191"
                     /translation="MFCADDIPRNDTSNENDSTSLEAFNLHSKAPSWCAETKSDLKNH
                     GKTLFENDVPGMAALRNGTLKYDASRHIKNGFRLSDGLERVWI"
     gene            complement(<697738..>699960)
                     /locus_tag="ACHE_10235A"
                     /db_xref="GeneID:66977192"
     mRNA            complement(join(<697738..697941,697993..>699960))
                     /locus_tag="ACHE_10235A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277020.1"
                     /db_xref="GeneID:66977192"
     CDS             complement(join(697738..697941,697993..699960))
                     /locus_tag="ACHE_10235A"
                     /note="COG:S;
                     EggNog:ENOG410Q1KZ;
                     InterPro:IPR001452,IPR036028;
                     TransMembrane:1 (o377-397i);
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131355.1"
                     /db_xref="GeneID:66977192"
                     /translation="MAPTRYGQENRPTRGPAGDGLALTARDSDSAVQGHGSSSYDDGY
                     YHPSSYHTGEKGQMAAEDGSYPSKKKDSTTRQDSSLATADQASRGRQQYQGYESGSQS
                     GSQYSGSEYDSSLGNGSQKAGSQYSGSQYAGSQNTNTQNTGSYNAGSQSGSHRGFPSG
                     SPSGSYSSGAYQQSSNTQDTGQQHSQQGTPNSGYLHGQGVAGQQQANSDAANTNAQQQ
                     SSSSQQNAQEVHSKPKQSSQQIQETPSDADNEQSSYKDNDHHATEPSHEQDNKDATLS
                     DAHASGEHHADTAEEGERHNLVNNHVAPVATMQTAQQPTHTLPTLTTGTLDPTSSLTT
                     SVATTDSTHTTSPTTSSTSSATSSPTPEATKDSDDGSYHKATGALAGLLGVALVAGFV
                     VFWLAKRKRQQKSEANRSKMVRDAFRQSLANTKQRTSQFYTNFLGTAVGTGASALGAV
                     RRSLAMAKFNRRSHEQPEKAPMPQEGHVNHPCNDGIHVRGHDLDYSSGHDSDRNDSIA
                     AEKADINESTPTLVVSPSESIARDQTPTVRRVVSGRPQMESSESVEPKSGLSHNMQES
                     EPEHNDKAPEQSPSPSPPAPDNPAPDHGAQENGPPPRNGNGQNLLAITSMVPSSTSVY
                     RVEIAFQPKKVGQLDLREGQHIIIRQSFDDGWVLCTPADGGQEGLAPRACLSPWPIKN
                     ASSASSSKHNLSDGTRTPESPTVPGTPRFYSHFFSARSVTQ"
     gene            complement(<702818..>705498)
                     /locus_tag="ACHE_10236A"
                     /db_xref="GeneID:66977193"
     mRNA            complement(join(<702818..704140,704413..>705498))
                     /locus_tag="ACHE_10236A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277031.1"
                     /db_xref="GeneID:66977193"
     CDS             complement(join(702818..704140,704413..705498))
                     /locus_tag="ACHE_10236A"
                     /note="COG:S;
                     EggNog:ENOG410PJQ9;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131356.1"
                     /db_xref="GeneID:66977193"
                     /translation="MTESTELANPPGESAQQSTESQNGPTAETTSAPAATESSFPALP
                     TIDSTLPAIDKTMPPMDSSLPAIDSSIPAFDSSVPALPSIDTSLPPLDTTLPAEVNLH
                     TDHSFFSDMRQDDTQGAQSGDPTSAPGESNDGLPQHADSSHASTPANQTNQPASNGTY
                     HYSQQSAEQPQPQPQQHQPPPPQPQGQEQQPQQQQAQQNQQPQAQSQQQYQQYQPQQQ
                     TQPQAQYQPQQQAPQQYQQAPQQQYQPQQQQQQYQQQYQQQGSPQAGGQPMNTNHMDH
                     NGVQGQQAHIPQAPIGSPMPANSPPMPSAGQYMTGYPTNVSQMNNAQMRYQLPGDPNK
                     MLSGSRHKKEVKRRTKTGCLTCRKRRIKCDEGHPVCRNCVKSKRDCLGYDPVFRPQSS
                     TPSAIQPAPNPSPSLVVTPQEPPSGASYPAAPPGYVPAVSQPFAPSLPSESSAPSSTE
                     QSQFNYSAAIDPSLEQNNNSGNMASVQHATTNLTDGFYQAPINASGMLCSLGSPAFLA
                     STDIRIVKQVQISDLLALRGIPPPPPHPVTALPPGRLEEIQAVFLATYAPAIDRFFET
                     PWFQEKALPHVMANAQLMAEYSALIDAFNDRNLEDPNVVARLESFEASVIWSTITLCR
                     HVMNMANGNHGQDFDLLAASKRLDVMEALLTGDHVETNPLEQSPVRQPAADPPALTVQ
                     ITQRSLDFWSCLGHFLTLHDNEASSAKEIDDTLARCRTLLDTTENRDVIYSIAIARHL
                     GQRWADFPHSLPQPITTNEKDAGAKLYVAQKFLEQQANGSGTTQVSKRICGMAVRSWF
                     VSRE"
     gene            complement(<706888..>707830)
                     /locus_tag="ACHE_10237A"
                     /db_xref="GeneID:66977194"
     mRNA            complement(join(<706888..707754,707807..>707830))
                     /locus_tag="ACHE_10237A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277042.1"
                     /db_xref="GeneID:66977194"
     CDS             complement(join(706888..707754,707807..707830))
                     /locus_tag="ACHE_10237A"
                     /note="COG:A;
                     EggNog:ENOG410PPJM;
                     InterPro:IPR036236,IPR013085,IPR040023,IPR003604;
                     PFAM:PF06220;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131357.1"
                     /db_xref="GeneID:66977194"
                     /translation="MAEYWKSAPRFWCKQCKIYIRDTAFEKSQHEASAKHQSNLKRFL
                     RDIHRNNELQQRDSQRAKDEVERLKQAVSGNAPPGKRTAAPPPPPTERPVSVDERKKQ
                     MAQLAEMGVAIPDEYRRDMALAGDWQTTSVKVIRDDNEKGKQATKSIGVRKRKAEEDA
                     DTDEEQEEPERLVSKGWGSTTRKYPGAQGEDEDLDTLLASTKNIKKVKPSKDEWPEEE
                     GVKKEAADDNVPTKSEAGEEAAAAAAAPAPAPESEQAPIKEEPSDTTSASAPVKNETE
                     EPEPAGGVLFKKRKPKAMRK"
     gene            complement(<708030..>709951)
                     /locus_tag="ACHE_10238A"
                     /db_xref="GeneID:66977195"
     mRNA            complement(join(<708030..709082,709132..709222,
                     709272..709734,709786..>709951))
                     /locus_tag="ACHE_10238A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277053.1"
                     /db_xref="GeneID:66977195"
     CDS             complement(join(708030..709082,709132..709222,
                     709272..709734,709786..709951))
                     /locus_tag="ACHE_10238A"
                     /note="BUSCO:EOG09261DJC;
                     COG:O;
                     EggNog:ENOG410PG75;
                     InterPro:IPR001611,IPR044079,IPR036859,IPR000938,
                     IPR032675;
                     PFAM:PF01302;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131358.1"
                     /db_xref="GeneID:66977195"
                     /translation="MDFAVNQRRSYDGNLCTIRYVGQVEGTSGDWLGVEWDNPTRGKH
                     SGEHNGVRYFTCRNKEATPGSFVRPSRPADKPRGFLEALREKYVSEFMEQKGSDGFDA
                     TYPLHYPVKFSSKVVEEVGFDKIRKKLAELQELKIVLLDGLRVAGVQAEDGVQKSEAE
                     GLGRERACREIEETCPKIAQLDISRCLVSQWRDVKDICARLERLRVLKLNGNRFGAVE
                     EGLRFEGIAELHLNETLLSWEELSTLSYQFPALKSLSVSMNQVNEVSTPISETITTLI
                     LEHNEIDSLFSVRKLAALPKLKYLSLRGNCIEKISRPSTAEDPIQFSFSLEFVDLSYN
                     KINSWSFINALPLVFPGLQSLRISGNPLYNQPVAPTEITNMPDKPMTVDEAYMLTLAR
                     LPSIQILNYGNITPQDRNNGELYYLSLIGKELSALPEDAEKGILAKHPRYGELCERHG
                     EPIVRRAEEKLGRTVNPRSVAARLVKLVFRLSSQEETIKTKEVPRSFDTYQVKALVSR
                     LFGLTPLEFRLTWETDELDPVSKENREEEEWDSEDEEMDIGNATGDETRFVRREVELV
                     DSTRDIGFWLQDLDETRIRVDLLG"
     gene            <710128..>710890
                     /locus_tag="ACHE_10239S"
                     /db_xref="GeneID:66977196"
     mRNA            join(<710128..710139,710192..>710890)
                     /locus_tag="ACHE_10239S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277064.1"
                     /db_xref="GeneID:66977196"
     CDS             join(710128..710139,710192..710890)
                     /locus_tag="ACHE_10239S"
                     /note="BUSCO:EOG092653YS;
                     COG:A;
                     EggNog:ENOG410PI89;
                     InterPro:IPR031781,IPR000690,IPR003604;
                     PFAM:PF12874,PF16835;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131359.1"
                     /db_xref="GeneID:66977196"
                     /translation="MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDP
                     YFFKNHVGSFECRLCLTVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSSLP
                     GAMGVQVKKQTIKIGRPGYKITKVRDPLTRQVGLLFQLQYQEITPGVVPRVRFMSAFE
                     QKVEEPPDKNFQYLVVAAEPYQTCGFKLQAREIDRRDGRFWTWFDEDSKEFWVQIMFK
                     TEREERFSGVPGLAPMRT"
     gene            complement(<711400..>713475)
                     /gene="CBK1"
                     /locus_tag="ACHE_10240A"
                     /db_xref="GeneID:66977197"
     mRNA            complement(join(<711400..711712,711766..712242,
                     712303..712806,712868..>713475))
                     /gene="CBK1"
                     /locus_tag="ACHE_10240A"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_043277076.1"
                     /db_xref="GeneID:66977197"
     CDS             complement(join(711400..711712,711766..712242,
                     712303..712806,712868..713475))
                     /gene="CBK1"
                     /locus_tag="ACHE_10240A"
                     /note="COG:T;
                     EggNog:ENOG410PIR4;
                     InterPro:IPR017441,IPR008271,IPR000961,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_043131360.1"
                     /db_xref="GeneID:66977197"
                     /translation="MDPNGNNRLHLNFGYNERAFNPAAMNNRAYPTTPSAFPQPIYQN
                     QGPQDLMDTQNGAYGGQGYFMNNPYPPQTPQYAQAAYGQQMASPQATYQNRVPYNDGT
                     NGLIQQFSNQDLNSPRGGFFNRNASPGQRPRTAGSSAPGQQQPHLVPPMPRSPRTPAE
                     NEELQRNPERFSENVHKRGKAAKELVNVFFHENIERARDRNMRSAELDKLIRDPAVPK
                     EKKCQDTGAVSIKESNFLRFLRTKETPNNFQTIKVIGKGAFGEVKLVQRKTDGKIYAL
                     KSLIKTEMFKKDQLAHVRAERDILADSKDNPWLVKLHASFQDTAYLYLLMEFLPGGDL
                     MTMLIKYEIFSEDITRFYMAEVIMAIEAVHKLGFLHRDIKPDNILLDRGGHVKLTDFG
                     LSTGGKKTHDNSYYQNLLKNSTSKDKNRNSGYFNDAINLTVSNRGQINTWRKSRRAMA
                     YSTVGTPDYIAPEIFNGQGYTYLCDWWSVGAIMFECLVGWPPFCAEDTTDTYRKIVNW
                     RECLYFPEELTLSRESEHLIRSFLCDPEHRIGSEGGQYGGASQIKNHPFFRGVVWEQL
                     RNIRAPFEPRLSSNIDVSYFPIDEISQEDTSAIHRAQARAMPDEQEAEMSLPFIGYTY
                     KAFNAFQGN"
     gene            <714370..>715870
                     /gene="TIM54"
                     /locus_tag="ACHE_10241S"
                     /db_xref="GeneID:66977198"
     mRNA            join(<714370..714460,714519..>715870)
                     /gene="TIM54"
                     /locus_tag="ACHE_10241S"
                     /product="mitochondrial import inner membrane translocase
                     subunit tim54"
                     /transcript_id="XM_043277087.1"
                     /db_xref="GeneID:66977198"
     CDS             join(714370..714460,714519..715870)
                     /gene="TIM54"
                     /locus_tag="ACHE_10241S"
                     /note="BUSCO:EOG09263XVS;
                     COG:U;
                     EggNog:ENOG410PGC5;
                     InterPro:IPR021056;
                     PFAM:PF11711;
                     TransMembrane:1 (o44-61i)"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit tim54"
                     /protein_id="XP_043131361.1"
                     /db_xref="GeneID:66977198"
                     /translation="MVDSSNSALAAGQAQSKPAPKAQNPAMRMLGMPNFRFKLPSRNW
                     MIFLTVTGSFTAALLYDRRERKRSQQKWCDLVAHLSKETLPIEQTRRKLTIYLAAPPG
                     DGLRIARDHFREYVKPILVAAALDYQVIEGRREGDIRAGTAENIRKLRRKAGEPSSVV
                     EEQSTEQIIAAARQSMGVYEEPGPQGDIVIGRHTWKEYIRGLHEGWLGPLDPPQPPAP
                     VEEVTNLQNNPETTPAESPEKEGEQAPESKEKEEEKEKAKKKPAGPAPAYIAPADYPS
                     RALPPTLPESFDGSVPIAFPHLLGFLNTPIRLYRYLNRRHLAEDIGREVAGAVLASYT
                     RPYHDDIMPSDSESVTTTPTSIPGHDVTTDLPPRNYEQQTILEEAEREWHKSVHKRDP
                     VGPNGDNEREWLDNVVLDPRIASRMQRYTLCPHEEARAQRIVEGTEYILGEKRPAPVP
                     FWKNLWVQYGYGEDEETLKRKPILGNIDEE"
     gene            complement(<718637..>721427)
                     /locus_tag="ACHE_10242A"
                     /db_xref="GeneID:66977199"
     mRNA            complement(join(<718637..719100,719156..721096,
                     721196..>721427))
                     /locus_tag="ACHE_10242A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277098.1"
                     /db_xref="GeneID:66977199"
     CDS             complement(join(718637..719100,719156..721096,
                     721196..721427))
                     /locus_tag="ACHE_10242A"
                     /note="BUSCO:EOG09260J97;
                     COG:B;
                     EggNog:ENOG410PG4X;
                     InterPro:IPR011990,IPR019734,IPR021183,IPR013026;
                     PFAM:PF13181,PF12569;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131362.1"
                     /db_xref="GeneID:66977199"
                     /translation="MAMISCFCGSSKITTPRHRRKSPPAHIQLPRTSQPGRSSQHHQT
                     RCATAIMPQQLSSKDASLFRQVVRHYETKQHKKGIKAADQILRKNPNHGDTLAMKALI
                     ISNQGQQEEAFVLAKEALKNDMKSHVCWHVYGLLYRAEKNYEEAIKAYRFALRIEPES
                     QPIQRDLALLQMQMRDFKGYINSRSAMLQARPSFRQNWTALAIAHHLAGDLEEAEKVL
                     TTYEETLKTPPPIADMEHSEAVLYKNTILSEAGKVDKALEHLEKVGHRATDVLAVMEM
                     KADYLLRLDRKEEAEAAYTDLLERNPENSIYYDALIRAKGISEDDHQALKAVYDSWSD
                     KYPRGDAARRIPLDFLEGEDFKQAADAYLQRMLKKGVPSLFANIKTLYTNSAKRDTVQ
                     ELVDGYTSGKAQNGDEFLSSSYYFLAQHYNYYLSRNLPKAMESVEKAIELDPKAVEYQ
                     MTKARIWKHYGNVQKAAEEMEKARTLDVKDRHINSKAAKYQLRNNENDKALDNMSKFT
                     RNETVGGALGDLHEMQCVWYLTEDGESYLRQRKLGLALKRLHAVYHIFDVWQEDQFDF
                     HGFSLRKGMIRAYVDMIRWEDRLREHPFYTRAALAGIKAYIQLHEDPDLVHGPMPAGT
                     SREDDTGEDSERRKAIKKAKKEQQRLEKVEAEKREMRKTATAVKGLDGEVKKEDSDPF
                     GTKLVQTSDPLNEATKILTPILEHSPQNIEGQLLGFEVYLRRNKLALAQKCLTAAHTL
                     DASNPTVHIQTLRLRKALDSPKEPLASEVSESVNAELEKILPKSQNLDEWNNNFLSVH
                     KDSVSHIQAALACRQLIDPDTKAQNEKDLAATLDSSDASIETALAGRELLNEWRSEQA
                     TKQVYAEKAKGKWPESSVFGLE"
     gene            complement(<721730..>722391)
                     /locus_tag="ACHE_10243A"
                     /db_xref="GeneID:66977200"
     mRNA            complement(join(<721730..722238,722319..>722391))
                     /locus_tag="ACHE_10243A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277109.1"
                     /db_xref="GeneID:66977200"
     CDS             complement(join(721730..722238,722319..722391))
                     /locus_tag="ACHE_10243A"
                     /note="COG:S;
                     EggNog:ENOG410Q2HU;
                     InterPro:IPR016805,IPR019171;
                     PFAM:PF09774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131363.1"
                     /db_xref="GeneID:66977200"
                     /translation="MSRAASTSAPTLSPQFCFDERVLRDFLRVSRSTIDDSITQNLNA
                     LITPARRGFDPSSTAVRQTDKLEKPIHPEACQSFKENVLFPSWQTRSDVLSYCAGVAT
                     SPDPEDPDLILRQIESARDRERVVNERLDPYSARFFPREARTESLANLVRNQRTVEEI
                     IRARTWAMVSERCSGSSSNWEEALNSWRERQQR"
     gene            <722875..>724040
                     /locus_tag="ACHE_10244S"
                     /db_xref="GeneID:66977201"
     mRNA            join(<722875..723467,723518..>724040)
                     /locus_tag="ACHE_10244S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277120.1"
                     /db_xref="GeneID:66977201"
     CDS             join(722875..723467,723518..724040)
                     /locus_tag="ACHE_10244S"
                     /note="COG:L;
                     EggNog:ENOG410PJBJ;
                     InterPro:IPR012319,IPR010979,IPR015886,IPR035937;
                     PFAM:PF01149,PF06831;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003684 - damaged DNA binding [Evidence
                     IEA];
                     go_function: GO:0003906 - DNA-(apurinic or apyrimidinic
                     site) endonuclease activity [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016799 - hydrolase activity, hydrolyzing
                     N-glycosyl compounds [Evidence IEA];
                     go_function: GO:0019104 - DNA N-glycosylase activity
                     [Evidence IEA];
                     go_process: GO:0006284 - base-excision repair [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131364.1"
                     /db_xref="GeneID:66977201"
                     /translation="MPELAEVSRIVHFIRQHLVGKTLSKVAAQHDDVVYGKVGTSAAE
                     FQKAVQGKQIAGAGQQGKYFWITMSSPPHVVMHFGMAGWLKIRNADTFYYRTDKPEDK
                     DWPPKYWKFLLETDEDPKTEAAFVDFRRLARIRLVDCPADEIRKYTPLKENGPDPVTD
                     KDAVTDSWLIEKVRSKKVPIETLLLDQANISGIGNWMGDEILYHAKIHPEQYSNTLSD
                     EQIKELNSSMRYVCDTSVELLADSERFPEHWLFKHRWGKGKKDQPSVLPNGKEIVFLT
                     VGGRTSAVVPSVQKKTGAVSKDVSDEDVNGAQTQSKRKRGAVKKEENDFESKDDESKV
                     QSKRQSKASVKDENEEDTKQTTETASAGRRRSTRNKK"
     gene            complement(<724157..>725044)
                     /locus_tag="ACHE_10245A"
                     /db_xref="GeneID:66977202"
     mRNA            complement(<724157..>725044)
                     /locus_tag="ACHE_10245A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277131.1"
                     /db_xref="GeneID:66977202"
     CDS             complement(724157..725044)
                     /locus_tag="ACHE_10245A"
                     /note="COG:S;
                     EggNog:ENOG410PV0H;
                     InterPro:IPR019261,IPR043472,IPR012664;
                     PFAM:PF10021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131365.1"
                     /db_xref="GeneID:66977202"
                     /translation="MNRITSQSVETERHNWDAGRQQRREIAKETVKVLPGILKNLPTK
                     PDGYKWTPVEIRRLDPKYCPNLNGQVQVVNGDTFDTAIRFDELFPRKNPINTKPVCVL
                     NMANAIWAGGGFRNGSLAQEEELCYRSSLIFTLKLRFYPMKDLEAIYSPTVVIIRKGI
                     KKDYELLDLKKPRSLPVVSVISMAALYNPGLWWPASGPPTYEDPADREIMKEKMRVIL
                     RMAAHNKHRRLVLGALGCGAFNNPREEVANCWAEVLKEKEFRGWWETIAFAIVPPPPS
                     LRERSNLEIFEEVLDGLSI"
     gene            <725723..>727602
                     /gene="NAR1"
                     /locus_tag="ACHE_10246S"
                     /db_xref="GeneID:66977203"
     mRNA            join(<725723..725830,725905..>727602)
                     /gene="NAR1"
                     /locus_tag="ACHE_10246S"
                     /product="cytosolic Fe-S cluster assembly factor Nar1"
                     /transcript_id="XM_043277142.1"
                     /db_xref="GeneID:66977203"
     CDS             join(725723..725830,725905..727602)
                     /gene="NAR1"
                     /locus_tag="ACHE_10246S"
                     /note="BUSCO:EOG09261P7G;
                     COG:Y;
                     EggNog:ENOG410PGEE;
                     InterPro:IPR004108,IPR009016;
                     PFAM:PF02906"
                     /codon_start=1
                     /product="cytosolic Fe-S cluster assembly factor Nar1"
                     /protein_id="XP_043131366.1"
                     /db_xref="GeneID:66977203"
                     /translation="MSAILSADDLNDFISPGVACIKPVETLPQKAPQNSEDPYQVTTE
                     DKVQPENFPPAEISLTDCLACSGCVTSAEAVLVSLQSHMEVLNTLDAHPQIPLAFEQD
                     GTAKLATNAVPEEGRIFVASVSPQVRASLAATYGISEKEAGYMIDQLLRGPNGLASGG
                     KHGNGFTWVVDTNNMREAVLVLTADEVDESLSPNNTTAADGTNNAPPKRPILSSACPG
                     WVCYAEKTHPFVLPHLSRMKSPQALMGTFFKTVLGKSLGISPSQIWHLAVMPCFDKKL
                     EASREELTDVSWRPEGSASQPVRDVDCVITTREILSLASARGLSLPNLPLKSLPQSLT
                     PRFPDRTLHDMLFSKCASKDQTLASSTSGGYLYHVLKTFQSRNSGSEIVIQRGRNADV
                     VEYILISAEKQPIMKAARFYGFRNIQNLVRKLKPARVSRLPGAKTIGSAGGNRRQPVS
                     RNGASAGSGPDYAYVEVMACPGGCTNGGGQIRIEDAKQITFDTQTTDASETSSKPTPH
                     EQRAWLARVDEAYYSAESESESIAENQQPPSLAEKEPKIHDAMQYWSQIMGVPLPRLV
                     QTTYREVQSDVGKTQTGDNDTARVVELAGKIGGGW"
     gene            <728023..>728306
                     /gene="RPC10"
                     /locus_tag="ACHE_10248S"
                     /db_xref="GeneID:66977205"
     mRNA            join(<728023..728219,728282..>728306)
                     /gene="RPC10"
                     /locus_tag="ACHE_10248S"
                     /product="DNA-directed RNA polymerase core subunit rpc10"
                     /transcript_id="XM_043277153.1"
                     /db_xref="GeneID:66977205"
     CDS             join(728023..728219,728282..728306)
                     /gene="RPC10"
                     /locus_tag="ACHE_10248S"
                     /note="COG:K;
                     EggNog:ENOG410PR3T;
                     InterPro:IPR039747,IPR006591,IPR029040;
                     PFAM:PF03604;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003899 - DNA-directed 5'-3' RNA
                     polymerase activity [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase core subunit rpc10"
                     /protein_id="XP_043131367.1"
                     /db_xref="GeneID:66977205"
                     /translation="MSREAYQVPSLGGQNAFGDGFAGSMDGPIVAYLCGECNSRVSLK
                     RGDQIRCKECGHRVLYKERTKRMVQFEAR"
     gene            complement(<728709..>730081)
                     /gene="TRP4"
                     /locus_tag="ACHE_10247A"
                     /db_xref="GeneID:66977204"
     mRNA            complement(join(<728709..729683,729755..>730081))
                     /gene="TRP4"
                     /locus_tag="ACHE_10247A"
                     /product="anthranilate phosphoribosyltransferase"
                     /transcript_id="XM_043277164.1"
                     /db_xref="GeneID:66977204"
     CDS             complement(join(728709..729683,729755..730081))
                     /gene="TRP4"
                     /locus_tag="ACHE_10247A"
                     /note="BUSCO:EOG09262N10;
                     COG:E;
                     EggNog:ENOG410PH4I;
                     InterPro:IPR036320,IPR000312,IPR017459,IPR005940,
                     IPR035902;
                     PFAM:PF02885,PF00591;
                     go_function: GO:0004048 - anthranilate
                     phosphoribosyltransferase activity [Evidence IEA];
                     go_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA];
                     go_process: GO:0000162 - tryptophan biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="XP_043131368.1"
                     /db_xref="GeneID:66977204"
                     /translation="MPSHPADMQAEHVSISPLLQRLAYPATQVPVEASEIASAFALIF
                     EDRLSAIQMAALLTLLHSTGKDKEADVIAKCSHRMREAASQVERSALKQALKARGKKE
                     GNYKGGLCDIVGTGGDSHSTFNVSTTASIIASPLLMTAKHGNRAQTSFSGSADVLNAI
                     SPVPPKISAVNASNVARVYEATNYAFLFAPNFHPGMGYANPVRRGLGLRTIFNLMGPL
                     ANPVDWALEARMVGVAYQSLGPVFADALRQGGAKKALVVCGEEDMDEISCAGKTNCWK
                     LSEYPNPAYQGSDKPDETSSSEEDTPRTLVTLETFQLHPSDFGLPTHPLSDVYGRKMP
                     KDNAAKLMSILRNELPRDDPILDFVIMNVAALLVVSGICDADTSNMGPGDDGQVITER
                     GPGGGRWKEGVRRARWAIENGASLKCLEEFIEVTNKLEQQQ"
     gene            <730437..>731492
                     /locus_tag="ACHE_10249S"
                     /db_xref="GeneID:66977206"
     mRNA            <730437..>731492
                     /locus_tag="ACHE_10249S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277175.1"
                     /db_xref="GeneID:66977206"
     CDS             730437..731492
                     /locus_tag="ACHE_10249S"
                     /note="COG:S;
                     EggNog:ENOG410PJEZ;
                     InterPro:IPR043141,IPR001790;
                     go_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131369.1"
                     /db_xref="GeneID:66977206"
                     /translation="MPPRLRVSNARLPRSLRCQRALYQHELPILVRSASTATTPAPSH
                     EQMTHSPPPIARYPPSQPPSHRSPEYRRSQLLRQYTSLIRTTPLMLFFQHTNLKSVEW
                     VGIRRELNKALRTVDEKIAAEGRATPALTPHIKMQTVQTNIFEVALRIVEYFRPDQAA
                     MAAGQSPSAVDPASQTSAEINLAGSRDDPSLFHDLSRTAHDAVLNMKNKHEFSTLLAG
                     PIAVLTIPQVSPEHMKAALSVLCPKAVGYPAPTRRANPGWHETGVQEGLQKLNLLAAR
                     VDGDVFDVDQTKWIGSIEGGMDGLRSQLVMALQSIGSSVTNTLEGAGKSLYFTLESRK
                     NVLEEEQKGPEEGKSDS"
     gene            complement(<731715..>733115)
                     /locus_tag="ACHE_10250A"
                     /db_xref="GeneID:66977207"
     mRNA            complement(<731715..>733115)
                     /locus_tag="ACHE_10250A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277187.1"
                     /db_xref="GeneID:66977207"
     CDS             complement(731715..733115)
                     /locus_tag="ACHE_10250A"
                     /note="COG:T;
                     EggNog:ENOG410PKC3;
                     InterPro:IPR000909,IPR017946;
                     PFAM:PF00388;
                     go_function: GO:0008081 - phosphoric diester hydrolase
                     activity [Evidence IEA];
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131370.1"
                     /db_xref="GeneID:66977207"
                     /translation="MAAEHLTIRNLTSTPVTVKRIERFHATNHGFSCLTGTLKNTTHS
                     KSVVVIDSHTEPFAEKEVDIRVEPFTTVKTELPAFVDSKKERLRWTIDAEGEQHQVQT
                     PVPTSESATMKPLSDSPRFQFTGIYVTPEAHLAIYSSANLNAWMKELRDDTLMSSLSI
                     PGTHNAPTYHHAPPSVRCQAVSPREQLQNGVRFFDIRVQPVHPENPDRDELALVHSVF
                     PVALTWRKYFRDLMDEVNDFLEKNPSESLIICLKREGPGTHTDEQLSRIVADHYATPE
                     SRWYTEPKIPTLGEVRGKVVLMRRFNIQERLKQAHEGRGWGIDAAGWADNCAHSMCPS
                     GQICIQDFYEVLKPEVIEKKIQYVSEQCHRASQTCYPFGILPPNADRNHPFYINFLSA
                     SNFFKLKTWPEKIAAKINPAAVDYLCRRHEAEGESDWSTGILVTDWVGKDGDWDLARC
                     IVGMNSRLKFRQSKCA"
     gene            <734155..>735797
                     /locus_tag="ACHE_10251S"
                     /db_xref="GeneID:66977208"
     mRNA            join(<734155..734326,734386..734413,734473..734548,
                     734601..734672,734736..>735797)
                     /locus_tag="ACHE_10251S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277198.1"
                     /db_xref="GeneID:66977208"
     CDS             join(734155..734326,734386..734413,734473..734548,
                     734601..734672,734736..735797)
                     /locus_tag="ACHE_10251S"
                     /note="COG:C;
                     EggNog:ENOG410PHM6;
                     InterPro:IPR036625,IPR000089,IPR001078,IPR004167,
                     IPR023213,IPR011053;
                     PFAM:PF00364,PF00198,PF02817;
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131371.1"
                     /db_xref="GeneID:66977208"
                     /translation="MNALRGSRGITWAARTYRSQRFLPTLSPTLLTIPRRTFHSSSSL
                     WSIKSQVLKDVGEGITEVQIIQWYVEEGAHIEEWNPLCQYQSDKAVDDITARYEGVVK
                     KLHFQADDTVPTGRALCDIEVDDAKYPDGDAQPAPSPEPVQISPIPTETQHTQPTQPS
                     QLTSSEPASEAPKSRYATLATPAVRGLLKTHNVNILDISGTGKDGRVLKEDVNKFIAM
                     RDSAATAQPAAVSTPETEKVVNLSPFQSQMFKTMSRSLSIPHFLYADELNINDISTLR
                     KKLASDSKDPQKITFLSFIIKAVSLALDQYPLLNAKVDTSNPDKPQLIMRPKHNIGVA
                     VDTPNGLIVPNIKDVANRSILNIATELSRLSALGKEGKLTPADLSGGTITVSNIGNIG
                     GTYVMPVIVPNEVAILGVGKSRTTPIFDDAGQVTKGELVNFSWSADHRVVDGATMARM
                     ATKVRQFIESPELMLLNLR"
     gene            <738154..>738983
                     /locus_tag="ACHE_10252S"
                     /db_xref="GeneID:66977209"
     mRNA            join(<738154..738320,738367..738623,738736..>738983)
                     /locus_tag="ACHE_10252S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277209.1"
                     /db_xref="GeneID:66977209"
     CDS             join(738154..738320,738367..738623,738736..738983)
                     /locus_tag="ACHE_10252S"
                     /note="COG:S;
                     EggNog:ENOG410Q2M0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131372.1"
                     /db_xref="GeneID:66977209"
                     /translation="MDFDDDEPIDKELCMSPMIGIANVKRTIIMGRIKLTFSNVGEKD
                     PFFKKESEGPQHKPYNSTAPSSTGRPTPESIRQSASWKFKITNTLDPSKKPGAATLAR
                     WSKAPTRSWWPPQLLPSAAFFALEVEIGRAPLQKRTSCLYELRGCFAIVAFGTRYKLF
                     YYVHYGPNPFPPLEPATNNSYCEQIAAKVTDPVSKNRLIQLIPGDEPMDLRNSEGWDM
                     LAHWL"
     gene            complement(<739764..>740519)
                     /locus_tag="ACHE_10253A"
                     /db_xref="GeneID:66977210"
     mRNA            complement(join(<739764..740216,740283..>740519))
                     /locus_tag="ACHE_10253A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277220.1"
                     /db_xref="GeneID:66977210"
     CDS             complement(join(739764..740216,740283..740519))
                     /locus_tag="ACHE_10253A"
                     /note="COG:G;
                     EggNog:ENOG410PNMQ;
                     InterPro:IPR027417,IPR006001,IPR031322;
                     PFAM:PF13238,PF01202,PF13671;
                     go_function: GO:0016301 - kinase activity [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131373.1"
                     /db_xref="GeneID:66977210"
                     /translation="MLSAGERPQPSTINASLDAPVKPVSLNHSAHTAAPWPDMDQVGN
                     IQHIWVITGPAGCGKSTVGRDLQEELNCPFLEGDDFHSVSNKQKMAQGTPLTDEDRWD
                     WLISLRKAAIDALSPSESNNFHPPSGVVVACSALKQKYRDVMRVAAYGTPLVQIHFIY
                     LRLSESVLIQRVNQREAHYMKSGMVHSQLEVLEEPLGEWDALTVNVEGPKEEVQRNVW
                     DLVTAKLAEYE"
     gene            <742695..>744312
                     /gene="VPS26"
                     /locus_tag="ACHE_10254S"
                     /db_xref="GeneID:66977211"
     mRNA            join(<742695..742914,742978..743450,743519..743543,
                     743633..743749,744086..>744312)
                     /gene="VPS26"
                     /locus_tag="ACHE_10254S"
                     /product="vacuolar protein sorting-associated protein 26"
                     /transcript_id="XM_043277231.1"
                     /db_xref="GeneID:66977211"
     CDS             join(742695..742914,742978..743450,743519..743543,
                     743633..743749,744086..744312)
                     /gene="VPS26"
                     /locus_tag="ACHE_10254S"
                     /note="BUSCO:EOG092632FC;
                     COG:U;
                     EggNog:ENOG410PHXC;
                     InterPro:IPR028934,IPR014752;
                     PFAM:PF03643;
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 26"
                     /protein_id="XP_043131374.1"
                     /db_xref="GeneID:66977211"
                     /translation="MTSLFFSTPVDIDVVLEDSDERQTVDVKLDKGRRERAPLYMDGE
                     SVKGAVTVRPKDGKRLEHTGIKVQFIGTIEMFYDRGNHYEFLSLVQELAAPGELQHPQ
                     TFPFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVVREKDLWVYSYRMPPENNSP
                     IKMDVGIEDCLHIEFEYSKSKYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGSPP
                     NQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKYSTRYYLSLVLI
                     DEDARRYFKQSEITLYRQAPEIAATPQIAQQQQIQQQQIQQQQQPLPPGSATAGPGRG
                     EAHQQQQQQQQRTAPPPAA"
     gene            complement(<745904..>751342)
                     /locus_tag="ACHE_10255A"
                     /db_xref="GeneID:66977212"
     mRNA            complement(join(<745904..750460,750511..750599,
                     750662..750868,750921..751094,751150..751216,
                     751265..>751342))
                     /locus_tag="ACHE_10255A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277242.1"
                     /db_xref="GeneID:66977212"
     CDS             complement(join(745904..750460,750511..750599,
                     750662..750868,750921..751094,751150..751216,
                     751265..751342))
                     /locus_tag="ACHE_10255A"
                     /note="BUSCO:EOG092604MJ;
                     COG:I;
                     EggNog:ENOG410PGDZ;
                     InterPro:IPR016024,IPR026829,IPR032817,IPR032629,
                     IPR032691;
                     PFAM:PF12783,PF16213;
                     go_process: GO:0015031 - protein transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131375.1"
                     /db_xref="GeneID:66977212"
                     /translation="MSSQFLQTELLHLIQESKRKNADLRNAAETSLNELKALPSTSEA
                     QTTADLIRRPKFVDPFIITCHSRHAKLAGIGVVCLQRLVASRSLPPERLRDVLNGLRE
                     TTNLSLDIQLKVLQTLPSLLQHYSNELSGELLVSTLEICAMLQASKTLAVSSTAAATL
                     QQLVTSAFERIAIDDKILDLSKPTEIVTVDDHPVTISHFAYDALRVLDDLCRLVDGEP
                     LQFLRMKSLSPTFTLELIESILVNNGNLFVGHAELTQVLRARLMPLTVRYLSERHNFA
                     QTVRVSRILLICLKRHMSLLTAECEMALGLLTHLLEPDGTAPWKRVICMELFRSLYAE
                     PGLVRLMYSLYDGEEGRKNVLRDHMASLVRVASERPSLIGVGSQSTVPTRAEHSRSIT
                     EEQITLEAGGVAGVIGTSVPTDTNVPGVSSQWSVVRSPYMDMLDKTDAPLPPDTYIYS
                     LILNCIAVFAEGLAKFILPLTVPEFKHKRKNRIATPDQEPSSPVALSSDFQRTHSWKI
                     TQNSKSKKSPVPVNLLELESHPQISAIKMCAGIIENCWPAVLATCSTFLYAALDDEFY
                     HSLVRSFQKLAHVAGLLRLSVPRDAFLTTLGKAAMPPETGGAKTGTSTAPVFDSQNDY
                     ASEKRRKGADIGSPLPADSPSATSDSHSVLLSTRNLLCLRALLNLGIALGPILDQPAW
                     SIILETLQDTDLLIGISSVSTIKSSAAVNSPGDAATSSGIDVPKANLGAEIIAVQTAS
                     NKMFESTNGYPTDSFQDILVALLSLSRFTEEASQEDPSGNVSGAPRSAQSLRCSGHMR
                     KSTRRVSLTVGKSKAQDEQLKFVLEKADQIAKANLERLSSLDENDLRSWQSLTDSLIS
                     GASHGEVSQALRLKASEVLNNLVFQTMKQNDVDDDSLRNTRQLRNLETLKKQINSLYN
                     SKLPGSYPAVVIEIHEQSLEILKNILEQYAETFADGWTLVFDLISSVFGEVMAEETSE
                     TGTANSGKASLLADSPRLIRAAYKSLQLVASDFLSLLPAPCRLDLVDSLSGFASQQQD
                     FNISLTTTSSFWNVSDFLQGQIERFTIESHVDASVGEEDLAALAKDNDVSVSRNSLWL
                     LLLLRIVDLATDSRTEIRNCAVHTLLRIFDAYGQQLSAKAWRLCLNRVLFQMVENVEA
                     ELTRVVRERSGANSLELKPWIDTTVVMIKGSAELITTFFDSIVQDEEFDRSWERLLNY
                     FQTLIGLGLLEFSEAVFSSLSNILLRVESPTGFSKQALESTWSLWDSGHPASKEDLLD
                     LDCPNQDSALAYLQSFEQVYRLHKDNLTRERIAGILGHMKLLAWNSVSPRYSPDIDRS
                     STLQSLIIASTKAICLDKKDSQPEILLCLADYADSALSKWTPGSDSRRPTFVAFSKSA
                     VDLLRWYIADFGIKEDVFTDGSLATALKHLSNPITRKYEWQGKDREPRLWQKATTTSL
                     DILQVAIPYVEKQYEKSIEGEISRFWECVVDILRGIVSAKGYRTKELSMTDMLADEFF
                     DITAFNRLKSLIIPSLGAAVIKDNIRRDFAFALFHSSFIYAPKRFDLPDITTLMNDPL
                     KGIYNVRPGRTFEPPPTTRFRMAYVLVDAMFELAAVPGDDDGHQEPHTLLARSISPYL
                     ILRSAVSLRAYIADQPLRGLMPQPTPARKVLLHLLRGMVELRSEPSAIPEPPVVRSVA
                     ASLVQPNDGYQLKKHLEWIYPLVVKALQVAGKEKDDGEVLRVLGELLQEVGHCGI"
     gene            <751833..>752504
                     /gene="MMS2"
                     /locus_tag="ACHE_10256S"
                     /db_xref="GeneID:66977213"
     mRNA            join(<751833..751905,751979..752058,752121..752246,
                     752304..752383,752444..>752504)
                     /gene="MMS2"
                     /locus_tag="ACHE_10256S"
                     /product="E2 ubiquitin-conjugating protein mms2"
                     /transcript_id="XM_043277253.1"
                     /db_xref="GeneID:66977213"
     CDS             join(751833..751905,751979..752058,752121..752246,
                     752304..752383,752444..752504)
                     /gene="MMS2"
                     /locus_tag="ACHE_10256S"
                     /note="BUSCO:EOG09264UD3;
                     COG:O;
                     EggNog:ENOG410PMX7;
                     InterPro:IPR016135,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="E2 ubiquitin-conjugating protein mms2"
                     /protein_id="XP_043131376.1"
                     /db_xref="GeneID:66977213"
                     /translation="MSAKVPRNFRLLEELEKGEKGLGAEACSYGLADGEDMMMSNWNG
                     TILGPPHSVHENRIYSVNIHCGADYPDNPPSIQFISRVNIPCVDQRSGKVDPTKLPCL
                     AQWKRDFTMETVLLELRRYMALPQHRKLPQPAEGSNF"
     gene            <752856..>753822
                     /locus_tag="ACHE_10257S"
                     /db_xref="GeneID:66977214"
     mRNA            join(<752856..752904,752970..753130,753196..>753822)
                     /locus_tag="ACHE_10257S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277264.1"
                     /db_xref="GeneID:66977214"
     CDS             join(752856..752904,752970..753130,753196..753822)
                     /locus_tag="ACHE_10257S"
                     /note="COG:S;
                     EggNog:ENOG410PSES;
                     InterPro:IPR008011;
                     PFAM:PF05347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131377.1"
                     /db_xref="GeneID:66977214"
                     /translation="MRKITAPKLSGVHRFACLALYRALLRQCAKLPSTAPTLSEVKPT
                     IQQKFHRYRNLQSPSQTLDALNFGYEALDLIHVASRGNQNVIQRVSTLISESQSERQI
                     NSSIQQALSKAKPAKPKSKKEQKKKIIQAFEKQTARRHPDAIPITFRPRPAVSGKRRI
                     PVLVNARGVPFLRIKKPQPMNLSGAIRSKLENRWRRIERRESLEAALEIARGEDRWDQ
                     LTHGQEPATWSQVITDALTEVNDKIRESDLQNKKLAKDMWNVVLAERKLAAEEEKRAS
                     NA"
     gene            complement(<754345..>755111)
                     /locus_tag="ACHE_10258A"
                     /db_xref="GeneID:66977215"
     mRNA            complement(join(<754345..754979,755045..>755111))
                     /locus_tag="ACHE_10258A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277275.1"
                     /db_xref="GeneID:66977215"
     CDS             complement(join(754345..754979,755045..755111))
                     /locus_tag="ACHE_10258A"
                     /note="BUSCO:EOG09265K60;
                     COG:S;
                     EggNog:ENOG410PPZ9;
                     InterPro:IPR016135,IPR040213,IPR006575;
                     PFAM:PF05773;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131378.1"
                     /db_xref="GeneID:66977215"
                     /translation="MGREEQIEEREVLDSIFPEEITDLSETSYRISVTLETPENDTIE
                     DAEQPVLLLQISYPADYPDVAPELEISAPHNAPKHPRLDVQEDRDRLLEALAPTVEEN
                     MGMAMVFTLVSALKESAELLMSERSNAAQALKEMEAAKAEEEENRKFQGSAVTIQSFL
                     EWHEQFRKEMAEKEQRQREEKEAEDKKGRKPAAREEKKLTGRQLWERGLAGKGDYDEE
                     GEDALPAVEKMKISS"
     gene            <755505..>756729
                     /locus_tag="ACHE_10259S"
                     /db_xref="GeneID:66977216"
     mRNA            join(<755505..756034,756090..>756729)
                     /locus_tag="ACHE_10259S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277286.1"
                     /db_xref="GeneID:66977216"
     CDS             join(755505..756034,756090..756729)
                     /locus_tag="ACHE_10259S"
                     /note="COG:S;
                     EggNog:ENOG410PI0V;
                     InterPro:IPR011990,IPR019734,IPR013026;
                     PFAM:PF07719,PF13424,PF13432,PF13181;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131379.1"
                     /db_xref="GeneID:66977216"
                     /translation="MGKPRPHKKKASKSKSALRARNSKMNEDPTKLLEQATLLLQTGQ
                     ADEALSVAQRALELASNSPLSALNTVAEVYIELGEIDVAREHFLRAVELDPNGTIPES
                     QGGGAEKFLWLSQLSEQGGQDSVKWFEKGVSSLRHTIQQLEGTNDPENLATLEEKKRK
                     MANALCGVAEIYMTDLSWEEDAESRCEALITEALHVNPNAPEVLQTLASVRISQLRTD
                     EARSALSRSMELWKDLPPEDQTVPEFAIRISLSRLLMEVGMELEALEVLERLILEDDQ
                     SVEAWYLGGWCLNLLAEKQQAPKDEEPEQETPESNRLASLVASREWLKQSLTLYDMVQ
                     YEDERLKEHALELVANMNKELPEDIDDEDDKEGEGEEGDWVDEIEAESDEEMADS"
     gene            <757085..>758841
                     /gene="SIR2"
                     /locus_tag="ACHE_10260S"
                     /db_xref="GeneID:66977217"
     mRNA            join(<757085..757364,757434..757744,757816..758367,
                     758421..758600,758659..>758841)
                     /gene="SIR2"
                     /locus_tag="ACHE_10260S"
                     /product="NAD-dependent histone deacetylase sir2"
                     /transcript_id="XM_043277298.1"
                     /db_xref="GeneID:66977217"
     CDS             join(757085..757364,757434..757744,757816..758367,
                     758421..758600,758659..758841)
                     /gene="SIR2"
                     /locus_tag="ACHE_10260S"
                     /note="COG:B;
                     EggNog:ENOG410PGKD;
                     InterPro:IPR029035,IPR003000,IPR026590,IPR026591;
                     PFAM:PF02146;
                     go_function: GO:0070403 - NAD+ binding [Evidence IEA]"
                     /codon_start=1
                     /product="NAD-dependent histone deacetylase sir2"
                     /protein_id="XP_043131380.1"
                     /db_xref="GeneID:66977217"
                     /translation="MDLAPAPSGESSSLKEPVIEVQAVDMTSTETEETTNPVTAEQEE
                     ELAKKEDEEDQKLLSEYETDSEAGSDEWETQSLYEDALQFVRDDQLRDGVPGACTLDE
                     AVAYRQRLHDIGKAAFVEETIVREIVSAKKLCTAFGILPPPFLEGAPDEAYHPLLAMG
                     ISREFSRRQKLPQYNTLDDAVKLLKDSKNIIVLTGAGISTSLGIPDFRSKDTGLYAQL
                     EHLGLSDPQEVFDIHVFREDPRIFFSVAKDILPTENKFSPTHGFIRLLQDKNKLLTNY
                     TQNIDNIEANAGVFPDKIVQCHGSFATATCFKCQHKVPGDTIMEDIKKGVIPECVECK
                     KRLDGDLLKPQGMKRKRSSNGTQKDRKDQDSSDDEDDYELPTPGIMKPDITFFGEDLP
                     DEFGRRLVHHDRERADLVIVIGTSLKVAPVAEVPGVLPRTVPQIYISRTPVSHTGFDI
                     DLLGDCDVVVSELCRRAGWDLKHEMIPPDEKVEVKQVEGYESRHEFKVVGA"
     gene            <759284..>760992
                     /locus_tag="ACHE_10261S"
                     /db_xref="GeneID:66977218"
     mRNA            join(<759284..759397,759550..760472,760522..760724,
                     760778..760902,760951..>760992)
                     /locus_tag="ACHE_10261S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277309.1"
                     /db_xref="GeneID:66977218"
     CDS             join(759284..759397,759550..760472,760522..760724,
                     760778..760902,760951..760992)
                     /locus_tag="ACHE_10261S"
                     /note="BUSCO:EOG09262GNE;
                     COG:L;
                     EggNog:ENOG410PFNQ;
                     InterPro:IPR002052,IPR029063,IPR016691,IPR000241;
                     PFAM:PF01170;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0032259 - methylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131381.1"
                     /db_xref="GeneID:66977218"
                     /translation="MEFLIRFAQAHETFRQPEIEALASLAGYEVKFLYYDKFSPYAVV
                     KLPDEAAARAVISRSILAKDIFVLWGQATNYDDLHADVRRRTSHLWEDLKHVSFRFTV
                     DAFAGKHTAEEKRNIIQSFAYVGFEGPIRMKDPDEQFWVFEEYISDVEVPRLSRSAEP
                     MPELLRPKRIFLGRWLAQGSRDIMAKYDLKKRKFISTTSMDAELTLITANMAHAAPGK
                     LFYDPFVGTGSFCVAMAHFGALNIGSDIDARSFKGKDPATVGNNKQVRDVRTGRSIGL
                     LSNLEQYGIASKYVDAFTSDLTNTPIRLGQFLDGIVCDPPYGVREGLRVLGTRDGRGT
                     EEVLIDGVPAHYLPGYIAPKKPYGFEAMQNDILTFASRTLVTGGRLCMWMPTSNDEVE
                     LVIPMHPNLEIVSVSVQPFNNWSRRLITYRRLPEGQVSDVSLGRQKDDAQGMYADELN
                     EFRRKYFTKNEKKLAKEQ"
     gene            complement(<761043..>762056)
                     /locus_tag="ACHE_10262A"
                     /db_xref="GeneID:66977219"
     mRNA            complement(join(<761043..761317,761379..761469,
                     761523..761941,761990..>762056))
                     /locus_tag="ACHE_10262A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277320.1"
                     /db_xref="GeneID:66977219"
     CDS             complement(join(761043..761317,761379..761469,
                     761523..761941,761990..762056))
                     /locus_tag="ACHE_10262A"
                     /note="COG:S;
                     EggNog:ENOG410PXRY;
                     InterPro:IPR011146,IPR001310,IPR019808,IPR036265;
                     PFAM:PF11969,PF01230;
                     TransMembrane:1 (i26-46o);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131382.1"
                     /db_xref="GeneID:66977219"
                     /translation="MSDSLLNNHLNKNLKFIRFPSWRMKYILQLQTILVYISRVILHL
                     RIMTSARCPFCNIAARYPHILPSLFNSNSNNATITTPDSVLSRLRAETEETRPESGPA
                     SGSGSEPELEAESSHAYLILSTKSVLAFLDIMPLTRGHVLVVPREHYGTVGDVGVTAG
                     RELGQWIPIISRAVMRALFGDSEAHWNVVQNNGIRAAQVVPHVHFHIVPRPPLDQPPS
                     SKKTSYVMFGRGQRDELDEEEGEKLAGEIREELAREVQRVRDVEGVDLEGDIGGDERK
                     RRGGGKL"
     gene            complement(<762903..>764609)
                     /gene="CLB2"
                     /locus_tag="ACHE_10263A"
                     /db_xref="GeneID:66977220"
     mRNA            complement(join(<762903..762988,763046..763184,
                     763234..764466,764601..>764609))
                     /gene="CLB2"
                     /locus_tag="ACHE_10263A"
                     /product="G2/mitotic-specific cyclin"
                     /transcript_id="XM_043277331.1"
                     /db_xref="GeneID:66977220"
     CDS             complement(join(762903..762988,763046..763184,
                     763234..764466,764601..764609))
                     /gene="CLB2"
                     /locus_tag="ACHE_10263A"
                     /note="COG:D;
                     EggNog:ENOG410PGW0;
                     InterPro:IPR036915,IPR006671,IPR004367,IPR039361,
                     IPR013763;
                     PFAM:PF02984,PF00134"
                     /codon_start=1
                     /product="G2/mitotic-specific cyclin"
                     /protein_id="XP_043131383.1"
                     /db_xref="GeneID:66977220"
                     /translation="MPPQVRSLRTRGAMNENDENGPSTRVTRAKAAALSTEGQAANVP
                     AKKPLQTKKVATSTANNGAPRRRAALGDVSNVTKSENTETKEGKKPATSKIGLTSKAT
                     SQTGGVQKLSRTNTSRTGTTATATAKKPSSETKRVGSAQVKRTSSQKSVQEKTLQAEE
                     PPRKKVEVEKKAAEKQPPVEKVSTVKEELEVPVADNAKQAFEDAVVDLDTEDLDDPLM
                     VAEYVVEIFDYLRDLEIETQPNPEYIEHQPDLEWKMRGILVDWLIEVHTRFRLLPETL
                     FLAVNIIDRFLSAEVVALDRLQLVGVTAMFIASKYEEILSPHVANFSHVADETFSDKE
                     ILDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLAKYLIEISLLDHRFLVY
                     QQSHVAAAAMYLARVILDQGPWDATLAHYAGYTEDEIDPVFRLMVDYLHRPVCHEAFF
                     KKYASKKFLKASIITRQWAKKYHHYYIKSSLAQSYSSL"
     gene            <765927..>767214
                     /locus_tag="ACHE_10264S"
                     /db_xref="GeneID:66977221"
     mRNA            join(<765927..767057,767113..>767214)
                     /locus_tag="ACHE_10264S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277342.1"
                     /db_xref="GeneID:66977221"
     CDS             join(765927..767057,767113..767214)
                     /locus_tag="ACHE_10264S"
                     /note="BUSCO:EOG09262X31;
                     COG:J;
                     EggNog:ENOG410PFKQ;
                     InterPro:IPR022669,IPR008991,IPR022666,IPR014726,
                     IPR002171,IPR012340,IPR014722;
                     PFAM:PF03947,PF00181;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131384.1"
                     /db_xref="GeneID:66977221"
                     /translation="MLQARMALTGLRLPFRCLPSLSLPARAYSTTINQTEKPPQQESN
                     PSNFDPGIAFAPPPTREDTGVLLRSYKPRTPGIRHLRRPINDHLWKGRPVQKLTFPKR
                     GHAKGGRNHTGRVTIRHRGGGHKRRIRTVDFSRIAPGPHLVERIEHDPGRSAHIALVR
                     SQQTQRLSYILAAEGMRAGDVVQSYMSGIPEDLWKSMGGTVDPGVLAARTAWRGNCLP
                     LHMIPVGTLIFNVGLYAGKGGQLCRSAGSFATVIAKGGDFQGRANDTSRTQTGGPGAE
                     EEKKPLSQREKQKLERATQHVTIRLQSGEVRLIHKDCCATVGVASNPNHQYSQLGKAG
                     RSRWLNIRPTVRGLAMNAADHPHGGGRGKSKGNVDPKSPWGIPTKSGYKTRPKWKINK
                     AVVVPRVRNQGKRRRGYS"
     gene            <767866..>770773
                     /locus_tag="ACHE_10265S"
                     /db_xref="GeneID:66977222"
     mRNA            join(<767866..768187,768292..768604,768655..769174,
                     769230..769721,769774..770031,770099..>770773)
                     /locus_tag="ACHE_10265S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277353.1"
                     /db_xref="GeneID:66977222"
     CDS             join(767866..768187,768292..768604,768655..769174,
                     769230..769721,769774..770031,770099..770773)
                     /locus_tag="ACHE_10265S"
                     /note="COG:K;
                     EggNog:ENOG410PMB5;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131385.1"
                     /db_xref="GeneID:66977222"
                     /translation="MADNDPSQYSAFQSLPQSQSQLTEIDHDAAASPATAAANGGGDG
                     SSNYVPRPKRIACVVCRRRKLKCDGKKPSCGTCSRLGHACAYDEARKKSGPKRGYVKQ
                     LEARLAQVEVLLNGQESTALPAPQTLPQSQENAFDAPMSNSTLPSDLTSIPAIPDVVD
                     RCIVSGEIATQTQPARGYLPEQGFNTTGNSTWDMISLGLEESLPDQNVIDELHQIYFE
                     KVHPSIPVVHRPRYLAASNLAPSLRPPVYLQYIMWCHAASINDKYHQLHGHFYQRARK
                     YAELEEMKGLGENILSLAYCQTWLLIATYESKMLYFPRAWLSTGRCARMALMMGLNRL
                     DGAGLNVKQSLPPPKDWTEREERRRLFWMIFCCDRYASIGTSWPMAIDERDIMTNLPA
                     TEDSFIKSKPQRTLRLADVLTGEGNATLSPLASVVLLAALFGRNLTHLHRPDPQDNDY
                     DLNGEFWKRHRSYDNLLLNIALQLPSHLRLPAGMDDPNIIFSNMCIHTSTICLHQAAI
                     FKAEKNKMPSQMIIESKRRCIVAADQIANIMKLISHMDLTIMNPFLSFCVYVAARIFV
                     QYLKSRPDDSLVQSSLQFVMSALRALKSKNPLTETFLVQLDVDTEGTAFQGVQTQKNR
                     DGHGNHCAPGLEVCAPENIADCPAFLGLPDSHSGDASENAPQSRASDPSLNHNSIPNQ
                     YNHDGTQPNLNAGFIRPSHNFDPEIDTTARAIIDMDAAPNLILNDDSNTPSNHQSPST
                     LNSMSRTEDPPPQKLSPPNTDHSTQIPMNPLNMPSSVGGGTDPSQFSNPSSLARHLNQ
                     DTAPFYSTRPGTSFSIPSPSAWDFANSQAGVSSPGNVTSGPTDSYAEAQFAQFILDTT
                     WRG"
     gene            complement(<771145..>772401)
                     /locus_tag="ACHE_10266A"
                     /db_xref="GeneID:66977223"
     mRNA            complement(join(<771145..771831,771896..772208,
                     772289..>772401))
                     /locus_tag="ACHE_10266A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277364.1"
                     /db_xref="GeneID:66977223"
     CDS             complement(join(771145..771831,771896..772208,
                     772289..772401))
                     /locus_tag="ACHE_10266A"
                     /note="COG:S;
                     EggNog:ENOG410PJKX;
                     InterPro:IPR024977,IPR040132,IPR015943,IPR001680,
                     IPR019775,IPR020472,IPR036322,IPR017986;
                     PFAM:PF12894,PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006406 - mRNA export from nucleus
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131386.1"
                     /db_xref="GeneID:66977223"
                     /translation="MAPPRRNLLSKDRFAFAFETLKTQNYYDPASKAPGSHTIRTLAW
                     NPTGQLIATGSADRTLRIWNPERPAVRYSTDLRGHSAGVEKVLFHPVRESELASCSTD
                     GTVRFWDVRSKTCVSRLDVGGEAFTLSWSADGSVLMVGRKDDTLIPVSVESPSSPTML
                     IDGVTSNGFPRDGKTTYTALESHPQPIQTNATTFSHHIPTPTASDLHLFATTGEGTVK
                     IMSYPSFDILHTLHAHTSACLSIALAPTGRYLAIGGSDALISLWDTTDWICKRTVSSN
                     NGGAVRGVSWSFDGRFLCGACDEAGCGGNGIEIFHAETGESVYTVPVGGSSNTGIPAV
                     AWHPSRYWLAYSTTNDGPGSGGAGGLKIVGAAGGSL"
     gene            <773302..>774810
                     /locus_tag="ACHE_10267S"
                     /db_xref="GeneID:66977224"
     mRNA            join(<773302..773445,773507..773651,773715..773777,
                     773844..773945,773995..774141,774193..774532,
                     774609..>774810)
                     /locus_tag="ACHE_10267S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277375.1"
                     /db_xref="GeneID:66977224"
     CDS             join(773302..773445,773507..773651,773715..773777,
                     773844..773945,773995..774141,774193..774532,
                     774609..774810)
                     /locus_tag="ACHE_10267S"
                     /note="COG:A;
                     EggNog:ENOG410PPRK;
                     InterPro:IPR013893;
                     PFAM:PF08584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131387.1"
                     /db_xref="GeneID:66977224"
                     /translation="MLDLGDDASRREKCYTTITQLPAYVDPKQPPTKKSPFSAILSLP
                     YIHTVETILPEALYSSIGESLNAKLQKPQYARVLMPLASLLEGEFFNAYIKIGKILMI
                     SEGRSGTDNVFSLRDGILRLELGKEIFERTGLAGKPIRGGGRKHAKERYLVELNLRLP
                     SMLHGKKGFERIVWAFRNVLTESVAWLFCDLASESNDLPKDIGNTPLQKHQPQIIECD
                     MARILHCEVLVPPSQMDITESTPSEDVQEHCNALSEWLAMVSLESPRVTANDTIDPYL
                     SRYSVPDADDANPTNLISLKWHGFINSRWITQLLTALLVETSSQTAGAQSWFALSSNA
                     LGREAVDGKDGYTILSQLPNSHSSNPSRRQCICWEFVGTSNTLVMK"
     gene            <775025..>775942
                     /locus_tag="ACHE_10268S"
                     /db_xref="GeneID:66977225"
     mRNA            <775025..>775942
                     /locus_tag="ACHE_10268S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277386.1"
                     /db_xref="GeneID:66977225"
     CDS             775025..775942
                     /locus_tag="ACHE_10268S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131388.1"
                     /db_xref="GeneID:66977225"
                     /translation="MDTRNGGAHYSISRDGNTTIADESEDATATAPVTQLPTPPATSP
                     VHTESTRRYTPKLPRHNRVASAGLRITIPNDSDYYAYALCRPLPESKDPMAYMTPVGY
                     GYTVFASTGQMLYLFIPGPKLPHQVSRYSVPPDGSIRPIVAPMDSVSPLSLPGPMLPH
                     SGSHAGSMLPVGSTLCTRENTSFIPVSTISQGIVQGSALLMAMSNFPQAPFGASNVFI
                     FAQYEAAPPAQRPSSSSQRQPNEHHTPLKQRAFETQRTALKRKFGFAEHIVPPSFMTN
                     SDKNGRWDIDYYSRWYPLIASKNKRPCLR"
     gene            complement(<776641..>781793)
                     /gene="DNA2"
                     /locus_tag="ACHE_10269A"
                     /db_xref="GeneID:66977226"
     mRNA            complement(join(<776641..779174,779235..779496,
                     779545..780039,780094..780189,780246..>781793))
                     /gene="DNA2"
                     /locus_tag="ACHE_10269A"
                     /product="tripartite DNA replication factor"
                     /transcript_id="XM_043277397.1"
                     /db_xref="GeneID:66977226"
     CDS             complement(join(776641..779174,779235..779496,
                     779545..780039,780094..780189,780246..781793))
                     /gene="DNA2"
                     /locus_tag="ACHE_10269A"
                     /note="COG:L;
                     EggNog:ENOG410PHGW;
                     InterPro:IPR022765,IPR041677,IPR014808,IPR026851,
                     IPR027417,IPR041679;
                     PFAM:PF08696,PF06023,PF13245,PF13087,PF12705,
                     PF01930,PF13604,PF05127;
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0017108 - 5'-flap endonuclease activity
                     [Evidence IEA];
                     go_function: GO:0017116 - single-stranded DNA helicase
                     activity [Evidence IEA];
                     go_process: GO:0033567 - DNA replication, Okazaki fragment
                     processing [Evidence IEA]"
                     /codon_start=1
                     /product="tripartite DNA replication factor"
                     /protein_id="XP_043131389.1"
                     /db_xref="GeneID:66977226"
                     /translation="MSKPLNSYPISSKSRTKLHAFRYDDDAEKSTEKSPAKSSSKSNH
                     ATKENQASWLNGVVEQEEPRPGKEPLSSQTTETKQIKECPQTPMNRLPLADLIGNAED
                     AISRAPGQELTPEDHVIWQHVPTSSNSGSVSRSARGKKRRHSATPSSSPLADNSNYAN
                     QEPLDMQSAQALLKTPQNDLATDLWNNYVGKGVLNGNGDLPPPRLQNLLSSSPQTPAS
                     AKKGRDSSGLRRAISCNVDWPTSKAKRRRMDGDGSRTGRNIFSRSRSNVVDSGNAKTT
                     SLRSLVEKMESLHKAPAAPADPPGSSSVPVRANVQQRNRSIPPIEDKTALKVSGMAGS
                     KDTTNTLGPNSRELQETTPQGSSSEFEDDDLDMDLLEFADTTLDSFTEPTQSRSTVHS
                     VKPVPTNRPVSKEQHMYDHSMEAMPHSTNVGMNIRNAANDIDEFDDDDDELPENIRMV
                     LDGCDKAPVAAKPESSPTPKHAVSTNSSKEIEKPDSSSGDEFDDEDFDFEAIEQSMRH
                     PGDNGRSHNIRSRQAIKRYLIADTAEDTYTTPKGRAQPEQILLVQDEKSKLRKVIILR
                     ESWFDSPCSKDSYIHLIGEFDAQGHCIVDDSQNMIILHPDHLISATVVSDSTSCQRRA
                     VLQERIKYSGDIGKAQVFGNVFHEIFQEAMKKNRWDLSSLKSLATNVLSKHVEDLYII
                     QMTMAQAVEYVMGRIPALRSWAETFLRVKPTNESVVEDRNSSKMRLSINKLLEVEEHI
                     WSPMYGLKGNVDATVQIACNDGEGDKNLVIPLELKTGNRDTNHAHRAQTALYTLLLSD
                     RYDVDVNFGLLYYLEISKIFRIRGIRHELLQMIQERNRLAGYVRQRLQLPPMVKRPGM
                     CNKCYAKTPCLIYHKLADDGNGDSSGLGDDFDKDTDHLTPQHQAFFKKWDQLLTKEEQ
                     DMMKFRRELWTLLSTEREALGRCFGNVVIEPGSSSDDNDNVKINRYRYTFIKKQASPS
                     FSFTESQLTLGEPIVVSDEKGHFALANGYVVQVSPKRITVAVDRRLHNARTKTPGFDS
                     KWNQSFKGVMEILDNGASATTAQADDSEEEMVYRLDKDEFSNGMAIVRNNIVAMMERD
                     LFQAKQLRRLIVDNEPPVFKPTSSHKMSEAGMSNLNIDQKRAIDKVMSAKDYALVLGM
                     PGTGKTTTIAHIIRALVSQGKSVLLTSYTHTAVDNILLKIRGENVRILRIGATAKVHP
                     EVQQFVDLAATPRNSVEEVQARYENPQIVATTCLGVNHSIFSRRIFDYCIVDEASQIT
                     LPVCLGPIRMARTFILVGDHFQLPPLVQNKEAQEGGLDVSLFKLLSAAHPDSVVNLEH
                     QYRMAEDIMLLSNNLIYSGHLKCGTPEVASRSLEIPNIAGLEQHHIDQFPQTPTMRQR
                     CLGTSQGRCWLRDLVDPSVKTRFVNTDTLVTTALEVAVGSRIVNTTESTLCAQLVEAF
                     ISCGISARNIGVITFYRSQLSVLKQDLRHYLPELEMHTADKFQGRDKEVVILSCVRSN
                     AENYVGDLLSDWRRVNVAFTRARTKLLVVGSKNTLRDGNELLGKYMNLVENRGWVYDL
                     PEGAIENHVFQHDSLSATQTQPPRASQSKPSFTPKKRPSQTKAARNPLSPVQDGQGPN
                     GAKQPAKKGAKILNGNRVIGNRPILQDVVNDFVG"
     gene            <782480..>782918
                     /locus_tag="ACHE_10270S"
                     /db_xref="GeneID:66977227"
     mRNA            join(<782480..782739,782831..>782918)
                     /locus_tag="ACHE_10270S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277409.1"
                     /db_xref="GeneID:66977227"
     CDS             join(782480..782739,782831..782918)
                     /locus_tag="ACHE_10270S"
                     /note="COG:S;
                     EggNog:ENOG410PQQZ;
                     InterPro:IPR019329;
                     PFAM:PF10183;
                     TransMembrane:1 (o64-82i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131390.1"
                     /db_xref="GeneID:66977227"
                     /translation="MSARLFSNRLRSSLLARRPQNVQGFSTRSNLRAADHGDHYDPPT
                     GYLFGVKPGQKYVKEGWENLWYYGFIGSLLVAGVAYIFKPDSSIQTWALEEARRRLEA
                     EGILEDPDKAQRK"
     gene            complement(<783296..>784359)
                     /gene="NIT2_1"
                     /locus_tag="ACHE_10271A"
                     /db_xref="GeneID:66977228"
     mRNA            complement(join(<783296..783652,783719..783797,
                     783864..784147,784196..784288,784348..>784359))
                     /gene="NIT2_1"
                     /locus_tag="ACHE_10271A"
                     /product="carbon-nitrogen hydrolase"
                     /transcript_id="XM_043277420.1"
                     /db_xref="GeneID:66977228"
     CDS             complement(join(783296..783652,783719..783797,
                     783864..784147,784196..784288,784348..784359))
                     /gene="NIT2_1"
                     /locus_tag="ACHE_10271A"
                     /note="COG:E;
                     EggNog:ENOG410PG53;
                     InterPro:IPR036526,IPR003010;
                     PFAM:PF00795;
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="XP_043131391.1"
                     /db_xref="GeneID:66977228"
                     /translation="MAIAAVGQICSTASMTANLAQCQTLVRKAVAAGAKALFLPEASD
                     YIGSSAAETISLARSVNDSEFVLGLQKEAEQANLHINVGIHEPAQGGKVKNTLVWINE
                     KGDITQRYQKVHLFDVDIKGGPVLKESASVEKGMEILSPFATPVGRVGLSICFDLRFP
                     EISLALKRQNAEIITYPSAFTVPTGNAHWEALLRARAIETQSYVIAAAQAGPHNEKRR
                     SYGHSVIVNPWGEVVAKLGDEYREPQIATAEIDLDLLAKIRKEMPLLRRTDIYTEV"
     gene            <784656..>787811
                     /gene="DIS3"
                     /locus_tag="ACHE_10272S"
                     /db_xref="GeneID:66977229"
     mRNA            join(<784656..784851,784909..>787811)
                     /gene="DIS3"
                     /locus_tag="ACHE_10272S"
                     /product="exosome catalytic subunit dis3"
                     /transcript_id="XM_043277431.1"
                     /db_xref="GeneID:66977229"
     CDS             join(784656..784851,784909..787811)
                     /gene="DIS3"
                     /locus_tag="ACHE_10272S"
                     /note="BUSCO:EOG09260AQB;
                     COG:J;
                     EggNog:ENOG410PHAG;
                     InterPro:IPR001900,IPR012340,IPR033770,IPR033771,
                     IPR022966,IPR041505,IPR029060,IPR002716;
                     PFAM:PF17215,PF17216,PF13638,PF00773,PF17849;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0004540 - ribonuclease activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="exosome catalytic subunit dis3"
                     /protein_id="XP_043131392.1"
                     /db_xref="GeneID:66977229"
                     /translation="MKSLRRDFSSNPQAANVSSKIFVRSTKSGKVQKIVRELYLRQDI
                     PCSSKLCLTCPSVAPADANGNIAPFVLSDKPAGTAAFPQGHYLVPDTNALLNGMDLFE
                     HTGAFYDVIILQTVLEELKNQSLPLYNRLLSLIKTDEKRFYLFFNEFRLETHVRRGPE
                     ESINDRNDRAVRTVAKWYSEHLRLAAKRKKEKAFPVIVMITDDKGSLQKAKQEDVTAL
                     SLADYVSGLEDSDRLLDMINEAREARDTKDARGQLFYPEYYSMSKLMTGLRAGTLHQG
                     VFSVSPYNYLEGTVNVAAFDKPLLILGRDNSNRAIAGDVVVIEVLPKDQWKSPSTKIV
                     DEEAVTRNDNPDTEDTEPVVTDRERKALQEEARKAHGKYSEGQPQPTARVVGVIKRNW
                     RQYVGHVDSGSTGVQTSSGRRQQNVFVLPMDKKVPKIRVRTRQAGDLLGQRILVTIDA
                     WDRDSRYPTGHFIRSLGELETKGAETEALLLEYDVQYKPFPKVVLDCLPPQGHDWKVP
                     ASKEDIGWKGRRDLRDLLICSIDPPGCQDIDDALHARLLPNGNFEVGVHIADVSHFVK
                     PNNAMDLEASLRGTTVYLVDKRIDMLPHLLGTDLCSLKPYVERYAFSVLWEMTPNAEV
                     VSADFTKSVIRSREAFSYEQAQLRIDDKSQNDELTQGMRTLLHMSKILRQKRMDAGAL
                     NLASPEVRIETDNDEVGDPLTDVKTKAMLETNSLVEEFMLHANITVAAKIYSAFSQTA
                     LLRRHATPPPQNFEELINQLAKKRNMELDVSSSRALAESLDRCVDAKNPFFNTLVRIL
                     ATRCMTSAEYFSAGAHAESEFRHYGLASPIYTHFTSPIRRYADLMVHRQLASAIGYEG
                     EDGRATLEGITTRNRLEDICRNINYRHRNGQFAGRASIEYYVGQALKARGEKLAANGI
                     DTGIDEEGYVMRVFENGVVVFVPRFGIEGVVRLEDFVLPGESAVRAVEDRRELAIRRE
                     TEFDREEYTLQVSEKGHPENERGVTIELFQKVQVNVSSIKEEGRGAGKRRVRILVTGA
                     GK"
     gene            <788802..>791499
                     /locus_tag="ACHE_10273S"
                     /db_xref="GeneID:66977230"
     mRNA            join(<788802..788898,789050..791115,791170..>791499)
                     /locus_tag="ACHE_10273S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277442.1"
                     /db_xref="GeneID:66977230"
     CDS             join(788802..788898,789050..791115,791170..791499)
                     /locus_tag="ACHE_10273S"
                     /note="COG:T,Z;
                     EggNog:ENOG410PHUY;
                     InterPro:IPR001781;
                     PFAM:PF00412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131393.1"
                     /db_xref="GeneID:66977230"
                     /translation="MMIQKHHHHHSLRDGQRKVSPPGPSYMSDNQIANYLKDLRTNRP
                     LRPSGSRPLPSKPPGSTAQHVKGSSPPRASSAMSSYALASGQSVESAVEGSSPPRASP
                     PRAASAMSHYRSSPSRMSYGSSAGRPLVQEPNTTEPRTIPIRKNISPPQIFSRPISVS
                     PNAAYKESDQRRMEKEEARSLRDALEEMDLHDDIHLHQAAQDEATELVWMHQNPGVPY
                     KNPGAPYRNPDMEKRSQSPDKNNRSPSQYRGFRKNFMSSPRRNSRQSASDTSSDGLHG
                     LGLEDSPGKQSQTDSNGEGSSPKRNSLFRKNLKVNFALPSEESSSTPAVDTSGPNKTT
                     FSSETSKGIFRNPNDQIYEEPEEQQSNSTNDRSEFSRSDSSALRNRPRNIFPRGSRPL
                     PSRFGNLPFVDKLAKFDLHKNSQTQSRNPEYTVNEPIIQPGVGAKAAEEETVPTKDGL
                     EIRSDDIRAATSKKRTDRSSNLPMPTAVSDRTGRPIVSFDPTWKPTEAASPGRSRDSP
                     INRGSSSPTPPPAAPTIQVSDAPTIQVSEAPSIQVSEAASIPVINLPDSKEPTISEID
                     ASSRPIPEPTRGNSRHPISPTKQPAAPQNRWYTPYTRAGVPTARCESCTLPIAGKIVT
                     AAGSRFHPECFVCSHCQTPLECIGFYQEPETKRNERLVQTPVEDEEARAIRFYCHLDF
                     HELFSPRCKSCKTPIEGEVVVACGAEWHVGHFFCAECGDPFDSQTPFVEKDGFAWCLQ
                     CYSRRTAPKCMGCKKPVQEDVVISAIGGQWHDECFNCHECGHGFGPNGRFFVREGEPK
                     RTAKGRIIGGPVQLAICEGCESIRLKSSSPRR"
     gene            complement(<792091..>793225)
                     /gene="TRM8"
                     /locus_tag="ACHE_10274A"
                     /db_xref="GeneID:66977231"
     mRNA            complement(join(<792091..792767,792820..793007,
                     793056..>793225))
                     /gene="TRM8"
                     /locus_tag="ACHE_10274A"
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     (tRNA(m7G46)-methyltransferase)"
                     /transcript_id="XM_043277453.1"
                     /db_xref="GeneID:66977231"
     CDS             complement(join(792091..792767,792820..793007,
                     793056..793225))
                     /gene="TRM8"
                     /locus_tag="ACHE_10274A"
                     /note="COG:J;
                     EggNog:ENOG410PFK1;
                     InterPro:IPR003358,IPR025763,IPR029063;
                     go_function: GO:0008176 - tRNA
                     (guanine-N7-)-methyltransferase activity [Evidence IEA];
                     go_process: GO:0006400 - tRNA modification [Evidence IEA]"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     (tRNA(m7G46)-methyltransferase)"
                     /protein_id="XP_043131394.1"
                     /db_xref="GeneID:66977231"
                     /translation="MTPPPSKRQKRIAEDAAATQLSEEKKENNNGEIKMPKKKFYRQR
                     AHANPFSDHRLDYPLSPAHMDWSPHYPAFVDPDPSKINLRGARKLLKDVEVVDIGCGF
                     GGLLVGLAPLMPDTLLLGMEIRTQVLDYVRTRVRALRYQQSQLKNSSVSSTSQPQEPT
                     PSEQQPEPEPSATSDDTPATILPGNYENISAIRSNTMKFLPNFFARSQLSKIFICFPD
                     PHFKMRKHKARIISETLNAEYAYVLRPGGLMYTITDVEEYHHWILRHFRQEKSVAQED
                     GGAAGETAAGTAGDVTDLFERVSEEELESDPCVQVMKEATEEGRKVTRNKGHKFVAVF
                     RRKADPQWPA"
     gene            <793797..>794516
                     /locus_tag="ACHE_10275S"
                     /db_xref="GeneID:66977232"
     mRNA            join(<793797..793823,793877..794354,794404..>794516)
                     /locus_tag="ACHE_10275S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277464.1"
                     /db_xref="GeneID:66977232"
     CDS             join(793797..793823,793877..794354,794404..794516)
                     /locus_tag="ACHE_10275S"
                     /note="COG:U;
                     EggNog:ENOG410PPAC;
                     InterPro:IPR014041,IPR008570,IPR036390,IPR036388;
                     PFAM:PF05871;
                     go_component: GO:0000814 - ESCRT II complex [Evidence
                     IEA];
                     go_process: GO:0071985 - multivesicular body sorting
                     pathway [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131395.1"
                     /db_xref="GeneID:66977232"
                     /translation="MYTPPPHSSFHESPTRMATSSITTPFQFPPTYSFPPFFTPQPNT
                     STRLSQLQKWSSLIQSYCRHHRIYRLSLIEAVESPLFHNAALRKRLGLSEARAVLEWM
                     AKAEEEGGGGRRAEWIDGGSKTVVWVWWKRPEEWAGILADWVEATGQKNTVLTVYELI
                     EGEGTASQEWHGMELEAMFKSLNVLVKRGKAQVFGSEGQEGVKFF"
     gene            complement(<794709..>797434)
                     /locus_tag="ACHE_10276A"
                     /db_xref="GeneID:66977233"
     mRNA            complement(join(<794709..795347,795400..796792,
                     796845..797281,797345..>797434))
                     /locus_tag="ACHE_10276A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277475.1"
                     /db_xref="GeneID:66977233"
     CDS             complement(join(794709..795347,795400..796792,
                     796845..797281,797345..797434))
                     /locus_tag="ACHE_10276A"
                     /note="COG:L;
                     EggNog:ENOG410Q18P;
                     InterPro:IPR001357,IPR036420;
                     PFAM:PF00533,PF16770,PF12738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131396.1"
                     /db_xref="GeneID:66977233"
                     /translation="MADEEGEQLFSNCKVCIICSKDLSQDTAQQLASMLEENGGESVI
                     WEPPSPFPPLEEFSHFISFTIDFPAFDAAADALKPVVKPQWLRASLEKKKVANPRQYS
                     PDPRLFLNDVVVTCGDIPEGDKDAIIGGVLAKGGIYSSKVTNTVTHLVDLTADSDKAR
                     IVLGKRPNVKVVLPHWFDDCLKLGRRIDERPYTLPDPEILRAAPNAPIRSSENRDIIG
                     ASTPAPSTLPTPVASPDTRLHLDLFGGKNIMFSKDLGIGSHLRETIEEIITEGGGYIT
                     SDVYEADMFICRYREGVEYRVASRLNKEVGNLAWLYHLMTYNTWTSPMRRLLHYPINR
                     TGIPGFKGLKISLSNYIGEARVYLENLIVATGAECTKTLKQENTHLITAHGHSEKCTA
                     AREWGLHVINHLWLEESYAKWKLLPTSEPRYTHFPRRTNLGEVVGQTRVDRSVAESLF
                     FPSSEHPQEQTSSPRRAMQNENQNTTTTSAPEESSEMDIDPPEPAIATPRTTTSRKNL
                     ENSNKKLQTPASARLTSEGKENETPSSTSSRKSKDAATAKLHGYAPDIALYEKEMKRV
                     GGVIYGGRKKTDEDRVQLDNRKKRRSVDPQEESDTEDAMDAKRQKKSKPPVAMHLLIT
                     GYQKWVGNLRKEDADKRQLRDLGILVVQDARKCSHLAAPSILRTPKFVNALAYAPVIV
                     NIEYITQCLKKNELLDPRDFELVDKAAEERFSFSLKEAAIKAKQNKNKLLQGYNIYCV
                     ESIRGGFDAFKSIVDANGGNCLLFRGRVSHKVQQPDSDDESSDEEPSEREVYLLSSVA
                     PEHQKLWPRFRQMVEEIGKTPRIVRVDWLLDIAMSQELHVADTYELDEETIEKN"
     gene            <800509..>800983
                     /locus_tag="ACHE_10277S"
                     /db_xref="GeneID:66977234"
     mRNA            join(<800509..800545,800599..800722,800785..>800983)
                     /locus_tag="ACHE_10277S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277486.1"
                     /db_xref="GeneID:66977234"
     CDS             join(800509..800545,800599..800722,800785..800983)
                     /locus_tag="ACHE_10277S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131397.1"
                     /db_xref="GeneID:66977234"
                     /translation="MEANYLRHMSRERRGHKRQRLSSTAESERQASSQNFEISHENSR
                     GSSSQVADNESTTSSRNLRRVASTNILTIEQRRQELELRDLEAEVKRKEEEVRLKQLQ
                     NEQLELELIVMGRSLAI"
     gene            complement(<805085..>806248)
                     /locus_tag="ACHE_10278A"
                     /db_xref="GeneID:66977235"
     mRNA            complement(<805085..>806248)
                     /locus_tag="ACHE_10278A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277497.1"
                     /db_xref="GeneID:66977235"
     CDS             complement(805085..806248)
                     /locus_tag="ACHE_10278A"
                     /note="COG:S;
                     EggNog:ENOG410PZ3X;
                     InterPro:IPR032567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131398.1"
                     /db_xref="GeneID:66977235"
                     /translation="MTTFSAEISDHESNDQTDGNMGDNIHSGGTTTPVPQDLVAVIAG
                     LQRQLQQMEERRIEDLRRLKEELTSPPREPLPQPTIEEIAPQPMADPVRRPRPKLTDP
                     EVFDGRNRSLYRPFRSKLRAKLEVDKEALGNAYDRMWYAFGRLTDGAAMQVLPWMERF
                     AKKGATESQLDGMLDQMDFIFLDRNLEEKAVRDLASLKQNNKPFTVFLTEFNRLLMEA
                     DGHNWPENTKRSYLDNALNREMNTRLETVEKKNGFEDYCRQLQQIADRMEKNQLRYSR
                     NNKHTTSTSPAHPVNTTRASSPPQDMDWEPTTTTSARSQPRRVAKHVSREEMERRRQE
                     RRCLRCGDSTHFISHCPYDSPRNSTRMARSHIHGPELEDEEEQLREQPKLGKE"
     gene            <807701..>809224
                     /locus_tag="ACHE_10279S"
                     /db_xref="GeneID:66977236"
     mRNA            join(<807701..807898,807968..808106,808160..808268,
                     808336..>809224)
                     /locus_tag="ACHE_10279S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277508.1"
                     /db_xref="GeneID:66977236"
     CDS             join(807701..807898,807968..808106,808160..808268,
                     808336..809224)
                     /locus_tag="ACHE_10279S"
                     /note="COG:S;
                     EggNog:ENOG410PJ7E;
                     InterPro:IPR000073,IPR029058;
                     MEROPS:MER0209971;
                     PFAM:PF12697,PF12146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131399.1"
                     /db_xref="GeneID:66977236"
                     /translation="MATSGPFRIVEHVVPGEHIREYPAATANEQEEMLYLAVKQYIPL
                     DNPNPQLGDVTIIGAHANGFPKELYEPLWEEIYKRSKANGFRIRSIWMADVAHQGRSS
                     VINEDRLGNDPSWFDHPRDLLHLINMKRDEMPRPLIGIGHSMGGAHIAQLSLIHPRLF
                     HTIILLDPVIQRQSSTHESQSSQPTSLIAKTVQLSTYRRDIWPSRKAAAESYEKSPFY
                     QAWDPRVLERWVQYGLRDLPTAIHPLEESQLKGKDAKDRYANHPVTLTSTLHQEVFTY
                     SRPNYDRPPGTDTPVNKMTHPDLDPSSLDTYPFYRPETSRIFAQLPHLRPSVLYIFGS
                     KSDISLPEVNAEKMATTGAGVGGSGGAQTGRVRDVTLDKIGHLVAQEAPAQCAEAGSS
                     WLGQELQRWRDEDQAFRAEWSKKSKIQKVTVDARWKEHIPPMRKPKKTPSKL"
     gene            complement(<809498..>810675)
                     /locus_tag="ACHE_10280A"
                     /db_xref="GeneID:66977237"
     mRNA            complement(join(<809498..809678,809730..810246,
                     810328..810514,810583..>810675))
                     /locus_tag="ACHE_10280A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277520.1"
                     /db_xref="GeneID:66977237"
     CDS             complement(join(809498..809678,809730..810246,
                     810328..810514,810583..810675))
                     /locus_tag="ACHE_10280A"
                     /note="COG:I;
                     EggNog:ENOG410PJEF;
                     InterPro:IPR008901;
                     PFAM:PF05875;
                     TransMembrane:7
                     (o33-56i68-88o94-114i126-145o151-169i217-237o264-284i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0016811 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds, in linear amides
                     [Evidence IEA];
                     go_process: GO:0006672 - ceramide metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131400.1"
                     /db_xref="GeneID:66977237"
                     /translation="MQWPSLPFYPYPPSKDGYWSPVTSTLNWCEEDYYATIYAAEIIN
                     TLTNLLFMWLGVKGILSCRRHKHDQIFLIAYCGYLVVGTGSFLFHSTLKYPMQLVDEL
                     SMIYTTCFMAYASFSYSRPTGVRLALAISLTSLAVFITLYYHYLQDPVFHQNAYAILT
                     AVVILRSMYTMEKTLRPKWRGTREEDRLTREKRGFPVLTREQQHYENVRDMKILKTMW
                     YMVGYGLSMFLGGFAIWNLDNIFCSQIRQWRKTVGLPWGIFLEGHGWWHIMTGVGAYL
                     YIIWGIWLRHCLNGRQEEYYLWWPHTWNIPEVICINDSQHESGSVKKSN"
     gene            <811523..>812559
                     /locus_tag="ACHE_10282S"
                     /db_xref="GeneID:66977239"
     mRNA            join(<811523..811577,811640..>812559)
                     /locus_tag="ACHE_10282S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277531.1"
                     /db_xref="GeneID:66977239"
     CDS             join(811523..811577,811640..812559)
                     /locus_tag="ACHE_10282S"
                     /note="COG:C;
                     EggNog:ENOG410PJED;
                     InterPro:IPR018108,IPR030847,IPR023395;
                     PFAM:PF00153;
                     go_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA];
                     go_function: GO:0015187 - glycine transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:1904983 - glycine import into mitochondrion
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131401.1"
                     /db_xref="GeneID:66977239"
                     /translation="MSNNAAYAVSPQVKKPSTSSKSTFHFAAGLCSGLTSSILLQPAD
                     LLKTRVQQSHQTAALLPTLKAILSSSNPIRGLWRGTLPSALRTGFGSALYFTSLNALR
                     QGLAQNGSSILVAKNNGGNISALPKLSNSGNLATGAAARVAAGFIMMPVTVIKVRYES
                     DYYAYRSLYGAGRDIVRTEGMRGLFSGFGATAARDAPYAGLYVLLYEQLKRRFASISA
                     PNGDVPTTSSSSINFVSGGLAAGLATTITNPFDAVKTRLQLMPGKYGNMLRAVSLMTR
                     EDGVRSLFGGLGLRIGRKALSSALAWTVYEELILRAENHWAAQNQIHL"
     gene            complement(<812880..>814740)
                     /locus_tag="ACHE_10281A"
                     /db_xref="GeneID:66977238"
     mRNA            complement(join(<812880..813089,813143..813208,
                     813262..>814740))
                     /locus_tag="ACHE_10281A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277542.1"
                     /db_xref="GeneID:66977238"
     CDS             complement(join(812880..813089,813143..813208,
                     813262..814740))
                     /locus_tag="ACHE_10281A"
                     /note="COG:S;
                     EggNog:ENOG410PT1M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131402.1"
                     /db_xref="GeneID:66977238"
                     /translation="MPRYPAMSIVSESETDYSDTDISIEARSPRRRTSFRRRSVSRQR
                     QPDFSNAYLSPVVQDIGGLQRSASTGGRRPNLANRDHHREWAREREPPAIVVDINNNT
                     HRGPHKGRRSQPQLETSDSDESEDESMLRNHRRVKPTSRRPSPGVSREREHPHEYYRE
                     HPYPREYQYAYVPHPPAAPVAPVPVAAPTPVPAQAPPQAQAPTPRGYSPWGREHEHPQ
                     RDYDMLVDQRLLQRNDARQDMQLMKQQAEIERLERDLARRREEQEAHNDERLDHRHEH
                     RLVREEDLWYEDEISERMRRLERFEKKERMEEERSRAEYNLKMKRFEEAERQAAEQEE
                     VQAKIHEEKMKELQLRIAEEKERERIQAKIQEEKLQELKRKMEEDEEKERIKQEIREE
                     EARKLLQEQERAAQEAAMKEAAVAEWKAEEERRIAAERKAQELRDQEFKERLRMEFGY
                     DEGAIQELITKSKTPEQPPPPAPPAEEEKKEEKEHHHRPTWIKVHRKHLLPDTLIAYR
                     LPWDWDEIDPNYIIIKQYISEDFQDELFAHTRRLRDGRLVAQDSSSLTELKVNDRHKD
                     KMYLVRKKSPGRRSWIFT"
     gene            complement(<816106..>816586)
                     /locus_tag="ACHE_10283A"
                     /db_xref="GeneID:66977240"
     mRNA            complement(join(<816106..816268,816334..816500,
                     816557..>816586))
                     /locus_tag="ACHE_10283A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277553.1"
                     /db_xref="GeneID:66977240"
     CDS             complement(join(816106..816268,816334..816500,
                     816557..816586))
                     /locus_tag="ACHE_10283A"
                     /note="COG:O;
                     EggNog:ENOG410PQNS;
                     InterPro:IPR009053,IPR002777;
                     PFAM:PF01920;
                     go_component: GO:0016272 - prefoldin complex [Evidence
                     IEA];
                     go_function: GO:0051082 - unfolded protein binding
                     [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131403.1"
                     /db_xref="GeneID:66977240"
                     /translation="MSIPNEALQKLLQEIEAQAITSQQQLNITKAQITAKQKNARLLE
                     LTSKELSSLPKETKVYEGVGKMFIGVPMQAVDKRLSSENTTLKNDVSGLEKKLNYFET
                     THTKARENLEAILKPRK"
     gene            complement(<817917..>818099)
                     /locus_tag="ACHE_10284A"
                     /db_xref="GeneID:66977241"
     mRNA            complement(<817917..>818099)
                     /locus_tag="ACHE_10284A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277564.1"
                     /db_xref="GeneID:66977241"
     CDS             complement(817917..818099)
                     /locus_tag="ACHE_10284A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131404.1"
                     /db_xref="GeneID:66977241"
                     /translation="MPSKITSAINILVVNISLWKDPQDRIGRLQVAQEIVDASKNVGF
                     VPRQPFPAKTCTRCSV"
     gene            <819389..>820165
                     /locus_tag="ACHE_10285S"
                     /db_xref="GeneID:66977242"
     mRNA            <819389..>820165
                     /locus_tag="ACHE_10285S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277575.1"
                     /db_xref="GeneID:66977242"
     CDS             819389..820165
                     /locus_tag="ACHE_10285S"
                     /note="COG:S;
                     EggNog:ENOG410PSFG;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131405.1"
                     /db_xref="GeneID:66977242"
                     /translation="MKASWLLPALSSISTALSADTIPFHEPVTAASEQKRAFEVLQVL
                     NKRVANNCPGGYNPCSNLNNLNVCCRTDAHCARDAADNIACCPNGASCTGSLAAATGT
                     TSSFMFPQTATATATGDATSTTNEISITGSTMNGAYPFVYVPTSFVDAATCSAYYSRC
                     QSDYTQCTSSLGSNGQYAVTVAGDNGAGVTVSGGEATPVVSACSNLRLQACHGLNLGY
                     CDDAYGSGSGNENAAASFRGATSLADLMFGMVVGVAGMFI"
     gene            <821228..>822412
                     /locus_tag="ACHE_10286S"
                     /db_xref="GeneID:66977243"
     mRNA            <821228..>822412
                     /locus_tag="ACHE_10286S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277586.1"
                     /db_xref="GeneID:66977243"
     CDS             821228..822412
                     /locus_tag="ACHE_10286S"
                     /note="COG:S;
                     EggNog:ENOG410PRC8;
                     SECRETED:SignalP(1-23);
                     TransMembrane:1 (n6-17c23/24o284-303i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131406.1"
                     /db_xref="GeneID:66977243"
                     /translation="MRAFQLIPAVVSSLVLLSQHAAASPLDMEGGDLDRRGCSNPCGF
                     YSQLCCTSSQTCVTSGGQAVCSDSGSGSDGNYDYHTTTWTETDTKTYTSTWSSQRAGQ
                     TAVGGGGSGSSSGSCDSSIGEEQCGSTCCGAAYVCSNGQCIIGSSSIWATATATPPVR
                     GTSSGLSTVTETGNPTTTQAFDTPVNTDGSPAIGVKAPDDDGLSGGAIAGIVIGTIAG
                     VALLLLVCACLCCRGALAGLAACLGIGRKRNNDEHYSQGGKPEGRTWFGAKPPAQSEA
                     GGEKKSRWGGLATIGIVLGALALCLGLKRHRDREHDEKSSYSYPSSYYYYSDYYTNSS
                     MSCTSHLPLTSGTNWFIGSASSDRRTRDTRRTRDTRGTRDTRGTRDTRRTRRSRARSG
                     RS"
     gene            <823268..>824641
                     /gene="RCD1"
                     /locus_tag="ACHE_10287S"
                     /db_xref="GeneID:66977244"
     mRNA            join(<823268..823733,823799..823954,824030..824405,
                     824464..>824641)
                     /gene="RCD1"
                     /locus_tag="ACHE_10287S"
                     /product="cell differentiation protein Rcd1"
                     /transcript_id="XM_043277597.1"
                     /db_xref="GeneID:66977244"
     CDS             join(823268..823733,823799..823954,824030..824405,
                     824464..824641)
                     /gene="RCD1"
                     /locus_tag="ACHE_10287S"
                     /note="BUSCO:EOG09263Q8J;
                     COG:S;
                     EggNog:ENOG410PFZX;
                     InterPro:IPR016024,IPR011989,IPR007216;
                     PFAM:PF04078;
                     go_component: GO:0030014 - CCR4-NOT complex [Evidence
                     IEA];
                     go_process: GO:0006402 - mRNA catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="cell differentiation protein Rcd1"
                     /protein_id="XP_043131407.1"
                     /db_xref="GeneID:66977244"
                     /translation="MLQTQTHHVFSHQHQYPQADPSWLHQQQQQQHHQAAQQHPHQQQ
                     HSLVAQQHAQVQAAAAAAAAAQQQHYSRIAMAGAAGAANPAQGAGAGGMGGDAGLSGA
                     ISVIDGGISEENRKVFIWVAELLDPNRREAALMELSKKREQVPELALVIWHSFGVMTA
                     LLQEIISVYPLLNPSQLTAAASNRVCNALALLQCVASHNETRTLFLNAHIPLFLYPFL
                     NTTSKSRPFEYLRLTSLGVIGALVKNDSSDVINFLLTTEIIPLCLRIMETGSELSKTV
                     AIFIVQKILLDDIGLAYICATYERFYAVGTVLSNMVTQLVEQQTVRLLKHVVRCFLRL
                     SDNSRAREALRQCLPEPLRDATFSSVLRDDAATKRCLAQLLINLSDNVSDGAPGIAM"
     gene            <825767..>828447
                     /locus_tag="ACHE_10288S"
                     /db_xref="GeneID:66977245"
     mRNA            join(<825767..825937,826023..826120,826183..826402,
                     826453..>828447)
                     /locus_tag="ACHE_10288S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277608.1"
                     /db_xref="GeneID:66977245"
     CDS             join(825767..825937,826023..826120,826183..826402,
                     826453..828447)
                     /locus_tag="ACHE_10288S"
                     /note="COG:S;
                     EggNog:ENOG410PHJ2;
                     InterPro:IPR019787,IPR019786,IPR011011,IPR001965,
                     IPR013083;
                     PFAM:PF00628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131408.1"
                     /db_xref="GeneID:66977245"
                     /translation="MVSRKRNHSEAGVAPKQPPEEPGLLHRLRNSWEFANLMQYISMF
                     GKLMKIDENFGIEDLETECLKPTPSEKLLEIGLCLLKWISSHRGLTFDNFDEYTRRQY
                     NAKAPHLPNPFGHDEVPNRFLDFDVFLKLRVLHQLSVWTFWNPDRIREKMPEQRETDQ
                     TIWRIEELGYDSEDRYYYVLDDNRLYRLTFPPIPPPKSQPKSRSRNARAMRVSKRRRV
                     SEAAGEDSDEANTNASGDLAKDPMHGMKWECIAVTLAEYQGFLDTIQKTRDPNEKVLR
                     DRLNEQVMPIIEKEEEAQQRQIAKREKELLNMELLAGAKRSSRLAGKMEKERQEREAE
                     EEALRRQAELAAARKEEAKQRKMEQERESRVNQREQRIKERERKRIEHEEELERITAE
                     QEKLERGESRMSERNLKAELERRRKNLEDISQDDQWIFDCSGCGVHGENLDDGSHSVA
                     CERCNVWQHSKCLGIGQDEAEQEDFHFICRECKRQEEEVKLPKLPLLKFRVDSASNSP
                     SAEAQHQHQPQEQDLPFSKKPQGPGFTNIRNGSPAKLSAVPPSLSAITAQLSSPERRR
                     SQPVPRFSPSKSANGFGVFSKNPVPTKPSGQPPLPPVQQSLSRRPSTSNSVQNPFSSP
                     VQNRPSMSPTQGNRDVGPLAGFPAGAPPNDAPWTPYGQHQAPRSDGPTRGASSSFQSN
                     PPSFSAATPSNPQSSPPQSSHGGMSLSGISPTKNSPRPMTSGSITGAPILPPIQKLEP
                     SPKLMGRSSPDAPIPAPVKCMTPEQEERRQQENSLMMRGRNPSQSQGQGQGPSLMSSP
                     SLNRIPPLGPSAVAPKSTAESMKQQSPTK"
     gene            <835034..>836546
                     /locus_tag="ACHE_10289S"
                     /db_xref="GeneID:66977246"
     mRNA            join(<835034..835102,835326..>836546)
                     /locus_tag="ACHE_10289S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277619.1"
                     /db_xref="GeneID:66977246"
     CDS             join(835034..835102,835326..836546)
                     /locus_tag="ACHE_10289S"
                     /note="COG:B;
                     EggNog:ENOG410PQ5M;
                     InterPro:IPR009071,IPR036910;
                     PFAM:PF00505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131409.1"
                     /db_xref="GeneID:66977246"
                     /translation="MSHSYEHPDSTVKMAYDSDTQPLIAGHPGLINTPPPTADESVVP
                     GSLESTSRWSVPKSSSAKPRVSRAPRIQRRSKKLKERSKPNVTAPLSKSTKHMTHIPL
                     RDMESWVHRPIKIRMQEVAKRNGRVARPMNSFMLYRSAYAERAKQLITETNHQKVSEA
                     AGESWKIESREIREKYELLASIEKSNHLKAHPGYKFSPSKKDKNPDESRSEPDPEQGP
                     SPMSSPSFAQSGRGMSCGVENGGWDSRDFTPFDQDHGLPSASYLSSSWQTGHPGRPFT
                     GINEAAHHYIPSSVPAGVVNLQELQYSSSTALAGLPGGTHHDLLQPQNSIPTPGSFTD
                     GQLDPQLLKRDTASPAQVYHHNGVYHPMWQEGPAYLPATTSMPPNAVPYSVAGYQPSM
                     QTLLDNRESWESSQETNVDGPNGGDFDHWINPHPTGY"
     gene            <837092..>837849
                     /gene="PSF1"
                     /locus_tag="ACHE_10290S"
                     /db_xref="GeneID:66977247"
     mRNA            join(<837092..837118,837170..837699,837756..>837849)
                     /gene="PSF1"
                     /locus_tag="ACHE_10290S"
                     /product="DNA replication protein psf1"
                     /transcript_id="XM_043277631.1"
                     /db_xref="GeneID:66977247"
     CDS             join(837092..837118,837170..837699,837756..837849)
                     /gene="PSF1"
                     /locus_tag="ACHE_10290S"
                     /note="BUSCO:EOG092648K5;
                     COG:L;
                     EggNog:ENOG410PJ86;
                     InterPro:IPR036224,IPR021151,IPR005339;
                     PFAM:PF05916;
                     go_component: GO:0000811 - GINS complex [Evidence IEA];
                     go_process: GO:0006260 - DNA replication [Evidence IEA]"
                     /codon_start=1
                     /product="DNA replication protein psf1"
                     /protein_id="XP_043131410.1"
                     /db_xref="GeneID:66977247"
                     /translation="MYGELGNKLVQHAKRTQSLAHLPPYQTEMVRAVAREVRDLDRDV
                     THLLTPFEGSFNPSAQPAVACALLVDHLCMRRNKRCLLAYHRVRTEKLEELCWKGVDL
                     LEQQLPEDSLQQQGQQESGLGQVGNHSSLSPEEEEYFRLYGDMLAAYKGQWTDVDLTG
                     SLEPPQDLFIDVRVLKDAGEIQTEYGVINLTKNSQLYVRQGDVERLIAQGFLERLN"
     gene            <838465..>842013
                     /locus_tag="ACHE_10291S"
                     /db_xref="GeneID:66977248"
     mRNA            join(<838465..838705,838762..840132,840186..840385,
                     840431..840664,840719..841923,841989..>842013)
                     /locus_tag="ACHE_10291S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277642.1"
                     /db_xref="GeneID:66977248"
     CDS             join(838465..838705,838762..840132,840186..840385,
                     840431..840664,840719..841923,841989..842013)
                     /locus_tag="ACHE_10291S"
                     /note="BUSCO:EOG09260A27;
                     COG:P;
                     EggNog:ENOG410PG8Q;
                     InterPro:IPR002645,IPR001902,IPR000595,IPR018490,
                     IPR036513,IPR014710,IPR011547;
                     PFAM:PF00916,PF00027,PF01740;
                     TransMembrane:11
                     (i278-298o304-322i329-352o382-403i415-437o457-479i486-
                     503o553-575i587-607o627-659i680-712o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0008271 - secondary active sulfate
                     transmembrane transporter activity [Evidence IEA];
                     go_function: GO:0015116 - sulfate transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0008272 - sulfate transport [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131411.1"
                     /db_xref="GeneID:66977248"
                     /translation="MGVLPPRRRRDSRLLGITPSNTEWSHDLLAHDSEFPVEHANNGS
                     SPPAPGVFGIEPSVHGGSSYRTPSRSFLHRSFHNSLDPANYSSNGVREETAELASFAL
                     SLNGTQSHSLPSDRNRFPQNLDIFRRSEGQSEDAISSGSLRDLAIPEVGGHEPVGVPA
                     TGSSALTQLIRSPSSSLEERISTGSNGNGGEEEEQYNDGEEDSQQEGESTTADEGENP
                     TTERTSLLSKSYRGYGIAEDVESQGVPNKCPRNTFSQFASKVTRCLQILSNPMSWNRR
                     AVWHNGVVYPLSLLPSVFLGLLLNILDALSYGMILFPLGEAVFADLGSDGISMFYVST
                     IIAQVVFSSGGSIFTGGIGSEMIEVVPFFHQMALTILQRVGEDNPKSVIATTILAFSV
                     SSVLTGLVFFLMGTCRLGSLIGFFPRHILIGCIGGVGFFLLQTGVEVSARLSGSLEYN
                     LSTLQKLSQLDTLPLWMIPLFLAIGLLILQRFVRSNFLVGGYFIFVGVIFYIVKFSAQ
                     VPMDVLRNRGWVFDAPSSSNPWYHFYTLYDFSAVNWSAFADTIPAMFALTFFGVLHVP
                     INVPALGISTGEDNLNVDRELMAHGVTNALSGFAGSIQNYLVYTNSLLFIDSGGSSRL
                     AGLMLAAATVGILIVGPSIVGFIPVMVVGALIFLLGIELMQEALIDTWGKLHRLEYLT
                     VVIIVVTMGAWDFVAGILVGIILACVSYVVQTSRKSAIRATFSGKITGSTVRRPPVQQ
                     RYLREAGQQTLIMKLTGYLFFGTIVNVENTMRGLIEEEAFNRRPIRFLILDFSRVYGL
                     DFSAAEAFTRINRILRKRNVQTTISGLDVRGDVGRSLQNVGLFAPENGVQIFEDLNSA
                     LEFSENEYLKVFYNYREELLDSNAPSRISLEVPTITRSATVPPQSGPASLADGLTSSP
                     RRRYLQQAATETIREDETAVLIPAAWTAMRQPLPLLLQTFQGLTSQNEDFWYPVCAYM
                     TRENYTAGTVLYQEGDYPQGFYLLESGMLRAEYELPQGRYFELIVAGRPCGELPFFSE
                     TRRTATVRAEQDCVAWCLGAEQWRALREEAPAIAQELLAVSLKLTTERMDSITSYVLT
                     MAA"
     gene            <843936..>845853
                     /locus_tag="ACHE_10292S"
                     /db_xref="GeneID:66977249"
     mRNA            join(<843936..844216,844277..844475,844527..844728,
                     844779..845090,845144..>845853)
                     /locus_tag="ACHE_10292S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277653.1"
                     /db_xref="GeneID:66977249"
     CDS             join(843936..844216,844277..844475,844527..844728,
                     844779..845090,845144..845853)
                     /locus_tag="ACHE_10292S"
                     /note="COG:S;
                     EggNog:ENOG410PJRW;
                     InterPro:IPR001849,IPR039483,IPR039712;
                     PFAM:PF15406,PF00169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131412.1"
                     /db_xref="GeneID:66977249"
                     /translation="MSAEAQKTVQETPAAAPATETTPAPAESTPATETPAQPEAPKEE
                     TPQENTEAAAAPAADNADKPAEEPKDENKKDEVTPATEGQLGYKAPGLVKGLRFSKRF
                     FYFQDDAVEAKQLTVFQQHEKPAVANPIAAWASQTGKGLLFLTKRAEDKATPAGIFSL
                     ADATDLTKEGSTEFLFKVNGTKHTFQAANAVERDSWVAALAAKIADAKSEKEAITSSE
                     GYKAELEKLTKPAGAEAAKKPTENKEEAKKEEAKPEEAAAAEETPENKENKENKDKSA
                     KSRSQSRKRASLFGSLLGKKEETEEKKEEKPEEAKAEANTEAPAESAQATETPAEAAP
                     AAETVENKEENKAEQKEEPKEEKKEEPKEEKKDDKEEKKDKKAEKSKRASLFGNFFQK
                     VSSPSQEKTEKEAAAPAETSVASTAPQLDNPVEGAAGRPIEPESVTAPADGEAAKDAS
                     AAQSPVETPKDKRRTSFFGNFGKKKAESSDTEDAEGKKGNKLGGLFRKPSKAVKLDNQ
                     KEETPADSETRAEEKPEPVSKDAPVEEKPAQEEAKPAEAPAEESKTNNVTSSTPVQAA
                     A"
     gene            <847651..>847839
                     /locus_tag="ACHE_10293S"
                     /db_xref="GeneID:66977250"
     mRNA            <847651..>847839
                     /locus_tag="ACHE_10293S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277664.1"
                     /db_xref="GeneID:66977250"
     CDS             847651..847839
                     /locus_tag="ACHE_10293S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131413.1"
                     /db_xref="GeneID:66977250"
                     /translation="MASLTPFPAASGSQTRIQRQQQQQQQQQQQLPSGGLCALSSNTR
                     ARANDNAFARVWSSNYNP"
     gene            <848168..>848935
                     /locus_tag="ACHE_10294S"
                     /db_xref="GeneID:66977251"
     mRNA            <848168..>848935
                     /locus_tag="ACHE_10294S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277675.1"
                     /db_xref="GeneID:66977251"
     CDS             848168..848935
                     /locus_tag="ACHE_10294S"
                     /note="COG:K;
                     EggNog:ENOG410PP0E;
                     InterPro:IPR004827;
                     PFAM:PF07716;
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131414.1"
                     /db_xref="GeneID:66977251"
                     /translation="MSQPNLAQGLKMSDFFNDIPSHPFGDDLDTTMLSQQFSTAGLGS
                     IPDSTASAPLGTISPKDLMMDASAPPSATFTDLSTPPSFESPGYFSQDTSPMFTELEF
                     PAGHEQWDPLFPTNDTDAFSAAFDSTAMEVATAMPPPKASLPPIPPSPVVKAPSSPAP
                     QAAPSPSPSRASSAKPSSVAGVNARQRKPLPVIKYDSNDPVAVKRARNTEAARKSRAR
                     KLQRQDELERRIAELEKSLEESQKREAYWKTLAQNNA"
     gene            complement(<851080..>852850)
                     /locus_tag="ACHE_10295A"
                     /db_xref="GeneID:66977252"
     mRNA            complement(join(<851080..852111,852161..>852850))
                     /locus_tag="ACHE_10295A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277686.1"
                     /db_xref="GeneID:66977252"
     CDS             complement(join(851080..852111,852161..852850))
                     /locus_tag="ACHE_10295A"
                     /note="COG:E;
                     EggNog:ENOG410PIH6;
                     InterPro:IPR029055,IPR017932,IPR001962,IPR014729;
                     PFAM:PF13537;
                     go_function: GO:0004066 - asparagine synthase
                     (glutamine-hydrolyzing) activity [Evidence IEA];
                     go_process: GO:0006529 - asparagine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131415.1"
                     /db_xref="GeneID:66977252"
                     /translation="MCGIFFSLSTSGPVLPTEETGDLLRQRGPDSFRVHIVQRDVRIN
                     DFKDDDQILKTVPACLTFVSTVLSLRGDHVHAQPLVGKESQSVLCWNGEAWKIAGEPI
                     QGNDTELIFQLFLQAAKPSSATGDAVQRLADLISSISGPFSFVFYDAINSKLFFSRDC
                     LGRRSLLHGTDENGSLKVCSLCDSTSSTVFEEVDTNGVYMLDLAAPVTTTTYNIQILP
                     WSNDKDSPANHLKNPIPQMNKSIPNGNPSLTIESNVVNELEQQLHQSLEFRIKHVPDQ
                     GQGPEATKVAVLFSGGLDCTLLARLSHEILPSNETIDLLNVAFENPRVVAAAARSKEA
                     STESVYESCPDRMTGRSAFAELQKVCPGRKWRLVAVDVPYTETISHRDRIKLLMRPHN
                     TEMDLSIACALYFASRGQGTVYEGETSFSYTTPARVLLSGLGADELFAGYGRHGVAFN
                     RDSYQGLIDEVYLDVSRLGKRNLGRDDRILCTWGREARYPFLDEVFVSWVLQTPIWEK
                     CGFGMADSEIPESEKGLDAEKKALRLLALKLGMEKVSREKKRAIQFGSRTAKMENGRT
                     KGTDALS"
     gene            <853155..>855566
                     /locus_tag="ACHE_10296S"
                     /db_xref="GeneID:66977253"
     mRNA            join(<853155..854475,854525..854602,854658..855465,
                     855521..>855566)
                     /locus_tag="ACHE_10296S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277697.1"
                     /db_xref="GeneID:66977253"
     CDS             join(853155..854475,854525..854602,854658..855465,
                     855521..855566)
                     /locus_tag="ACHE_10296S"
                     /note="BUSCO:EOG0926499W;
                     COG:U;
                     EggNog:ENOG410PIQF;
                     InterPro:IPR041804,IPR009060,IPR003892,IPR041545,
                     IPR003123,IPR037191;
                     PFAM:PF18151,PF02845,PF02204;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0043130 - ubiquitin binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131416.1"
                     /db_xref="GeneID:66977253"
                     /translation="MSTTQPPASPSLTGQGDAHPTPPNEGTEGPQQVTEPTGQEPATE
                     TTAAEKENVQETRMKSAALHEPETAAAPTMKAPPATPSRNESLPEKLKGLSVSTDIPE
                     DRPSSSSDAPPPPPAKDEVYLNPASSSRPTHPPQSPIDPSLEWNEKELPDVPGGQIVD
                     NKGTPSAEYSREHDSSQPEIQSIMGQFQGGQEQLMSPRLELAEQFFGTYPPRQSSLDH
                     KKKVEVAATPDPAGMASSSSEKQPARAPSNPHIHDDDMLSRRSSSSTAPPPPEPEKRF
                     DFHRFLEQLRHRTADPVAKFLRSFLHEFGKRQWMVHEQVKIISDFLTFITNKMAMCEV
                     WRDVSDNEFDNAKEGMEKLVMNRLYSQTFSPAIPQPPSIPRSASRSKRRELERLHGPW
                     RRGQHQEDIERDDVLAQKMKIYSWVREEHLDIAPVNNHGRRFLNLAQQELLKINGYRA
                     PRDKVICILNCCKVIFGLLRNSKKGDTSADSFVPLLIFVVLRANPEHLVSNIQYILRF
                     RNQEKLGGEAGYYLSSLSGAIQFIETLDRTSLTVSDEDFEQNVEAAVSAIAEQNRQTE
                     TMEQKAAERSGSPQGSARSSGEGQRNTWRREQSSDEDTAPVAGLLRTIQKPLSTIGRM
                     FSDEPDSPQDRHSPSGASPLSPAPPRLSPNVYQPPRHSTEERWSGEGPREQQQLERVL
                     DAQDAAARQASAEDAQARQIQRVEHNDVVETLSNMFPNLDREVIDDVVKIKQGRVGLA
                     VDACLALSAE"
     gene            <856435..>856725
                     /locus_tag="ACHE_10297S"
                     /db_xref="GeneID:66977254"
     mRNA            <856435..>856725
                     /locus_tag="ACHE_10297S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277708.1"
                     /db_xref="GeneID:66977254"
     CDS             856435..856725
                     /locus_tag="ACHE_10297S"
                     /note="COG:S;
                     EggNog:ENOG410Q1AS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131417.1"
                     /db_xref="GeneID:66977254"
                     /translation="MPIPTYDQTKSSNETRPSGSAGYASLEALSGMENNSSGRLVGTG
                     SGGVVTAPGYIAAENSDLLENAGSDRALSKEEADQLYEERMEEEYAKREGGA"
     gene            <857085..>858530
                     /locus_tag="ACHE_10298S"
                     /db_xref="GeneID:66977255"
     mRNA            <857085..>858530
                     /locus_tag="ACHE_10298S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277719.1"
                     /db_xref="GeneID:66977255"
     CDS             857085..858530
                     /locus_tag="ACHE_10298S"
                     /note="COG:S;
                     EggNog:ENOG410Q1KJ;
                     InterPro:IPR001810,IPR036047,IPR032675;
                     PFAM:PF00646,PF12937;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131418.1"
                     /db_xref="GeneID:66977255"
                     /translation="MSSSAGPFHLLPQDCWKEILEYLPVDDRSRVSKTCRALRVSAEP
                     YLYRKITINWDTPRLRTPLQLLRTFFARPELANFVHHVASFRQYYADPEWFGWPSPWH
                     LRDWPREQTAFIDVVDKTIDIIQRARFPNTDEWIQAVYEGDFHVFWTVCISKLHNLRT
                     LRLDYSFVWQGGYPGRMVRHALLGSNNILPRFEALELVDYGGNVPLPEPYGHLPEELE
                     ETEGFPSVYNKEQFTGWFYLPALQHLAIWLREITGLKEAKFKCNLGNLRTLVLARSTI
                     TEEDALFLLSQTKTLRNLHLGLAYSWPDKSVLQKGELLVQALGSVSETVEKLSVGLDC
                     YPRVYEEYVTFEDCKALCVPFNGFLKNFPRLQSAELPIIMLLGFDPGDQIDLRSVLPA
                     TLLELGLRDDLALCMGRWHQLTIYERVQHLHPTYKEATPFLSRIYHRLWSGIDFEEKE
                     LQTTRTGTEIRVDIVADELGPGFGPYSYFKL"
     gene            <859794..>860432
                     /locus_tag="ACHE_10299S"
                     /db_xref="GeneID:66977256"
     mRNA            join(<859794..859897,859952..>860432)
                     /locus_tag="ACHE_10299S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277730.1"
                     /db_xref="GeneID:66977256"
     CDS             join(859794..859897,859952..860432)
                     /locus_tag="ACHE_10299S"
                     /note="COG:S;
                     EggNog:ENOG410PZ1C;
                     SECRETED:SignalP(1-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131419.1"
                     /db_xref="GeneID:66977256"
                     /translation="MQYKTLSLLLLSATAMAAPQDGNNYSDLIGDLGSLASQTGILSS
                     IPTNLDIPGVPSSVVEVLATAVPSTWLQNILTNSAAQTSVLNDLESSKYPDWWSSVPT
                     GVQSYLWDVQSSLDASVTPTSGSSGTTTGGSATATSTSDSDGDNSDDSSSSSSSSSSG
                     AAASDTSEGAAPAQTAMAATVAGAAGILGLALAL"
     gene            <861130..>862166
                     /locus_tag="ACHE_10300S"
                     /db_xref="GeneID:66977257"
     mRNA            join(<861130..861202,861263..861611,861665..>862166)
                     /locus_tag="ACHE_10300S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277743.1"
                     /db_xref="GeneID:66977257"
     CDS             join(861130..861202,861263..861611,861665..862166)
                     /locus_tag="ACHE_10300S"
                     /note="COG:S;
                     EggNog:ENOG410PHKX;
                     InterPro:IPR008217;
                     PFAM:PF01988;
                     TransMembrane:3 (i213-238o244-262i283-304o);
                     go_function: GO:0005384 - manganese ion transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0030026 - cellular manganese ion
                     homeostasis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131420.1"
                     /db_xref="GeneID:66977257"
                     /translation="MALLFIKQKFFPSQANNGKSKDSSRKPLLSPEDSDTLHGFSDSD
                     LESQRSYSTFHNPSGLENNDYDTDSTSSGSTRARINPRIVSDAILGLSDGLTVPFALS
                     AGLSALGKTKVVVLGGLAELTAGALSMGLGGYVGAKSEAESYETTVRETKELIQTSPI
                     ETGAIVHNIFSSHGIPSDVVSQINASLHASHDRLLEFLITFHHKESQPDCNQAWISAI
                     TLAIGYFVGGFIPLIPYFIADQVIAALYYSIGVMAVTLLAFGYIKTCIVRGWSGRENI
                     IAGIRGGIEMCFVGGVAAGAAIALVRLIDTA"
     gene            complement(<862300..>862962)
                     /locus_tag="ACHE_10301A"
                     /db_xref="GeneID:66977258"
     mRNA            complement(<862300..>862962)
                     /locus_tag="ACHE_10301A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277754.1"
                     /db_xref="GeneID:66977258"
     CDS             complement(862300..862962)
                     /locus_tag="ACHE_10301A"
                     /note="COG:S;
                     EggNog:ENOG410PN26;
                     InterPro:IPR025255;
                     PFAM:PF13875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131421.1"
                     /db_xref="GeneID:66977258"
                     /translation="MTTPYEKALHQVDQAHSEDPRRIPYPNSSQPTSLQQQQDEIQET
                     QNETIPYELHYATKMTQYLDKRQPNASELLRLAIRAQHLRRWEVPRDSYPMTKIGYHS
                     WRNHLAKRQAELVVEICVKSGYTQDEAERVGALVRKEGLKRNPGEESETQVLEDVACL
                     VFLDDQFEDFEKGIKDEEKVITILRKTWVKMSSKGHEMAIELSEEMSERARGLVQKAL
                     GG"
     gene            complement(<863822..>865218)
                     /locus_tag="ACHE_10302A"
                     /db_xref="GeneID:66977259"
     mRNA            complement(join(<863822..864465,864573..>865218))
                     /locus_tag="ACHE_10302A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277765.1"
                     /db_xref="GeneID:66977259"
     CDS             complement(join(863822..864465,864573..865218))
                     /locus_tag="ACHE_10302A"
                     /note="COG:S;
                     EggNog:ENOG410PN5H;
                     InterPro:IPR013942;
                     PFAM:PF08633;
                     go_component: GO:0016592 - mediator complex [Evidence
                     IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_process: GO:0006357 - regulation of transcription by
                     RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131422.1"
                     /db_xref="GeneID:66977259"
                     /translation="MSDRTSSATFRVGFPSPSSPSVGYLKENDQPYISSDHFPQTPTS
                     PPLMSVSAQSHATYFAPSQTSPRQATSQSADYSSLPPSDPMSSQISQQPTLSSTTTSF
                     PTPASSVSGHLVDADKLTGTGMQESGSTVTADANLVPTQTPPEHTQTDHDRNMGGADP
                     GTRVRDSANMDAMEIDNNDNSGSSNNEGAASSENNGFSLDSLQREFTSAYHLCKSSHV
                     ATGPDPSLDLVSLYGLGPIAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVK
                     NEAGMPGSLRHLTMWPEEEWQNQKVFGKQIKIADMDSALQQLQMKAMKLEPGTVPNND
                     YWEDVLGHEKPSKHAGAGDAGRKAAAPSGGVRAPSQSNGTPAPAELERSRPSRGHKRR
                     YDDNSFVGYGEGYADDDDEGAFYSNSEGIGKKKRKKV"
     gene            complement(<866405..>868907)
                     /locus_tag="ACHE_10303A"
                     /db_xref="GeneID:66977260"
     mRNA            complement(join(<866405..867542,867599..868361,
                     868420..868836,868901..>868907))
                     /locus_tag="ACHE_10303A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277776.1"
                     /db_xref="GeneID:66977260"
     CDS             complement(join(866405..867542,867599..868361,
                     868420..868836,868901..868907))
                     /locus_tag="ACHE_10303A"
                     /note="COG:K;
                     EggNog:ENOG410PHFN;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131423.1"
                     /db_xref="GeneID:66977260"
                     /translation="MRSKNATVPRTYIISLRERARALESEVEKLKNEIQHAADAELMV
                     RGAGRIRFKENDEPRYLGPSSGIAITRLVMEMAKQHTDSKSIKDVVPELTAQEIKSTF
                     SEESNKPTSKIYPMISSIPQSNLPPRNLTYRLMDLFAVKAQAMLPTLHYPTFRQEVEE
                     VFDGSDDPRQNFQLRIVIAISMQKLSTDYAGLADSYYLAALPYLEPSLKRMDLGALQC
                     LALIAQYSMLTPTRTAAYWVVGLAIKLSQDLGLTEESTISKSPTGETLNCLEVDMRRR
                     LFWIVMSMEFGLSHSLGRPSCLAVSHDHVNVKFFEQVDDQYITPDGILPGSKPILTKC
                     IAIHFLKMRLLQAEIRRTLYLNRRDNPIHDHDPWFRQMEEKMEHWVVTCPKNDGGSGL
                     GETWFRGRLNTMIVFLYRPSPQVPEPSPVAAEKAYKASIFNVGMQRQQIATGSVDLTW
                     IFTQSLFMALNTILWSLSYPNIRKDHPIEEVQGHLDVALEAIMLAAKRWPGVESALLL
                     YRSLVAACLKAYNTEESFVVRSPSNPSNHATPGSCQDAMSPPDMSSPSSITTSLQSHN
                     ARFGKPSITDGSSTSTASRAHSTDPTLPYSHSSISSTPPIGVAESTPYQMLTPPMQQQ
                     QQQQQQQQQQQQQQQQIPISNDSPAMQFTSPSYATPAATYGGLQVDPTTPFNAFPTVV
                     PGLQGWDPDFNLASTTAGHLAYVEAAVDPMNWTSTIADQYSQYLNAPLPVPSWRERTL
                     SYQEQVELMASLEDNIPDVSAQLMGDASNTFYQP"
     gene            <871028..>873068
                     /locus_tag="ACHE_10304S"
                     /db_xref="GeneID:66977261"
     mRNA            join(<871028..871422,871483..872088,872183..>873068)
                     /locus_tag="ACHE_10304S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277787.1"
                     /db_xref="GeneID:66977261"
     CDS             join(871028..871422,871483..872088,872183..873068)
                     /locus_tag="ACHE_10304S"
                     /note="COG:K;
                     EggNog:ENOG410PHSZ;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131424.1"
                     /db_xref="GeneID:66977261"
                     /translation="MSSSFLDHPILKVSRPVAACSRCRTAKIKCDGKLPACSACEKAG
                     KAGSCSGASDEFAKGKERSYVASLEGYCEKLEKEIATLRHRKEHASINDAGVLQESSI
                     TAISSTGTVAEAHRREVSDIDDLVGDFGYLSVNATSRDFRGITSTMSFSNLLLSVAVV
                     DSLPNISSPPLLPRHEATPLLQFYFDNIYTQLPFFVERSLWTSIDSIYEPGGRFAKPF
                     DHFLVRMVLAIASATMSYHSDDKSQQRSLALVVGALEYAEDVLQPGSIVGIQAILLLA
                     QYSLANPMRFRSWYLVGMAVRLIVDLGLHQDPPEEVVSNRDRLDLCRRVFHCTYCLDR
                     GISSALGRTFSFSDASINVSLPAPTTSLGSSLTEQSHLFQRSSEPGLYLVKIRQIMST
                     AYQEMYFSGRESSQQPLPLIWARCSQAQEWFDRAPTNVPHHFPVLYRLEALYTTIIIL
                     SPSHRCPIVCDFNKVMLFDRCMDYISQLHQALENPNMLPCMTFLDIQRAYQVGRRFVD
                     LLSQDYDIVLRPSAPAPPPVPPGSVDPPLLGNEGRTNCPARAIRCLTYTQNLLRYSAR
                     KWAMYAFLQQYEQAAAPVRKWLTQPSVVYLPPGSGAFMAGPPTTVTPSAGGVHYPGFN
                     YGPF"
     gene            <875357..>878255
                     /locus_tag="ACHE_10305S"
                     /db_xref="GeneID:66977262"
     mRNA            join(<875357..875407,875472..875511,875581..875934,
                     875984..876162,876219..876429,876487..876626,
                     876678..>878255)
                     /locus_tag="ACHE_10305S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277798.1"
                     /db_xref="GeneID:66977262"
     CDS             join(875357..875407,875472..875511,875581..875934,
                     875984..876162,876219..876429,876487..876626,
                     876678..878255)
                     /locus_tag="ACHE_10305S"
                     /note="COG:S;
                     EggNog:ENOG410PIQQ;
                     InterPro:IPR027842,IPR017943;
                     PFAM:PF14613;
                     go_function: GO:0008289 - lipid binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131425.1"
                     /db_xref="GeneID:66977262"
                     /translation="MPSKMVNKPTDSKQKEQSINQKLQLYGIYHGFKHGKLPSNKQCD
                     IALNSALQSKIISSPSKDLSEEGQQLVGDLREVIDQARKLILTKNDGHLLQEFIWEAQ
                     RLTDVETKTPNAPVDKEAAKQDGDNAVQGLKTLGTLLITNGEFRKILSDALVIIRDMA
                     SDASQTAANKLRPSEEQLSQIDQPAEENTWHEKPDKEQLKAKFKRNKGDRESMLSDPS
                     ANADGESEVSKSTRRSTKERAREYADKGKEYLSEKVPKERREQAIWRLKKMVMEVQGH
                     ADYQRAIETLLNLAEKYARHSQDLSKQGTGTVKDVRGNDGVRTVETNLRVLLERFANS
                     TSLDDFFDSLETVYRDAEKDPELKGWFKNVNTFIRKCLQEQGYVMEEDCNRDWNHLYD
                     HGRYLLRDRYKSHTTRILDEVKFFGEQYNEDSQNKAFGDAMNKLFLDLGRNSEGKMAF
                     KKHLLKDIGNVILPGIFEHVRYVPIPRIEVSDPMADVVVENLVVESDNLMPNVLEFGS
                     DNYFRWGRKQISSKRDNKIMISASGIQADLTDVSYYIKKKKGFPSITDKGVMDILLGG
                     EGFGFKIAASIANKEDREHIVKVDKVSVDIHHMDIKLRKSKHKVLFKTFKPLLFKIVR
                     PTLEKVLEQKIRESFISADNFARDVHNEAKKSEELARKNDPEDKTSIYARYMDVCRQK
                     LSDKRKKAQEEAAKRDTKVQTTATLRDSQFPEIKLPGSVTTKATEYAELAEKGERWES
                     PVFSLGNASESTDVPKPAPITRKPHRAGSVNGSETAAAAGTAGAANGAANGADGVTKA
                     DGYPSRGFSDEINQAFGTEGGNVGAGANGAAKNVADGTTVPGAPAAFNPQTA"
     gene            complement(<878716..>880613)
                     /gene="ADE2"
                     /locus_tag="ACHE_10306A"
                     /db_xref="GeneID:66977263"
     mRNA            complement(join(<878716..878912,878979..879936,
                     879995..880092,880148..>880613))
                     /gene="ADE2"
                     /locus_tag="ACHE_10306A"
                     /product="phosphoribosylaminoimidazole carboxylase ade2"
                     /transcript_id="XM_043277809.1"
                     /db_xref="GeneID:66977263"
     CDS             complement(join(878716..878912,878979..879936,
                     879995..880092,880148..880613))
                     /gene="ADE2"
                     /locus_tag="ACHE_10306A"
                     /note="BUSCO:EOG09261D4D;
                     COG:F;
                     EggNog:ENOG410PH6H;
                     InterPro:IPR011761,IPR016185,IPR035893,IPR033747,
                     IPR005875,IPR040686,IPR016301,IPR013815,IPR011054,
                     IPR000031,IPR003135;
                     PFAM:PF02786,PF02222,PF00731,PF17769,PF07478;
                     go_function: GO:0004638 - phosphoribosylaminoimidazole
                     carboxylase activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0006189 - 'de novo' IMP biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazole carboxylase ade2"
                     /protein_id="XP_043131426.1"
                     /db_xref="GeneID:66977263"
                     /translation="MWNSRKVGILGGGQLGRMLVESANRLNIQANVLDAENAPAKQIS
                     AHTGHVTGSFKEREAVRELAKGCDVVTAEIEHVDTYALEEIASEVRIEPSWEAIRTIQ
                     NKFNQKEHLRKYGIPMAEHRELAKNTPEELAAVGEQLGFPLMLKSKTMAYDGRGNYRV
                     NSKDDIPEALEALKDRPLYAEKWAYFKMELAVMVVKTKDEVLSYPTVETVQEDSICKL
                     VYAPARNVSNAINQKAQELARKAVSAFEGKGVFGVEMFLLEDDSLLLCEIASRIHNSG
                     HYTIEGCPLSQFDTHIRAILDLSIPPQSLEIRQPSIMLNIIGGAEPDTHLKAAEHALS
                     IPNASIHLYSKGAAKPGRKMGHITVTAATMHEAETHIQPLIDVVDDIRAQRTDVKTKA
                     QPSGPSKPAPSVAVMMGSDSDLKTLVPGLKLLRDYFGIEPAVDITSAHRTPTYMAEYS
                     ADAAARGIKVIIAAAGGAAHLPGMAAAHTALPVIGVPVKGSSLDGVDSLYSIVQMPRG
                     VPVATVGINNSINAALLAARILGSFEPTIQRKVEAYAEKARAENMEQKGVRMQELGWE
                     KYFESM"
     gene            <880919..>882476
                     /locus_tag="ACHE_10307S"
                     /db_xref="GeneID:66977264"
     mRNA            join(<880919..880928,881036..881081,881139..881187,
                     881243..881882,881944..>882476)
                     /locus_tag="ACHE_10307S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277820.1"
                     /db_xref="GeneID:66977264"
     CDS             join(880919..880928,881036..881081,881139..881187,
                     881243..881882,881944..882476)
                     /locus_tag="ACHE_10307S"
                     /note="COG:S;
                     EggNog:ENOG410PQDV;
                     InterPro:IPR015267;
                     PFAM:PF09184;
                     go_component: GO:0030289 - protein phosphatase 4 complex
                     [Evidence IEA];
                     go_function: GO:0019888 - protein phosphatase regulator
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131427.1"
                     /db_xref="GeneID:66977264"
                     /translation="MSLDEEALQIVAKGGLMESGKWAGLVEPLVERLEYIVYNIFPMP
                     KMPPEAAPSSVPHQLPSSADPSSQDSSIPSSSNKENNLPDLQTPPRPAPTSAAPATSP
                     LSERVPDSQSQSFTGPTNESLPAPLALLLDSIKSTLRSLFSSKPPHTIQRLAELILHP
                     TAHYRTLPAYLRAVDRVVSVTSSAEIFPLQVQASTSQPNGVTNGGGSSGLLFDHTPGS
                     DESLGGALLTPIPWLNAASFEEENGEPVAKAITTESISITVHRAQQAPQGEQQQQPQP
                     QEEIEPSTLTQETTSPTHTTTSAIENEALGSSGSPPPADSEEVPHARGPPVVGVEDMG
                     LQDGKGVEMPLSNVDNAGDAPPDDNAIKQPAQEKDDEKPKQESASASEEGKKDGDGDI
                     SLDDVKGKNENESATGSSDKEQKEQAETEPAKS"
     gene            complement(<882839..>886411)
                     /locus_tag="ACHE_10308A"
                     /db_xref="GeneID:66977265"
     mRNA            complement(<882839..>886411)
                     /locus_tag="ACHE_10308A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277831.1"
                     /db_xref="GeneID:66977265"
     CDS             complement(882839..886411)
                     /locus_tag="ACHE_10308A"
                     /note="BUSCO:EOG092609YT;
                     COG:P;
                     EggNog:ENOG410PG9C;
                     InterPro:IPR018303,IPR023298,IPR023299,IPR008250,
                     IPR036412,IPR001757,IPR017969,IPR006121,IPR006122,
                     IPR027256,IPR036163,IPR023214;
                     PFAM:PF00403,PF00702,PF00122;
                     TransMembrane:8
                     (i372-390o402-426i447-471o477-496i662-683o703-725i1054-
                     1077o1083-1103i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0019829 - ATPase-coupled cation
                     transmembrane transporter activity [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA];
                     go_process: GO:0030001 - metal ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131428.1"
                     /db_xref="GeneID:66977265"
                     /translation="MAGPSPSALLRAGAEDQPSALMATTTVKVDGMTCGACTSAVEGA
                     FKGVEGAGNVSVSLMMGRAVVHHDPTLLPPEKVAQTIETSGFDAAVLSTDTSSAKQAG
                     HNNEGLSVSTTTLAVEGMTCGACTSAVESGVNEKPGVKSVNVSLLSERAVVEYDPSSI
                     TPEEIAEAIENRGFGATVLETASPQDGSQETEGQKSGLKITTVAIDGMTCGACTSSVE
                     NAFKDVEGLVQFNISLLAERAIIVHDPNTLPSDDITSLIEDRGFDASIVSSEAHASTS
                     KTIQQVNMSLHGPRDASSAMALEDALVQKQGITSASVNMATFRISLSYDSTVIGIRSV
                     VEAIEAFGYNALLADSDDTNAQLESLSKTKEIQEWKRAFLTSVSFAVPVFVINMFMPM
                     YLPALDFGNFALLPGIFLGDVACLLLTIPVQFGIGKRFYISSYKSLKHRSPTMDVLVM
                     MGTSAAFFYSAFTMIIALLFSPHKRPSTVFDTSTMLITFITLGRWLENRAKGQTSAAL
                     SRLMSLAPSMTTIYDDSIAAEKVAEEWDRTNAKSESKSTNSTNDEASGPGLKYIPTEL
                     IEVGDIVLLRPGDKVAADGIVIRGESYVDESMITGEALPVYKKKGSLVNAGTVNGTGS
                     VDVKVIRAGKDTQLSQIVKLVQDAQTSRAPIQRMADVVAGYFVPSIITLGLVTFFGWM
                     VVSHLLPNPPKIFMAEDGGGKVMVCLKLCISVIVFACPCALGLSTPTAVMVGTGVGAQ
                     HGILVKGGAVLEAATKVNHVVFDKTGTLTSGKMSVTEAQLEAIWKSSESRRQLWWLIV
                     GLAEMGSEHPIGKAVCSAAKDESGHPGEDGLPGSVGDFDSCTGKGISAIVEPTSSGER
                     TRYRVLLGNVPFLRSRDVPVPECADPDSRPSVDRTSISSKPGSLAGITQIHVAIDGQY
                     AGTISLRDNIKVTAVAAVAALHRMGLSTSLITGDTYSTAVAIATAVGIPTSSVHASVS
                     PSDKQSIIGSLQESGEHIAMVGDGINDSPALATASIGIALASGTDVAMEAADVVLMRP
                     DDLLSVPASLSLSKSVFNRIKMNLMWACLYNLIGLPFAMGLFLPFGGFMLPPMAAGAA
                     MAASSVSVVVSSLLLKFWKRPQWMDAEKLEKEFQMEHSQFGTRGSQKKSWWAAALSVT
                     GSRRKPVSQRVKDAGFAVWSLVTGKRTRVNDDEGYVPLQTVEPV"
     gene            <887457..>888448
                     /locus_tag="ACHE_10309S"
                     /db_xref="GeneID:66977266"
     mRNA            join(<887457..887715,887775..>888448)
                     /locus_tag="ACHE_10309S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277842.1"
                     /db_xref="GeneID:66977266"
     CDS             join(887457..887715,887775..888448)
                     /locus_tag="ACHE_10309S"
                     /note="COG:O,T;
                     EggNog:ENOG410PQ0D;
                     InterPro:IPR000717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131429.1"
                     /db_xref="GeneID:66977266"
                     /translation="MDHTHARALEALQPFIHLANSNSATSPRFIAKIITDATSSPQAY
                     VFAELLESRTIQSLRSKETPEEYQGYLTLLEIFAWGTWKDYQSTPNLPELNQDQTLKL
                     RLLSLLSLAPTIKPLTYEALMEALSISKAAELESLVTKAIYSSLITARLSPASDPPTV
                     NITSVATLRDVKPQSLPSMISILTEWESRCGGVISDIEAEIEKIKANSAKRAAKENAR
                     AELLNKAINSWSEEGDEGHPKRSGTRSGGRRLGPGGGGSKREYSADDNDDDGYFENGS
                     DDAEPVGSRMEIDEGVGSSRVAARQAKRLLGKKT"
     gene            complement(<889107..>890343)
                     /gene="RAX1"
                     /locus_tag="ACHE_10310A"
                     /db_xref="GeneID:66977267"
     mRNA            complement(join(<889107..889343,889404..890127,
                     890189..>890343))
                     /gene="RAX1"
                     /locus_tag="ACHE_10310A"
                     /product="Bud site selection protein, revert to axial
                     protein 1"
                     /transcript_id="XM_043277854.1"
                     /db_xref="GeneID:66977267"
     CDS             complement(join(889107..889343,889404..890127,
                     890189..890343))
                     /gene="RAX1"
                     /locus_tag="ACHE_10310A"
                     /note="COG:S;
                     EggNog:ENOG410PI0N;
                     InterPro:IPR016137,IPR036305;
                     PFAM:PF00615;
                     TransMembrane:3 (o260-283i290-310o348-366i)"
                     /codon_start=1
                     /product="Bud site selection protein, revert to axial
                     protein 1"
                     /protein_id="XP_043131430.1"
                     /db_xref="GeneID:66977267"
                     /translation="MASPSLLDVEQRNRLPTLYEVLSRRTLAPVDLFSFYIYMRDQQR
                     SVDYLDFWLDVSQHMSLCRHYVRELRRSVLVATPELEKAESKGSSAAVLDNMDTMGDI
                     PLVEAGPSNTRNDLPDEKDADQRLSAFLRLDGHNTNGNTTEASHETNHHERSASDEQA
                     RESSETRDISNSPGHTVARADIRASAEKVLYTYLLPGAEREIVLPDEMVSTIINLVED
                     DGRDDPEVFDPAKDYVFQAMERDAFPGFLQAKALGNLVPLSIVFRLAFALISFGGGFW
                     GAFYVVLRPKPRHIRCWIILPFVVAVYFIITYQYKLDPVMALLGYSEYTFMNWAPIRE
                     PYVRKLLNKRSTSVLFIGAFIAAALSVLFIFVPGTSL"
     gene            complement(<891393..>892999)
                     /gene="GCN5"
                     /locus_tag="ACHE_10311A"
                     /db_xref="GeneID:66977268"
     mRNA            complement(join(<891393..891413,891489..892196,
                     892248..892362,892415..892623,892686..892742,
                     892817..892911,892978..>892999))
                     /gene="GCN5"
                     /locus_tag="ACHE_10311A"
                     /product="histone acetyltransferase"
                     /transcript_id="XM_043277865.1"
                     /db_xref="GeneID:66977268"
     CDS             complement(join(891393..891413,891489..892196,
                     892248..892362,892415..892623,892686..892742,
                     892817..892911,892978..892999))
                     /gene="GCN5"
                     /locus_tag="ACHE_10311A"
                     /note="COG:B;
                     EggNog:ENOG410PFEX;
                     InterPro:IPR036427,IPR001487,IPR037800,IPR016181,
                     IPR000182,IPR018359;
                     PFAM:PF00439,PF13673,PF00583;
                     go_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008080 - N-acetyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="XP_043131431.1"
                     /db_xref="GeneID:66977268"
                     /translation="MAAMAIDSAKRKASEEITSPDSQQQSKKARTDSPEREPKVEEDE
                     DTGKPLRIVPFPEKPAVLEERRGDIEFRVVNNDGSRDSFVILTGLKCIFQKQLPKMPK
                     DYIARLVYDRSHLSIAIVKHPLEVVGGITYRPFNSRKFAEIVFCAISSDQQVKGYGAH
                     LMSHLKDYVKATSPIMHFLTYADNYAIGYFKKQGFTKEITLERSIWMGYIKDYEGGTI
                     MQCTMLPKIRYLEIGRMLLKQKEAVHAKIRAFSRSHIIHNPPKEWKNGPCQIDPLSIP
                     AIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEV
                     IKEPMDLSTMEEKHEKDMYPTPQDFIKDAMLIFDNCRRYNNESTPYAKSANKLEKFMW
                     QQIRNIPEWSHLADGH"
     gene            <893231..>893635
                     /locus_tag="ACHE_10312S"
                     /db_xref="GeneID:66977269"
     mRNA            join(<893231..893333,893389..893418,893472..893526,
                     893590..>893635)
                     /locus_tag="ACHE_10312S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277876.1"
                     /db_xref="GeneID:66977269"
     CDS             join(893231..893333,893389..893418,893472..893526,
                     893590..893635)
                     /locus_tag="ACHE_10312S"
                     /note="COG:S;
                     EggNog:ENOG410Q23J;
                     InterPro:IPR007915;
                     PFAM:PF05251;
                     TransMembrane:2 (o25-44i51-76o);
                     go_component: GO:0034998 - oligosaccharyltransferase I
                     complex [Evidence IEA];
                     go_process: GO:0006487 - protein N-linked glycosylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131432.1"
                     /db_xref="GeneID:66977269"
                     /translation="MSLNEVWEAASAYPFSPVVSKDNQFSVGFSLLLIAFFLTGLFGL
                     NRSFLSIASLGVPASLAFGFGAVYMICAVGVYV"
     gene            complement(<895091..>898781)
                     /gene="RAD50"
                     /locus_tag="ACHE_10313A"
                     /db_xref="GeneID:66977270"
     mRNA            complement(join(<895091..895099,895158..>898781))
                     /gene="RAD50"
                     /locus_tag="ACHE_10313A"
                     /product="DNA repair protein rad50"
                     /transcript_id="XM_043277887.1"
                     /db_xref="GeneID:66977270"
     CDS             complement(join(895091..895099,895158..898781))
                     /gene="RAD50"
                     /locus_tag="ACHE_10313A"
                     /note="BUSCO:EOG092606WZ;
                     COG:L;
                     EggNog:ENOG410PG7Q;
                     InterPro:IPR027417;
                     PFAM:PF13558"
                     /codon_start=1
                     /product="DNA repair protein rad50"
                     /protein_id="XP_043131433.1"
                     /db_xref="GeneID:66977270"
                     /translation="MVATRSLQLTVKKTTRQQKTLEGQLLMVKDGERTAISSRVAELD
                     QIMPQYLGVSKAVLDSVIFCHQDESLWPMSEPSVLKKRFDEIFEAMKYTKAIENIKVL
                     RKKQNEELAKYKIMEQHAKEDKEKADRAEKRSIKLQEEIEALRIEAHQLSEEMRRVAD
                     LADKAWKESESYSQILGALKGKRIEANSIQSTIDNLKRHLVELDDSDEWLESNLEQFE
                     SKQLHYQQNEEAQKENYMEIKEQIEQARHRLGLKQAECGKFENDKANYERQLERRKKL
                     IREIARTHNIRGYDDDLDQTDMNEFMRKIRKSLTDQNQTLDRAKREAQTELREVQVTL
                     NEIGQRKSALQESKNAARRQIASNDKEIASYQRKLNEIDVDEGVQAAIESNIEDINSR
                     LSSSKGRAQAASWDKEIQEINTAIRNLEDDSSRLNSELIEATRMAGDLARLDHLKKEL
                     KDRERSLETMKGAHDERLTKLVSSDWRPETLEQEFQQVMNEESRLVTNAENDRNGVNR
                     ELEQVEFKLRNVRKTLDQRQKELQDSIKEIREAVDDEPEEYLEIVKQRQVQLDIARKD
                     AEQYAGVGEYITTCLETANKAKVCRLCTRPFRNDSEFQSFKAKLEQLVKKTQMQAEDE
                     DVRRLEEDLNTAREAGTAYDSWIRLREMDIPELEKEEQQHDSRRDELLTELENRDKVV
                     DEKVEKKRDVESLSKTVNTIVRYDGDIKSIKSQIKELSSKRQGTSATRTLEDIQDEIA
                     ATGEKSRALKKTLTKLTHDKEQARTEITTLELQLRDAKSSLDNAKFQLEKKADLLARL
                     EEYKNFNAQQREAIEKADQDIEGLTPELLKAQARYDDISRRAEARERELQHAISTLSD
                     SVNQLDLANDEINSYNERDGPGQLERARNELRHIEGEINQLETKLANITKEINKISAQ
                     LKDSENTKRQYSDNLTYRQSTRAFDAVTAEIEQLEAQNAEVDRSRFKKESERRTREHN
                     ALAAQQASKMGEMKSKDDQLMQLLADWNTDYKDAASKYKEAHIRVETTKAAVDDLARY
                     GGALDKAIMKYHSLKMEEINAIIGELWQRTYRGTDVDTILIRSDNENAKGNRSYNYRV
                     CMVKQDAEMDMRGRCSAGQKVLASIIIRLALAECFGVNCGLIALDEPTTNLDRDNIRS
                     LAESLHEIIRARQQQANFQLIVITHDEDFLRHMQCGDFCDYYYRVSRNEKQKSIIERQ
                     SIAEVM"
     gene            <899846..>901037
                     /gene="WC2"
                     /locus_tag="ACHE_10314S"
                     /db_xref="GeneID:66977271"
     mRNA            join(<899846..900944,900997..>901037)
                     /gene="WC2"
                     /locus_tag="ACHE_10314S"
                     /product="blue light receptor"
                     /transcript_id="XM_043277898.1"
                     /db_xref="GeneID:66977271"
     CDS             join(899846..900944,900997..901037)
                     /gene="WC2"
                     /locus_tag="ACHE_10314S"
                     /note="COG:K;
                     EggNog:ENOG410PKDR;
                     InterPro:IPR000679,IPR035965,IPR013088,IPR013655,
                     IPR000014;
                     PFAM:PF08447,PF00320,PF08448,PF00989;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="blue light receptor"
                     /protein_id="XP_043131434.1"
                     /db_xref="GeneID:66977271"
                     /translation="MEPASIRHGQAYGLQIDGGNSYTIQAQRMRQAQSLTGDFEAQTV
                     QQSGARSWPQRAIAEMKDMFLLLSADGTITYASPSCQSITGYTTKQLEGKPLSYFTHQ
                     DDRAIFSEELDQCVATGCALHLHFRFSRVGDSHCILEASGHPHMSNQGGNNADGNSKP
                     YDGVFIICRPYPTKSAQFIDSFLEHKIENIRLMQQVTRLKEEEEEESKANKAPYARSD
                     HSSSSNKTYFNQPPRFIASNPAGFTGTIIPDFITSAEEYESSDTLEPEQPKPFAAENL
                     SHIEGIEVLTGLHYGEGERSQGISTGIRRGRLIQCDTDFTKIDQQVRSMEESDRRKRL
                     RGEYRCSDCGTSDSPEWRKGPKGPKTLCNACGLRWAKKKRQTPPT"
     gene            complement(<901410..>902433)
                     /locus_tag="ACHE_10315A"
                     /db_xref="GeneID:66977272"
     mRNA            complement(join(<901410..901758,901809..902108,
                     902180..>902433))
                     /locus_tag="ACHE_10315A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277909.1"
                     /db_xref="GeneID:66977272"
     CDS             complement(join(901410..901758,901809..902108,
                     902180..902433))
                     /locus_tag="ACHE_10315A"
                     /note="COG:S;
                     EggNog:ENOG410PU8W;
                     TransMembrane:4 (i20-41o89-110i117-137o176-200i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131435.1"
                     /db_xref="GeneID:66977272"
                     /translation="MSWKQNLLYFPRNHRYHKVFLWLMAVELPFTIVILTLTGIASHD
                     LYRTRLWQDGADNGFNSAPDEILYAMANYRPYKVPKVWSSFTDDYNLALGVLSTFFLI
                     TKVPLHFLRLFYPPVAAFVHAGLLAVYIASASFQAGSDTSDSKHPQNGAPWYIAKSCG
                     VAAHPNNIQYCKQAKALFAITIIVIILYFVELVLSFHSCVPTKEEIEKRRERQEEKRT
                     MKEYEEEILKSPVMIPMTPGPNTSGLPPMTPHNFVFTPMSNGPSDLPFRNQPCSRAST
                     HQESAETLTSGPQFFPPPPKAVTK"
     gene            <903477..>904758
                     /locus_tag="ACHE_10317S"
                     /db_xref="GeneID:66977274"
     mRNA            join(<903477..903785,903842..904239,904293..>904758)
                     /locus_tag="ACHE_10317S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277920.1"
                     /db_xref="GeneID:66977274"
     CDS             join(903477..903785,903842..904239,904293..904758)
                     /locus_tag="ACHE_10317S"
                     /note="COG:C,H;
                     EggNog:ENOG410PNTM;
                     InterPro:IPR017927,IPR039261;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131436.1"
                     /db_xref="GeneID:66977274"
                     /translation="MYGKSLQWLCFNQLFRSPPSIVTRTLYQNRNQYPFSPRYYRQMS
                     SKPKTGVPHQVRTAAEPRQNRLYTVRLTHIDELNPTVRLLQLTIPPNVQSLENDTQDG
                     DEDKTPQPLTFLPGQWLDVHIPTIPNAGGFSITSTPADANVLPIPEQPPKEHFDSVAE
                     PGLPPVDSAGRPPYVELAVQKALSNPASAWLWKPKDEILGAELGIRVGGGFVWPPSGI
                     DLNDVRNVGLIAGGVGINPLISILSHLNNNESNTVLPNPTNIQILYSTRLPKPTPSST
                     EATLDQILFLTRLRQITQSQCQSHRLRIGLDLFITDLPEDSPLRTAPPVDISIHARRI
                     SREDLSVAVRGADASIKPEETVCYLCGPPEMTDEFVGVLRGLLGDGQERILFEKWW"
     gene            complement(<904956..>906742)
                     /locus_tag="ACHE_10316A"
                     /db_xref="GeneID:66977273"
     mRNA            complement(join(<904956..905220,905273..906651,
                     906728..>906742))
                     /locus_tag="ACHE_10316A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277931.1"
                     /db_xref="GeneID:66977273"
     CDS             complement(join(904956..905220,905273..906651,
                     906728..906742))
                     /locus_tag="ACHE_10316A"
                     /note="BUSCO:EOG09260K29;
                     COG:E;
                     EggNog:ENOG410PFRJ;
                     InterPro:IPR004843,IPR029052;
                     PFAM:PF00149;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131437.1"
                     /db_xref="GeneID:66977273"
                     /translation="MTRRIVRAGVQLALFAGFALLLVLFLDNRYRLLPASIHGHLPTH
                     YSGLVVTDVTVSTCSSFNIFSNCKVNKDTWTRVDKDLYLRTGWTSSAYLHFERKKEEE
                     LLPTDKVVLDMKIGRLNPKLMEGTPQSDLELWEQRPGGIWLKRTAKRHASDSQTTVTS
                     VDVLFGADAVEPRVGWEVKDTPLLLNSWTEQLEARVTVRRGDPQKTKRAVPRIKDNGR
                     FKIMQLADLHMSTGLGACREPVPVELVPGQPCEADPRTLDFVERLLDEEKPDLVILSG
                     DQVNGETSKDAQSALFKPVKLLVDRKIPYAAIFGNHDDEGDLNRSELMEIYEDLPYSL
                     SSAGPDDIDGVGNYIVEVLGSGKSAHSALTLYLLDTHSYSPDERQFRGYDWIKPNQIR
                     WFQNEARGLKTKHQAYTHMHLNMAFIHIPLPEYRDNRNFFRGGWPEVPTAPGFNTGFK
                     DAMEEQGVLFVSCGHDHANDYCMLNKDKNDKPSSWMCYGGGAGLGGYGGYNDYVRRVR
                     FFDFDMNAGRVVTYKRLEWGETASRIDEMMLVDGGTVKGPDGAN"
     gene            complement(<907107..>908186)
                     /locus_tag="ACHE_10318A"
                     /db_xref="GeneID:66977275"
     mRNA            complement(join(<907107..907264,907320..907468,
                     907532..907831,907902..907978,908033..908046,
                     908099..>908186))
                     /locus_tag="ACHE_10318A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277942.1"
                     /db_xref="GeneID:66977275"
     CDS             complement(join(907107..907264,907320..907468,
                     907532..907831,907902..907978,908033..908046,
                     908099..908186))
                     /locus_tag="ACHE_10318A"
                     /note="COG:E;
                     EggNog:ENOG410Q17A;
                     InterPro:IPR036412,IPR006384,IPR023214;
                     PFAM:PF12710;
                     go_function: GO:0016791 - phosphatase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131438.1"
                     /db_xref="GeneID:66977275"
                     /translation="MAPADLPYLKTNPSIIFFTDFDGTITLEDSNDYLTDNLGFGQTK
                     RRKLNIEVLEKKTSFRDAFWQMLGSVKTPFNECVETLCKVMKLDPHFVEFYEWAKANN
                     VPIVVLSSGMIPIIRALLEKLLGHKPDHIVIIANDVESRDGKHINNPGGWQIKYHDDS
                     HFGHDKSLEIKPYAQLPHDERPTLLYAGDGVSDLSAAAETDLLFAKKGNDLVTFCERE
                     GMPFTTFEDWSSILATSKDILSGKVSVKKVAKEGLEKVQKDEA"
     gene            <908733..>910278
                     /locus_tag="ACHE_10319S"
                     /db_xref="GeneID:66977276"
     mRNA            join(<908733..908841,908902..909048,909116..909186,
                     909262..>910278)
                     /locus_tag="ACHE_10319S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277953.1"
                     /db_xref="GeneID:66977276"
     CDS             join(908733..908841,908902..909048,909116..909186,
                     909262..910278)
                     /locus_tag="ACHE_10319S"
                     /note="COG:J;
                     EggNog:ENOG410PJPR;
                     InterPro:IPR014816,IPR029063;
                     go_component: GO:0031515 - tRNA (m1A) methyltransferase
                     complex [Evidence IEA];
                     go_function: GO:0016429 - tRNA
                     (adenine-N1-)-methyltransferase activity [Evidence IEA];
                     go_process: GO:0030488 - tRNA methylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131439.1"
                     /db_xref="GeneID:66977276"
                     /translation="MARLLQSLRRVLGLNTSKPALPKFSRSLDTDFHIFREGDRVIVH
                     GKNPILSKPLRQGHKTDTRRGTLYHDTIIGRRVRDLYPAHKGPEYRLSLPNLDEYVAM
                     TPRLVTPIYAADANLIVSLLDIHVAPPAEGEQSAPLEILESGTGHGSLTLHLARAIQA
                     ANSNSPPLPEKSQIQYLPDRPLRPDEDAPKTVRKEQQSDGDTAEDSRQKQWDTWRASR
                     GAVIHTVDVSPKFSAHAEQIVRSFRRGIYAGNVDFYVGHVENWIAEQIKQRAAALSAS
                     TGSLSSLTSRDNTQPGPFLSYAILDMPSAHIRIPHVAQILKRDGFLAVFMPSITQIGE
                     CIDLIRRQRLPFVQEKVVELGAGISGGRQWDVRFAVKKSRADPSSWAESSSSTELGEG
                     AVQQDQEEPASSSNIEEEAPKEEDSVLVCRPKVGTRIVGGGFVGIWRRIEDSARK"
     gene            complement(<913993..>916289)
                     /gene="CCR4"
                     /locus_tag="ACHE_10320A"
                     /db_xref="GeneID:66977277"
     mRNA            complement(join(<913993..915179,915248..>916289))
                     /gene="CCR4"
                     /locus_tag="ACHE_10320A"
                     /product="glucose-repressible alcohol dehydrogenase
                     transcriptional effector"
                     /transcript_id="XM_043277965.1"
                     /db_xref="GeneID:66977277"
     CDS             complement(join(913993..915179,915248..916289))
                     /gene="CCR4"
                     /locus_tag="ACHE_10320A"
                     /note="BUSCO:EOG09260WGT;
                     COG:K;
                     EggNog:ENOG410PHFH;
                     InterPro:IPR001611,IPR005135,IPR003591,IPR032675,
                     IPR025875,IPR036691;
                     PFAM:PF03372,PF12799,PF00560,PF13855;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="glucose-repressible alcohol dehydrogenase
                     transcriptional effector"
                     /protein_id="XP_043131440.1"
                     /db_xref="GeneID:66977277"
                     /translation="MADGTYRFQQPGAGQFFFQTQPQQQSHQRQLLRNGTNSPSGKSR
                     YTHDTPSPARSPPLTQAAALNFAMYSQAHQGQHVMMNGSQAHQRFGMQIPKFQTQTHH
                     AHAQQTHPHAHHNQPLTQHAFSAAALATTTPHFTPTPMQNGIHTNLDDDIDEMNEHWQ
                     QQLQLAAESRQASSPHYHARSVAQQAKGIQIAPSQIEVQEVSTDGRNGVVKTKPAPRQ
                     GWNALDFGGQGLRALSTSLFHYTFLEQLYLNHNKLKVLPPAIGQLRKLTHLDLSGNDL
                     TDLPEEIGMLSSLKKLYLFDNNLRTLPYEMGYLYRLETLGIEGNPLNDVLKAQIMKDG
                     TKALIRYLKEETPVHLPPPDRDWIILDETASSTNNPTEKVTVISYNTLCSTSATQSHY
                     GYAPSRVLSWEFRRELIFNELRSHNSDIVCLQEVDQGSYNEYFREQLAYSGYKGVYWP
                     RGRAMGMQEDDAKNVDGCATFFKEKKFILLDKQMINFGQTAVRRPDAKGQDDIYNRLW
                     QKDHIAVVIFLENRQTGSRFIVVNAHLYWDPAFKDVKLIQTAILMEEITKLSDTYAKW
                     PACTDKTAFRFSEAEEESDAPLSEPAPSMEYASGDQIPLLMCGDFNSSPGSAAYNLIA
                     NGRLSEEHPDLEKRLYGNLSRVGMTHPFKLRSAYGTIGEMSFTNYTPDFKDILDYIWF
                     SSTSLHVSALLGEVDKEYLKRVPGFPNYHFPSDHVALFAEFTIKGKKGKVVEADFGPQ
                     RN"
     gene            <920326..>921528
                     /locus_tag="ACHE_10321S"
                     /db_xref="GeneID:66977278"
     mRNA            <920326..>921528
                     /locus_tag="ACHE_10321S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277976.1"
                     /db_xref="GeneID:66977278"
     CDS             920326..921528
                     /locus_tag="ACHE_10321S"
                     /note="COG:S;
                     EggNog:ENOG410PKEG;
                     InterPro:IPR029063,IPR041698;
                     PFAM:PF08241,PF13649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131441.1"
                     /db_xref="GeneID:66977278"
                     /translation="MDSMTSSTIPAMTAAASGSDLNSTLSSTGRGWAGTSTSSLSSLQ
                     NDYSTYPLIHHGDRTYLRDPENLYPLPCDLPEIHRQSLRTLMLIRVFGGPFGTPSLAE
                     KPPKRVLELACGSGLWSSLCHDYFARRGHPNISFTGLDIVSVAPDLRKKGVNWQFKRH
                     DLRKPRLPFPDDYFDFVFIKDAGMCPSSPAQQASGLSEPLRVLKSGGVLEIWDSDWVF
                     RSLIPNPAPARKLASREQETADTTATYTFSSATPFTRAQNKYLQDYNSWLETAFDRRK
                     LSAMPCATIGLSFNAEVDILENVDSRRIAIPLGELRWEREGHGRDSTGRTRKTLTSDQ
                     FAIRRTALLTVIQMIEGMEPMLMEASGKSRDEWDRWWTAMTADLFQKDGLTSGECLEV
                     SAWWGRKK"
     gene            complement(<922004..>922358)
                     /locus_tag="ACHE_10322A"
                     /db_xref="GeneID:66977279"
     mRNA            complement(join(<922004..922020,922095..922238,
                     922313..>922358))
                     /locus_tag="ACHE_10322A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277987.1"
                     /db_xref="GeneID:66977279"
     CDS             complement(join(922004..922020,922095..922238,
                     922313..922358))
                     /locus_tag="ACHE_10322A"
                     /note="COG:S;
                     EggNog:ENOG410PTXK;
                     InterPro:IPR008011;
                     PFAM:PF13233,PF05347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131442.1"
                     /db_xref="GeneID:66977279"
                     /translation="MTNPALRREVINIYKELLNLGRAYPLGYDHFRNRLHKAFSSQAH
                     LSDEEQIKKGIARAEFVKKEIEAL"
     gene            <922781..>923152
                     /locus_tag="ACHE_10323S"
                     /db_xref="GeneID:66977280"
     mRNA            <922781..>923152
                     /locus_tag="ACHE_10323S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043277998.1"
                     /db_xref="GeneID:66977280"
     CDS             922781..923152
                     /locus_tag="ACHE_10323S"
                     /note="COG:S;
                     EggNog:ENOG410Q0QJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131443.1"
                     /db_xref="GeneID:66977280"
                     /translation="MSILARQVLRQQPLVASTVIKPSIAAGRFFSTSPARAETKSASA
                     SPTPTKPHSIDPKWLTLTKQRIGRCMMFGLKPPQIQEAGDILQQIAKDWRELVSGSEG
                     FLTNETVRGLFQHNVAWGEMV"
     gene            <923360..>923925
                     /locus_tag="ACHE_10324S"
                     /db_xref="GeneID:66977281"
     mRNA            join(<923360..923512,923572..>923925)
                     /locus_tag="ACHE_10324S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278009.1"
                     /db_xref="GeneID:66977281"
     CDS             join(923360..923512,923572..923925)
                     /locus_tag="ACHE_10324S"
                     /note="COG:S;
                     EggNog:ENOG410PMXZ;
                     InterPro:IPR029069;
                     PFAM:PF13279;
                     TransMembrane:1 (o28-45i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131444.1"
                     /db_xref="GeneID:66977281"
                     /translation="MYVRYAETARVNFMRNFATHMDPANKKAWMNLVGSTGIGLILRS
                     IKIDYKFPMKYPDKISVYHKLVQDPSSQVDKSAFELQVVILSETHQRPAARCHEDIVT
                     YNYRQAKKTPMPPFMMEQFQKAWALQEEAKKTWQQRILEIEGRVRTLETDSWDHEDAV
                     EDKGSANK"
     gene            <926844..>929961
                     /locus_tag="ACHE_10325S"
                     /db_xref="GeneID:66977282"
     mRNA            join(<926844..928620,928697..>929961)
                     /locus_tag="ACHE_10325S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278020.1"
                     /db_xref="GeneID:66977282"
     CDS             join(926844..928620,928697..929961)
                     /locus_tag="ACHE_10325S"
                     /note="COG:S;
                     EggNog:ENOG410PJR6;
                     TransMembrane:3 (i169-190o222-243i331-349o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131445.1"
                     /db_xref="GeneID:66977282"
                     /translation="MPRSSAAARKSQSSRHENGPVGSSKKVTKQKSNGHLNGHANGGA
                     GGFASSSSSSQVDLSSSRSSSDPAITATVATAAKLNGTADTSPSPSKSDSNVRGLLNG
                     YTKSNADMSNGVGPPNNGLTGPSSRRTEQAATTTTAMGPKRSGSNASINPLQLASTIL
                     KSCPMYDTIAILIFLLQLPPMVLTLVQFLFASLTFMPPSGASAGSFTSNFDIFQGPAG
                     TPSLATMLAADGFSLLVWGLFMWTWAQNFALDLAHVQVAITLGGGGSGKSEGVSWVCV
                     GIVLALHLLRSKGIQDFVMGYLLSAKIVSPDLLSQYSHFLPTEFRRTETQSSPSWIRS
                     LLAVHILAQAGTAMLRRSMAQNRSPTPPRLGKRGDTEASAGSSQAQADSAFESGTSLS
                     SILGTDGQIAPSSSALKDGRDRLVSAKKRRRQANQVRSRQPFWAALASTKVTVMREYE
                     HSRAMSKTTRGSTMTEEDLQGVSLDDGLIWITDVDGSSIRYAAGDFASADDPAVSGAA
                     CEAGHLGNEEMEPFYVCVNGALWATATVYKVDDASNGSNAVHWRGEISGLAPNCAYTC
                     SFVRSDTDEEICVMSVKTPATNDADQVSSVSTPPQPSYRPSSPTTTLKNSIVNAEAKL
                     NEKRARQKKTRADHTRVLNKIKRDMESLSNRLNSGTDENKQKQRSLQLERTIRQTEEA
                     TTALEAQLSTKTQIPEEELQEWASQKADYERERDQLANAKEELVATRTAIAREVSSLE
                     SDLNSTIQRRERLQSRRARVNEQHERIVSANAQGLNERERRAAEQFAREQDQAKLEAN
                     YNDQFASIGQSVQDYHVRTNQLLQQAAAIEQAIQQQQLIDPGPLTPGAPISDGMALGP
                     LTSTASNHRSLLGLSFPPLKSSPLQHSATLTGTTSSHPTSPAPQPSYLHQHAPSSPLA
                     HTNSYFATDSAYRDRSFSNRSGRSGQFNSTAEFLDGSRLPPLQLDLSELVTDKRGSFC
                     SENNNPLNSSMRPSPTSFKRAGSGSGSSGSGSPGSARGQGN"
     gene            complement(<930628..>931489)
                     /locus_tag="ACHE_10326A"
                     /db_xref="GeneID:66977283"
     mRNA            complement(join(<930628..931364,931426..>931489))
                     /locus_tag="ACHE_10326A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278031.1"
                     /db_xref="GeneID:66977283"
     CDS             complement(join(930628..931364,931426..931489))
                     /locus_tag="ACHE_10326A"
                     /note="COG:S;
                     EggNog:ENOG410PSA4;
                     InterPro:IPR012349,IPR002563;
                     PFAM:PF01613;
                     go_function: GO:0010181 - FMN binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131446.1"
                     /db_xref="GeneID:66977283"
                     /translation="MKLFTYSRLGLLTGQAIAQLNVPQCLTRLARHPAGLGLNRPAQE
                     CQRRTLVDTPKPSLSDQVRLLMRRVPYPVAIITATDPHTHTHKDTQIEHSYRGMTVSS
                     FSTVTLHPEPVVSFNVKRPSETLNALISSGRFLVHLLAPAKPTADLARDFSRGNHNLS
                     IVNGKGDFEFVAHAQKVNENESDRPLPLLRRSGLRSRDIVDFPFVFECRLLPQQMEVF
                     DHTIVLGHVVDTILQRPLDAEVRSQADSGELCLTYANTKFWEMGHEIK"
     gene            <931852..>932421
                     /locus_tag="ACHE_10328S"
                     /db_xref="GeneID:66977285"
     mRNA            <931852..>932421
                     /locus_tag="ACHE_10328S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278042.1"
                     /db_xref="GeneID:66977285"
     CDS             931852..932421
                     /locus_tag="ACHE_10328S"
                     /note="COG:J;
                     EggNog:ENOG410PQSV;
                     InterPro:IPR034600;
                     go_component: GO:0005762 - mitochondrial large ribosomal
                     subunit [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0032543 - mitochondrial translation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131447.1"
                     /db_xref="GeneID:66977285"
                     /translation="MSLSTPLRRSAATTSTIRTPTTFICSQCRHATLLRRPKRPYTFT
                     QLVTLSDGSTYTQRTTSPVPVYRSTRDTRNSLLWNPSSHKLMNVEEDEAGRLAAFRAK
                     FGRSWDANTPTEEEVKKKEEDAQVRSEAAAAQAAGEQKLEKNNEAAEAEKARLQAEQA
                     KADQEEEDNLLDLISSFGQEEEEAGNKKK"
     gene            complement(<932808..>934864)
                     /gene="VPS5"
                     /locus_tag="ACHE_10327A"
                     /db_xref="GeneID:66977284"
     mRNA            complement(join(<932808..932954,933019..933621,
                     933680..934060,934125..934600,934712..934771,
                     934831..>934864))
                     /gene="VPS5"
                     /locus_tag="ACHE_10327A"
                     /product="vacuolar protein sorting-associated protein 5"
                     /transcript_id="XM_043278053.1"
                     /db_xref="GeneID:66977284"
     CDS             complement(join(932808..932954,933019..933621,
                     933680..934060,934125..934600,934712..934771,
                     934831..934864))
                     /gene="VPS5"
                     /locus_tag="ACHE_10327A"
                     /note="COG:U;
                     EggNog:ENOG410PI2Z;
                     InterPro:IPR027267,IPR035803,IPR001683,IPR036871,
                     IPR015404;
                     PFAM:PF09325,PF00787;
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 5"
                     /protein_id="XP_043131448.1"
                     /db_xref="GeneID:66977284"
                     /translation="MDLDAGDSPWGDVPSQSTANLGASNPDIEETSTEQPTQQTGSSS
                     SARRNPRVNRRINAQATKLEAVGDEVDPLGPLGDTAVDGGPSPIEQAPEPPQKEFAAR
                     NARPTSSTSRASSLAGMVDSVTLEENGAGFRDPPPVQPPVEGEGTKRQSQPSVSIEEA
                     AKPTFEIVVGDPHKVGDLTGSHIVYQVRTQTTSKAYRQPEFAVSRRYRDFLWLYNSLH
                     NNNPGVVVPPPPEKQAVGRFDTNFVESRRAALERMLNKIAAHPILQHDGDLKIFLESE
                     TFSIDIKNKENREPDLGQNKGMFSSFGISVGGGTKFVEHDDWFHDRKIYLDALENQLK
                     SLMKAIDTVVAQRKGLAEAAGDFSASLHALATVELSPALATPLDGLSDLQLRIRELYE
                     RQAMQDVLTLGITIDEYIRLIGSVKTAFNQRQKSYHSWHAAESEMQKRRHTQEKLLRQ
                     GKTQQDRLNQVSADVADAERKVHQAKLLFEDMGRLMRNELQRFEREKVEDFKSGVETF
                     LESAVEAQKELIELWETFLLQLDVGEEGNPLFSPQAPSNEPAAATAASAEVTTAGEGA
                     "
     gene            complement(<935413..>936273)
                     /gene="MDE1"
                     /locus_tag="ACHE_10329A"
                     /db_xref="GeneID:66977286"
     mRNA            complement(join(<935413..935530,935590..936065,
                     936139..>936273))
                     /gene="MDE1"
                     /locus_tag="ACHE_10329A"
                     /product="methylthioribulose-1-phosphate dehydratase"
                     /transcript_id="XM_043278064.1"
                     /db_xref="GeneID:66977286"
     CDS             complement(join(935413..935530,935590..936065,
                     936139..936273))
                     /gene="MDE1"
                     /locus_tag="ACHE_10329A"
                     /note="COG:G;
                     EggNog:ENOG410PHCC;
                     InterPro:IPR036409,IPR017714,IPR027514,IPR001303;
                     PFAM:PF00596;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0019509 - L-methionine salvage from
                     methylthioadenosine [Evidence IEA]"
                     /codon_start=1
                     /product="methylthioribulose-1-phosphate dehydratase"
                     /protein_id="XP_043131449.1"
                     /db_xref="GeneID:66977286"
                     /translation="MTDIQNVENNDHLVQSDDPEHPANKIPDLCRRFYNWGWVTGTGG
                     GTSIRQDDHIFIAPSGVQKEMMQPQNIFVLQWPTPKYPPSERKYIRKPLALKPSDCTP
                     LFLSAFERGALCSIHTHSQWAVLVTLLVEREKGPDGCFEISDIEQIKGIPRGRGKGML
                     GFHDTLRIPIIENTPFEEDLTGSLEKAMDRYPDTYAVLVRRHGIYVWGDTVAKAKTQC
                     ESLDYIFQLAVEMHKLGLPWVKDS"
     gene            <936942..>938907
                     /locus_tag="ACHE_10330S"
                     /db_xref="GeneID:66977287"
     mRNA            join(<936942..937067,937163..937445,937513..937643,
                     937712..938365,938428..>938907)
                     /locus_tag="ACHE_10330S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278076.1"
                     /db_xref="GeneID:66977287"
     CDS             join(936942..937067,937163..937445,937513..937643,
                     937712..938365,938428..938907)
                     /locus_tag="ACHE_10330S"
                     /note="COG:O;
                     EggNog:ENOG410PFWS;
                     InterPro:IPR001580,IPR009033,IPR018124,IPR013320;
                     PFAM:PF00262;
                     SECRETED:SignalP(1-23);
                     TransMembrane:1 (n6-17c23/24o494-515i);
                     go_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0051082 - unfolded protein binding
                     [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131450.1"
                     /db_xref="GeneID:66977287"
                     /translation="MRFNSAFTSALVSSATLMGYAHAEEAEQKPDSSSVAEKPTFTPT
                     NLEAPFLEQFTEGWDSRWIPSHAKKEDSKSEDDWAYVGNWAVEEPSIFKGIEGDKGLV
                     VKDPAAHHAISAKFPKKIDNKGKTLVVQYEVKPQNSLVCGGAYLKLLQENKKLHAEEF
                     SNTSPYVIMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLKAPPAARTSKVTSVYTLI
                     VRPDQSFQILIDGEAIKNGTLLEDFNPPVNPAKEIDDPKDKKPADWVDESKIPDPEAK
                     KPEDWDEEAPFEIVDEDATIPDDWLEDEPTSIPDPEAEKPEDWDDEEDGDWIPPTVAN
                     PKCNEVSGCGPWSAPLKKNPAYKGKWSAPLIDNPAYKGPWAPRKIANPAYFEDKTPSN
                     FEPMGAIGFEIWTMQNDILFDNIYIGHSAEDAEKLRKETFDVKRPVEIAEEEAAKPKP
                     EGKGATPSVSFKEDPILYVREKVDHFVGLAKQDPVHAIKQVPEVAGGLGALLVTMILI
                     IVGAIGASSPAPSDSKKGKETAGKSKEKEGEATSSSADTGKGGATKRRS"
     gene            <939511..>941411
                     /locus_tag="ACHE_10331S"
                     /db_xref="GeneID:66977288"
     mRNA            join(<939511..940231,940297..940934,940995..>941411)
                     /locus_tag="ACHE_10331S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278087.1"
                     /db_xref="GeneID:66977288"
     CDS             join(939511..940231,940297..940934,940995..941411)
                     /locus_tag="ACHE_10331S"
                     /note="COG:C;
                     EggNog:ENOG410PFAG;
                     InterPro:IPR015590,IPR016162,IPR016160,IPR016161,
                     IPR010061,IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0004491 - methylmalonate-semialdehyde
                     dehydrogenase (acylating) activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131451.1"
                     /db_xref="GeneID:66977288"
                     /translation="MAARRSLTQSLPALRITASSARVASASASRSLTSLSKSSSAMSS
                     SQRIPSCVSSPLTATRRLHATAAQLTPATTSAASTATEYPTTHERIANPIDTTNFLDN
                     EFVSSKATQWIDLHDPATNNLITRVPQSTDEELRAAVESAEEAFPAWRATSIMARQQI
                     LFKFVGLIKANWDRLAASITLEQGKTFPDAKGDVLRGLQVAETACGITTQITGEVLEV
                     AKDMETRSYREPLGVVAAICPFNFPAMIPLWCLPVATVAGNCLIMKPSERDPGAAMIL
                     AELAKEAGFPPGVINIIHGSAKTVDFILDEPAIKAISFVGSNRAGEYIYNRGSANGKR
                     VQANLGAKNHAAVLPDANKNQTLNAIVGAAFGAAGQRCMALSTAVMVGETQDWLSEMA
                     ERAKVLNVNGGFEEGADLGPVISPESQKRVEELITSAEQEGATILLDGRGYRPEKYPN
                     GNFVGPTIITNVTPEMRCYREEIFGPVLVCLNVDTLDDAINLINKNEYGNGAAIFTRS
                     GSTASRFQKDIEAGQVGVNVPIPVPLPMFSFTGNKKSIAGGGANTFYGKPGLQFYTQQ
                     KTVTSLWRAEDAVSTKAQVVMPTNS"
     gene            complement(<942300..>943165)
                     /locus_tag="ACHE_10332A"
                     /db_xref="GeneID:66977289"
     mRNA            complement(join(<942300..942422,942477..942944,
                     943004..943045,943112..>943165))
                     /locus_tag="ACHE_10332A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278098.1"
                     /db_xref="GeneID:66977289"
     CDS             complement(join(942300..942422,942477..942944,
                     943004..943045,943112..943165))
                     /locus_tag="ACHE_10332A"
                     /note="COG:S;
                     EggNog:ENOG410QED3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131452.1"
                     /db_xref="GeneID:66977289"
                     /translation="MAAPADITIKNLNGEWTLDKSVSNDADPVLALQGMSWLTRKAIG
                     LATLTLKVHQYPDSANPTVINIDIDQIATGGIKGTSEKRITDWTARPHNDHIFGNVEG
                     QSRVVRGAKGADGKVRPNLEVSTKVGNDADDANVGRFLRGEILADGSETEGFLVETLG
                     EEYGDGEGLYIQNFVVNKDAGYGWTAEQVWGFEIVQGERRYTRRIVVAKDGKYQMIRF
                     VYSFLKHRDV"
     gene            <943555..>945099
                     /locus_tag="ACHE_10333S"
                     /db_xref="GeneID:66977290"
     mRNA            join(<943555..943593,943650..943709,943762..>945099)
                     /locus_tag="ACHE_10333S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278109.1"
                     /db_xref="GeneID:66977290"
     CDS             join(943555..943593,943650..943709,943762..945099)
                     /locus_tag="ACHE_10333S"
                     /note="COG:Z;
                     EggNog:ENOG410PGGR;
                     InterPro:IPR028133;
                     PFAM:PF04912;
                     go_component: GO:0005869 - dynactin complex [Evidence
                     IEA];
                     go_process: GO:0007017 - microtubule-based process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131453.1"
                     /db_xref="GeneID:66977290"
                     /translation="MALNKKYAGLPDLDQAPDIYETPDLTDEASTVPTQTIRTASEAD
                     EDDTNSDIDRQGVNADEARAQFMGATVDARDVNFSDSIAAKRKSYKSKNRRRRIRDDG
                     LEEVGDLSDSEDESLERKLARLRREVEELKDEMTARQEKVDIETKESSGEGQEKLDDG
                     VQELSRALDNLYTLSRSAAGPHSAAATLSRKIATDAAPDTTPPRSPAPENKTDASTSA
                     SSGVLSHAAAFDGRLALVEAAMGISSSSNPFVADGNSEPSLQPVLPALDHLTSRLSTL
                     TTLFIGPAPASAVPTMSSAPPSTTVSTPNLEALSTRVRKLTTDAEALASARKRALDAA
                     KAAQTAKVAPASVEPSDMSVSSSSATEVDPVATQRDEQATKIQALYATLPTIQSLHPL
                     LPSVLERLRSLRAIHAGSAQAAESLDELERRQGEMKKEIEQWREGLRVVEERMGQGEA
                     AMKSNIELVEPWVRDLEKRLDKLKGSGV"
     gene            complement(<945203..>946978)
                     /gene="ALG12"
                     /locus_tag="ACHE_10334A"
                     /db_xref="GeneID:66977291"
     mRNA            complement(join(<945203..946578,946629..946910,
                     946963..>946978))
                     /gene="ALG12"
                     /locus_tag="ACHE_10334A"
                     /product="dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichol
                     alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_043278120.1"
                     /db_xref="GeneID:66977291"
     CDS             complement(join(945203..946578,946629..946910,
                     946963..946978))
                     /gene="ALG12"
                     /locus_tag="ACHE_10334A"
                     /note="CAZy:GT22;
                     COG:G;
                     EggNog:ENOG410PI08;
                     InterPro:IPR005599,IPR039485;
                     PFAM:PF03901;
                     SECRETED:SignalP(1-20);
                     TransMembrane:10
                     (i5-24o98-116i128-146o152-171i183-209o221-242i283-300o306-
                     324i331-352o358-383i);
                     go_component: GO:0005788 - endoplasmic reticulum lumen
                     [Evidence IEA];
                     go_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA];
                     go_function: GO:0052824 - dolichyl-pyrophosphate
                     Man7GlcNAc2 alpha-1,6-mannosyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0006488 - dolichol-linked oligosaccharide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichol
                     alpha-1,6-mannosyltransferase"
                     /protein_id="XP_043131454.1"
                     /db_xref="GeneID:66977291"
                     /translation="MGRDIVFLFLFLLIPGLVLLHLLVAPYTKVEESFHVQAIHDIET
                     YGIPSLDEATNYLQEHYDHFKFPGAVPRTFIGALVLSGLSRPFIWLNENADRQVFARA
                     ILGLFNASALMSYASGIERAFGQPTAIWYLFFQTSQFHVLYYASRTLSNMFAFGISTL
                     AMRFLLFEPGVRHKHRAQCRFSLCLLTVAGIIFRSELALFLATHTLFLLLTGRVSLLR
                     DVIPAGILGLSIGLVSTVFVDSFFWQQFPLWPELAAFKFNVVSGGASAWGTQPWHFYF
                     SNSIPRLLLNPCTYLIGIPVAFSLSSTRAATAYLLTPSLAFVALFSSQPHKEWRFILY
                     VIPPLTAAAALGASYIWTHRTKSIIYRLLSIVMVLSPLASFAISTFVLLPSSAANYPG
                     AHALRALHENHADTSSQSEVSVYLGNLACQTGVTRFLQVPSNTPSTVWKYDKTEDETI
                     KSSSTFWNQFDYALIEAVGPEECKLTSWAVSRWENVELINGFAGIRVLRPGEKAKGSV
                     EESALRRLGGERAIGAWEKGRELVRRVVTRGWWVELRMEPRIKIMRRVE"
     gene            <947120..>947553
                     /locus_tag="ACHE_10335S"
                     /db_xref="GeneID:66977292"
     mRNA            join(<947120..947153,947207..947266,947322..947429,
                     947501..>947553)
                     /locus_tag="ACHE_10335S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278131.1"
                     /db_xref="GeneID:66977292"
     CDS             join(947120..947153,947207..947266,947322..947429,
                     947501..947553)
                     /locus_tag="ACHE_10335S"
                     /note="COG:U;
                     EggNog:ENOG410PRZ5;
                     InterPro:IPR013880;
                     PFAM:PF08571;
                     TransMembrane:2 (o6-24i64-83o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131455.1"
                     /db_xref="GeneID:66977292"
                     /translation="MFFFGLGKLVYVIILIINAIAVLSEDRFLARIGWGRTQPDAFGA
                     SYDSTSVKAKTIDLIASVRTVMRIPLIIINSVIIVAKLIW"
     gene            complement(<948407..>950867)
                     /locus_tag="ACHE_10336A"
                     /db_xref="GeneID:66977293"
     mRNA            complement(join(<948407..950426,950520..950533,
                     950597..950737,950832..>950867))
                     /locus_tag="ACHE_10336A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278142.1"
                     /db_xref="GeneID:66977293"
     CDS             complement(join(948407..950426,950520..950533,
                     950597..950737,950832..950867))
                     /locus_tag="ACHE_10336A"
                     /note="COG:O;
                     EggNog:ENOG410PG83;
                     InterPro:IPR038765,IPR001394,IPR018200,IPR028889;
                     MEROPS:MER0014642;
                     PFAM:PF13423,PF00443;
                     go_function: GO:0004843 - thiol-dependent
                     ubiquitin-specific protease activity [Evidence IEA];
                     go_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA];
                     go_process: GO:0016579 - protein deubiquitination
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131456.1"
                     /db_xref="GeneID:66977293"
                     /translation="MGSFFKSFRGNAGSSMSSSGASPAKKEPQAPPMSPLEKKLQGMG
                     PIRNDGSDKFFGMENYGSTCYCNSILQCLYFSVPFREAVLNYPTRTPIESLEAALEKS
                     LRFQDPNAYLEAEAQAQREKAANPQRIGAPPNQPQKPEDKESPEYKKKVALQTLPLLE
                     TQNNSNSYGMSESLFTALKDIFESLVGSKSRIGITRPQQFLEVLRREHEMFRTAMHQD
                     AHEFLNLLLNEVVSNVETEALKQPPPPKSLPFTESADSFDLANSSGSKTPNTTRWVHE
                     LFEGTLTSETQCLTCEKVSQRDEIFLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFH
                     CDNCGGLQEAEKRMKIKRLPRILALHLKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTT
                     DDAEDPDRLYELYAVVVHIGGGPYHGHYVSIVKTEDRGWLLFDDEMVEPVDKNYVRNF
                     FGDKPGLACAYVLFYQETTMEAVLKEQEQEDLAASMDFPIPNEKQHNGVPPSPSLNHF
                     QSTSQLSSPSSEFIRSNGSRPPTAPRLSTQIERTEPEITSLRTPTVHTPPPVPPIPVA
                     HTMPLSPKKSDVQSRKDRAREEKERKIAEKEREKSEKQRRVSNAREHRHEGVPKPPVD
                     TSKSSRPEDDRRNVPDNGNTDSPKKMHHHGFHRFRRSSKSLSHRFGMDKDSRTSTSDL
                     PRTPINEHIASAGVSPPRKSELPDRPSLNHKTGTDAPKEHKHGKWRSFSFRKML"
     gene            <954555..>956426
                     /gene="HTS1"
                     /locus_tag="ACHE_10337S"
                     /db_xref="GeneID:66977294"
     mRNA            join(<954555..956072,956136..>956426)
                     /gene="HTS1"
                     /locus_tag="ACHE_10337S"
                     /product="cytoplasmic and mitochondrial histidine tRNA
                     synthetase"
                     /transcript_id="XM_043278153.1"
                     /db_xref="GeneID:66977294"
     CDS             join(954555..956072,956136..956426)
                     /gene="HTS1"
                     /locus_tag="ACHE_10337S"
                     /note="COG:J;
                     EggNog:ENOG410PHWW;
                     InterPro:IPR036621,IPR006195,IPR041715,IPR015807,
                     IPR004154,IPR033656;
                     PFAM:PF03129,PF13393;
                     go_function: GO:0004821 - histidine-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006427 - histidyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="cytoplasmic and mitochondrial histidine tRNA
                     synthetase"
                     /protein_id="XP_043131457.1"
                     /db_xref="GeneID:66977294"
                     /translation="MKTSLFPGLLCPAQRAVYRCSPIRTSPAATVIGQRKNIHPTRTP
                     HYNHHRPSYYQFPCRYYSSEFSLDTMPKDNKNTFNLKTPKGTKDWSGSDALLRDRIFN
                     TIADIFKRHGGTALDTPVFELREILAGKYGEDSKLIYDLQDQGGEICSLRYDLTVPFA
                     RWLAMNPDVRSIKRYHIAKVYRRDQPAVSKGRMREFYQCDFDIAGSFDAMVPDAEVLK
                     IVTEVFEGLGWQGRYSIKTNHRKILDGVFEVCGVPSEKIRPISSAVDKLDKMPWADVR
                     KEMVEEKGLDSAVADKIETYVARRGGRDLLNDLLEDEALTANESAKAGLEEMTNLMDY
                     LEAFGVLDRISFDMSLARGLDYYTGVIYEVVTEGSAPAVQQSSLPTSSSEAPEAQKLQ
                     KSGKKDKSKSGNLEDDDRSNDPTLGVGSVAAGGRYDNLVGMFLPKANIPCVGVSFGVD
                     RIFSITKARIEREQRAEALRSSEVDVYVMAFGGKGFTGMLKERMDVCKTLWNAGIKAE
                     FSYKVKPKLPQQFKAAEQGGIPFGIILGEDELANGKVRVKEMGLEEGHPEKEGVLVDL
                     SSLVDEVKARLARKSQSNVDALAQQLEGTKTEDAGV"
     gene            complement(<956555..>958142)
                     /gene="COQ6"
                     /locus_tag="ACHE_10338A"
                     /db_xref="GeneID:66977295"
     mRNA            complement(join(<956555..957915,957968..>958142))
                     /gene="COQ6"
                     /locus_tag="ACHE_10338A"
                     /product="putative ubiquinone biosynthesis monooxygenase"
                     /transcript_id="XM_043278164.1"
                     /db_xref="GeneID:66977295"
     CDS             complement(join(956555..957915,957968..958142))
                     /gene="COQ6"
                     /locus_tag="ACHE_10338A"
                     /note="BUSCO:EOG09261031;
                     COG:H;
                     EggNog:ENOG410PFEE;
                     InterPro:IPR018168,IPR036188,IPR002938,IPR000689,
                     IPR010971;
                     PFAM:PF01494;
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0016709 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen, NAD(P)H as one donor, and incorporation
                     of one atom of oxygen [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative ubiquinone biosynthesis monooxygenase"
                     /protein_id="XP_043131458.1"
                     /db_xref="GeneID:66977295"
                     /translation="MRPVNCSVFHLCVRSPCRPGAFAVQRRGFASKPDQAPEIYDVVC
                     VGGGPAGLGLLAALRALPATSKLRVALVETQDLRKARAWNPAPHEFSNRVSSLTPSSV
                     SFLQHIGAWDYLDANRAQNYQEMKVWDGETGSRLSFDWSMETSPFEDLRTVATMAENS
                     NLVRSLLARIEASGDENLSIFANSTVSSIENGTNFYPDGPNMSAWPVLSISSTQQQQQ
                     PSRIAARLLVGADGINSPVRRFADINTDGWDYGRQGVVATLALSDPDPAPFPLGTRTA
                     FQRFLPSLGGPIALLPLPNNHATLVWSTTPENTAYLKSLAPKAFIAMVNAAFRLGMAD
                     LKYMMGMERPSSTSVADTENLHENELVWRLQHTPLPSHVPPMVTGVQEGSVASFPLRF
                     RHASTYISPRVALVGDAAHVVHPLAGQGLNLGLGDVASLSNTIEYAVTHGMDVGDLLT
                     LERYSAERYGVNAKIGGVCDMLHKLYNVPGQGPVTWARSLGVEAIERLPFVKAFLMRN
                     AEG"
     gene            <961066..>961460
                     /locus_tag="ACHE_10339S"
                     /db_xref="GeneID:66977296"
     mRNA            join(<961066..961281,961338..>961460)
                     /locus_tag="ACHE_10339S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278175.1"
                     /db_xref="GeneID:66977296"
     CDS             join(961066..961281,961338..961460)
                     /locus_tag="ACHE_10339S"
                     /note="COG:S;
                     EggNog:ENOG410Q1B0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131459.1"
                     /db_xref="GeneID:66977296"
                     /translation="MASSTGNSSPAATTELKPQSKSKSKKEDNEPPLSANFARSSSSM
                     IGYDHEVYLQLIAGGKSSTKTANQVYREERTRHLTTRALDPAILEPQGDPSSVDFECA
                     EYQRKKDRIQ"
     gene            complement(<961716..>963308)
                     /gene="SNX4"
                     /locus_tag="ACHE_10340A"
                     /db_xref="GeneID:66977297"
     mRNA            complement(join(<961716..962903,963015..>963308))
                     /gene="SNX4"
                     /locus_tag="ACHE_10340A"
                     /product="intercellular trafficking and secretion"
                     /transcript_id="XM_043278187.1"
                     /db_xref="GeneID:66977297"
     CDS             complement(join(961716..962903,963015..963308))
                     /gene="SNX4"
                     /locus_tag="ACHE_10340A"
                     /note="BUSCO:EOG09261PNZ;
                     COG:U;
                     EggNog:ENOG410PFJX;
                     InterPro:IPR027267,IPR001683,IPR036871,IPR015404;
                     PFAM:PF09325,PF00787;
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="intercellular trafficking and secretion"
                     /protein_id="XP_043131460.1"
                     /db_xref="GeneID:66977297"
                     /translation="MNQHDDFDSVSWRNEPDSDNSRPTTSGTDTEEQRGLNYDVNGKR
                     RMSSAHDEPQAGALADAIDLAGIGDGVLECNVSSPLKENDGTKDAYVSYLVTTHTDFK
                     SFQKPEFSVRRRFTDFYFLYKTLYREYPACAVPPLPDKHKMEYVRGDRFGPEFTTRRA
                     WSLHRFLKRLTLHPVFRRAPILTIFLESPDWNAHMRLRSSRTSQGSSETAGGAGIFDN
                     FTDTFVNAFTKVHKPDRRFIEVREKADKLDEDLNHVEKIVGRVARRESDLETDYNELA
                     TQFRSLVSLEPNVEVPLQIFAASVEETGRGLKTLKDHTDQNYLGSLRDMESYITSVKN
                     LLKTREQKQLDFEALVDYRNKAVAERDSLAANPSSYYASNPLTSSPASFIRSKMEDMR
                     GVDHEQSRRERVRKLELRIDELTREVDSAKTTSEMFDEEVVREVADFERIKAAEFRDT
                     LGDFAAKHIDFYQGVINTWERFVADMEGEVEGNPERTEDNTER"
     gene            complement(<964911..>967465)
                     /gene="KEX2"
                     /locus_tag="ACHE_10341A"
                     /db_xref="GeneID:66977298"
     mRNA            complement(join(<964911..965658,965715..>967465))
                     /gene="KEX2"
                     /locus_tag="ACHE_10341A"
                     /product="pheromone processing endoprotease"
                     /transcript_id="XM_043278198.1"
                     /db_xref="GeneID:66977298"
     CDS             complement(join(964911..965658,965715..967465))
                     /gene="KEX2"
                     /locus_tag="ACHE_10341A"
                     /note="BUSCO:EOG09260J8F;
                     COG:O;
                     EggNog:ENOG410PF8E;
                     InterPro:IPR023828,IPR002884,IPR000209,IPR034182,
                     IPR008979,IPR022398,IPR015500,IPR036852;
                     MEROPS:MER0000364;
                     PFAM:PF01483,PF00082;
                     SECRETED:SignalP(1-19);
                     TransMembrane:1 (n3-14c19/20o727-749i);
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="pheromone processing endoprotease"
                     /protein_id="XP_043131461.1"
                     /db_xref="GeneID:66977298"
                     /translation="MRFLTSAAVALGFLCTASTTNFQPRSYDTHDFFALQLDESTLPS
                     EVAQALGARHEGQVGELPGHHTFSLPREESSNIDALLQDLQLRRKLRRRSGNGAALDK
                     REDGLDGIVWSQKLALRKRLEKRMPPPINQPRSFFSSKTDAQAVQTQQEVAMALGITD
                     PIFADQWHLYNTVQVGHDLNVTGVWMEGITGQGVITAIVDDGLDMYSNDLRPNYYPEG
                     SYDFNDKTPEPKPRLYDDKHGTRCSGEIAAAKNDVCGVGVAYDSRIAGIRILSKPIDD
                     ADEAASINYDYQHNDIYSCSWGPPDDGQTMEGPGIMIKRAIVNGVQNGRDGKGSIFVF
                     AAGNGAASDDNCNFDGYTNSIYSITVGAIDRAGKHPSYSESCSAQLVVAYSSGSGDAI
                     HTTDVGLDTCSKLHGGTSAAGPLGAGVVALALSARPDLTWRDTQYLMLDSAIPIHEDD
                     GSWQITKAGRKFSHDWGYGKIDAYSMVQKAKTWDLVKPQAWFNSPWLRVLHEIPQGEQ
                     GLSSSYEVTSDMLKKANIDRLEHVTVTMNVNHTRRGDLSVELRSPEGIVSHLSTARKS
                     DNAPVGYVDWTFMTVAHWGESGIGKWTVIVKDTKVNENSGEFIDWRLNLWGEAIDGAN
                     QPLHPLPTEHDDDHTIEDATVVTTSVQPQPTKTQVPGEPNEAVDRPVNAKPSETQDLA
                     TTTIASPEPRPPMETQSAIPTSTPVSESFLPSFFPTFGASKRTQAWIYAAIGSIIVFC
                     IGLGVYFNVQRRKRARDNPRDDYDFEVVEDEDELHAMTGFSSRTQRRGGELYNAFAGE
                     SDEELLSDDDDEGPYRDHKARETSSGERYDEPEK"
     gene            <970227..>974636
                     /locus_tag="ACHE_10342S"
                     /db_xref="GeneID:66977299"
     mRNA            join(<970227..971769,971824..973220,973271..973769,
                     973825..>974636)
                     /locus_tag="ACHE_10342S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278209.1"
                     /db_xref="GeneID:66977299"
     CDS             join(970227..971769,971824..973220,973271..973769,
                     973825..974636)
                     /locus_tag="ACHE_10342S"
                     /note="COG:S;
                     EggNog:ENOG410PGCZ;
                     InterPro:IPR018946,IPR043904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131462.1"
                     /db_xref="GeneID:66977299"
                     /translation="MAAAASRRLADATNGHPMPSQETENKGVERIPSSRRQNGYERDV
                     AYHPRAPQAQVSRSQTVSYRRYPAPTARGHHRSSNSFSARSRNMPPNWDDKPLPPEPE
                     TTEDESTTPSRRPLPQPAVPQDESARGASPQTILSTQPTSPLSRSDTTRSTKERRHDW
                     ASDRSPLQKLEVALDGISKEEKRARVMEAEMKVKERLERQKAESEAHDSPAPAPAPAK
                     ESASPSPALETPKPKVETPQMNLDRSTRSTTRSINSSLGTNTPDGYRDSPEERHIQRS
                     NTTREPSSFRYAAVPRNDMRYVKPSAGQPVPAGQAPRRAVSVSHHPGRPMPRPLVNGK
                     SSQETPVIHKRTVSQADPVSVPPRRVMLDENQAPRQASIPVPHDLPGRPAEQRAPSAA
                     MPNSQRPSAGAYLAQNAMVPEPVQPVTKDLAVPQDLPSHESNECTAPLKPKRNTVSFN
                     VPPPTPPPLFEWKNAPVARLNISDFEFQNLDVARIKAWWGEGASNRRRSRGLPKNYQM
                     PSQKPRSYKAFQPSLHLRSGPLLRYTGMKRVQIDGPNGPFEKVTWRGSIMIVTQDSKS
                     VYEPAPTLRLFSQPMDLLPPPPVVVNGDDEGSQLPPEYVDPTAGLMKLGRDGRPLYVK
                     PVEHTEEELDLSHVEDDDGIYELSASILDFSSEGVKQPMPANRVHTVDGEVAGAYKEL
                     TGIRLYADLDRDVTFWRFNIEVELGEAQQRIAYRINHSPALGFWVPAKSQMMNMTFHS
                     GNGFTPGVDTNKFCGPDPLWRDILNEHQTRPFHVVIGGGDQIFNDKVTAESIHFQDWL
                     KIKDLGDQYNMPFDPEFRAELESLFLKNYLTWFSQGLFSLVGSQIPMVNMWNDHEILE
                     GYGSYPDEFMQSPVISGLGRIAFKYYLLFQHQTAIEETEHDEPSWIMGAGPGPYIKER
                     SRSLFIPLGKGVTLLGLDERTERMSHEILSEPTCDIIWDRCHREMNRGEVKHLLVLSS
                     IPIAYPRMAMLKNILNSRKSLGKAGLFGGLVNKNGGKIEIYDDHWTAKHHKAERTFLI
                     EDLQDLAADKSIRITILSGDVHLAAMGQFYSNPKLGLPKDKDYRYMPNIISSAIANFP
                     ETEMVSDMLNRRNQVHHMDSNTDEDMIPIFTHDVDGKPRNNKRLIPRRNWCSIREYQP
                     GFTPPVTPDIDDDEEEPRPGKLKRTLSLTRGDRPAGGLLRRLSGRGRPPTTDIDFDNL
                     GNGKASRRMSMDGPFPPSSNSSLRPPRSTESFNRPGTGAGTGPGSFFRRPTNPSRRGS
                     IRSKKSTTSNTNSTTNTTTGDDDGMGGLVNLEGGLAITLNLELNPKDPAGITTPYKLL
                     VPMLRYDGVEYDPPATRVTKGWKKWLGVKKGGHLSQENNRNGEETEGDEVESDGENYD
                     NGDQHGQAEDHSDSDADVGAGPASEEGRKRKKWFGRNL"
     gene            <975288..>976535
                     /gene="TRR1"
                     /locus_tag="ACHE_10343S"
                     /db_xref="GeneID:66977300"
     mRNA            join(<975288..975309,975373..976272,976333..>976535)
                     /gene="TRR1"
                     /locus_tag="ACHE_10343S"
                     /product="thioredoxin-disulfide reductase"
                     /transcript_id="XM_043278220.1"
                     /db_xref="GeneID:66977300"
     CDS             join(975288..975309,975373..976272,976333..976535)
                     /gene="TRR1"
                     /locus_tag="ACHE_10343S"
                     /note="BUSCO:EOG0926386D;
                     COG:O;
                     EggNog:ENOG410PF9Q;
                     InterPro:IPR023753,IPR005982,IPR008255,IPR036188;
                     PFAM:PF13738,PF00070,PF07992;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0004791 - thioredoxin-disulfide reductase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0019430 - removal of superoxide radicals
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="XP_043131463.1"
                     /db_xref="GeneID:66977300"
                     /translation="MVHTKVVIIGSGPAAHTAAVYLSRAELKPVLYEGMLANGTAAGG
                     QLTTTTDIENFPGFPDGIGGAELMEAMRKQSIRFGTEVITETISKLDLSQKPFKLWTE
                     YNDGPDNAPAHTADAVIIATGANARRLNLPGEEKFWQNGISACAVCDGAVPIFRNKPL
                     FVIGGGDSAAEEAMFLAKYGSHVTVLVRRDKLRASKTMAHRLLSHPKVTVRFNSVATE
                     VLGEDKPMGLMTHLRVKDTVSGQEEVVDANGLFYAVGHDPANALVKGQVDLDEDGYII
                     TKAGTSYTSREGVFACGDVQDKRYRQAITSAGSGCIAALEAEKFIAEAESESPPQAET
                     QATNQAEGSTIQPAAQEVPGTERRKDSQGGTAEYQQNPLL"
     gene            complement(<976891..>980199)
                     /locus_tag="ACHE_10344A"
                     /db_xref="GeneID:66977301"
     mRNA            complement(<976891..>980199)
                     /locus_tag="ACHE_10344A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278231.1"
                     /db_xref="GeneID:66977301"
     CDS             complement(976891..980199)
                     /locus_tag="ACHE_10344A"
                     /note="COG:B;
                     EggNog:ENOG410PH3T;
                     InterPro:IPR036910,IPR036188,IPR036388,IPR002937,
                     IPR009071,IPR007526,IPR009057;
                     PFAM:PF13450,PF04433;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131464.1"
                     /db_xref="GeneID:66977301"
                     /translation="METTASVETQGLNGQSSETLRIRQYMPTTETLRHSSNGYSSETL
                     QIKQYMPPTRTQSNGNAQSPQIPSHQSLPESPAKHPRSARQSGDAECHTGMERSDSQE
                     GSYINFRISKKVTDSGLDDGLLSTETDTNTSTPNESMTSASLLSSANPKKSASPLNPV
                     HSFPSTSSFGSPSYVIDSKNDLARFRPKSSIPSGLSAAAYGQQCVAAAYASRLNPYAL
                     HPNEQEALQDHLCHLHVTVYLNIRNRILRLWTRNPLVSVSKDEALGCAKDYRWMNLAS
                     FAYEWLLRNGYINFGCVEIPLPPAPAVPAKPGRKKDGPVVVVIGAGMAGLGCARHLEG
                     LFNQYHDTISSEPRVVVLEGRRRIGGRIYSHPLQSLKTSDLPSGLVPKAEMGAHIIVG
                     FDHGNPMDPIIRGQLALPYHLLRDLSTLYDIDGTPTDEVQDAMVESLYNNVFDRSGLY
                     RHKSVISRTAEGDRELIDSGRDLTVSDGLTVRQYEEARAAGTVGLLKPNKRVRRGVGH
                     KTADIKTKVAPVADLGPAEEQPAALTCQTMGWKLNAGISVNTTLDLDPVAKASDQQTL
                     GAVLDEGVRQYQRMLPLTPKDMRLYNWHFANLEYANAANAGQLSLSGWDQDVGNEFDG
                     EHSQVIGGYQQVPYGLFSLPYKLDIRTNKNVSKILYDTTGTRQGKTVVQCEDGEVIQA
                     DRVVFTGSLGILKSQNIEFSPPLPDWKLGAIERLGFGLLNKVILVFNQPFWDTERDMF
                     GLLREPTNPESLKHEDYAANRGRFYLFWNCLKTTGLPVLIGLMSGDAAHQAECIPDAE
                     IVTEVTSQLRNVFKDVAVPDPLETIVTRWGTDKFTRGSYSFVPPQSLPGDYDLMATPV
                     GNLHFAGEATCGTHPATVHGAYLSGLRAASEVINTITGPIEIPQPLVPEKGSVSNTPV
                     TTGQKRKEPAAPTPSSTDRQPPARTNNSFIPAEKALRDAYNTAMWDAIYAEIGHPQPR
                     PAKTGLNPFLFYQKDYWLQAREQADDQKRATSKNCNAKAARDEVRQVLGLMWRQAAEE
                     IRRPYLEQVEVNRRMNEKAAERWRREAMEWERRSYEVKDRWCKENPFESWQPESSTAN
                     GANASVSNPSTNPS"
     gene            complement(<981259..>982657)
                     /gene="TVP38"
                     /locus_tag="ACHE_10345A"
                     /db_xref="GeneID:66977302"
     mRNA            complement(join(<981259..981625,981685..982101,
                     982161..>982657))
                     /gene="TVP38"
                     /locus_tag="ACHE_10345A"
                     /product="Tlg2-vesicle protein"
                     /transcript_id="XM_043278242.1"
                     /db_xref="GeneID:66977302"
     CDS             complement(join(981259..981625,981685..982101,
                     982161..982657))
                     /gene="TVP38"
                     /locus_tag="ACHE_10345A"
                     /note="COG:U;
                     EggNog:ENOG410PINQ;
                     InterPro:IPR032816;
                     PFAM:PF09335;
                     TransMembrane:5
                     (o92-110i131-161o167-189i244-262o282-303i)"
                     /codon_start=1
                     /product="Tlg2-vesicle protein"
                     /protein_id="XP_043131465.1"
                     /db_xref="GeneID:66977302"
                     /translation="MPADYASTARALSISTSPEPLSPADEDSRPLWGHRSATSRRNSP
                     RAEPNKVTSTSTGEATATFRDKVVQRGAQIWRRIGSTWRKMNWWQRSGAVAAVVASIA
                     LALVFLYFTSQIFHWMAPVVEDWERSWTAFLVLWLCVFFVSFPPLVGWSTFGTMAGFI
                     FGVWKGWLLYASGTILGSTVSFVVSRTVLSRFVNRLMERDKRFAALALTLKYDGLKLL
                     CMIRLCPLPYSICNGAVSTFPTVHPLMYGLATIIISPKLLVPAFIGSRLRLLSGDEKM
                     SAGSKAINICSIVFTVGIGVFTGWYIYKRTLARAKELEAKEREEIRNSLDRDHSARRP
                     HRAFSEDPNANIAATTLARDEEERAGFHDFDDDNVDIVIDDESDDGSSSPAKNAVSPY
                     RDEFTDNDSDVFRDGDEPERETYRMHTHIRSNQG"
     gene            complement(<983391..>985208)
                     /locus_tag="ACHE_10346A"
                     /db_xref="GeneID:66977303"
     mRNA            complement(join(<983391..984289,984344..>985208))
                     /locus_tag="ACHE_10346A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278253.1"
                     /db_xref="GeneID:66977303"
     CDS             complement(join(983391..984289,984344..985208))
                     /locus_tag="ACHE_10346A"
                     /note="COG:K;
                     EggNog:ENOG410PV4G;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131466.1"
                     /db_xref="GeneID:66977303"
                     /translation="MARPSPLACIECRQHHVKCDAKTPSCSRCLDTGISCKYLPSRRG
                     RNRKARDGRRPESSTLVPEISRPGDSGPLGGDIINSPFSSMGNITKDNASITSRAHGQ
                     SPLPGASAQNDLDPDTRLVRQYYENFHSAHPILVPANEYERRGYPECVRQVVRFIGSH
                     YSLLISSESLRESTAVRLSSNDTRSPSMVKALLLYSIILYARGENTEAQEWFSRAVDG
                     ALELGMHRKEFATMYCDGQELEAESLRRTWWELTIMEIYMASFQRKITLRCGSIAHDV
                     GLPCEESIYANSNDDGDTTESRYSSYSYRIDAAYILARVLVLNSLGETHRDHLQAVEN
                     ALVSWTNHLPPNKVDIVDTYGVVDEMLFQAHTIIQYAAMLLHLPRSNIRPAVPDAETV
                     TCPITPARLPPSFTRHVHDIKATEASKQLSNLLSMRPNVQRYSPFIICSLALCGLVQL
                     ATSRIHSPECSEHHRNRVVLVLGCLKVLKRNWSIAQHAYQHVRQAAAETFAASSGPLR
                     WFQSHGSSNSSATLKNGPVSGRSSVEGPELLNVGGNLPAMPPTNTDGQDMFSQGLLSA
                     YIDPTCSDPSFLNNIFDMELT"
     gene            complement(<988305..>988484)
                     /locus_tag="ACHE_10347A"
                     /db_xref="GeneID:66977304"
     mRNA            complement(<988305..>988484)
                     /locus_tag="ACHE_10347A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278264.1"
                     /db_xref="GeneID:66977304"
     CDS             complement(988305..988484)
                     /locus_tag="ACHE_10347A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131467.1"
                     /db_xref="GeneID:66977304"
                     /translation="MIIDAKVFRIFDVEEVPFYRRPAQYLTASMAAAGFNDKEAKIAL
                     DKLQIFPAILAPQMQ"
     gene            complement(<989595..>990242)
                     /locus_tag="ACHE_10348A"
                     /db_xref="GeneID:66977305"
     mRNA            complement(<989595..>990242)
                     /locus_tag="ACHE_10348A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278275.1"
                     /db_xref="GeneID:66977305"
     CDS             complement(989595..990242)
                     /locus_tag="ACHE_10348A"
                     /note="COG:G;
                     EggNog:ENOG410PNPF;
                     InterPro:IPR013078,IPR029033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131468.1"
                     /db_xref="GeneID:66977305"
                     /translation="MAFRLHVVRHAEGIHNPKHDISILDPPLTPKGVQQSERLSQIFP
                     FNDNVGLVITSPLKRTLQTTLIGFQQTLDGKYYPETAGSGQPDGARLLLSPDIQAHSA
                     RLCDTGSDQAILQSEFPHLPWDELAFDPVFPAKEELYAPDREALVERGRSFQRFLKKE
                     FVALDSGRPDIVVVSHGGFMKHIIPNEKLAFDQAGWMSFFVQFDRDSEMTSIRIQ"
     gene            <990645..>992312
                     /locus_tag="ACHE_10349S"
                     /db_xref="GeneID:66977306"
     mRNA            <990645..>992312
                     /locus_tag="ACHE_10349S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278286.1"
                     /db_xref="GeneID:66977306"
     CDS             990645..992312
                     /locus_tag="ACHE_10349S"
                     /note="COG:I;
                     EggNog:ENOG410PP2D;
                     InterPro:IPR019819,IPR019826,IPR002018,IPR029058;
                     MEROPS:MER0030934;
                     PFAM:PF00135;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131469.1"
                     /db_xref="GeneID:66977306"
                     /translation="MRHIFSALLGLAALGAASATLHAAAHQSPVINTTYGDVRGAPSS
                     FRGGSTATVYKGIPFAAPPTGSNRWKAPKKPRSWSGVLNATEFGPQCAQTISDAGIFS
                     SGKNITSEDCLYLNVWTPTYNDTSEITTKNLPVFLWIYGGRFTGGSGDVITYDGTGLA
                     SKDIIVVTINYRLGPFGFFAHPELSAESGRNTSGNYGILDQQAALRWVHENIRNFGGN
                     PDQVTVGGQSAGSASALDAMWSPLVKGLAHGVIAESGARGPHDPVTGSAATSYRSKEA
                     AESHGVRFLEELNVSSIAQLRNVSMETLLEYDSLSDTIFENTQFENLTSAFMEPPMWR
                     PNLDGYVFPHTYGEALRLNGHSDIPILTGNNKDESGASPDTSYNVSTYHTLYQELFGD
                     FADEFFQLYPANNSTQASENSNEFFRDLSRVGTWRWAVDWAAGGAKSNVYTYYFTRAP
                     AENRDKGAYHGSEIWYTFNNIPYSDYSNVTWYDYDFVVEGRMSEYWANFIRKGDPNGD
                     GLPRFVKTTNQTKETMWLGNSWGAGPLSIQDKRIDFIERWYATLKEW"
     gene            <992415..>994649
                     /locus_tag="ACHE_10350S"
                     /db_xref="GeneID:66977307"
     mRNA            <992415..>994649
                     /locus_tag="ACHE_10350S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278298.1"
                     /db_xref="GeneID:66977307"
     CDS             992415..994649
                     /locus_tag="ACHE_10350S"
                     /note="COG:K;
                     EggNog:ENOG410PNF0;
                     InterPro:IPR002110,IPR036770,IPR020683;
                     PFAM:PF12796,PF00023,PF13637;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131470.1"
                     /db_xref="GeneID:66977307"
                     /translation="MSIEPTLGHVTNYPRPCSKVANLQIKETTQSPSMLLLDLPTELL
                     WLIGSFLERKSDLNFLSQANRHLHLLFNRVVYDLDVKNSWSCALEWAARNGCEATARK
                     AIDAGASLDSEEYYESKPLTLAVENGDDAFVRLLLEKGANPNDDSYWNWGLNPLTDAS
                     MRGYESIVRLLLEHGASQYRPDSAPMTFPALQIYNLPLPSAAGEGHLEIVKLLTGADH
                     EKRFRDLIGPIALTQAAAGGHISVAQHLIEEGVDPNLHEWQGEDDPISWASRQGRLEM
                     VKFLLDKKAEVLPKEQDNLLYPMTLAASRGHYAVAELLVSTYVERITQSGSIEERGTL
                     LAVAVICGWEVTVQRLLEHGCPPDTLSLGYNRMNWDASLTPLARAVENNDYEMIQILL
                     HHGANPNGQGCSELYDSPLFLAITNGYPDIVQCLLDHGAYLSCPEGHTCDHEAMVLLG
                     AIPFKTIFPLLLDRGANPEAITEDHEYPLAQALRSGHIARVQLLLDKGVPLQTPPELK
                     YAPSVLACAVDGGQAMVEFVLAQGFVPQPEETERALYVAARHGNPALLELFLDQATDQ
                     GWCPNASVMMEAALEHNIDDAKAMIDLLLDRGVHIDTRDRDNTTLLFKAAELCHHKMV
                     PFLLERGADPISRNGSGSICPLVASAANVTNTSLSVTTCLLEFIEERGIPLQDWEDQL
                     KVIEEATYEPWKDQVTRLLQRLYWRNVYPPPSNMPSDSAKGLKRRRNNSSAGGREVRG
                     RQDA"
     gene            complement(<997558..>998454)
                     /locus_tag="ACHE_10351A"
                     /db_xref="GeneID:66977308"
     mRNA            complement(<997558..>998454)
                     /locus_tag="ACHE_10351A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278309.1"
                     /db_xref="GeneID:66977308"
     CDS             complement(997558..998454)
                     /locus_tag="ACHE_10351A"
                     /note="COG:S;
                     EggNog:ENOG410Q1YN;
                     InterPro:IPR001279,IPR036866;
                     PFAM:PF00753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131471.1"
                     /db_xref="GeneID:66977308"
                     /translation="MEPIIHPIFEKQTSTWQYIVACPRTLQAAIIDPVLDYDQAQMSI
                     STTSADALLDFATSHNYTITRLLETHAHADHLTAAYYIKQRLKVENHAHVPICTGYRI
                     RQVQNTFARRYGVPKDELDNAFDHLSQDDETFRIGDIAGQVLHLPGHTPDHSGYLIGR
                     NVFTGDSMFNPDVGSARCDFPAGDAHALYSSMQKLLSLPDEYKLYTGHDYPPSSGDYQ
                     SRDPMPYVTVKEQREGNKHVKGGTPKEDFVRWRQERDSGLNEPRLLHQALQVNIRGGR
                     LPLHADRRVFLSMPVRVPESWN"
     gene            <999172..>1000433
                     /locus_tag="ACHE_10352S"
                     /db_xref="GeneID:66977309"
     mRNA            join(<999172..999524,999574..999870,999935..1000220,
                     1000269..>1000433)
                     /locus_tag="ACHE_10352S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278320.1"
                     /db_xref="GeneID:66977309"
     CDS             join(999172..999524,999574..999870,999935..1000220,
                     1000269..1000433)
                     /locus_tag="ACHE_10352S"
                     /note="COG:P;
                     EggNog:ENOG410PI7D;
                     InterPro:IPR004695,IPR038665;
                     PFAM:PF03595;
                     TransMembrane:8
                     (o19-44i64-88o94-118i125-146o166-188i246-269o275-294i306-
                     330o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131472.1"
                     /db_xref="GeneID:66977309"
                     /translation="MGTGIVSILLNTLPYNGEWLYWISVVVFALNVLIFVIFLCLSIL
                     RYAFYPEIFPVTVTHPTQSLTLGSFPMGLATIINMICFVCVPSWGPWASYLAWGLWMA
                     TVVFSVATCFALMFIMTTSEGEVLLSSASAAWLLPIVACVVTSASGSVVAEVLPNPQY
                     ALGTIVASYVVWGIGVPMALMMTVIYLLRLMLYKLPPKAAIASTFLPIGPLGQGGYGI
                     QRLGQAAKMAFPQTGTLQPGTGDVLYDIGFLVGLIFWGFGLVWLFFAIATVFRVRRFS
                     FNLGWWSFVFPLGVYATCTNQLGQDMPSRFFKVLGTILSLSVVISWIVVSYFTVRGVY
                     KQNLFVDPCLTALHDKQQRKLEHQHRERHSYP"
     gene            <1001504..>1003831
                     /locus_tag="ACHE_10353S"
                     /db_xref="GeneID:66977310"
     mRNA            join(<1001504..1002432,1002498..1003217,1003270..>1003831)
                     /locus_tag="ACHE_10353S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278331.1"
                     /db_xref="GeneID:66977310"
     CDS             join(1001504..1002432,1002498..1003217,1003270..1003831)
                     /locus_tag="ACHE_10353S"
                     /note="COG:L;
                     EggNog:ENOG410QE6U;
                     InterPro:IPR002625,IPR013899,IPR036063,IPR000571,
                     IPR036855;
                     PFAM:PF01713,PF14608,PF08590;
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131473.1"
                     /db_xref="GeneID:66977310"
                     /translation="MVAEDVLDSCLRLLQDAALDEEEQAEKVEDFLREKTSLTGSSLE
                     NAVLDILWRHRNRSVPDSSPPPRHTIIRRSSPAPWQMARSSTPLSPASNLGTSPGSTS
                     WLHSSRGTFSRAPLSATVSPFSSPRPSPRLALAQPIPHSPNLNAYEFSDQTQASDYFY
                     GDLGNDSNVDWLVADDANSTTSSIGGLSASGSLSATAPEFVPDMSPHDILRTVLGDKR
                     SNEEIETALEANSYDLGATIASLTQNDGESLSNQSDDGRIVVGKSMAIEQPQLVTSTA
                     QNRSPVVCKYWLSTGQCLRADCRFSHDLTSHVCKYWVMGNCLAGDGCPFSHDPSALIS
                     NISVQDDNQQLNAGSSFPVDNAADAFPPLQSPALGDPWANQYTSKYPAHLSGMGGSRA
                     GSHLQVHGGRRNGSTGNVSRPHSRPTSRQQHRELNPTAPSVDDPDAFPTLGTVTAKNA
                     GKKHGKRNAREYQSGKENHPTSLADVVRMTPSPAPGKGKPSSRNGRDGFKSRENTAAA
                     QSIPAPQNIPWLETGSRANQQYIKYRTEAIRHGTVRNKFLQSAAQAWNRNDARAAKAL
                     SLRGQAENEAMRKCHREAARQLYEERNKHLLTMGLDDSTEELYVDLHGLHPEEAIEYL
                     EKILLKHAREGRRVLYAITGTGHHSKNGKDKIGKAVKTWLNEWRYLFREFSVPGERGG
                     YVGGILGIDPTSYDRSLAKSLEEEIKDDDNRNQPTISMGKIQLLRREDLEPQSN"
     gene            complement(<1004252..>1005360)
                     /locus_tag="ACHE_10354A"
                     /db_xref="GeneID:66977311"
     mRNA            complement(join(<1004252..1004968,1005028..1005248,
                     1005321..>1005360))
                     /locus_tag="ACHE_10354A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278342.1"
                     /db_xref="GeneID:66977311"
     CDS             complement(join(1004252..1004968,1005028..1005248,
                     1005321..1005360))
                     /locus_tag="ACHE_10354A"
                     /note="COG:G;
                     EggNog:ENOG410PHU5;
                     InterPro:IPR015813,IPR005000,IPR040442,IPR011206;
                     PFAM:PF03328;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131474.1"
                     /db_xref="GeneID:66977311"
                     /translation="MATRNALRRSLLYIPGSSQRFIDKSRTLSADCVAYDLEDSVTPH
                     KKVEARGLVRRALDQPAPDGIRERAVRINSVDSGLALGDLTEVLQSPNLSTIVLPKVN
                     SASDLTFVTDVISHILSQQEQQEHQQHQQRPTISLLALVESAKSLTNLTQICSASPLL
                     QGLIFAAEDFALDLSLTRTPALTEFLFARSMIATAARAANLPSTIDLVCTAYKSTTGD
                     GRPPAALEEECRGGKHLGFNGKQCIHPSQVETVERIFGPEDSEVEWAVRVKIADEKAA
                     AAGWGAWTLDGKMIDVPVAEKARAIVKKAEVCGFNVHELREKWQHQEPE"
     gene            <1006118..>1006819
                     /gene="TVP23"
                     /locus_tag="ACHE_10355S"
                     /db_xref="GeneID:66977312"
     mRNA            join(<1006118..1006254,1006333..1006619,1006671..>1006819)
                     /gene="TVP23"
                     /locus_tag="ACHE_10355S"
                     /product="Golgi apparatus membrane protein tvp23"
                     /transcript_id="XM_043278353.1"
                     /db_xref="GeneID:66977312"
     CDS             join(1006118..1006254,1006333..1006619,1006671..1006819)
                     /gene="TVP23"
                     /locus_tag="ACHE_10355S"
                     /note="COG:U;
                     EggNog:ENOG410PK6X;
                     InterPro:IPR008564;
                     PFAM:PF05832;
                     TransMembrane:4 (i20-40o46-64i109-130o136-155i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Golgi apparatus membrane protein tvp23"
                     /protein_id="XP_043131475.1"
                     /db_xref="GeneID:66977312"
                     /translation="MEQVQPQQGDLNWRLSAHPITLICFLAFRIGALLMYLFGVLFIK
                     DFILVFIFTLLLLSADFYYLKNIAGRRLVGLRWWNEVNVSTGDSHMVFESSDPNTRTI
                     AATDKRFFWLSLYVAPTLWVGLAILAIIKLSSVIWLSLVAIALVLTITNTVAFSRCDR
                     FSQASTYATSAFGGSIVNNLAGGLLGRLFK"
     gene            <1009855..>1012062
                     /locus_tag="ACHE_10356S"
                     /db_xref="GeneID:66977313"
     mRNA            join(<1009855..1009900,1009996..1010110,1010162..1010242,
                     1010297..1010365,1010419..1010549,1010611..1010741,
                     1010801..1010899,1010957..1011375,1011444..1011520,
                     1011581..1011641,1011702..1011850,1011920..>1012062)
                     /locus_tag="ACHE_10356S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278364.1"
                     /db_xref="GeneID:66977313"
     CDS             join(1009855..1009900,1009996..1010110,1010162..1010242,
                     1010297..1010365,1010419..1010549,1010611..1010741,
                     1010801..1010899,1010957..1011375,1011444..1011520,
                     1011581..1011641,1011702..1011850,1011920..1012062)
                     /locus_tag="ACHE_10356S"
                     /note="COG:A;
                     EggNog:ENOG410PK44;
                     InterPro:IPR036875,IPR001878;
                     PFAM:PF00098;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131476.1"
                     /db_xref="GeneID:66977313"
                     /translation="MPGWESGEAAGAWDSGDGGFGGEDDFNSNGFDGGDSRFEGVGDG
                     GAGGDNNCRNCGGGGHFARECLEPRKMGACFNCGEEGHSKVDCPQPRKQSGACFNCGE
                     EGHSKAQCTKPRVFKGPCRVCEKEGHPASECPERPPDVCKNCKQEGHRTIECTENRKF
                     DLNGIPDKLPEEAWAAMKAASDSKDLGEYREAFKIYSKAVPQVTFVDIEKKMREEDFN
                     IYLIAMEKPIGDIMCLINLQGKLNCKYVVGFYYSPKPQRAALRERWPASTEENLARLE
                     DAGLPYDRQIPKCINCGGKQARVPNEENKNKDADTDEQELGHVSRSCKEERAERERVE
                     VKCVNCNAVGHRARDCPEPRRDQFACRNCGSPEHKASECTEPRTAEGVECRRCNETGH
                     FAKDCPQASAPRTCRNCGSEDHMARDCDKPRDVSTVTCRNCDEVGHFSNDCPKPRDYS
                     RVKCNNCAEMGHTTRRCPAENSGEPDLMGGTDDYNNGGDDVGAGGGWGASEGAAGW"
     gene            <1013642..>1015466
                     /locus_tag="ACHE_10357S"
                     /db_xref="GeneID:66977314"
     mRNA            join(<1013642..1013864,1013933..1014121,1014175..1015114,
                     1015169..>1015466)
                     /locus_tag="ACHE_10357S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278375.1"
                     /db_xref="GeneID:66977314"
     CDS             join(1013642..1013864,1013933..1014121,1014175..1015114,
                     1015169..1015466)
                     /locus_tag="ACHE_10357S"
                     /note="COG:G;
                     EggNog:ENOG410PFEN;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:10
                     (i12-31o37-57i78-99o105-125i163-180o192-215i349-369o375-
                     402i414-436o442-463i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131477.1"
                     /db_xref="GeneID:66977314"
                     /translation="MGGGQYLGLRGNALQIAIGVIAGMDFLLFGYDQGVTGGLLNLKS
                     FISVFPTIATTGAEYENLSRPEQSARSTEQGIVVAAYNLGCFAGSIPTIWIGNWLGRR
                     KTIFLGSFIMVIGAILQCTAYHLPQLIVGRIVTGLGNGMNTSTVPTWQSECCKSNRRG
                     QMVMIEGAMITLGITISYWIDFGLLFTDPNPVSWRFPLAFQIFFALIILAFVMFLPES
                     PRWLVLKGREHDAQEVLTALLDDTPDSTLVQNELIAIKATVLEMSKGSFSDMFTMTED
                     RHFHRTMLAYVNQMFQQISGINLITYYIPKLLEDQVGMDAVTSRLISACNGTEYFLAS
                     LIAIFTIEIFGRRTLMLFGAAGMSLSMVVLAITASIANTPANIVCCVFLFVFNTFFGI
                     GWLGMTWLYPAEIVPLKIRAPANALATSSNWIFNFLVVMITPVAFDNIGYQTYIIFAV
                     INAFIFPVTYFFYPETTRRSLEEMDRIFRKTTSVFNLVRTARDEPHMYGKKGELLHTV
                     DDVEDAAVHAARQVSIADGTHKEHREHIENEKFGDGSSDRS"
     gene            complement(1016762..1016833)
                     /locus_tag="ACHE_t10006A"
                     /db_xref="GeneID:66987312"
     tRNA            complement(1016762..1016833)
                     /locus_tag="ACHE_t10006A"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:66987312"
     gene            <1017411..>1019178
                     /locus_tag="ACHE_10358S"
                     /db_xref="GeneID:66977315"
     mRNA            join(<1017411..1017562,1017620..1017931,1017999..>1019178)
                     /locus_tag="ACHE_10358S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278386.1"
                     /db_xref="GeneID:66977315"
     CDS             join(1017411..1017562,1017620..1017931,1017999..1019178)
                     /locus_tag="ACHE_10358S"
                     /note="COG:G;
                     EggNog:ENOG410PH49;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i57-75o95-114i134-153o159-180i192-210o222-244i305-
                     324o344-362i374-394o406-424i436-461o481-504i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131478.1"
                     /db_xref="GeneID:66977315"
                     /translation="MLSGRPEKTSKMSDQQDTKDITNVTTRCPEDPAHAETGDEPDVA
                     SIERIYRKLDYRIIPPFWILYFLCSAIRSNVGLAQTMNEDAGHDLGTVLNATPHQIST
                     GLALFYVCYVVFDLPSNLIMTRLSPHVWMSRIVISVGVIGACMAAMKAAWSLYLLRLL
                     LGIVEAGLWPGMSYYLTLFYPPSRTGKRIGQYYTAAQISAAVVGLVSAGFQGMDGDRG
                     LVGFQWMFLIYGLVTIVLGIVLLWWLPDRPVIPGSPETEKKKYFGVIPRSAPALSGAN
                     ALAHYHDLRRVYHRPRWTLRDLARVFLDWHLWPLLIMYFGVVGVGIGVQNYSTIIIQA
                     TNPSLSSVDLSLLSAPIWLMDLLAILLITPISDRFHRHRALFFSGPVVLQILGLLLMT
                     YAGSDANPWPRYGGLLIVGFGLGPTVPVTMTWTNELFQPRHGEVGVAAASAVVSGWGN
                     LGSILTTYALYTGWKSDAEAPGMAKYRKSNLVMVGILCGSILAAFLMQFLVWFVDRKN
                     PDSTATGQNDIVDGAARREAGQRGLHGLGSNLTKILPKK"
     gene            complement(<1019643..>1021155)
                     /gene="GLN1"
                     /locus_tag="ACHE_10359A"
                     /db_xref="GeneID:66977316"
     mRNA            complement(join(<1019643..1019660,1019714..1020135,
                     1020189..1020693,1020863..1020955,1021043..1021078,
                     1021153..>1021155))
                     /gene="GLN1"
                     /locus_tag="ACHE_10359A"
                     /product="glutamate--ammonia ligase"
                     /transcript_id="XM_043278397.1"
                     /db_xref="GeneID:66977316"
     CDS             complement(join(1019643..1019660,1019714..1020135,
                     1020189..1020693,1020863..1020955,1021043..1021078,
                     1021153..1021155))
                     /gene="GLN1"
                     /locus_tag="ACHE_10359A"
                     /note="BUSCO:EOG09262MXH;
                     COG:E;
                     EggNog:ENOG410PI17;
                     InterPro:IPR014746,IPR036651,IPR008147,IPR008146,
                     IPR027302,IPR027303;
                     PFAM:PF03951;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004356 - glutamate-ammonia ligase
                     activity [Evidence IEA];
                     go_process: GO:0006542 - glutamine biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="glutamate--ammonia ligase"
                     /protein_id="XP_043131479.1"
                     /db_xref="GeneID:66977316"
                     /translation="MAETSTVISNTENLMKYMDLPQKGHVQAEYVWIDAVGGCRCKTK
                     TLSKPVTSVDELPEWNFDGSSTGQAGGDNSDVYLRPVAFFPDPFRRGDNILVLCETWD
                     SDGTPNKFNYRHEANRLMEAHSKEDWWFGLEQEYTLLGTDGWPYGWPKGGFPGAQGPY
                     YCGVGTGKVYCRDIVEAHYRACLYAGIKISGINAEVMPSQWEYQVGPCNGIEMGDHLW
                     MSRFFLHRVAEEFGVKISFEPKPVKGDWNGAGLHTNVSTASMRADGGMKFIEAAMKKL
                     EARHVEHIAVYGEGNEERLTGRHETGNIDKFSYGVADRGGSIRIPRQCAKDGKGYFED
                     RRPASNADPYQITGIIVETLCGGN"
     gene            complement(<1025227..>1027536)
                     /locus_tag="ACHE_10360A"
                     /db_xref="GeneID:66977317"
     mRNA            complement(join(<1025227..1025826,1025884..>1027536))
                     /locus_tag="ACHE_10360A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278409.1"
                     /db_xref="GeneID:66977317"
     CDS             complement(join(1025227..1025826,1025884..1027536))
                     /locus_tag="ACHE_10360A"
                     /note="COG:S;
                     EggNog:ENOG410PJZ4;
                     InterPro:IPR019680;
                     PFAM:PF10744;
                     go_component: GO:0016592 - mediator complex [Evidence
                     IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_process: GO:0006357 - regulation of transcription by
                     RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131480.1"
                     /db_xref="GeneID:66977317"
                     /translation="MATPSSKQNPGATPTHLTSSPRPAGVPMARPMSHKSPSARSPSA
                     SGHFHGGGGSHAPLHQYSTPLAVAAAGLDDPVTFSSPSALLALGGYSGISPSPATHEV
                     LVGAGMHDSDIHALGMQGFKLGNARDSDEERRRHIEDVVQMLRTRVAGRGVCREGIER
                     LGQLEGFESIWQEDNLSIAGNFVDLEIEFHPGKHTVKDVSLKYATPEATEGEGREEAT
                     AVLRRDLMQSPEEIERGAWKSLNGFYENLRWLAKLDRLSQEVNCFEAIEGLYESLKRI
                     WDVESRHSKFSETYEHLCSGWVGRPSLHRGGRIGISLDYWVYQAKILDAKRKSTSPGA
                     MVLDNADQEFDNHQHKMWSAMIECEEGYPSLRVSKDWVNSEVLVPTETDESSAPKESA
                     APDVSMVNWAEPPMTTSSDNQGNPDAMALDSGMLGSSTPNRRFVAKIEPPLDVPILAA
                     SDIYRQLGLQLPQEFRMVTYDGLLVPGSSPLSGADIMGFDTEEASQADRRKRRLSVQA
                     FDSEDKPCKKQHCYTFQAFESVAGRTMRDIPFSHPRQLAEILPVLRQYATLENMIQKI
                     FDTSSRDHDDKQDGQGSTKLDRKQQAAQSGTANGKGDVTILSNQDPNEQKLDALMKGL
                     NVEGASTDNDADDVKIDITLRTQLGQAPVIMLLFTINDAAIENNYLSTFSISFEVGLN
                     GHVTVVDTSGLWEEPVSGDDRPEGADTDDQKNEASEMPKKIARALEVSQDLGILVEWV
                     LRWRRQREST"
     gene            <1030821..>1031719
                     /locus_tag="ACHE_10361S"
                     /db_xref="GeneID:66977318"
     mRNA            join(<1030821..1030916,1030978..1031387,1031442..1031521,
                     1031572..1031602,1031653..>1031719)
                     /locus_tag="ACHE_10361S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278420.1"
                     /db_xref="GeneID:66977318"
     CDS             join(1030821..1030916,1030978..1031387,1031442..1031521,
                     1031572..1031602,1031653..1031719)
                     /locus_tag="ACHE_10361S"
                     /note="COG:S;
                     EggNog:ENOG410PPIB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131481.1"
                     /db_xref="GeneID:66977318"
                     /translation="MFSIRLVVRKGLRFPKRTQIRSVTTLDGRPYIYVIPNESASGES
                     HILSLLPSKPTNPNVPIGITSKLPPTPESFKENRGFLNILQEVVSKHAHEDPDNISQA
                     QMMISTSGANLSSGGVLLTGQKARRRRASADSSGGASGQGGAGGAGRGGWIHVFDERR
                     PPEYGRIPWPEDIFGSLEVDGEGKFVNGNGNYQPSGTYRTITRDGIIAPSPFLRGKLV
                     QRLREIESQ"
     gene            complement(<1031912..>1033244)
                     /locus_tag="ACHE_10362A"
                     /db_xref="GeneID:66977319"
     mRNA            complement(join(<1031912..1032552,1032615..1033170,
                     1033218..>1033244))
                     /locus_tag="ACHE_10362A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278431.1"
                     /db_xref="GeneID:66977319"
     CDS             complement(join(1031912..1032552,1032615..1033170,
                     1033218..1033244))
                     /locus_tag="ACHE_10362A"
                     /note="COG:S;
                     EggNog:ENOG410PK5Y;
                     InterPro:IPR003738,IPR036590;
                     PFAM:PF02586;
                     go_function: GO:0003697 - single-stranded DNA binding
                     [Evidence IEA];
                     go_process: GO:0006974 - cellular response to DNA damage
                     stimulus [Evidence IEA];
                     go_process: GO:0018142 - protein-DNA covalent
                     cross-linking [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131482.1"
                     /db_xref="GeneID:66977319"
                     /translation="MCGRYSLGVRMAFVRQRLEQQGMQVDDAPGDDEVRETYNFAPGY
                     NGVVYCADPGERDHGATRETEEDEATDKAQEEIREQEDEYNTQYLGLENESATKYKLQ
                     SMRWGLIPFWTKRKPDYGSLMRTINCRDDSLIEDRGMWTSMKRKKRCIVICQGFYEWL
                     KKGPGGKEKVPHFVKRKDGELMCFAGLWDCVRYEDSDEELYTYTIITTSSNPYLKFLH
                     DRMPVVLDQNSGAMKTWLDPNRTTWSNDLQSILKPYKGELECYPVSKEVGKVGNNSPD
                     FLIPINSKENKSNIANFFANAKQKKSDEPVKTEGEKNTTSDMSEQKVTKDNDENRTTQ
                     DNEWSEDNAPVPVPGVKREHPPDSNDEIGVTEQKKQKTQFVSPWKQSNHKPVKKADEK
                     KSTDGSQRITDFFRK"
     gene            <1033538..>1034986
                     /locus_tag="ACHE_10363S"
                     /db_xref="GeneID:66977320"
     mRNA            <1033538..>1034986
                     /locus_tag="ACHE_10363S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278442.1"
                     /db_xref="GeneID:66977320"
     CDS             1033538..1034986
                     /locus_tag="ACHE_10363S"
                     /note="COG:S;
                     EggNog:ENOG410PMXJ;
                     InterPro:IPR013026,IPR011990,IPR019734,IPR040201;
                     TransMembrane:1 (i83-104o);
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131483.1"
                     /db_xref="GeneID:66977320"
                     /translation="MLRAASRRACASAQKTAQHTPQPLPRSISSNTNRPTPLHTNYRL
                     LNPLVSRNAFLQIRYLSFAQRMRYGFREASKGIWRKNPILLPIALISTIGAGLLFAYI
                     AYIEITRVGPQYHKFPPPVAETLRTAVYYTEVDLNPPKALKAYKEALHIAVEMGLHPF
                     SDEVIGIKLQVAMMLEKAGLVKPAIDVLERTKVEALNWVDDMRKKKTLQSKEAALVSD
                     RKKTEEDKVVVDDPEILEEQKRIRELEEFEDLQQDKTLKKTVGIQMKLAELYSSDYIQ
                     DEKKAEQAQVAAVELSLKEMYRRQALGLPVGGGSQNENSDSWLNLTEMATALTDLATT
                     YVTQEKYELAMPLYLRALDLLRVDEGKSPTCKQVTLLNGVATAMAGQVQRGIRQQQQP
                     VPREQTIDAAKKWAQKAIDVAARIQPPVRDEDCDLSCVAATYNLGELAEMQGKREEAV
                     KRYRESKSLAVGLGFEDAVAVADGALKRLSKK"
     gene            complement(<1035599..>1036740)
                     /locus_tag="ACHE_10364A"
                     /db_xref="GeneID:66977321"
     mRNA            complement(join(<1035599..1035655,1035707..1036188,
                     1036263..>1036740))
                     /locus_tag="ACHE_10364A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278453.1"
                     /db_xref="GeneID:66977321"
     CDS             complement(join(1035599..1035655,1035707..1036188,
                     1036263..1036740))
                     /locus_tag="ACHE_10364A"
                     /note="COG:C;
                     EggNog:ENOG410QDJM;
                     InterPro:IPR039556,IPR015813,IPR040442;
                     PFAM:PF13714;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131484.1"
                     /db_xref="GeneID:66977321"
                     /translation="MSVTYPFQFTTPDQPTFSGDGTTTSLPIQLENVRGRIPSAQASR
                     LRTMMLEAHNDPNKIIAHACSYDGLSSRLVEEAGFPMVFLAGYAVASAFGLPDTGYIA
                     MEDLCRKIQEVVRVTTVPVMADGDTGYGGPMNVKRTVESFAIAGAAGVMIEDQTWPKR
                     CGHTKGKSVVSRGEAYARIQAACDARNEGHDIFILARTDALIHGWDEAMTRAREFKRI
                     GVDAVFVEALPDREAMKRCAEEVDIPIFGNIIEGGKTENLSALDLAQLGYSAVAYPWT
                     LVAAKLKSIRETLDNLKKSMTVSAPPMILGYSEVCEGVGFNWYWDREMRYEYDQDGLV
                     NLRQ"
     gene            <1037292..>1039028
                     /locus_tag="ACHE_10365S"
                     /db_xref="GeneID:66977322"
     mRNA            join(<1037292..1037414,1037468..1037528,1037581..1037752,
                     1037803..1038071,1038121..1038763,1038833..>1039028)
                     /locus_tag="ACHE_10365S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278464.1"
                     /db_xref="GeneID:66977322"
     CDS             join(1037292..1037414,1037468..1037528,1037581..1037752,
                     1037803..1038071,1038121..1038763,1038833..1039028)
                     /locus_tag="ACHE_10365S"
                     /note="COG:G;
                     EggNog:ENOG410QDHJ;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i85-104o110-130i137-157o169-192i204-224o311-328i335-
                     355o367-387i399-419o425-448i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131485.1"
                     /db_xref="GeneID:66977322"
                     /translation="MEAVKDTESQHVENAESIDAEKNAIQRIQVSVSEQAYIRRKFDR
                     RVLPIVCILYVLSYLDRGNVGNAKTAGLENDLGLSDSQWTWVLNSFYICYVLFEWTTI
                     LWKLLPAHIYVAMLCICWGAAAMCTGAVDNMAELIICRCFLGVFEAAFGAGAPYFLSL
                     FYQRYELGFRVSLLLGMSPVANCFASALAYGIIQIRHSIASWRYLFIIEGAPTVIFSV
                     VVFFFLPDSPGTAKFLTETEQTHAVERLQTVDHTAKTRLDRRQVFNGLADYKNYVHTA
                     IHFCCNFSFAGLSNFLPTILNDMGYTSVDAQGLSAPPYFASFLLCIVAAVVSDRWGGR
                     GLVIAFSATAGMVGYLILAAVQDEYKTGVRYLGVWLATCGIFPALSINITWLLNNQGG
                     DSKKSAGMALLAVFGQCSSFVSSAVFPNSEGPIYIRGCAIGCGLTGCIAIMALGLYAK
                     LTLENKKRDRLYGTVSRDVHVDVTRDGDKNPQFRYLT"
     gene            <1040314..>1041644
                     /locus_tag="ACHE_10366S"
                     /db_xref="GeneID:66977323"
     mRNA            join(<1040314..1040851,1040902..>1041644)
                     /locus_tag="ACHE_10366S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278475.1"
                     /db_xref="GeneID:66977323"
     CDS             join(1040314..1040851,1040902..1041644)
                     /locus_tag="ACHE_10366S"
                     /note="COG:S;
                     EggNog:ENOG410QE3U;
                     TransMembrane:3 (i83-104o124-141i271-290o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131486.1"
                     /db_xref="GeneID:66977323"
                     /translation="MHTTPNDRDPPVTTEETPIQERWEQDVVEPTRRSDRMSWMLVSS
                     ALALAHELGVFDSREQSSIANGPDVGNYIKHLEFRRERLPALLFIVSSLLASRIGCPP
                     IMSDTYKPKNLNDILLVDPQWTNFMASWICLTGFVRVIGEKFFFGARDNDHRSIDFKS
                     LEQFKDQLATWNGNHRQTGNFHYDDILHFEYQYLRVFTNSLGVQGIVERVLSDTMPQR
                     TIDGTFISRARQTNISRNEYDFLEEVIDGACAILSRIVSLSQTKLLQYFPIRIFLRMV
                     SSSVFLLKALSLGVRTTKLQESLRLLDQAITALQSNQQDDIHLVSQYASLLQIHVCRL
                     RQTFAKSGRLGNQNNEPNQEEAPDSGKLSQLIAEETPWDPGMIDWANQLDNLGDWLSL
                     PLDPLMAPFGSWDGVSTDLDSGYLDLDFIWNLPP"
     gene            <1041814..>1042319
                     /locus_tag="ACHE_10367S"
                     /db_xref="GeneID:66977324"
     mRNA            join(<1041814..1041822,1041852..>1042319)
                     /locus_tag="ACHE_10367S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278486.1"
                     /db_xref="GeneID:66977324"
     CDS             join(1041814..1041822,1041852..1042319)
                     /locus_tag="ACHE_10367S"
                     /note="COG:C,H;
                     EggNog:ENOG410PMQ3;
                     InterPro:IPR036188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131487.1"
                     /db_xref="GeneID:66977324"
                     /translation="MVALLCALSDDGSWIGAWPLGDGQNASLPVNCSELNTLLWEYTQ
                     ELGIPIDFSAVVDDYFETDNEAGIILTGGQKLTADIVVAADRVGSKSWSLVLGEKDVA
                     ISSEFAYYRAAFPAGEALKNPIIAKQCENQPDRASMHIGPGAVWSWEKLNGKYAIY"
     gene            complement(<1044015..>1045367)
                     /gene="CPC2"
                     /locus_tag="ACHE_10368A"
                     /db_xref="GeneID:66977325"
     mRNA            complement(join(<1044015..1044440,1044631..1044948,
                     1045044..1045170,1045288..>1045367))
                     /gene="CPC2"
                     /locus_tag="ACHE_10368A"
                     /product="cross-pathway control WD-repeat protein cpc2"
                     /transcript_id="XM_043278497.1"
                     /db_xref="GeneID:66977325"
     CDS             complement(join(1044015..1044440,1044631..1044948,
                     1045044..1045170,1045288..1045367))
                     /gene="CPC2"
                     /locus_tag="ACHE_10368A"
                     /note="BUSCO:EOG092636T6;
                     COG:T;
                     EggNog:ENOG410PIEY;
                     InterPro:IPR036322,IPR015943,IPR001680,IPR019775,
                     IPR020472,IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="cross-pathway control WD-repeat protein cpc2"
                     /protein_id="XP_043131488.1"
                     /db_xref="GeneID:66977325"
                     /translation="MAEQLVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWN
                     LTRDEQAYGYPKRSLQGHSHIVSDCVISSDGAYALSASWDKSLRLWELASGATTRTFV
                     GHNNDVLSVSFSADNRQIVSGSRDRSIKLWNTLGDCKYTITDKGHTEWVSCVRFSPNP
                     QNPVIVSAGWDKLVKVWELASCRLQTDHIGHTGYINTVTISPDGSLCASGGKDGTTML
                     WDLNESKHLYSLHAGDEIHALVFSPNRYWLCAATATSITIFDLEKKSKVDELKPEYIE
                     KGKKSREPECVSLAWSADGQTLFAGYTDNKIRAWGVMSRA"
     gene            complement(<1045773..>1046749)
                     /gene="EMI5"
                     /locus_tag="ACHE_10369A"
                     /db_xref="GeneID:66977326"
     mRNA            complement(join(<1045773..1046227,1046290..>1046749))
                     /gene="EMI5"
                     /locus_tag="ACHE_10369A"
                     /product="succinate dehydrogenase assembly factor 2"
                     /transcript_id="XM_043278508.1"
                     /db_xref="GeneID:66977326"
     CDS             complement(join(1045773..1046227,1046290..1046749))
                     /gene="EMI5"
                     /locus_tag="ACHE_10369A"
                     /note="COG:U;
                     EggNog:ENOG410PPQH;
                     InterPro:IPR028882,IPR005631,IPR036714;
                     PFAM:PF03937;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_process: GO:0018293 - protein-FAD linkage [Evidence
                     IEA]"
                     /codon_start=1
                     /product="succinate dehydrogenase assembly factor 2"
                     /protein_id="XP_043131489.1"
                     /db_xref="GeneID:66977326"
                     /translation="MSVPRLITRFLRPSTTTSKLPSTHTFGTTTIRNSDHENDKRLRP
                     DLSTAPEHRKGQTSKPANQAIPNTTSTMTDDYPKVGAKSAPPEMLSSVDPNYKPADPY
                     PGRVEHFTGGRQKSGAQKPELGVGEMEGITFKVEPLKRKGEDSATMRARLLYQSRKRG
                     ILESDLLLSTFADVYLPEMTTKQLEEYDRFLDENDWDIYYWATQDPPAESAATDGQLA
                     EQQTQTQDTVTETWKRTGAKSGEWAQTHGAFRAAYRPVPSRWADSEVLGLLRQHVRDK
                     SAKGFESAKNKKTAGGGLGRMPNIKVFS"
     gene            complement(<1047233..>1048109)
                     /gene="ERV25"
                     /locus_tag="ACHE_10370A"
                     /db_xref="GeneID:66977327"
     mRNA            complement(join(<1047233..1047251,1047326..1047626,
                     1047689..1047815,1047894..>1048109))
                     /gene="ERV25"
                     /locus_tag="ACHE_10370A"
                     /product="vesicle coat component"
                     /transcript_id="XM_043278520.1"
                     /db_xref="GeneID:66977327"
     CDS             complement(join(1047233..1047251,1047326..1047626,
                     1047689..1047815,1047894..1048109))
                     /gene="ERV25"
                     /locus_tag="ACHE_10370A"
                     /note="COG:U;
                     EggNog:ENOG410PKXU;
                     InterPro:IPR015720,IPR009038;
                     PFAM:PF01105;
                     SECRETED:SignalP(1-24);
                     TransMembrane:1 (n8-19c24/25o190-210i)"
                     /codon_start=1
                     /product="vesicle coat component"
                     /protein_id="XP_043131490.1"
                     /db_xref="GeneID:66977327"
                     /translation="MGFTLKSLLRPLLSLLVLVQLTSALRFDLPAVSGHSSKNERCIR
                     NFVLKDQLVVVTAIVDGNRGDGQMVNMHIKDALGNDHGRPKDVAGETRQAFTSPADIA
                     FDVCFENQLVSHNAVTNPYRSIELDIDIGADARDWSSIQAQEKLKPVETELRRIEELV
                     AEVVNEMEYLRAREQKLRDTNESTNERVKWFAFGTMGMLVGLGAWQVVYLRAYFRSKH
                     LI"
     gene            complement(<1048823..>1052482)
                     /locus_tag="ACHE_10371A"
                     /db_xref="GeneID:66977328"
     mRNA            complement(<1048823..>1052482)
                     /locus_tag="ACHE_10371A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278531.1"
                     /db_xref="GeneID:66977328"
     CDS             complement(1048823..1052482)
                     /locus_tag="ACHE_10371A"
                     /note="COG:S;
                     EggNog:ENOG410PGR2;
                     InterPro:IPR016641;
                     go_component: GO:0005854 - nascent polypeptide-associated
                     complex [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131491.1"
                     /db_xref="GeneID:66977328"
                     /translation="MPPLSKTPEPFDFGSVSRSRSTSISSDGQLPRISLLLPPPVTPQ
                     PAFIASSAASQIITADQEFNTADFVADDRDGEENGDSASALVMPEALSHLNGFLDHLL
                     FNILAVSKSTQLSSIRPAVAEVLKPRLAKEVVSAADDELSEYMGGEGDEHLEFRGGQQ
                     PTGEFDLVRSWKRTRLRCMVYTRLGDMEEDEEDEHIVRDGLAETETAPRRFASHVDNI
                     TPAAAIFLTSIIEHLGEQALIIAGETARSRLSTKLSLEHDETTESGAERGRIDRLVVE
                     DYDMEKLAMNATLGRLWRTWRKRMRTPNLSRTLSRESFRRRGIASTLASSRKSSVVTI
                     DELPARSVTSFETTEAHEEDIDPAFIPLPMSEHDIKEISIPGFSAEPEGEIRTMEAVV
                     AHKVRPRSLMVLPSPLPRSHSVASSPVTAPESRPKLNRHARSRSLPNNSYFPLDVVAA
                     QEEAASPTDEGATKQEDVQDIVSPTPSEERRRLETMYEQDEPVDPESQTGLAISTPTA
                     TEFSTERRQSEGAKTPTARHSIIAPSLSGASVEVEVSRPGSAQTAYLNEETQRGITEV
                     IEARGTSRPTSTIQRPRRKASDDSKKSLSASASSASGMPEEVKVPIPTQGTDADSTDA
                     QKVADDASKANDAKKTVEKTWFALDDEDDDDGAAPAPSVPKRPSAERAGRSSPAISRP
                     NRASVQRIPAQVSAHSKSDSNSEKRPPTAGSSSSQVSNKLKGMVGRSPRGETASLRVR
                     SSSETSRPSSGSRNSPGLDQLIQSDETIHYTLTPKNMREMEEPDSPRWKVNRSSTADL
                     ADFLKTTGPPGDQGPKVNSKSLARPVSKFQPIAAASEVLSSPKDAKPAADSTRDFASS
                     VKSSGPSGPTIVREATKTPDTASKPTRRFSDATELSKKFIRPDSGLSNSTRNTTGPRL
                     QARSAVAPRGEQTSELIDFIREGPPTPGSHRISRSVAPFRNTMDSDDMNNSASRASGE
                     STPNGSMATKSHTSLGSRTGLLDSSNRANAKADAPAPTSASSGGAKAFDGDRMPARKQ
                     RRVRDPYAIDDDDDEELEELLRLEEKPQRKEESLIDFLRSEPPPDFDSTPQPLVTTNV
                     TAASSKSPSSLTSASAMKARFLRNNTEKAPISKTSKSSLRSTQTDPRPSGQSDYATKV
                     GMERNGGNKPAAVHVTHGTAMPKRHTETSDLADFLKNTGPPEPPRVPSAFATSKAKDS
                     NGISRLFVRRKKVEA"
     gene            complement(<1055455..>1056531)
                     /locus_tag="ACHE_10372A"
                     /db_xref="GeneID:66977329"
     mRNA            complement(<1055455..>1056531)
                     /locus_tag="ACHE_10372A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278542.1"
                     /db_xref="GeneID:66977329"
     CDS             complement(1055455..1056531)
                     /locus_tag="ACHE_10372A"
                     /note="COG:S;
                     EggNog:ENOG410PZ72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131492.1"
                     /db_xref="GeneID:66977329"
                     /translation="MGEPTTLSRKSWESLSSAFSNLEVSLSQDSSYASDEISVVSSNP
                     TTVDTSSQDPSSESKLRPYLKSILKKPETELEEENAQSESGYGTDAFDYEYETMSEGE
                     GEEEELYEVSICWDTDDAMSEIVSGDEDGMFDDSFIAFESMVRFDPNVQYIEAPELEE
                     DEGPETGLTCHELMEMARSSGSLQTFDGEKPVEIKLTEGHWRNAFDPEEYPGDMVDVD
                     RQLFVAYVNGIKGLADSQYKGRLRALVDDIRLGQAETPYLETNSSDGVYLDHALNHVI
                     GVFRNLLVPNEFEELVALSSQKMSLTPQTKALESHNASLMDRIQRLLVERLAQGNVHV
                     EADELSFFAGGVTYALENWKADQH"
     gene            <1059419..>1061167
                     /locus_tag="ACHE_10373S"
                     /db_xref="GeneID:66977330"
     mRNA            <1059419..>1061167
                     /locus_tag="ACHE_10373S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278553.1"
                     /db_xref="GeneID:66977330"
     CDS             1059419..1061167
                     /locus_tag="ACHE_10373S"
                     /note="COG:S;
                     EggNog:ENOG410PS4B;
                     InterPro:IPR040112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131493.1"
                     /db_xref="GeneID:66977330"
                     /translation="MFAQQFDHSFNDIFNQYVDVESSSADGNKDVSFPSGDFDQLFPL
                     DSLSSDCGALSSPTISPSNKRRQSPQPWSTPTQDLWSLPQETGAASSSSVDQGTFSFH
                     DTVQPSAVSSLSLNLDAQSSSSSSRPAAAHGLSSTSLSTPPETPRKKVCTGSGITTPK
                     SIRHHQDTGDRRRLLRKQSFSPSLTRSSRAQKARMAYSDASAPRFHNFSLHSTDDRLP
                     LSPPPTDLLAQHENLSADNATNLNGSSDRFSGDPAEMPQQYDSSIFNQSPAISMPSPS
                     ASALARRQQKYMSQPNSTTLTSSPPSADEVFSSPHSSGSQSLSSWYSDSLAPSAFSFT
                     PDLNHDAQQWWSPMASRIAQQHQSSYQPMLEAPTPQRPIANHDQHNDILQGGLMIQFD
                     PSFDMPAPAEPSFPPSTMSSSAPAATQESQTYHPVSNTPQKYINPSFAASTPQIQHHT
                     RSPSLSPKNNGASTSPKSGSTTATATPRTGTVMRTPHRRSYERKMSAPSNTPKSVKTT
                     SPRGSNKSVSVSFVNFTPSDSKKILTGVAPSGSSKTKARREQEARDRRRKLSEAALKA
                     VRNAGGDIDALEAVLC"
     gene            complement(<1062488..>1063182)
                     /locus_tag="ACHE_10374A"
                     /db_xref="GeneID:66977331"
     mRNA            complement(join(<1062488..1062858,1062922..1063038,
                     1063110..>1063182))
                     /locus_tag="ACHE_10374A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278564.1"
                     /db_xref="GeneID:66977331"
     CDS             complement(join(1062488..1062858,1062922..1063038,
                     1063110..1063182))
                     /locus_tag="ACHE_10374A"
                     /note="COG:S;
                     EggNog:ENOG410PQ2I;
                     InterPro:IPR007763;
                     PFAM:PF05071;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0008137 - NADH dehydrogenase (ubiquinone)
                     activity [Evidence IEA];
                     go_function: GO:0009055 - electron transfer activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131494.1"
                     /db_xref="GeneID:66977331"
                     /translation="MSPINSLWFKWKGLRLPWRRSFLAGSDLSGNTYWEFKESLSASR
                     LRRIVKYNPKTHYADIKVSPQWHQWLRYVRADPPSIQEQQQDVVRQIQIKHLARLADE
                     RWASKPSYLDKPQTQQPKPALRTSDPTLRGPEENAPSSQSEGTESTTEQVRRYAEEND
                     PWAKAKAGNPGDSWQPEPWTPTAARK"
     gene            <1063624..>1065534
                     /locus_tag="ACHE_10375S"
                     /db_xref="GeneID:66977332"
     mRNA            join(<1063624..1063790,1063860..>1065534)
                     /locus_tag="ACHE_10375S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278575.1"
                     /db_xref="GeneID:66977332"
     CDS             join(1063624..1063790,1063860..1065534)
                     /locus_tag="ACHE_10375S"
                     /note="COG:Z;
                     EggNog:ENOG410PGZF;
                     InterPro:IPR003096,IPR001715,IPR036872;
                     PFAM:PF00307;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131495.1"
                     /db_xref="GeneID:66977332"
                     /translation="MASVTSLDKDLRSLRLSRYTPQAAAEVRDWIEEVLQEQLAPGDL
                     LDALKDGVALCKLINLAVSPGVKFKQSSMPFVQMENISHFLRACQIPPLSLPPHDMFL
                     TVDLYEGKDPAQVLQCIMSFSRRANAVQPSKFRRTIGPQVNKGSGLSPNVTGSSQGPT
                     TPSRFRGASPSSSGPSTPAKSPNVSSWSRKTDEISTAPAWNIHQYGYMGGADQGNQGV
                     VFGGRRQITTAAPVVPSLAEKEKRRREAEARALVEKQEAEQTRQRQREAEEEQARLEE
                     QRRWDEQTDRLREQERRKVEEEKKRWDEEKRQWEEEEQRRLNEEREAEEKFEQERQRR
                     RSMADNRLNGQFLSQYQASQAIPAKAAVPPSAESQESQRVKELERELELARQRELQYQ
                     HERGDFKKKEAEPPRPRPVPPKPSYDFSSLEQERRMLRTEWHKNQDETSAPPTPPRPL
                     PDPTAAQKSAQTSPRPLPDPVAYTNARENRVDRFLASNKPPVGPKPATHRPADYSTTA
                     EVDAENSRREAAQQKTKAGGWASKSLLEREMERERERQREWEDNQKETEEAAAKGLAD
                     PSQGSGPGGAWNVFQYGYMGGDNQSRGGPGLSNWGARRQIIGPRPPP"
     gene            complement(<1065762..>1067497)
                     /locus_tag="ACHE_10376A"
                     /db_xref="GeneID:66977333"
     mRNA            complement(join(<1065762..1067338,1067395..>1067497))
                     /locus_tag="ACHE_10376A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278586.1"
                     /db_xref="GeneID:66977333"
     CDS             complement(join(1065762..1067338,1067395..1067497))
                     /locus_tag="ACHE_10376A"
                     /note="COG:S;
                     EggNog:ENOG410PM21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131496.1"
                     /db_xref="GeneID:66977333"
                     /translation="MAVENGEETPSYRASRPVPFELVQHSGIFFEEKLYTQALNLLLN
                     IITSGTVASGPVFVPSPPLLAVAATFLVHPSTTTRARSSEEQEAPSAALRLLRLTNTL
                     VGPIAARFDNAFAFTHFEASRHGGIRRRASEDEGTSQNEMLRNEWKLLNTELGQSSAV
                     WSRAEDFWHAVGWAFNCSVLHPERWERWQVWLQFMCEVLEDDWNERKRHVEREVSGAG
                     NGKLKKRLRQNILQQSLIFRYIDGSSGSYGRNRRILRAIFADGTSGSVNEFREVFRNE
                     LKQLKRDQENIKKREAEVNIDEEQYGDYLTKDDEDESEEGDGETDKPTTTERRSKRTR
                     RGTRNTIAEQQPTATFTTNNTLYSHGTLSLLGGLPSLALRQRLLHLLSAVSESLPDIF
                     TTLEELYHLFIENIRHLPLPIYQSFVSPHVLPYFSAAAQTTLCEFLLFRLRESTAPET
                     EDEYLSQTKLEQCFLPYAASTASVVDNTKMALALEALVMLLAESEMLKVTPELRTAVE
                     DGIMARAERAQEVKRNQSSKQVEEIEWCWLIESGERLLFMINELVPSMQAS"
     gene            1067806..1067876
                     /locus_tag="ACHE_t10007S"
                     /db_xref="GeneID:66987313"
     tRNA            1067806..1067876
                     /locus_tag="ACHE_t10007S"
                     /product="tRNA-His"
                     /db_xref="GeneID:66987313"
     gene            complement(<1068138..>1069272)
                     /locus_tag="ACHE_10377A"
                     /db_xref="GeneID:66977334"
     mRNA            complement(join(<1068138..1068404,1068456..1068788,
                     1068846..1069130,1069180..>1069272))
                     /locus_tag="ACHE_10377A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278597.1"
                     /db_xref="GeneID:66977334"
     CDS             complement(join(1068138..1068404,1068456..1068788,
                     1068846..1069130,1069180..1069272))
                     /locus_tag="ACHE_10377A"
                     /note="COG:S;
                     EggNog:ENOG410PVUI;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF13460,PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131497.1"
                     /db_xref="GeneID:66977334"
                     /translation="MSTTKVAIVGASGESGQSIVNALLDSATPRYEVIALTRPQSIQK
                     PVNTKLQEHGVKVVSADLSGPSDELVGLLTGIDVVISAIYFDNLDEEIPLANAAKAAG
                     VKRFVQSALMIVIPPKGVVDFREKKEDNFHYFQKIRLPYTYIDAGWWYQLTLPRLPSG
                     RIDHLLSPAHKDLPIGLDGSVPTALADLRDVGRYVARVIADPRTLNKRVHVYSELYTQ
                     NKVYEVVEGLSGEKLPRGYVSEKEASTNIDNARAKLQQNPTEIDAKLAFIANQLFYSW
                     GIRGDNTPENAEYLGYLNGKDLYPDFEYVTFEDYVKEVLDGKVKGVYQG"
     gene            <1069851..>1070635
                     /locus_tag="ACHE_10378S"
                     /db_xref="GeneID:66977335"
     mRNA            join(<1069851..1069895,1069961..>1070635)
                     /locus_tag="ACHE_10378S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278608.1"
                     /db_xref="GeneID:66977335"
     CDS             join(1069851..1069895,1069961..1070635)
                     /locus_tag="ACHE_10378S"
                     /note="COG:G,M;
                     EggNog:ENOG410PKT0;
                     InterPro:IPR036291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131498.1"
                     /db_xref="GeneID:66977335"
                     /translation="MLISYASVEVEYRFEVHKTAINAARSSSVSHIFYSSLAFAGNLS
                     PTSVASVMGTHLLTEQYLSSLPAQGPATYTAIREGLYSEPFPVYTAWFDIHNPVEEIT
                     TPHSGDGPGIRWAKTDELGEATAKMIVSYVQSSGDFLWLNKAVLLSGPQVLSLKETAD
                     ILGRVTRKDVRIKEISAIEYAELPFKDKYWYRGVNLLNDYTLCWEAFRRRETAVVSPL
                     LGEILGKEPGDFETTVRGLLH"
     gene            complement(<1071322..>1072008)
                     /gene="ORM1"
                     /locus_tag="ACHE_10379A"
                     /db_xref="GeneID:66977336"
     mRNA            complement(join(<1071322..1071372,1071431..1071789,
                     1071876..>1072008))
                     /gene="ORM1"
                     /locus_tag="ACHE_10379A"
                     /product="sphingolipid homeostasis protein orm1"
                     /transcript_id="XM_043278619.1"
                     /db_xref="GeneID:66977336"
     CDS             complement(join(1071322..1071372,1071431..1071789,
                     1071876..1072008))
                     /gene="ORM1"
                     /locus_tag="ACHE_10379A"
                     /note="BUSCO:EOG09264F60;
                     COG:S;
                     EggNog:ENOG410PI6A;
                     InterPro:IPR007203;
                     PFAM:PF04061;
                     TransMembrane:2 (i124-140o146-164i);
                     go_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="sphingolipid homeostasis protein orm1"
                     /protein_id="XP_043131499.1"
                     /db_xref="GeneID:66977336"
                     /translation="MDQTKSGRRRRSSSIIYQEPAESLEHTSDQAALPNLNANWVNAK
                     GAWTIHFVLIVALKIFYDIIPGVSQETSWTLTNISYMFGSFIMFHWVRGIPFEFNAGA
                     YDNLNMWEQIDNGDQYTPTKKFLLCVPIVLFLLSTHYTHYDLTYFTINFLATLGVVIP
                     KLPFSHRLRIGFLSGDPEEL"
     gene            <1072964..>1074876
                     /locus_tag="ACHE_10380S"
                     /db_xref="GeneID:66977337"
     mRNA            join(<1072964..1073947,1073998..>1074876)
                     /locus_tag="ACHE_10380S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278631.1"
                     /db_xref="GeneID:66977337"
     CDS             join(1072964..1073947,1073998..1074876)
                     /locus_tag="ACHE_10380S"
                     /note="COG:S;
                     EggNog:ENOG410QEDP;
                     InterPro:IPR001878;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131500.1"
                     /db_xref="GeneID:66977337"
                     /translation="MPNSSGEENDSRTASVGLQRTRAQNQDSHPNKRQRRTRGNSGNN
                     DVRDFVPQGGTFSAKPLEVDPDDTSSSGSDSDSGSNWSDANPPAANPYAGTTSQAINW
                     NQGNKRAVRTTLGGRGKANNNKRPEPQSQREPEKKLDAQFDAVNGAYWRSRSESVSIG
                     GGDNGKKDECKDMEEGEVNEDTTEAPALDTSGDSDDSESLDSEADDSILLNIGQRQNG
                     HATTDENDEDDDYDPEMQPFVGVVISNGTTKTQKGTQDGTAKDPSKKEAICIFTQRYP
                     SPPAVMTDLVQEDKDIQTRFMYWTESKDPQIPISCIECMQEGHIAQVCPSKECTHCGA
                     WDKHDSNFCPTWRRCQRCRERGHDEAQCSSLLKGSASEVPCDLCGSQSHLELDCDYMW
                     KLPLRDPSSGPVLVSISCSHCTSNHHLAGDCPSLPKPLSSSSWTLNGIDPNMVTNINS
                     VIPGRGRPGPGPVARGRGGMKIRGRAERSPTPDSDEDDGMFTRPNQRPPPPGRGGGRG
                     NIRIGSGIGRGKNLGPGGYRDQNDSFGDRSRQRSMSPVGRPGPGSGRGRGSRDNWNVR
                     SRSPPRRGRPPPPPARGGRGRGGGGGKRGGGGGGGDAYRPMPSAAKKNWDRYRF"
     gene            complement(<1075006..>1076130)
                     /locus_tag="ACHE_10381A"
                     /db_xref="GeneID:66977338"
     mRNA            complement(join(<1075006..1075215,1075270..1075438,
                     1075494..1075703,1075779..1075811,1075862..>1076130))
                     /locus_tag="ACHE_10381A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278642.1"
                     /db_xref="GeneID:66977338"
     CDS             complement(join(1075006..1075215,1075270..1075438,
                     1075494..1075703,1075779..1075811,1075862..1076130))
                     /locus_tag="ACHE_10381A"
                     /note="COG:S;
                     EggNog:ENOG410PKDS;
                     InterPro:IPR041492,IPR006439,IPR036412,IPR023214;
                     PFAM:PF13242,PF13419;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131501.1"
                     /db_xref="GeneID:66977338"
                     /translation="MDLFFHIQRQPNTILTTSMRLLPSPPFQPLLRFNTLSRAISTKV
                     MSSPSIPIPSYPLRQRRFAPLKPERKSESDAPALEGIVFDVDGTLCLPQHYMFSEMRS
                     ALGIDKSIDILHHIRDLPTPEARLAAADKIKAIEREAMSSQQPQPGLVQLMDYLQARG
                     VRRALCTRNFETPVLHLIQTHIPAHEKDFLPIITRETPDLLPKPDPAGILHIAQAWKV
                     GARAEHLIMVGDSIDDMTAGHMAGAATVLLLNEKNGWLKDHEHTDLSINRLDNLVDIL
                     ENGFVGHRGGDKPATSDREG"
     gene            <1076442..>1077761
                     /locus_tag="ACHE_10382S"
                     /db_xref="GeneID:66977339"
     mRNA            <1076442..>1077761
                     /locus_tag="ACHE_10382S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278653.1"
                     /db_xref="GeneID:66977339"
     CDS             1076442..1077761
                     /locus_tag="ACHE_10382S"
                     /note="COG:S;
                     EggNog:ENOG410Q2EA;
                     TransMembrane:1 (o36-56i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131502.1"
                     /db_xref="GeneID:66977339"
                     /translation="MSLPTTTHDLRRLPETQQPQPTTDNYYNYSNYSNSITITFTQLF
                     TLLGALLTLKFYHGLSTLSHGKRPAHQSIEELERRIVALFQAIVPEGLYQVNSRGSNS
                     GSGSDAASRHSFPCDNGGNKSGNGSGKRNGNGSAARSMASASTHRLQPGNAMIDLDNA
                     TTEEGSAHSPLMRVTTNIAPAIRMSQGLSRMSGEQLVRTATAGTTITESIPEMSLDNI
                     HGDNRQSFASCQAYCGSMSSAAPPPVSAYAAYRPGTPSFCPPPQNTPESGTPAITNLD
                     RFILQVRPPRSTFIGRFPTDEDGWSPIVSQRELTNESEEESPTNRLNKWPGVEQEQSR
                     SSSHEEESPKNELVKWRFGKEDVDDVHSSIYDAEGVETDSNSDEDGNEDDDGDGEGGL
                     KLVLVRSAESYPGKFPVSEGLPLEALATAPICLRGKAQTSVRPLSEI"
     gene            complement(<1078443..>1083354)
                     /locus_tag="ACHE_10383A"
                     /db_xref="GeneID:66977340"
     mRNA            complement(join(<1078443..1078580,1078642..1079931,
                     1079983..>1083354))
                     /locus_tag="ACHE_10383A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278664.1"
                     /db_xref="GeneID:66977340"
     CDS             complement(join(1078443..1078580,1078642..1079931,
                     1079983..1083354))
                     /locus_tag="ACHE_10383A"
                     /note="COG:S;
                     EggNog:ENOG410PJ7B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131503.1"
                     /db_xref="GeneID:66977340"
                     /translation="MGVDTRKPIMPAASDSLVETSGGSMTGTDLATDLSRRTDKTSYS
                     VPDDGSPVTIPTRRRNRDSRRDDPSKLSRTSHNSQTSLLIEYFEGGTGAGNIVSRPSV
                     RVRVTPSSKKLKDQRDHHLQITESNGNRGPVYARRISLGSLPKSRKHLELDDLDEQGL
                     SDDENHHGSRPLEIEFENREQAEEFLNNPDQESVLSSLSRENRHIQPAMSDISSMPTD
                     SLLEGPTSSLHHKRSQSLEPEADNKELLKTPRRKRSRSLSTERIAHRVAEKLTSGPQE
                     RERDDDHSSNPRSLLDPDTPAARRRRQRAQRRQENDDSVYNPAESSLLSASAVSANRR
                     SNDQYSFLSQNSNKSTFNNNPKLLETVEDAIRRLILPELKELKKDQKVMHNTSKFDRD
                     MNASMQSSTQTRDGLGRRLSKHASAPDIIKPKVLLKKDSKNEGTTLLGDDPAPTKNPE
                     RKPSKESSQSKGTEADPTYVKWGLRPEMNENDKLRRAKSKGLRDAEKAGRVGTALTAA
                     ALRRHDSKSSMDTNESNRQSPSPTKERAGNGNETELVFQKHNVPPMPLRSALESDMTR
                     DSLVSHRTAETESIVPQKTRFQEVARGSPVQSPSPLSRTPNRTPLDTRHELDIRHPNK
                     STHNVSVESVSDEEDRASFGGHDRGDSEDAAAAGDIAAAAVANLLDTQADPSRRRALS
                     PIQSVASEQSDLRPPPPPPPPQVRPSPGQQSGGDKELKPRLSIDSLSSAPSTDLARST
                     RTKPSGLSLNKRHESEQDSSRQPRAEDWDEQSDLYSRRHSAADTSSLDPKRMTNHTDD
                     SEIDYMDKVRRGQRVSQGNGANPHFVHPAPVESAVASLLEPSVVERYTQVFSELTNRS
                     KSDLSKRQEQRSPETRGPQPRSPQPTAQQPQETTTPGSRQGSPLKQRQDAGSPDATSF
                     GKRMGVSSPPQSIAQSMDEQAELGHSRSFDPGDDAQIPEAGDAQDSESEIDTNPSIIQ
                     GPRAPSQNQDYWPYDERSQSKEDVQDDQASKGLGLDEELSYDPGYYPEGAYAPEGYFD
                     QSYDQVPGTPPAVKDEGYASGAHPLSPSVGTPKSEGKGLGGMDTLGLFDSPSGAEHQR
                     NLSGYSHGVGSPMYDSATGQGVDRIQSKDIIALMDHLTVRDAQRNARDTEILVSLVRS
                     AAEMRNSFEDMKKYIAYQDGLIMEANDKQHERTFRAISGPRPQPPSARSRQLAAAAEG
                     EEDMRSKRKNVFKRALKGLSLKSGNDLTRIEDMLEQLLDDVDALRAQQDDHFGRSGRG
                     SFDHDGYETEGEDGTSPVDQPGRPSTGGSRTIHNQPSRPSTVPEEDEEDDYDERAEFL
                     SPKLPPQESSKPPMASGALNGEATPPKQNDKAQKRKSGGFLPKFIRNTLQNKKERSDT
                     SLAPYGAYKTDDYYDPQGDDRIRSNTNLEQQQQQEDRPPSPLIPSQVSEAPKYRAHRD
                     SMDLQHPQPRQGPTGRYQTQLETQAQVYGFHNPQSEQWGSNSSFSGGNSSNVQKRYSG
                     YSGGSRLSPISDTGYSEASSRRTGPPRPPKVRDDGPLVPERPPKVKEDDERSYADRVV
                     SRSSGMRSSPVPSRKPTGPRPLNSGSQYSRTSRYRGASPDQVDDLDY"
     gene            complement(<1084780..>1085325)
                     /locus_tag="ACHE_10384A"
                     /db_xref="GeneID:66977341"
     mRNA            complement(<1084780..>1085325)
                     /locus_tag="ACHE_10384A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278675.1"
                     /db_xref="GeneID:66977341"
     CDS             complement(1084780..1085325)
                     /locus_tag="ACHE_10384A"
                     /note="COG:E;
                     EggNog:ENOG410Q9UP;
                     InterPro:IPR008794;
                     PFAM:PF05544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131504.1"
                     /db_xref="GeneID:66977341"
                     /translation="MHYAIIDARSVGLEIKNANGPRLIEVGERIKQAVRKTYTPVHPK
                     NDKIRQVTIVEFTEPVRQASDGTKMAMNTVVVSPGRFDRCPCGTGSCARLALLHARGG
                     LHVGEKLAHQSIIGSTFDCHIRGTTTVGGFDAALPTVKGNAWITGFKYMSLDPSDPFP
                     TGFRVGDQWHMPEPSGERIVE"
     gene            complement(<1085530..>1085844)
                     /locus_tag="ACHE_10385A"
                     /db_xref="GeneID:66977342"
     mRNA            complement(<1085530..>1085844)
                     /locus_tag="ACHE_10385A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278686.1"
                     /db_xref="GeneID:66977342"
     CDS             complement(1085530..1085844)
                     /locus_tag="ACHE_10385A"
                     /note="InterPro:IPR008794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131505.1"
                     /db_xref="GeneID:66977342"
                     /translation="MRLTRTISIVGVHCAGKVGDVIVGGVFNPPHCKTMYEKLLYFQN
                     EADDIRKFLMNEPRSRPANVHESCSVSLRSSRRRRIAHYGKRRIPAYVRGKHHLYGNG
                     VA"
     gene            <1086855..>1088720
                     /locus_tag="ACHE_10386S"
                     /db_xref="GeneID:66977343"
     mRNA            join(<1086855..1086879,1086928..1087469,1087529..1087802,
                     1087856..1088034,1088089..1088272,1088326..>1088720)
                     /locus_tag="ACHE_10386S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278697.1"
                     /db_xref="GeneID:66977343"
     CDS             join(1086855..1086879,1086928..1087469,1087529..1087802,
                     1087856..1088034,1088089..1088272,1088326..1088720)
                     /locus_tag="ACHE_10386S"
                     /note="COG:S;
                     EggNog:ENOG410PMHC;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131506.1"
                     /db_xref="GeneID:66977343"
                     /translation="MSTGFGRTFYLGTSSNWSFARKVLSMIHEHLYDSPLPTDRRHFD
                     ETAYELGWDGLRTSMSTEVPMVPTLDFSMYLLNAVKFHVGQLFHIFDELSFMEGLYAY
                     HENPVHRTSADPLWYIQYLLILAFGKAFTVQRGPSTRPAGCEFFVKALQLLPDLTHLN
                     QYPMISTEILCCVALYLQSLDFRSSAYGFIGQAVRLSLASGMHTNMPIDHLGGEALQR
                     RRRIWWTVYILDRQMTSLMGLPQSIEDNQIYHELPLFPESPHKVTALSIEIKMCQIIA
                     DVNRTVYGVDGRLNRKFLSSTKTALGNTANLDTRLQESHRLGLDESSPNGVSRLSAHL
                     HLLYHQCIVLATRPLLFCFLKMRLQSLDPNAKPLTSSAIVCKLLQVCVESAKQMLNIL
                     VILQKQTLLDSFLPFDLESTFVSALVLLLAPFVDPYLLDDSLPWLQKAYDVLDEMIYR
                     GNQIAAFRRSDLEQLHDLLRESSGQCGRREEMISHMSLLYSEESQFGDAADLTTADIM
                     AVAESIDSVDVDWMAHAVTENCIW"
     gene            complement(<1088808..>1089935)
                     /locus_tag="ACHE_10387A"
                     /db_xref="GeneID:66977344"
     mRNA            complement(<1088808..>1089935)
                     /locus_tag="ACHE_10387A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278708.1"
                     /db_xref="GeneID:66977344"
     CDS             complement(1088808..1089935)
                     /locus_tag="ACHE_10387A"
                     /note="COG:E;
                     EggNog:ENOG410PHTM;
                     InterPro:IPR036291,IPR003462;
                     PFAM:PF02423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131507.1"
                     /db_xref="GeneID:66977344"
                     /translation="MTSIQVLDNPTMYNLLINLSKEESLTFREIIEHTLESFSVNGER
                     QYQPPPSIVNRPNGQNTLFRPFTSNTCIGTKITVEPGPDGQGRKSPLHGAIVLTDSKG
                     NPTGLLSSDEVTGYRTSMNAMVPFSWRRHVDHIVIFGAGMQALWHTRLILTLRGEQVR
                     SITYVSPSKERVDGLVATVSEDNRVRWKSGCSFHYINSTAFNAQWEIESCLRNADCIF
                     CTTSSKKPLFPASYLTKTEDGRRRPLISAIGSWQPDMIELDPSLLHDAVTASYGYNPL
                     TGKEGRGVIIIDDREFGIESCGELVQSGIAANDVVELGEIIALRKGVSSTKEHAEKMN
                     WFFSEGFVVYKSVGVSLTDLTVGDAILDLYKKRQQTPLDSS"
     gene            complement(<1090611..>1092858)
                     /locus_tag="ACHE_10388A"
                     /db_xref="GeneID:66977345"
     mRNA            complement(join(<1090611..1092433,1092489..>1092858))
                     /locus_tag="ACHE_10388A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278719.1"
                     /db_xref="GeneID:66977345"
     CDS             complement(join(1090611..1092433,1092489..1092858))
                     /locus_tag="ACHE_10388A"
                     /note="COG:U;
                     EggNog:ENOG410PHBS;
                     InterPro:IPR032800,IPR010308,IPR040241;
                     PFAM:PF06011,PF14558;
                     SECRETED:SignalP(1-21);
                     TransMembrane:7
                     (n3-16c21/22o326-348i380-400o406-428i469-489o495-515i527-
                     548o560-586i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131508.1"
                     /db_xref="GeneID:66977345"
                     /translation="MRLISLFTWFFVALLAQFGGATKLIESNALSLCQDSNNFTATYF
                     SVTFTPANRSLAFAFDGVAAISGKVKAELVLTAYGYTALRKELDPCEMGLAGLCPMQT
                     GPIDVPRANLDLPENVVSQIPSIAYTVPDLDANVRIYINSTDTGESISCLEARLSNGQ
                     TVYQKGVGWTTAVISGLGLTASAITSGLGHSNTAAHVAANALSLFGFMQSQALFGMVA
                     VHMPPIVESWTQNFQWSMGIIRVGFLQTICTWYQRSTGGTPSTVLSELSTTSVQVLKR
                     SVDPSLALMKRAAEPLLKREAESQKATQKTTTVRGIKRVGFEAGIEETNIFLTGLIFF
                     VFFVAVVMIIVAIFKGVCELLAKNGKMNSDKFSDFRNGWKVVARGILFRLTLIGFPQM
                     VVLCLWELTQRDSVAEIILAIIMIVSMVAALGWASVKVIRLAKRSITMHRNPAYILYS
                     DPTCLNKWGFLYVQYRATAYYFVIPVLVYILVKGMFIGLSQPAPIVQTVAFVIIEAAM
                     LIAVSVLRPWMDKKTNIYNITIQAINFLNAIFLLFFAQVFNQPGLVTGVMGVVFFVYN
                     AVFALVLLILVLIASIYAIVSKNPDTRYQPMRDDRGSFIKSQTQLTTELDALGATARG
                     DAKGSAYNTSPFEDDDSFSSGNGASVGRQNLEPPHSATSPHNATGGVPVSPVDPSVPL
                     FPSDNRGPPPSYNGMRSPSPVPRGYNASPFQRAQNNASPWQRGAGYDH"
     gene            <1095492..>1097533
                     /gene="HAS1"
                     /locus_tag="ACHE_10389S"
                     /db_xref="GeneID:66977346"
     mRNA            join(<1095492..1096131,1096179..1096900,1096956..1097216,
                     1097282..>1097533)
                     /gene="HAS1"
                     /locus_tag="ACHE_10389S"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_043278730.1"
                     /db_xref="GeneID:66977346"
     CDS             join(1095492..1096131,1096179..1096900,1096956..1097216,
                     1097282..1097533)
                     /gene="HAS1"
                     /locus_tag="ACHE_10389S"
                     /note="BUSCO:EOG09261F73;
                     COG:A;
                     EggNog:ENOG410PH4U;
                     InterPro:IPR025313,IPR027417,IPR001650,IPR014014,
                     IPR014001,IPR011545,IPR000629;
                     PFAM:PF00270,PF00271,PF13959;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_043131509.1"
                     /db_xref="GeneID:66977346"
                     /translation="MAKEIEKKAEPVDSAKSIAKKRKRKHARAGAGAEEETPKQQAAI
                     ANGNREVSDSDNENENEQKKTFSKMNATKEKELSRKRKVSDSPSEEEDDEEKSQSEND
                     DDDSDEEEDKGDEEAADDKAGADLPSVDAVRLPQTEGAPQKFSDLNLSDKTMKAIGDM
                     GFHTMTEIQQRTIAPLLAGRDVLGAAKTGSGKTLAFLTPAVEMLSALRFKPRNGTGVI
                     VVSPTRELALQIFGVARELMAHHSQTYGIVIGGANRRAEAEKLTKGVNLLIATPGRLL
                     DHLQNTQGFVFKNLKTLVIDEADRILEVGFEDEMRQIVKILPAEDRQTMLFSATQTTK
                     VEDLARISLRPGPLYINVDHRKEHSTVEGLEQGYVICEADKRFLLLFSFLKRNLKKKI
                     IVFFSSCNCVKYHAELLNYIDLPVLELHGQQKQQKRTNTFFEFCNAKQGTLICTDVAA
                     RGLDIPAVDWIIQFDPPDDTRDYIHRVGRTARGKEGKGRSLMFLQPSEVGFLKHLKEA
                     RVPVVEFDFPASKIVNVQSQLEKLIGQNYYLNKSAKDGYRAYLQAYASHSLRSVFDVH
                     KLDLVKVAKGFGFSTPPRIDIQLGSSLGRDKKQQQGRRNYGSQPNGKGLKFKRQRRDD
                     "
     gene            complement(<1097674..>1098950)
                     /locus_tag="ACHE_10390A"
                     /db_xref="GeneID:66977347"
     mRNA            complement(join(<1097674..1097882,1097938..1098521,
                     1098581..1098703,1098756..1098778,1098831..>1098950))
                     /locus_tag="ACHE_10390A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278742.1"
                     /db_xref="GeneID:66977347"
     CDS             complement(join(1097674..1097882,1097938..1098521,
                     1098581..1098703,1098756..1098778,1098831..1098950))
                     /locus_tag="ACHE_10390A"
                     /note="COG:Q;
                     EggNog:ENOG410PHHZ;
                     InterPro:IPR036291,IPR020843,IPR013154,IPR011032;
                     PFAM:PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131510.1"
                     /db_xref="GeneID:66977347"
                     /translation="MTNRAAWIVSEKAKPLKVDDAPLPKPEPGTLVIKNHAAAVNPID
                     WKIQNYEYSAYVKNYPFILGTDVAGTVDEVGEGVTRFQKGDRVISHVPSLLTANPIHS
                     GYQLYPHAYSSLTSKIPDSLSFGQSVVLPLAISTAAAGLYLPGYLSLPLPTINDNPKS
                     RPTFGAKKSVLIWGGSSSVGATAIQLAAASGLRVVTTASGSNFDFVKSLGASLVFNYQ
                     AKSLVEDVVKKLSQAESELVGVYDAISEEKSIAPIAEILERLGKKGLRIASVLPYKEA
                     RGLNARFVFALHLAMSEHEQIGKAIWEDFVPAALDNGQLQTKPDPIVVGKGLESVQHA
                     LDVQMKGVSARKVIIDFQ"
     gene            complement(<1099238..>1100204)
                     /locus_tag="ACHE_10391A"
                     /db_xref="GeneID:66977348"
     mRNA            complement(join(<1099238..1099590,1099640..1099723,
                     1099785..1099913,1099971..1100072,1100134..1100139,
                     1100195..>1100204))
                     /locus_tag="ACHE_10391A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278753.1"
                     /db_xref="GeneID:66977348"
     CDS             complement(join(1099238..1099590,1099640..1099723,
                     1099785..1099913,1099971..1100072,1100134..1100139,
                     1100195..1100204))
                     /locus_tag="ACHE_10391A"
                     /note="COG:A;
                     EggNog:ENOG410Q13V;
                     InterPro:IPR036236,IPR000690,IPR003604,IPR017340,
                     IPR013085;
                     PFAM:PF06220;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0005685 - U1 snRNP [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0000387 - spliceosomal snRNP assembly
                     [Evidence IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131511.1"
                     /db_xref="GeneID:66977348"
                     /translation="MPKFFCDYCDVYLTHDSMSVRKAHNAGRNHLRNVLEYYQQIGQE
                     QAQSVIDSITSSYAAEGQAVPNPVMVPPGAYPPPFGFPGRPGQMPPPPFGIPPPGAPG
                     AVAPGMPPPPGGRGLPFPPPFPAGSGNLPPPPMPGMSLPPGGQGLPPPPPGGFPNFPI
                     PPPGAQGFPAIPPPGAGFTPSPSPGTPVAPGQEGFGGPPPMPAFAGAPPGASLPGPPG
                     PPPGLGDGR"
     gene            <1103132..>1103623
                     /locus_tag="ACHE_10392S"
                     /db_xref="GeneID:66977349"
     mRNA            <1103132..>1103623
                     /locus_tag="ACHE_10392S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278764.1"
                     /db_xref="GeneID:66977349"
     CDS             1103132..1103623
                     /locus_tag="ACHE_10392S"
                     /note="COG:S;
                     EggNog:ENOG410PRUK;
                     InterPro:IPR022024;
                     PFAM:PF12223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131512.1"
                     /db_xref="GeneID:66977349"
                     /translation="MPASTNYHVIEPHPSVPHTSRPAIHTARGGAGNVISLKNTKTTD
                     SRNASGPPSLTRLDSRVPRTFKSGRGGAGNVHSSSERAMFSFDEELERELRRVAPVYH
                     VGRGGAGNMIHNDTSGSSSLSRMFSGSSSGTSSSSLSMGDQVRDKAIHGLQKGWGKLR
                     GVA"
     gene            complement(<1105128..>1106378)
                     /gene="RO4"
                     /locus_tag="ACHE_10393A"
                     /db_xref="GeneID:66977350"
     mRNA            complement(join(<1105128..1105190,1105241..1105555,
                     1105611..>1106378))
                     /gene="RO4"
                     /locus_tag="ACHE_10393A"
                     /product="actin-like protein"
                     /transcript_id="XM_043278775.1"
                     /db_xref="GeneID:66977350"
     CDS             complement(join(1105128..1105190,1105241..1105555,
                     1105611..1106378))
                     /gene="RO4"
                     /locus_tag="ACHE_10393A"
                     /note="COG:Z;
                     EggNog:ENOG410PHDF;
                     InterPro:IPR020902,IPR004000,IPR043129;
                     PFAM:PF00022"
                     /codon_start=1
                     /product="actin-like protein"
                     /protein_id="XP_043131513.1"
                     /db_xref="GeneID:66977350"
                     /translation="MAEATLHNAPIVIDNGSGTIRAGFAGEEVPSCYFPSFVGRPKHP
                     RVMAGGLEGDVFIGDRAQELRGLLKIRYPLEHGIVTDWDDMEKIWHYVYENELKTLPE
                     EHPVLLTEPPLNPRKNRDAAAQIMFETFNVPALYTSIQAVLSLYASGRTTGVVLDSGD
                     GVSHAVPVFEGFAIPNSIRRIDVAGRDVTEQLQLLLRKNGHVLHTSAEKEVVRMIKEK
                     VCYVSLDPKREEKDWMNSYHKSEAKSVDYALPDGYKIKVGQERYRAPEILFDPELIGL
                     EYPGVHQIVQDAIIRTDLDLRKSLYLNIVLSGGSTLCKNFPDRLMREIKRLAVEDMKI
                     RISAPAERKYTTWIGGGILAGLSTFRKMWVSADEWHEDPEIIHRKFV"
     gene            complement(<1107003..>1107696)
                     /gene="ALG13"
                     /locus_tag="ACHE_10394A"
                     /db_xref="GeneID:66977351"
     mRNA            complement(join(<1107003..1107138,1107192..1107330,
                     1107387..>1107696))
                     /gene="ALG13"
                     /locus_tag="ACHE_10394A"
                     /product="N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase catalytic subunit alg13"
                     /transcript_id="XM_043278786.1"
                     /db_xref="GeneID:66977351"
     CDS             complement(join(1107003..1107138,1107192..1107330,
                     1107387..1107696))
                     /gene="ALG13"
                     /locus_tag="ACHE_10394A"
                     /note="BUSCO:EOG092658CI;
                     COG:G;
                     EggNog:ENOG410PRX7;
                     InterPro:IPR039042,IPR007235;
                     PFAM:PF04101;
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0006488 - dolichol-linked oligosaccharide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase catalytic subunit alg13"
                     /protein_id="XP_043131514.1"
                     /db_xref="GeneID:66977351"
                     /translation="MKLCFVTVGATASFESLLQSVFNETFLSALKQHGYTHLLVQYGK
                     DGQAICENFTKKNPEGSVARHGIDITGLDFNQAGLGAEMRLAQANAELDQEGGMIISH
                     AGSGTILEAMRLGIPLVVVPNPSLKDNHQKELANELQKQGYVIASNVNEVSEAVSEAE
                     ALRSHMLRWPPVRGRNQRQPTLEQVMSDELGFVD"
     gene            <1108044..>1109243
                     /gene="RSM24"
                     /locus_tag="ACHE_10395S"
                     /db_xref="GeneID:66977352"
     mRNA            join(<1108044..1108602,1108654..>1109243)
                     /gene="RSM24"
                     /locus_tag="ACHE_10395S"
                     /product="37S ribosomal protein S24, mitochondrial"
                     /transcript_id="XM_043278797.1"
                     /db_xref="GeneID:66977352"
     CDS             join(1108044..1108602,1108654..1109243)
                     /gene="RSM24"
                     /locus_tag="ACHE_10395S"
                     /note="BUSCO:EOG09264KIV;
                     COG:J;
                     EggNog:ENOG410PH1C;
                     InterPro:IPR039848,IPR019349;
                     PFAM:PF10213;
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0032543 - mitochondrial translation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="37S ribosomal protein S24, mitochondrial"
                     /protein_id="XP_043131515.1"
                     /db_xref="GeneID:66977352"
                     /translation="MASVARSLGRPAFLLARRGPLATSSRSFFLTPFRYMPEDPPVPP
                     PPKARKPEDYAAMPEYSPDLLSKEERSMYDMMAPEEKEQFDAENRRIVEEFNDPQKRA
                     AAFAEIENLANQVEREEPMRFNDEPERRRGFWAEDDGDEFALVEDGDEAFNDDEITSM
                     AHAEVELHREIREYARIAAWDMPLLSHLAKPFTLPPETHILRFRYTTYMGEQHPAEPK
                     VVVELSTKDLTPKYLTEAQRQTFLKLVGPRYNPDTDIVRMSCERFNTRAQNKRYLGDV
                     INNLVKEAKEGDSFADVPLDLRHHKPKRQLRFPKEWIMTEQRKKQLEARRAQRERSEE
                     KRQIVDGSAVFAEAARTLPELNPALRAQASNEREKVAVKVGARAKKLR"
     gene            complement(<1109988..>1111766)
                     /locus_tag="ACHE_10396A"
                     /db_xref="GeneID:66977353"
     mRNA            complement(join(<1109988..1111102,1111156..1111231,
                     1111281..>1111766))
                     /locus_tag="ACHE_10396A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278808.1"
                     /db_xref="GeneID:66977353"
     CDS             complement(join(1109988..1111102,1111156..1111231,
                     1111281..1111766))
                     /locus_tag="ACHE_10396A"
                     /note="COG:S;
                     EggNog:ENOG410PTIC;
                     InterPro:IPR000571;
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131516.1"
                     /db_xref="GeneID:66977353"
                     /translation="MTSPLRPQFFCTRPNGTVTPLIAVDELPSHISIRGVSRALSPND
                     TQGMTSLGTVNARNQTYVVDGVPTAPMRATAGNSAAAVAGDAGARSRDYELQTSLVRI
                     LSDESIPANQRLALHASIQQALAPQWPVGAAGNSSTQTAAAGNWLVPAGGSGGRAGGP
                     KQGPNFNAKKEYCSYWIRHGECDYQQQGCLYKHEMPTDPFMLEKLGLRDIPRWYREKY
                     GVPSILPGGANARASTNNSHNWREDAADSSTVKAIQYPVRLRYNGTTTPSSSDTEKAS
                     KQKATSYAPTVQSNGNGAAMFPGNPRASYPAMNPPRAPSSQRHGSRNAASQSIGVPGT
                     RKIDLLSFDPLPDYPSLDSLHGGVAGVTYPASGPGNNANNTNTKTPDEAHREGMVRNL
                     QSLMPNSPDYLPTPLGPNSTQQRSKRTQKGRRLYQPRSQIVVPGDSQEIRDQASFKNA
                     QHGNTTYSSAASVASKGTNGSQVTSPMGILGSSDPPTRVASPSTHSPTSLSSQSSPQA
                     FYNKNKDGVMPGAIGSKRGYNRKKSANTNSSEEDLFDFGVESGNGKGHGK"
     gene            complement(<1112668..>1117393)
                     /locus_tag="ACHE_10397A"
                     /db_xref="GeneID:66977354"
     mRNA            complement(join(<1112668..1113284,1113353..1116944,
                     1117007..>1117393))
                     /locus_tag="ACHE_10397A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278819.1"
                     /db_xref="GeneID:66977354"
     CDS             complement(join(1112668..1113284,1113353..1116944,
                     1117007..1117393))
                     /locus_tag="ACHE_10397A"
                     /note="COG:B;
                     EggNog:ENOG410QDWM;
                     InterPro:IPR041684,IPR011011,IPR019786,IPR040934,
                     IPR000330,IPR038718,IPR001650,IPR027417,IPR014001,
                     IPR001965,IPR016197,IPR013083;
                     PFAM:PF18585,PF00176,PF11496,PF00271,PF15446;
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131517.1"
                     /db_xref="GeneID:66977354"
                     /translation="MDWNFQLDPNDDLVADLLSQFDAASAHVQAEEPAAKSSHGVQPD
                     NSQPTGSQVQPANQLQETLQLDVTTEDEQPPGPKLAAVEIPAIVNGEEYDTLPGHSAV
                     WYIISEEQGADGDVVYKVRMRSSELQTVNLTQLQTLQNGPEALERFESSDQDLRITIS
                     SDEDYNSTESRSVNDRQSKRATKSRRLFTEFFAGVSSDDDGGIMSSSSDDVIVSSVTT
                     SRARRLQRGVRHKGLQNRRQSSRISDFFDSDDEPKSKGTRFSTRERRTVRSNLRERFE
                     DDFSENEIRAKKKYIGAKEVFHTVPRRDPFRHRHLNVCDVCGISDNNDEKGPLIFCQG
                     CTFSYHQVCLGPRGSRDHLVTKVADDHFVLQCRHCLGVAHAKDRLSPHLGHCNACNEK
                     GSMSKPLRERLSPKQEQQLRQENGGKDPITSVDMTRFNNLDNLLFRCSGCRRAYHLDH
                     LPPLSNDNREDVAASPFQQYSSRWHCLDCISAPDEIAAMVAWRPVQLDLVDCAASKLA
                     EGKKEYLIKWRNKSYHHSTWMPGTWVWGVAKHAMRRAFLKSDKDINPQKSAQEAIPED
                     FLRVDIVFDVRYSEKPQDRSEEADLARIDKVQEAYMKFKGLPYEETVWEVPPEADSER
                     WNDFKTAYEDWVRRDYIHTPSQDALKKHLAYVRKQNFKTTVVRDTQPESMTGGEIMEY
                     QKDGLNWLYYMWFKQQNAILADEMGLGKTIQVIGFFATLIQYHKCWPFLVVVPNATCP
                     NWRKEIKKWVPSIRVVTYYGSAFSRKLAHDYEMFGKEGSVLRCHVVVTSYEAMVDDHS
                     RKTLSRIPWAGLVVDEGQRLKNDRSQLYEGLFKIKFPFKVLLTGTPLQNDTRELFNLL
                     QFCDPSIKAEDMEAEYGVLSKDNIPQLHEMIRPFFLRRTKAQVLNFLPPIANIIVPVS
                     MSVVQKKLYKSILAKNPQLIETIFQRKDDQTGVKQVERKNLNNILLQLRKCLCHPFLY
                     SKAIEERTPDVTESHRHLIEAAGKLQLLQLMLPKLQQRGHRVLIFSQFLEHLDIIEDF
                     LDGSSMLYRRLDGRMPAMEKQKRIDEYNAEGSPYFAFLLSTRSGGVGINLATADTVII
                     MDPDFNPHQDMQASSRAHRIGQKNKVLVFQLMTRGSAEEKIMQIGKKKMVLDHVLIDR
                     MIAEEDDGRDLESILRHGAQALFDDDDSGDIHYDSESVDKLLDRSQAEQTKSPDANST
                     EDPFSFARVWANDNQNLDGQLGDGVDEGPINSSVWENILKEREQAAEEEAKRKAENFG
                     RGKRKRTAVDYSHAAGISPAKPRRQDDDSDVEFQAGNLDAPESDSDSDPGMLSDDLKP
                     ATKRTKVAPFERVDLPDPEPPSAPAPVRENILVCYACNRTHPPGQCRLKSAGVEHCPL
                     CGLAHYGVKRTCPHLQSEVQLSRMLEALKNSIEDREIRNLARSYVSGIKGDLARRRRS
                     LNPNPNPTPTSGGKPALGVLNGQKRNSTHGTAAPSPVPGGPGPAPEPGVSPGIGPGPP
                     PATNLTGDNGTNNTAMGSGPNGPSWRSTFKTWLNGQR"
     gene            <1117758..>1119185
                     /locus_tag="ACHE_10399S"
                     /db_xref="GeneID:66977356"
     mRNA            <1117758..>1119185
                     /locus_tag="ACHE_10399S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278830.1"
                     /db_xref="GeneID:66977356"
     CDS             1117758..1119185
                     /locus_tag="ACHE_10399S"
                     /note="COG:A;
                     EggNog:ENOG410PP14;
                     InterPro:IPR029028,IPR029026,IPR029064,IPR001537,
                     IPR013123;
                     PFAM:PF08032,PF00588;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0008173 - RNA methyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0006396 - RNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131518.1"
                     /db_xref="GeneID:66977356"
                     /translation="MSIHASLGSLRVCIWPSNVSSAQLTTVRHASLNSAIGRGIRKSR
                     GLDNSPPSRNPTNDNNSRNGQKGSWSRNHTDYDDRRDTRSDVDEFVRSGNFRERVGER
                     QHPSWMKRGRMDKDETLKKLSRAKKREPRHKWSEKMPERVKDHVFVPKSIPYTTPASE
                     FIYGTNAVESTLRCSRRKIYKLYIYQNKGEELGPAKLMLRKLALVKNIPVKLAFAEWD
                     RLLDKMSSGRPHNGCVLEVSPLPRLPVQSLAPVPSPEEDFFRVELGSQSREEALINGT
                     SNRIEIHQPVQQEHRRYPVTLLLDGIVDQGNLGAIIRSAYYLGIDAIVFAGRNSAPLS
                     DVTIKASAGASENMTLLEVSNERAFIQQSKTNGWRFYAADVPGPGSTLEGQHDANPTS
                     GGSRLTQGPSVIMMGSESSGLSRHFMSHANAIVSIPGSRFVGDSSVESDPARVDSLNV
                     SVAAALLMEKFLRTPLAVTEIPQEG"
     gene            complement(<1119520..>1123155)
                     /gene="ISW2"
                     /locus_tag="ACHE_10398A"
                     /db_xref="GeneID:66977355"
     mRNA            complement(join(<1119520..1119633,1119689..1122646,
                     1122714..1122830,1123030..>1123155))
                     /gene="ISW2"
                     /locus_tag="ACHE_10398A"
                     /product="chromatin remodeling complex
                     adenosinetriphosphatase"
                     /transcript_id="XM_043278841.1"
                     /db_xref="GeneID:66977355"
     CDS             complement(join(1119520..1119633,1119689..1122646,
                     1122714..1122830,1123030..1123155))
                     /gene="ISW2"
                     /locus_tag="ACHE_10398A"
                     /note="COG:K;
                     EggNog:ENOG410PG55;
                     InterPro:IPR036306,IPR027417,IPR017884,IPR000330,
                     IPR038718,IPR009057,IPR001650,IPR001005,IPR014001,
                     IPR015194,IPR015195;
                     PFAM:PF09110,PF00176,PF09111,PF00271,PF04851;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016818 - hydrolase activity, acting on
                     acid anhydrides, in phosphorus-containing anhydrides
                     [Evidence IEA];
                     go_function: GO:0031491 - nucleosome binding [Evidence
                     IEA];
                     go_process: GO:0006338 - chromatin remodeling [Evidence
                     IEA];
                     go_process: GO:0043044 - ATP-dependent chromatin
                     remodeling [Evidence IEA]"
                     /codon_start=1
                     /product="chromatin remodeling complex
                     adenosinetriphosphatase"
                     /protein_id="XP_043131519.1"
                     /db_xref="GeneID:66977355"
                     /translation="MVAPLKSLDPHSDAPSQADTPMTDANEEITSVPVDSTDAQMTDD
                     NSVAGDTTVDGRKRRSAESNQRKSALGKKHGRLDESKETDSIRRFRYLLGLTDLFRHF
                     IETNPNPRIKEIIAEIDRQNADDEAKAKKKGTSRSGGAGNERRRRTEQEEDAELLKDE
                     SGEQTGTVFRETPPFINGEMRDYQIAGLNWLVSLHENGISGILADEMGLGKTLQTISF
                     LGYLRYVCDIPGPHLVAVPKSTLDNWKRELEKWTPDVRVLVLQGDKEERQRLINEELL
                     EENFDVCITSYEMVLREKTHLKKFAWEYIVIDEAHRIKNEESSLAQIIRVFNSRNRLL
                     ITGTPLQNNLHELWALLNFLLPDVFGDSEAFDQWFSTQDSDQDTVVQQLHRVLRPFLL
                     RRVKSDVEKSLLPKKEINLYVPMSEMQVKWYQKILEKDIDAVNGAAGKRESKTRLLNI
                     VMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYNSGKMVILDKILTRMQKQGSRVLIFSQ
                     MSRVLDILEDYCVFRDYNYCRIDGTTAHEDRIAAIDDYNKPGSDKFVFLLTTRAGGLG
                     INLTSADIVVLYDSDWNPQADLQAMDRAHRIGQTKQVVAFRFVTEKAIEEKVLERAAQ
                     KLRLDQLVIQQGRAQQQAKNAASKDELLGMIQHGAASVFGQENSTISSEKQISEDDID
                     AILRKGEERTAELNKKYEKLGIDDLQKFSSESAYEWNGQDFTERKKDIGINWINPAKR
                     ERKEQFYSIDKYYRQALATGGRTADPKPKVPRAPKQIAVHDWQFFPPGLQELQEKETA
                     YFHKEIGYKAQLPDGPEEELSEREAERDLEQQEIDNATPLTEDEQAKKAKMSEEGFST
                     WNRRDFQQFINGSAKFGRNDYDGIATEVDSKDADEVEEYANVFWKRYTEIQDYPKYLR
                     VIDQGEEKLRKMGHQRKMLRKKIEMYRVPLQQLKINYTVSTTNKKVYTEEEDRFLLVM
                     LDRYGVDGEGLYEKIRDEIRESPLFRFDWFFLSRTPVEIGRRCTTLLNTVAKEFEPGD
                     GKANGEAGKGRGRGRDDEDEENEEEAPAKKKTKNGAVNKQVKAVKGGSKSNSASTSRA
                     ASVSSNTAPKSKSRKK"
     gene            <1123841..>1124620
                     /locus_tag="ACHE_10400S"
                     /db_xref="GeneID:66977357"
     mRNA            <1123841..>1124620
                     /locus_tag="ACHE_10400S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278854.1"
                     /db_xref="GeneID:66977357"
     CDS             1123841..1124620
                     /locus_tag="ACHE_10400S"
                     /note="COG:S;
                     EggNog:ENOG410PQR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131520.1"
                     /db_xref="GeneID:66977357"
                     /translation="MDSMRSLNTSLPSSTPRPQPPEQLLQSFKAAALSVTNLYKNAVC
                     EQSQAKQAGYQEAIEDLLQFLDRENLGLGDGEGWSVRQWATERLDGNGVPGSDDDDTE
                     KRARSTTPAAVRKEQSGPDASQSPPKPASSPYDAHVAPQQQQQPQPQQQPAPPSQPEA
                     NSFDRPAIFTFTSGPSFPQPQEQDVDMQPSENSPDGAPVLSVFPRNSRSQHRHNNLTR
                     SNQRTSTREPSVGVGSKRKLAVPDFFDLSDMFGGSKRGRFT"
     gene            complement(<1124956..>1125296)
                     /locus_tag="ACHE_10401A"
                     /db_xref="GeneID:66977358"
     mRNA            complement(join(<1124956..1125137,1125194..>1125296))
                     /locus_tag="ACHE_10401A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278865.1"
                     /db_xref="GeneID:66977358"
     CDS             complement(join(1124956..1125137,1125194..1125296))
                     /locus_tag="ACHE_10401A"
                     /note="COG:S;
                     EggNog:ENOG410PT20;
                     TransMembrane:2 (o33-54i75-93o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131521.1"
                     /db_xref="GeneID:66977358"
                     /translation="MAPAQNESWNVQEKDAKRAIAEDTYDDCLSCRVTGSAAFVGLGV
                     YSYYTGMNNLRQQEKAIMQSASKYKMGSRQLGIATISATLVGMGIWRALN"
     gene            <1125560..>1127598
                     /locus_tag="ACHE_10402S"
                     /db_xref="GeneID:66977359"
     mRNA            join(<1125560..1125606,1125694..1126104,1126170..>1127598)
                     /locus_tag="ACHE_10402S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278876.1"
                     /db_xref="GeneID:66977359"
     CDS             join(1125560..1125606,1125694..1126104,1126170..1127598)
                     /locus_tag="ACHE_10402S"
                     /note="COG:U;
                     EggNog:ENOG410PIT0;
                     InterPro:IPR011012,IPR028565,IPR036168;
                     PFAM:PF00928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131522.1"
                     /db_xref="GeneID:66977359"
                     /translation="MMSGEIDALYIYDEHNQPLVEHVYRSRPPSAATLRPLYFAHRVP
                     RPSLLYFPNTSPPVTVFSVVQSNLLFLAVSEVDTEPLLALEFLHRVVDVLEEFVGAPL
                     ISTKIQSNYDVVAQLLHEMCDGGLVCNTELNALQEVVDMPGWMGKLLGGVGSSSSTPS
                     LGGPNSLKPPLSSAASQGPAILWRRPNVRHTSNELYVDIVESLSVTIAPSGRLLSALV
                     SGTIAFTAKISGVPDLLLSLTTPGGQQAIGRKMDLPVFHPSVRLARWRERPGDLSFVP
                     PDGRFILAGYGVDLLPIDPDLDEPPSHMEKLFLPAFVDMRKSLGPTGSEFEVRLTLNT
                     SFPGVASAARPGAGRANSGTSTPSFLGGGGGGTPSAPVLDEVVVTVPIPQLVRNITDM
                     QASRGEAIYNPGSDVLEWRVPTKDAGTVSGTATLRCTVSGHQTGDEDVEDEAAEADTN
                     LLQGYYDPSTSYQDGTGMDPSVRRKRKTKKKKKTKKVSKSKHASADPDQQQQSETQPE
                     ASDPHLSIPQSPTPQQSSPIASSPLPPSSPNPTSPLRSSQPFPQSIFRPAPRKTKTQL
                     NASLMPDSVSVSFVVQGWLPSGIKVDSLNIDPRRSRGLGEGVRPYKGVKYLCVSRRGV
                     EARC"
     gene            complement(<1128465..>1130607)
                     /locus_tag="ACHE_10403A"
                     /db_xref="GeneID:66977360"
     mRNA            complement(join(<1128465..1128511,1128899..1129258,
                     1129310..1130109,1130175..1130405,1130462..>1130607))
                     /locus_tag="ACHE_10403A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278887.1"
                     /db_xref="GeneID:66977360"
     CDS             complement(join(1128465..1128511,1128899..1129258,
                     1129310..1130109,1130175..1130405,1130462..1130607))
                     /locus_tag="ACHE_10403A"
                     /note="COG:C;
                     EggNog:ENOG410PGT9;
                     InterPro:IPR015590,IPR012394,IPR016161,IPR016162,
                     IPR016163;
                     PFAM:PF00171;
                     TransMembrane:1 (o488-517i);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0006081 - cellular aldehyde metabolic
                     process [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131523.1"
                     /db_xref="GeneID:66977360"
                     /translation="MGAIDIPELQYTPLNDIQGRVAELRQTFSEHKTRDVEFRLVQLR
                     KLYWAIKDREDRIAEACRLDLNKPPFETIIAESGWLENDCVFVSRNLHKWAKDEKAED
                     IDLTFKFMNPKIRKDPLGMVLVIGAFNYPFQLTLGPVIGAIAGGNTVAIKPSENAPNS
                     AVIIQEIVEEALDPSCYKIIQGSIPETQALLAERWDKIFFTGGANVGRIIAKAAAPHL
                     TPVVLELGGINPAIITKSADPRLVARRLLWGKTMNAGQLCTSQNYLLVDRAIVPRVVE
                     EFKKAYNEFYPQGAKASPDYSRMINAGHFQKLKSMIDNSKGKILVGGTMDEKELFIEP
                     TIVEVNSTDDSLLIQESFGPLIPILPVDDLDEAVKIANGIQATPLGLYPFGSKQDTDK
                     ILSMTRSGGASVNDAALHIPTLPFGGVGESGYGAYRGRASFDTFVHRRPITTSPSWLE
                     SILAIRYPPYAGKAGPFRAASTLVPDFDRDGKKLTMGWLRMIFTLGGGSATAGAGRAA
                     AVAAVAYVVMRLLERRAKL"
     gene            complement(<1131185..>1132930)
                     /gene="ICL1"
                     /locus_tag="ACHE_10404A"
                     /db_xref="GeneID:66977361"
     mRNA            complement(join(<1131185..1132441,1132504..1132659,
                     1132727..>1132930))
                     /gene="ICL1"
                     /locus_tag="ACHE_10404A"
                     /product="isocitrate lyase 1"
                     /transcript_id="XM_043278898.1"
                     /db_xref="GeneID:66977361"
     CDS             complement(join(1131185..1132441,1132504..1132659,
                     1132727..1132930))
                     /gene="ICL1"
                     /locus_tag="ACHE_10404A"
                     /note="COG:C;
                     EggNog:ENOG410PGND;
                     InterPro:IPR006254,IPR040442,IPR015813,IPR018523;
                     PFAM:PF00463,PF13714;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004451 - isocitrate lyase activity
                     [Evidence IEA];
                     go_process: GO:0019752 - carboxylic acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="isocitrate lyase 1"
                     /protein_id="XP_043131524.1"
                     /db_xref="GeneID:66977361"
                     /translation="MGFFEDEDRKYQEEVNDVKAWWQDSRWRYTKRPFTAEQIVAKRG
                     NLKIDYPSNVQAKKLWGILEHNFKNKVPSYTYGCLEPTMVTQMAKYLDTVYVSGWQSS
                     STASSTDEPSPDLADYPMNTVPNKVNHLWMAQLFHDRKQREERITTPKDQRHKVANVD
                     YLRPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPIS
                     EHINRLVAIRAQADIMGTDLLAIARTDSEAATLITSTIDFRDHPFIVGSTNPGLQPLN
                     DLMVAAEQAGKSGEDLQAIEDQWNAQAGLKLFDEAVIDTIKSGVHVNKEGLINDYLKA
                     VKGKNNSEARAIAKGITGVDIYWDWDSARTREGYYRYRGGTQCAVNRAVAFAPFADLI
                     WMESKLPDYKQAKEFADGVHAVWPEQKLAYNLSPSFNWKKAMPRDEQETYIQRLGELG
                     YCWQFITLAGLHTTALISDQFAQAYSKQGMRAYGELVQEPEMERGVDVVTHQKWSGAN
                     YVDNMLKMVSGGISSTAAMGKGVTEDQFKA"
     gene            complement(<1134657..>1137112)
                     /gene="NTH1"
                     /locus_tag="ACHE_10405A"
                     /db_xref="GeneID:66977362"
     mRNA            complement(join(<1134657..1134792,1134869..1136610,
                     1136668..1136789,1136853..1136925,1136978..>1137112))
                     /gene="NTH1"
                     /locus_tag="ACHE_10405A"
                     /product="alpha,alpha-trehalase nth1"
                     /transcript_id="XM_043278909.1"
                     /db_xref="GeneID:66977362"
     CDS             complement(join(1134657..1134792,1134869..1136610,
                     1136668..1136789,1136853..1136925,1136978..1137112))
                     /gene="NTH1"
                     /locus_tag="ACHE_10405A"
                     /note="BUSCO:EOG09260TWS;
                     CAZy:GH37;
                     COG:G;
                     EggNog:ENOG410PFDB;
                     InterPro:IPR018232,IPR011120,IPR008928,IPR001661,
                     IPR012341;
                     PFAM:PF01204;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0004555 - alpha,alpha-trehalase activity
                     [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0005991 - trehalose metabolic process
                     [Evidence IEA];
                     go_process: GO:0005993 - trehalose catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="alpha,alpha-trehalase nth1"
                     /protein_id="XP_043131525.1"
                     /db_xref="GeneID:66977362"
                     /translation="MSSSQPHHHHHRRISSADPLSDADVYYGDENVLNRFRDRRRAFS
                     TSLKSFNREDIDSYLGHFPARRGSHDETSAQPRKFLIDVDATLHDLLEREDTDRNMQI
                     TIEDVGPKVLAVGTASSGGYNRFDLRGTYMLSNLLQELTIAKDYDRKHIILDEARLSE
                     NPVARLSRLIKNSFWKALTRRIDGHNIGEAGRDPKDWTDNPRPRIYVPPGAPAQLKYY
                     RNIAKDHPELRLDVQLLDSNITPEYVKDLNDKPGLLALAMHPKYNESTMKEDLIGVPF
                     VVPGGRFNELYGWDSYMISLGLIVSDRVDLAKAMVINFCFCIKHYGKILNANRTYYLS
                     RSQPPFLTDMALRVYDRIKTEPDAKEFLRNATLAAIKEYYSVWVSAPRFDPATGLSRY
                     RPEGKGVPPETEPSHFTHILTPYAEKHGMKFRDFVEAYNHSKIEEPELDEYFLHDRAV
                     RESGHDTSYRLEKVCANLATVDLNSLLYKYEVDIAMIIRTHFNDRLDIPEEFRTDSSR
                     DITHESSAVWDRRARRRKMRMDSLLWDQEKGMFFDYDTAKKQRTSYETATTFWAMWAG
                     LATPRQAADMIEKALPRFEAFGGLVSGTEESRGPVGLERPNRQWDFPYGWAPQQMLAW
                     AGFLRYGYEDEAKRLAYKWLFMITKAFVDFNGVVVEKYDVTRPIDPHRVDAEYGNQGV
                     DFKGAPREGFGWVNASYVYGLEILNAHMRRALGTITPYETYRHAMEQSEEAFS"
     gene            complement(<1137830..>1138806)
                     /locus_tag="ACHE_10406A"
                     /db_xref="GeneID:66977363"
     mRNA            complement(join(<1137830..1138049,1138115..1138418,
                     1138490..1138724,1138777..>1138806))
                     /locus_tag="ACHE_10406A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278920.1"
                     /db_xref="GeneID:66977363"
     CDS             complement(join(1137830..1138049,1138115..1138418,
                     1138490..1138724,1138777..1138806))
                     /locus_tag="ACHE_10406A"
                     /note="COG:Q;
                     EggNog:ENOG410PJCA;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131526.1"
                     /db_xref="GeneID:66977363"
                     /translation="MDAQSLFDVKGKVVLVTGGAKGIGRMISEGFVSNGATVYISSRD
                     AKSCDEAVKELNALGKGKAHAIPANFYKEEECQRLAEELKKRESKLHVLVNNSGSNWG
                     APYDEYPSSAWSRVLTLNLHRVFDITKLVTPLLEKAATPGDPARIINIGSVDGLRVPA
                     LETFAYSASKAGLHHLSRVLANHLGKRNITSNSLACGPFQSKMMAATLEAYRETIEAG
                     IPLGRIGTPQDVAGSCLFLSSRAGAFVNGATIALDGGTLVGSKL"
     gene            <1139187..>1140164
                     /locus_tag="ACHE_10407S"
                     /db_xref="GeneID:66977364"
     mRNA            <1139187..>1140164
                     /locus_tag="ACHE_10407S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278931.1"
                     /db_xref="GeneID:66977364"
     CDS             1139187..1140164
                     /locus_tag="ACHE_10407S"
                     /note="BUSCO:EOG09264IPL;
                     COG:O,T;
                     EggNog:ENOG410PK8T;
                     InterPro:IPR003323,IPR038765;
                     MEROPS:MER0400048;
                     PFAM:PF02338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131527.1"
                     /db_xref="GeneID:66977364"
                     /translation="MEELLSKHRKEQKDLQARITQKKKSATKKTRKGINDECDRIQQE
                     LNEKQRAEVALVNGEDTAGVDGVQDLSIADPVDEDGEKNSSNDAPKDTGVSDTTSFST
                     PSQQPPAYTRKPNRQKARLARRAAEQAAQTEIAHEEAAKLTDHRANEKEVMDGVFKQF
                     NLKEIEVNPDGHCLYSAIANQLDESGLGLRPDPKRIALQSTTESRVETVSSPKHDGYR
                     AIRAVTADYITGHKDDFEPFMEEPLDQYTRKIKLTAEWGGQLELLAIAKAYGVDINVI
                     QGDGRIEKIESGDMESFDEEEKNKRVIWLAYYRHTYGLGEHYNALTKQA"
     gene            <1141924..>1143677
                     /locus_tag="ACHE_10408S"
                     /db_xref="GeneID:66977365"
     mRNA            join(<1141924..1142245,1142309..1143318,1143381..>1143677)
                     /locus_tag="ACHE_10408S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278942.1"
                     /db_xref="GeneID:66977365"
     CDS             join(1141924..1142245,1142309..1143318,1143381..1143677)
                     /locus_tag="ACHE_10408S"
                     /note="COG:G;
                     EggNog:ENOG410PG9Q;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i86-111o123-142i154-180o186-204i216-238o244-262i326-
                     347o359-381i416-433o439-462i483-500o506-526i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131528.1"
                     /db_xref="GeneID:66977365"
                     /translation="MASSMEESRPPTAAPIDIEQLPARDGDEEKSLDHSSPAVEGKEH
                     DDQSIGPGPTVVPRLKRRGLFGQFTLLAEVENPKLYPRKTKWFITFIVAVAGATAPMG
                     SSIFFPSLARVTKEMHTTTTITNLSISLYMLSMSIFPLWWSSFSERLGRRTIYIVSFC
                     LFVVFNVLCAISHNIVMLIVMRMLSGGASASVQAVGAGTIADLWDTHERGRAMTTFYL
                     GPLCGPLIAPIVGGALAQRWNWRSTLWFLAAYGGLVAAFIFLALPETLAKRKAPAMVE
                     NIEQPAPVERRLSRASSRQVVQLTTKWLKMLKLVFLDPLKIVLYLRYPPVLLTVYYAS
                     ITFGSLYVLNVSIEHTFGYAPYEFPTIIVGLLYIPNSLGYVVASTFSGRWMDSIMQRE
                     ARKANRYDEDGKLIYRPEDRMRENAWLGALIYPAGLIWYGWTAGEGVFWLVPMIANFF
                     FGVGSMIIFGMATTMLTEFMPKNASAGVALNNFMRNIFSCVGSLVTAPIIDAIGNGWL
                     FTILGLVAFASSSTLYIMRVFGPRWRKSMDALTQ"
     gene            <1146273..>1149645
                     /locus_tag="ACHE_10409S"
                     /db_xref="GeneID:66977366"
     mRNA            join(<1146273..1146416,1146553..1146628,1146694..1147023,
                     1147073..>1149645)
                     /locus_tag="ACHE_10409S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278953.1"
                     /db_xref="GeneID:66977366"
     CDS             join(1146273..1146416,1146553..1146628,1146694..1147023,
                     1147073..1149645)
                     /locus_tag="ACHE_10409S"
                     /note="COG:S;
                     EggNog:ENOG410PZ9T;
                     TransMembrane:1 (o698-715i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131529.1"
                     /db_xref="GeneID:66977366"
                     /translation="MAKGGKKSNRKKSINNKQLLPVINDNNLPVSEPTSDEKAIVEDG
                     VLGPDQGDGDEPNGTEDAPAGDDAAAPDAEAAEHSTPPEEPAEPVDEEVKPEKEASPE
                     EAKPEGEDEAQRDEAAAEAEEAPAADGEDAPVPEEGALDGEQGGQPAEEVPQEAKPAP
                     EPGEDAPPAADEAPAEENEGKGDGEEPSAEEPAAEPAGAEPVADAEETPADPPAEDEP
                     AADKTAPANDNAAAPEEPAAEDPVAEAEGAPEGENEKAEEPEETPAEQPEGDEEDAEE
                     PGPAFEEPAEAAQSEESAAHSGPAGDEAEAEAATGDGADEVTPEETPAEEPAAEDSPE
                     EHPAEEAPAPAEEAEQTAEETTEEETSGGSADESGEEPADEPAEETAEKAPAEESPPE
                     EEATAAEESAEKPPAGDVPAEEAPAEEAPAEEAPAEEAPEEEPAEEPAPADEQPAEES
                     AQSAEEGAVEESAAEDVPADELSAEEEAPEEELAEEAPAEEPAAEEPPSEEPVPEEAE
                     PAEEAPEEAPVEEPSEEASTEEEAADAEPATEPAEELAKEALAEEPEEPPADEPAAAE
                     EASAEEPTPEAPAEEPVPEEAPEEAPAEREPAPEELAVEELPAEGTPAEEPAEVPAPE
                     EIPAEEGLAEPTPEEPAAEEPTTEETPELAAEEAPPAEEPAPEKPVPEEPVPTEEPPA
                     DADSGESSKGDHLTEAAVAAGAVAAGAAGAAAIHSRRKKRRSTDVDGERRHSRSSSYG
                     YRDLERGGKGDGNLITNRWVKALGEAKRQHEEKAIKQEDKRQKHKVAVIERGRRSEER
                     EREREESQPRERRRSRRASRSERTERTTGKESVALETKSRRRSSVSYERDLASRHAMS
                     ASSAPKPRAFLKYMNTESDTNGPLLMINGHKASANVRYHDHSHGSRRSSKSYAHSHAH
                     SHSHSHSRDEGRKSLERSHSTRSRHSNKGDSEDEAAKREEREARRARRKAAEEEERKL
                     KEQEEQQKQQEQQQNEAEEKESRRRRHSGEKEHRHRSHHHRSRQLETPPPPRPSKLRQ
                     ILKATTVVVC"
     gene            complement(<1149908..>1151832)
                     /locus_tag="ACHE_10410A"
                     /db_xref="GeneID:66977367"
     mRNA            complement(join(<1149908..1151194,1151249..1151620,
                     1151668..>1151832))
                     /locus_tag="ACHE_10410A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278965.1"
                     /db_xref="GeneID:66977367"
     CDS             complement(join(1149908..1151194,1151249..1151620,
                     1151668..1151832))
                     /locus_tag="ACHE_10410A"
                     /note="COG:E;
                     EggNog:ENOG410PIB1;
                     InterPro:IPR043137,IPR029055,IPR043138;
                     MEROPS:MER0094876;
                     PFAM:PF01019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131530.1"
                     /db_xref="GeneID:66977367"
                     /translation="MPLNSKAVYSKLNADFVPFSSRRSTVHSTKGIVSCTQPLAAAAG
                     QRILKEGGNAADAAVAVAAALNITEPSSTGIGGDMFCLYYDAKTKKVGSLNGSGRYAG
                     NASLEKVRGDLNIAPENQGGRIPMTSALAVTVPGAAAGWIDTIEKFGSGKLSLEEILK
                     PAIELGEEGFPVSELASSFWQESENLLRNASPNFREMLKTDPNGKDGVRSPLPGDILK
                     NPTLAQTFRSLAAEGKRGFYEGRIAEAIVKVVQDLGGYISLDDLKHHAEAGTQATDAI
                     SLKFSGQNIVENQRAGTDDGAHHGVEIWEHPPNGQGIVALMALGILEELERTHKIPQF
                     TEDQHNSAEYLHAVIESLRIAFADASWWVTDPDVEKVPTKELISQRYLTERAKLFNPD
                     QASNVLDHGSPAHNHCDTVYFAVTDKDGNGISFINSNYAGFGTGIIPQGCGFTLQNRG
                     CNFSLTAGHPNALAPRKRPYHTIIPAMITNSTDGSLHSVYGVMGGFMQPQGHVQVLLN
                     MLAFKYHPQAALDAPRICLAATSPEPGKDMDRTVFVEEGVSEKAVEGLKKKGHKIQVL
                     EGWKRGMFGRGQIIRSHYDDGVLVYSAGSDPRGDGMAIPVV"
     gene            complement(<1152509..>1154932)
                     /gene="THS1"
                     /locus_tag="ACHE_10411A"
                     /db_xref="GeneID:66977368"
     mRNA            complement(join(<1152509..1152663,1152719..1153385,
                     1153439..1154014,1154075..1154339,1154412..>1154932))
                     /gene="THS1"
                     /locus_tag="ACHE_10411A"
                     /product="threonyl-tRNA synthetase"
                     /transcript_id="XM_043278976.1"
                     /db_xref="GeneID:66977368"
     CDS             complement(join(1152509..1152663,1152719..1153385,
                     1153439..1154014,1154075..1154339,1154412..1154932))
                     /gene="THS1"
                     /locus_tag="ACHE_10411A"
                     /note="COG:J;
                     EggNog:ENOG410PFEM;
                     InterPro:IPR036621,IPR006195,IPR002320,IPR012675,
                     IPR012676,IPR004154,IPR033728,IPR018163,IPR012947,
                     IPR002314;
                     PFAM:PF03129,PF07973,PF00587;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0004829 - threonine-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA];
                     go_process: GO:0006435 - threonyl-tRNA aminoacylation
                     [Evidence IEA];
                     go_process: GO:0043039 - tRNA aminoacylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="threonyl-tRNA synthetase"
                     /protein_id="XP_043131531.1"
                     /db_xref="GeneID:66977368"
                     /translation="MAAEGSNDLPVRPAEANPAKADAKQSNTDALPDFIVERNNFFEE
                     LWQKHLEELKNKPHPDINITVDLGNGTTTTVTAKAWETTPAKLLKDLPKELGANAVIG
                     KVDGELYDLGRVLEHDCTVAYIPFDDPEGREVFWHSSAHCLGEACECQYGCLLSHGPP
                     TPQGFFYDMAMPDGRVVNQSDWPPLESKSNRIMKEKQSFDRLEVTKEDLRKMFAYSKY
                     KLHYIDKLVTGEKSTVYRCGTLVDLCRGPHIQSTGKIKNFKIMQNSSAYFLGDQANDS
                     LQRIRGVAFPDKQRFHEHMKFLEEAEKRNHVKIGKEQELFFFDEVSPGCPFLLPNGTK
                     IFNALQSLLRSEYRKRGYQEVQTPNMYDVGIWKTSGHWAHYKDDMFKLDVEKREWALK
                     PMNCPGHFVLFGHRERSYRELPLRIADFGVLHRNEASGALSGLTRVRKFQQDDTHIFC
                     TQDQITSEIEGLFDFLQSIYGLFGFTFKLKLSTRPEKYLGEVETWNYAEEQLKKAMSN
                     FKGSDWTIDEGDGAFYGPKIDITIADALKREFQCATIQLDYQAPINFKLEYMSHEKAQ
                     AGAEEAKEGETKSNEPGPGRARPVVIHRAIIGSFERFLGILIEHFGGKWPFWISPRQI
                     LIVPVMPAVNDYVEELQQLLRDDKLNVDIDVSGNTMQKKIRTGQLAQYNFIFVVGAQE
                     KESRSVNIRNRDDPATQKQGVMIPLEEARTKLRALRKERRLVNTL"
     gene            <1155170..>1156073
                     /gene="GAR1_1"
                     /locus_tag="ACHE_10412S"
                     /db_xref="GeneID:66977369"
     mRNA            join(<1155170..1155245,1155310..1155357,1155416..1155516,
                     1155579..1155724,1155781..1155809,1155859..>1156073)
                     /gene="GAR1_1"
                     /locus_tag="ACHE_10412S"
                     /product="H/ACA snoRNP pseudouridylase subunit"
                     /transcript_id="XM_043278987.1"
                     /db_xref="GeneID:66977369"
     CDS             join(1155170..1155245,1155310..1155357,1155416..1155516,
                     1155579..1155724,1155781..1155809,1155859..1156073)
                     /gene="GAR1_1"
                     /locus_tag="ACHE_10412S"
                     /note="COG:J;
                     EggNog:ENOG410PPNM;
                     InterPro:IPR007504,IPR009000,IPR038664;
                     PFAM:PF04410;
                     go_process: GO:0001522 - pseudouridine synthesis [Evidence
                     IEA];
                     go_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="H/ACA snoRNP pseudouridylase subunit"
                     /protein_id="XP_043131532.1"
                     /db_xref="GeneID:66977369"
                     /translation="MSFRGGGRGGFATGANRGGNFGGRGGRGGFQPSFGPPAQVLEMG
                     SFMHACEGELVCESINPKIPYFNAPIYLENKTPIGKVDEVLGPINQVYFTVKPQEGIV
                     ATSFKPGDKVFIGGDKLLPLEKFLPKPKPPPGAAKPKRVTKPGARGGGMRGGRGAPRG
                     GRGGAPRGRGGFGGGFGGRGGAPRGGGFSRGGGRGGRGGPRGRF"
     gene            <1156523..>1157564
                     /gene="CHO1"
                     /locus_tag="ACHE_10413S"
                     /db_xref="GeneID:66977370"
     mRNA            join(<1156523..1156595,1156647..1156704,1156773..1156810,
                     1156872..1156883,1156947..1157128,1157196..>1157564)
                     /gene="CHO1"
                     /locus_tag="ACHE_10413S"
                     /product="CDP-diacylglycerol-serine
                     O-phosphatidyltransferase"
                     /transcript_id="XM_043278998.1"
                     /db_xref="GeneID:66977370"
     CDS             join(1156523..1156595,1156647..1156704,1156773..1156810,
                     1156872..1156883,1156947..1157128,1157196..1157564)
                     /gene="CHO1"
                     /locus_tag="ACHE_10413S"
                     /note="BUSCO:EOG09263MR4;
                     COG:I;
                     EggNog:ENOG410PKTK;
                     InterPro:IPR016271,IPR000462,IPR043130,IPR004533;
                     PFAM:PF01066;
                     TransMembrane:6
                     (i48-68o80-97i118-137o143-165i177-197o217-235i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0016780 - phosphotransferase activity, for
                     other substituted phosphate groups [Evidence IEA];
                     go_process: GO:0008654 - phospholipid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="CDP-diacylglycerol-serine
                     O-phosphatidyltransferase"
                     /protein_id="XP_043131533.1"
                     /db_xref="GeneID:66977370"
                     /translation="MSRRTTAMSSSNSSNSGKPASGDGGQEKQKMLLSAETGHFSMIR
                     ALHLADLVTELNGFCGVMSVFSSMRYCLGEPTDYGNIWAALAFMPFGLFFDFMDGKIA
                     RWRKKSSLMGQELDSLADLISFGLAPAAAAFALGARTPADHLFLTFFVLCGLTRLARF
                     NVTVAVLPKDKTGKSKYFEGTPIPTTLSIASLMAYWVSQGWILDDLPLGVVAQGTPFE
                     FHPIVLLFVLHGCLMVSKTIHIPKP"
     gene            <1160703..>1161611
                     /locus_tag="ACHE_10414S"
                     /db_xref="GeneID:66977371"
     mRNA            join(<1160703..1161012,1161071..1161537,1161588..>1161611)
                     /locus_tag="ACHE_10414S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279009.1"
                     /db_xref="GeneID:66977371"
     CDS             join(1160703..1161012,1161071..1161537,1161588..1161611)
                     /locus_tag="ACHE_10414S"
                     /note="COG:G,O;
                     EggNog:ENOG410PTCF;
                     InterPro:IPR002889;
                     PFAM:PF01822;
                     SECRETED:SignalP(1-25);
                     TransMembrane:1 (n9-20c25/26o173-197i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131534.1"
                     /db_xref="GeneID:66977371"
                     /translation="MRFSTIRSAFLTSTLFFAASVPVMAADSSSKGCYSDATPLEDQG
                     PYTFQSSGYCKTQCTKKNKAVYALYQGSNCLCGDEIPASSKKVSDDECNVSCNGYPSD
                     KCGGDNAYAVYLTGESDNVKTYGSSSSTDSSSSTSTDGTVETSGGHTVVVTAASETGA
                     TGEKSKDSGPNTAAIAAGVVVGVVGFCALVGAAFFLWRFRKRKGMQNEYARNAHIDNF
                     GKPKSTSSMSDSRFDGDFMAQRRQSNGSIDDDQDFSRRILKVTNPDRS"
     gene            complement(<1163102..>1164163)
                     /locus_tag="ACHE_10415A"
                     /db_xref="GeneID:66977372"
     mRNA            complement(<1163102..>1164163)
                     /locus_tag="ACHE_10415A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279020.1"
                     /db_xref="GeneID:66977372"
     CDS             complement(1163102..1164163)
                     /locus_tag="ACHE_10415A"
                     /note="COG:S;
                     EggNog:ENOG410Q2DH;
                     InterPro:IPR017853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131535.1"
                     /db_xref="GeneID:66977372"
                     /translation="MKYRGVVYDVGLRFQDQGFSVEPFDSVLVEYDMRVIANDLHANA
                     VRIEGEEVQRLTTAARAAHAMKLTVFFNPWKMNADVDETRAYFEEAAEAAEQLRNEGV
                     DIVFVAGCEYTIFSKGVFPGDSFNERGAWFGAQLAGFTLENIPETVREKSTKLNEILR
                     SFAEAIRAKFAGSLTYSAGTWEIVDWSIFDIVGIDHYRRGETEEQYVAGLQRHRSDKP
                     LVVMEVGCCAYEGAAERGDAGFILLKGTNPDGSGMFEDDVVPTRSEREQADYLGTQLV
                     LLANADVHAVFVYVFSFACMRMGEGAKDLDMMSYSLVKTFPDQNPRSRTMPPWAPKES
                     FHRVANFFRDHAAATSGSL"
     gene            <1166824..>1167921
                     /locus_tag="ACHE_10416S"
                     /db_xref="GeneID:66977373"
     mRNA            join(<1166824..1166975,1167033..1167140,1167199..1167772,
                     1167832..>1167921)
                     /locus_tag="ACHE_10416S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279031.1"
                     /db_xref="GeneID:66977373"
     CDS             join(1166824..1166975,1167033..1167140,1167199..1167772,
                     1167832..1167921)
                     /locus_tag="ACHE_10416S"
                     /note="COG:S;
                     EggNog:ENOG410PPW6;
                     InterPro:IPR036236,IPR013087;
                     PFAM:PF00096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131536.1"
                     /db_xref="GeneID:66977373"
                     /translation="MRRTSATLDIPLPITYTPTTHRISKAKKGKRVHACQYPGCEKVF
                     TRAEHRRRHELNHNPEALFRCTYSECQRTFHRQDLLNRHIERHELDAQMEHAARWKQT
                     QLPVAPQPYPSKNLMPTPFDSNMFLPTPQQSTSTSMSIDSLVTPEIRLDLTNDQPFQW
                     DGLDFPLYPQQPSLLRSPMPEPIDDNSSFYSYPESCASPSSSGGATFLSSRPGSSLSS
                     TPATTMESYQENYPEPILDCGLTSSPLPLQADLPPLDFSGVDISWSDIEPLSLDGDFA
                     PQPLQYNTAPAWTLPQEESDPQQYAAKSFFF"
     gene            <1169810..>1171215
                     /locus_tag="ACHE_10417S"
                     /db_xref="GeneID:66977374"
     mRNA            join(<1169810..1170051,1170128..1170446,1170508..>1171215)
                     /locus_tag="ACHE_10417S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279042.1"
                     /db_xref="GeneID:66977374"
     CDS             join(1169810..1170051,1170128..1170446,1170508..1171215)
                     /locus_tag="ACHE_10417S"
                     /note="COG:S;
                     EggNog:ENOG410PNG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131537.1"
                     /db_xref="GeneID:66977374"
                     /translation="MVVFVDLDDDAFSNQHHLPGGPEDALLQSFITRPEKASLMPSSK
                     RMSDSTTDESSVDSSDHLSTDRYSNQTTFSAALSCYPIIKELARCVDLNTLHALSQTC
                     RQFYTNLTPYRQQLTKRTLRCENEYIETLSDMLNSGAAIPESVKSVIQLLSQGTGQSG
                     RMTRGKVSKCARDMVGECRRCSKVICRNCTIKTPTNAMLKNRIRRLCITCRTVPISQH
                     MAYSASQDMQTVSPFDPSSFTAPAFLRTPCSCEDAVWLCYQCGHTIRREDTTYRRVWA
                     WRTRYSTHLGGLGTGLGEGCQGVKCGRGESCLAAQEIELELVSEADDDPDGLHNHGLL
                     QHTGENTISTLDDEEPGYFRQEIVGIGGRFKQKVKRRVMVGACVPEYEDERDTGRYLI
                     REEEGKHRGWCGWCWRVIPAKNETMNDYNP"
     gene            <1171591..>1173132
                     /gene="MPK1"
                     /locus_tag="ACHE_10418S"
                     /db_xref="GeneID:66977375"
     mRNA            join(<1171591..1171703,1171804..1171936,1172003..1172069,
                     1172126..1172440,1172492..>1173132)
                     /gene="MPK1"
                     /locus_tag="ACHE_10418S"
                     /product="mitogen-activated protein kinase"
                     /transcript_id="XM_043279053.1"
                     /db_xref="GeneID:66977375"
     CDS             join(1171591..1171703,1171804..1171936,1172003..1172069,
                     1172126..1172440,1172492..1173132)
                     /gene="MPK1"
                     /locus_tag="ACHE_10418S"
                     /note="COG:T;
                     EggNog:ENOG410PFQD;
                     InterPro:IPR017441,IPR008271,IPR003527,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004707 - MAP kinase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mitogen-activated protein kinase"
                     /protein_id="XP_043131538.1"
                     /db_xref="GeneID:66977375"
                     /translation="MADLQGRKIYKVFGQDFIVGDRYHVTKELGQGAYGIVCAANDTV
                     TGDGVAIKKVTNVFSKKILAKRALREIKLLQHFRGHRNITCLYDMDIPRPENFNETYL
                     YEELMECDLAAIIRSGQPLTDAHFQSFVYQILCGLKYIHSANVLHRDLKPGNLLVNAD
                     CELKICDFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCI
                     LAELLGGRPFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPF
                     DRLFPNANPDALDLLDRMLAFDPTSRISVEQALEHPYLHIWHDASDEPSCPSTFDFHF
                     EVVEDVAEMRKMIYEEVVNFRAAVRQQSQAHAAAVAAQQQQLGNVPIPEGQHGGWKHE
                     EPKPQEAGGGGGPANDLEASLARGMDAHHR"
     gene            complement(<1173655..>1175873)
                     /locus_tag="ACHE_10419A"
                     /db_xref="GeneID:66977376"
     mRNA            complement(join(<1173655..1175561,1175681..>1175873))
                     /locus_tag="ACHE_10419A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279064.1"
                     /db_xref="GeneID:66977376"
     CDS             complement(join(1173655..1175561,1175681..1175873))
                     /locus_tag="ACHE_10419A"
                     /note="COG:S;
                     EggNog:ENOG410PK89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131539.1"
                     /db_xref="GeneID:66977376"
                     /translation="MAVDGGSISSSAPPNHGMAQGPVEARSLSSITGIASNPPAYPRN
                     PTQKKLDPLELYIVRVPGSKDVFLSPLKPPTKDSVSAEAINASLYYLHVATPEDEALL
                     QEVEEEREQEAKLRREMHGDEAESGPMQQEFARLNNVRRKPVPGGAPTAGTGNADANS
                     ITPTPPPSLPSQENIAPAVPEHRPQASPPPPFAESVPDTEPPKEAGQRVQFMERKSTI
                     KRKPTIRSPVPQRPLPSVPNEEPLETMENGHPAKRNNRWSALAGYVNIQGLEGWKEKY
                     EAISNNRHSLDSRRTELRPPSSHESPRRSPGLSPSRRSHDSRSPDPSSGFHITLIRRD
                     PTHGTQWNVATISTTRLDEGAIDLEISTPGYNRFLAQDEPISLASLGLNSDKMNGPSF
                     SALQALQQQAESHGAVPHNDTHDNSSQEPAGPKRFRRKLCVSRPLQDEKRGSMDQQSA
                     PRGSIDSIGPGSPPPKTQSGHSLSKLKSGYYTFNSPWNGICTFSTSVNGRSLKCKHMI
                     PLQAPAGFPPISAQTVGSSPAVTVAEIRFNTPFQPGHLHHQPSPTHLSPWQLSQTPTF
                     ANPHADPNDQPLSTIPGNIPPERQSPPLQPTNPTSKRASLAQMLNPNRPRAHTTNNTL
                     GNIGLTRKPSTASTASKSSDDPDRLDFSLARERAGGGMRGKSAKLGKLVVEDEGIKML
                     DLVVAACMGVWWRGYYY"
     gene            complement(<1176579..>1177887)
                     /locus_tag="ACHE_10420A"
                     /db_xref="GeneID:66977377"
     mRNA            complement(join(<1176579..1177163,1177215..1177745,
                     1177864..>1177887))
                     /locus_tag="ACHE_10420A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279076.1"
                     /db_xref="GeneID:66977377"
     CDS             complement(join(1176579..1177163,1177215..1177745,
                     1177864..1177887))
                     /locus_tag="ACHE_10420A"
                     /note="COG:U;
                     EggNog:ENOG410PPN9;
                     InterPro:IPR019325;
                     PFAM:PF10176;
                     TransMembrane:2 (i226-247o326-344i);
                     go_process: GO:0007034 - vacuolar transport [Evidence
                     IEA];
                     go_process: GO:0030001 - metal ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131540.1"
                     /db_xref="GeneID:66977377"
                     /translation="MSSQRYQRVNAHDEDDPNHYPSNPSRSNSHLAPSSPPPSFHSRS
                     SSPSSRRLLNDDSRRADDTDQTLADAFDDGSDSEVENEPDDRQRLMRANPEPRAFAGG
                     SDYNNDDNGNGNAAASSSSQGGGQGQQDQTQQQGRGIFRRLTILPSFTPSSSAPGRVI
                     GSNDGVFANLAAKPERGEKNEDLPPSYEEAAADATPPYWETTILAPGISSDEVFVDGL
                     PVGSIFSFVWNAMISMSFQLVGFLLTYLLHTTHAAKNGSRAGLGLTLVQYGFYMKGGS
                     DPKPDDGGDADQYVNPPDPNSHNFDPDAVTDGGAGGDGNGAMSAISTSEWISYILMIV
                     GWFILIRAISDFLRARRHEQIVLQSPDRGLGIPVIAEGERAETVV"
     gene            <1178240..>1178692
                     /locus_tag="ACHE_10421S"
                     /db_xref="GeneID:66977378"
     mRNA            join(<1178240..1178254,1178303..>1178692)
                     /locus_tag="ACHE_10421S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279087.1"
                     /db_xref="GeneID:66977378"
     CDS             join(1178240..1178254,1178303..1178692)
                     /locus_tag="ACHE_10421S"
                     /note="COG:S;
                     EggNog:ENOG410PTDX;
                     InterPro:IPR037653;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_function: GO:0043022 - ribosome binding [Evidence IEA];
                     go_process: GO:0034551 - mitochondrial respiratory chain
                     complex III assembly [Evidence IEA];
                     go_process: GO:0070131 - positive regulation of
                     mitochondrial translation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131541.1"
                     /db_xref="GeneID:66977378"
                     /translation="MAKPPVRPQTLQTRISHLLSHWPSDPVRPASVSVQTYLQTRLSQ
                     ISPQDAAASQQQQHLPQNHQPQEMSEASLNALASLLEDRYTRRYPLSPKLRRPASNPD
                     HYDNVVKEFEEAPSRDWFGRLGKRLKGLLRFS"
     gene            complement(<1179023..>1180697)
                     /locus_tag="ACHE_10422A"
                     /db_xref="GeneID:66977379"
     mRNA            complement(join(<1179023..1179336,1179391..1180576,
                     1180635..>1180697))
                     /locus_tag="ACHE_10422A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279098.1"
                     /db_xref="GeneID:66977379"
     CDS             complement(join(1179023..1179336,1179391..1180576,
                     1180635..1180697))
                     /locus_tag="ACHE_10422A"
                     /note="COG:C;
                     EggNog:ENOG410PMDR;
                     InterPro:IPR004165,IPR004164,IPR012792,IPR012791,
                     IPR037171,IPR014388;
                     PFAM:PF01144;
                     go_function: GO:0008410 - CoA-transferase activity
                     [Evidence IEA];
                     go_process: GO:0046952 - ketone body catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131542.1"
                     /db_xref="GeneID:66977379"
                     /translation="MSSQLATCLRIARQFSTDPSKHQKFLARTFSSSARRYEINKVVA
                     SADLAIKDMKSNSTLLAGGFGLSGVPDTLINAVRANPSITGLTAVSNNAGVDGSGLGL
                     LLQSKQIRKMIASYVGENKTFERMYLTGEIELELTPQGTLAERCRSGGAGIPAFYTPA
                     AFGTVVQTGDLPLKHNADGTVALYSKARDVKVFDNKSYVMEEAIKGDYAFVKAWKADK
                     LGNCQFRYAAANFNGAMGRNAKMTIVEAENIVEVGELDPAAVHLPGIYVKRVIQSTTD
                     KKIEKYTFAKEEGEEKDAAALGKGDTANKRERIVRRAAKEFKNGMYANLGIGMPMLAP
                     NFVDPSVEVMLQSENGILGLGPYPKKGQEDPDLINAGKETVTLLPGAAVFGSDESFGM
                     IRSGRVNLTILGAMQVSAKGDLANWMLPGKIKGFGGAMDLVSNPSATKVVVTMEHTDK
                     KGNPKIVKNCEFPLTGKTCVSRIITDLCVFDVDFTNGLTLIELADGVTVDEVKAKTEA
                     PFKVADDLKPML"
     gene            complement(<1181509..>1185982)
                     /gene="UBP2"
                     /locus_tag="ACHE_10423A"
                     /db_xref="GeneID:66977380"
     mRNA            complement(join(<1181509..1182077,1182136..1182307,
                     1182365..1182785,1182838..1183516,1183572..1184109,
                     1184168..1184256,1184317..1184711,1184767..1184812,
                     1184862..1185072,1185128..1185882,1185961..>1185982))
                     /gene="UBP2"
                     /locus_tag="ACHE_10423A"
                     /product="ubiquitin-specific protease ubp2"
                     /transcript_id="XM_043279109.1"
                     /db_xref="GeneID:66977380"
     CDS             complement(join(1181509..1182077,1182136..1182307,
                     1182365..1182785,1182838..1183516,1183572..1184109,
                     1184168..1184256,1184317..1184711,1184767..1184812,
                     1184862..1185072,1185128..1185882,1185961..1185982))
                     /gene="UBP2"
                     /locus_tag="ACHE_10423A"
                     /note="BUSCO:EOG092604S1;
                     COG:O;
                     EggNog:ENOG410PGYH;
                     InterPro:IPR025305,IPR001394,IPR018200,IPR028889,
                     IPR038765;
                     MEROPS:MER0000865;
                     PFAM:PF13446,PF00443;
                     go_function: GO:0004843 - thiol-dependent
                     ubiquitin-specific protease activity [Evidence IEA];
                     go_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA];
                     go_process: GO:0016579 - protein deubiquitination
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ubiquitin-specific protease ubp2"
                     /protein_id="XP_043131543.1"
                     /db_xref="GeneID:66977380"
                     /translation="MSSLQRSGKTAPRLVQDVQDYDPAHPPGTGRNLLSDVPPVYPEY
                     YNGPQDFVSPLACRHQYARKEMQTFLSQPDQRRNTGTPSRVSAMGTKCRTHLQVIVNY
                     AGAIGQSGQNLSGHIHHFVYKSGRQRSGVSPVEVTPKGQVAESFHYECSYLSCSATTS
                     VRVLSPVLADDWVRLLTDVDLLAERTDAAIAAYPERMEGIARPPPISVLANLRIYITN
                     SIRDVQRSKSISAVNKRFMACFGVEGRPCGDLLEFLGFTFKEAEGLWDPPRPNPWAEY
                     PYQDQQKIFLDDVAHELAALMEQRPLSEKRGNQVDPIGSPASDDLLDALEALAYPKTT
                     RSNDFSMAPAPYYEDLGAVENMSSTLIVDAFNRQVSVDPGRTSLYLQCLKAIGELRGG
                     EDGAIIDQAVQVAYAEGKYTDDDIVTAYRYFGLSHDDIRLTEDSIIGKFYAFLSSTSQ
                     ETESRTQLWRIGDSRKSERIKSAAEDRVSNAEQAQVFLGVDDKTSDDFIITMYTAKVN
                     DNPTTRDLARRAVDLIAQSRKSEGLKHFLQTGEAGAGEMDVADAYRLLQIPDRTIDDG
                     AIMAAYTICIDEAPAQAETYNRALCLIAQDRESPLLSSMVPGAAAQPGRNISEWPVGL
                     QNIGNTCYLNSLLQFYFSVLPFREMVLDFENFRMEVDDEGIEKKQVGSRKVQKQEVER
                     SQKFLRELRILFNDMINSSRPYVIPGQELARLTLISPSNEAAIRRRSTISAGRPSGLG
                     EVDGMPILGPLGPPQTTTEEAEKRDPSENPGIAEAERPRRPISDGDSDATLVSETTKQ
                     GVPAVHADNQENASQQTDVVMENSENDAPETTNNGDMPPLGPADGPIAPPSQPPPVPP
                     RPTPQVDPQKQLIEEVEIGAQQDVTEVINNVLFQSQCAIRPIGIASDGEQLDQIKDLF
                     YGRTKSYLSTEKNVRSREEWWCDIKVDVATGSRDIYAAIDGAFDVQKVNIDNSIAEQY
                     GAISKLPPVLQVQVQRVQFDPVKKSSFKSTHHLDLKETIYLDRYMDTQHPEILKRREQ
                     CWGWKKSLKKLEARRADLLRKNESDGLDMPTLFSSTKDLLDDLNSMKEDPEAAQDALD
                     INPQLASELGQLSQITQTELSHIEKEIRDTQAMISSQFADYRHLAYRLYAVFVHRGSV
                     SFGHYWIYIYDFKNNVWRKYNDSEVTEVQDPSEIFQDRQEQNPSTPYFLVYVNDTMKD
                     RLVNPVCREIVDPQSNAQTFPETEQDTAMQEAIMASQQPTEGDVNMDPPAYDEASGGA
                     PGTGADLPSLTQEKKAYGNEGKWPSDTQTNTNDAQW"
     gene            <1186323..>1187260
                     /locus_tag="ACHE_10424S"
                     /db_xref="GeneID:66977381"
     mRNA            join(<1186323..1186650,1186724..1186843,1186914..1187111,
                     1187166..>1187260)
                     /locus_tag="ACHE_10424S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279120.1"
                     /db_xref="GeneID:66977381"
     CDS             join(1186323..1186650,1186724..1186843,1186914..1187111,
                     1187166..1187260)
                     /locus_tag="ACHE_10424S"
                     /note="COG:O;
                     EggNog:ENOG410PNSI;
                     TransMembrane:2 (i133-150o156-179i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131544.1"
                     /db_xref="GeneID:66977381"
                     /translation="MELHCSSRKAVSHGRTALPNSESITGPPANNYESRQTIHHPSTP
                     STATMAAEHTETHYHPHDAIGAAMKATTLTGGVGLFAAAVQNTLTKQNVGPLGIFFKS
                     GGTIGIFAAMGGTYEFVKTASANLREKEDHWNVAIGGFFSGAILGLRARTFPALMGYG
                     AGLAIGMSGFNYAGGLWGYKRDKDLSVDEFERRTQLRKNYRTPGEQTLAELGEGRGLY
                     GPGYAERRRERIKEAYGYDVPTTQAPAS"
     gene            <1189115..>1192077
                     /locus_tag="ACHE_10425S"
                     /db_xref="GeneID:66977382"
     mRNA            join(<1189115..1189760,1189822..1190309,1190369..1190706,
                     1190754..>1192077)
                     /locus_tag="ACHE_10425S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279131.1"
                     /db_xref="GeneID:66977382"
     CDS             join(1189115..1189760,1189822..1190309,1190369..1190706,
                     1190754..1192077)
                     /locus_tag="ACHE_10425S"
                     /note="COG:T;
                     EggNog:ENOG410PIQP;
                     InterPro:IPR043453,IPR001849,IPR033191,IPR011993;
                     go_component: GO:0031932 - TORC2 complex [Evidence IEA];
                     go_function: GO:0005546 -
                     phosphatidylinositol-4,5-bisphosphate binding [Evidence
                     IEA];
                     go_process: GO:0016197 - endosomal transport [Evidence
                     IEA];
                     go_process: GO:0030036 - actin cytoskeleton organization
                     [Evidence IEA];
                     go_process: GO:0038203 - TORC2 signaling [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131545.1"
                     /db_xref="GeneID:66977382"
                     /translation="MAMAARPPSPLVQDAYGPIPQQPNNNAANFNNDGATHPDVVALS
                     RGYGSRSNSRPNSFVASSAASNVAHGALLDPPSIAAGSRYYQPPYQQHHHNPRFHEDF
                     DAASQRGSVVLEGPSAVQATAAATPGVQRSVSQMSQSRSATPTRTSTLKKRASLTKRG
                     SMRRSGSKKSMRAGSVRSLDRERYGADGVDDINSAFTVPIPTDGNPTEALANRFQSWR
                     KILKDLIIFFKEIQKSYEMRSKLFLSASNVINNSTMPPSFLKSGGIADATEILRDFHR
                     QGYLEANKAAEVESEVVNQLMSLRNDLHKKIKEIKGLASDFKNTVEKEVDGTRKSVRN
                     LHEALDLVDSDPAAASGRGDPFIVRLNVDRQIEKQIEEENYLHRAYLNLENSGRELES
                     IVVSEIQKAYNAYASVLKREADEAYDTVEKLRAGPIGMPQDHEWNSFIASTDDMVDPR
                     VPLRNVENITYPGRDHPAAAEVRSGMLERKSKYLKSYTPGWYVLSPTHLHEFKSADLV
                     ASQTPMMSLYLPEQKLGQHSQPNSSSYKFMLKGRQTGTMHRGHSWVFRAETHETMMSW
                     FEDIGSLISKTGEARNAFVRRHVRSISGNSISFSGGSDAMEDEEDEADRTPYSSEAAL
                     MNVERPTSQPRQPGGRFPSDVHIDRHLQVPLSPSSGESSGDRDLLAVVGSSGPDRSTS
                     PLEGYGNRLSAVSDRDGDAGSTARSSVHGVNDASSLGPGRVERHDSYYGDWIGPAALA
                     ARQQQQAQYKAYNPPAQNEQGLLQPDERRPLSSSDSNLLASTGSTHSQDPSSTGFRRR
                     RESASTAPTTTNVTNVTDHTSNTLPTSIDEPSIVGTGDPAGPHRRQPTDETLKEDPTS
                     AAIKMDGVSTTDFPVRGISPGRSASNQFDPSMVGEELKPTTTAATGTTGTTGRTKGSV
                     STLELKIPGHYPPHVAA"
     gene            complement(<1192735..>1193319)
                     /locus_tag="ACHE_10426A"
                     /db_xref="GeneID:66977383"
     mRNA            complement(join(<1192735..1192860,1192921..>1193319))
                     /locus_tag="ACHE_10426A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279142.1"
                     /db_xref="GeneID:66977383"
     CDS             complement(join(1192735..1192860,1192921..1193319))
                     /locus_tag="ACHE_10426A"
                     /note="COG:C;
                     EggNog:ENOG410PMBI;
                     InterPro:IPR001155,IPR013785;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131546.1"
                     /db_xref="GeneID:66977383"
                     /translation="MISFFGTQSVGVKLCPSDDYNDSAASFKEITETYIYYINQIMAR
                     EVGFINLSGRGCDVSREGTDEYFKPSPRPEGLELPVVYELVQQFGGLIKYPGSKTMLM
                     VNHEYSVEAERVVREGVVDLVAFGRPFIYNPDLVSRVRNGIPLPGNDRGERVNYGSYE
                     TVDEYYNDWPRAVA"
     gene            complement(<1193558..>1194238)
                     /locus_tag="ACHE_10427A"
                     /db_xref="GeneID:66977384"
     mRNA            complement(join(<1193558..1193653,1193730..1193831,
                     1193891..>1194238))
                     /locus_tag="ACHE_10427A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279153.1"
                     /db_xref="GeneID:66977384"
     CDS             complement(join(1193558..1193653,1193730..1193831,
                     1193891..1194238))
                     /locus_tag="ACHE_10427A"
                     /note="COG:C;
                     EggNog:ENOG410PMBI;
                     InterPro:IPR001155,IPR013785;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131547.1"
                     /db_xref="GeneID:66977384"
                     /translation="MTSPALLHPTTLDPLSLRNRICMASLTRNRCTDANKPTLASIHH
                     YTDRACDGAGLIVAEVTFVYLNGRSGRMRRYVRQESCGGLEEGYGWGAWGWGEDFISA
                     VPPWCFSFLDFDVNNENMPMLKKIGYPVLAPSKIKTKGGKVRTLERLPGYTENIAEIE
                     DPQVIVEQCRHSVALAKGSLV"
     gene            complement(<1194866..>1196609)
                     /locus_tag="ACHE_10428A"
                     /db_xref="GeneID:66977385"
     mRNA            complement(join(<1194866..1195162,1195219..1195661,
                     1195717..1195768,1195828..1195965,1196020..1196113,
                     1196167..1196174,1196286..1196338,1196504..>1196609))
                     /locus_tag="ACHE_10428A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279164.1"
                     /db_xref="GeneID:66977385"
     CDS             complement(join(1194866..1195162,1195219..1195661,
                     1195717..1195768,1195828..1195965,1196020..1196113,
                     1196167..1196174,1196286..1196338,1196504..1196609))
                     /locus_tag="ACHE_10428A"
                     /note="COG:A;
                     EggNog:ENOG410PJTU;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131548.1"
                     /db_xref="GeneID:66977385"
                     /translation="MMQNVRESSQQDRRVYVGNLSYDVKWHHLKDFMRQAGEVLFADV
                     LLLPNGMSKGCGIVEYATRDQAQNAVNTLSNQNLMGRLVYVREDREAEPRFTGGPPRG
                     EFGAGRGGFGGGFGGGGFGAGAAGRQLYVNNLPFNVGWQDLKDLFRQAAQQGTVIRAD
                     VHTDPTGRPKGSGIVAFESPDDARNAIQQFNGYDWQGRMLEVREDRFAGGPPGFGGRG
                     GFGGGFGGRGGFGGRGGGFGGRGGFGGGFRGGYSGGPGGFGGPGGPGGPGFEPVSAVP
                     PNPFTDFATSGGDRSAVIYVRNLPWSTCNEDLVDLFSTIGKVDRAEIQYEPNGRSRGT
                     GVVQFDSPETAETSIAKFTGYQYGGRPLGITFVKYMNAGPGEPDAMDSDFQPPSGITQ
                     DQIM"
     gene            <1198220..>1198897
                     /gene="COQ9"
                     /locus_tag="ACHE_10429S"
                     /db_xref="GeneID:66977386"
     mRNA            <1198220..>1198897
                     /gene="COQ9"
                     /locus_tag="ACHE_10429S"
                     /product="ubiquinone biosynthesis protein Coq9,
                     mitochondrial"
                     /transcript_id="XM_043279175.1"
                     /db_xref="GeneID:66977386"
     CDS             1198220..1198897
                     /gene="COQ9"
                     /locus_tag="ACHE_10429S"
                     /note="COG:S;
                     EggNog:ENOG410PNI5;
                     InterPro:IPR012762;
                     go_function: GO:0008289 - lipid binding [Evidence IEA];
                     go_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein Coq9,
                     mitochondrial"
                     /protein_id="XP_043131549.1"
                     /db_xref="GeneID:66977386"
                     /translation="MAQPFLLSLPRRGLTPSPRLSLTSPSRTIASCSRFTPTRPQHHY
                     QPHQPQQPQLLQRNYHSENHPSTPPQENEYSNSQLTILSAALAHVPRHGFSRDALILG
                     ARDSGFLDVSVQLLPRGEFDLVLFWLASRRGLLRDVAEKLKGKEMGVEKKVRCLVMER
                     LRMNEMVKTEWQGVSSCPSFSYNKSVIGCGEVVLTDILCRRWHLCPSLEISPSPSPNF
                     TPSRLIS"
     gene            complement(<1199217..>1200551)
                     /locus_tag="ACHE_10430A"
                     /db_xref="GeneID:66977387"
     mRNA            complement(<1199217..>1200551)
                     /locus_tag="ACHE_10430A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279187.1"
                     /db_xref="GeneID:66977387"
     CDS             complement(1199217..1200551)
                     /locus_tag="ACHE_10430A"
                     /note="COG:S;
                     EggNog:ENOG410PP36;
                     InterPro:IPR043837,IPR040009;
                     PFAM:PF19189;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131550.1"
                     /db_xref="GeneID:66977387"
                     /translation="MATSRKWLLAARHSSITPFLYQTRTLAAPTLRTSYSTTADGLDE
                     ETSNPSSTSPSSTTTSTERAPRPSFLQKHAASRLSSSRDASKKRKVAMTRSERKAFGE
                     LLGELQKSEPYPAFAASQGLKKKPESGNSRGDEMSQLSEIFESVLAEVRGKDKRGGER
                     RQLRRRSVHAEEEGDEEDEMWAEMTLGEGGETVVDISAILGEEGKQVPMQRAVRIIVK
                     REAKKIENMLREAVSDDKGDIGIWDVCKARIFSMLEHIGPNTVSGQRKRHSQQEQEQP
                     TLEIPPSVPVEPVVVSLYPKMLLVAFRLLNQHYPKSQLIGQFRSTIKSHGRASAVLGT
                     STGLYNELITFYWQGMNDLAGVTSLLQEMEVIGVDANERTCHILKEILRQRDRDLKEH
                     WYRRRQVEEGGKVRTREPWWDMAPNRRAVRDLLGPEGWVSRLEARVQKRRSV"
     gene            <1200913..>1202622
                     /locus_tag="ACHE_10431S"
                     /db_xref="GeneID:66977388"
     mRNA            join(<1200913..1201468,1201520..1202348,1202403..>1202622)
                     /locus_tag="ACHE_10431S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279198.1"
                     /db_xref="GeneID:66977388"
     CDS             join(1200913..1201468,1201520..1202348,1202403..1202622)
                     /locus_tag="ACHE_10431S"
                     /note="COG:S;
                     EggNog:ENOG410PFUE;
                     InterPro:IPR015943,IPR001680,IPR036322;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131551.1"
                     /db_xref="GeneID:66977388"
                     /translation="MPAEELSEFEKQRLANIAERDQLLKKLKQEAQSSGLALPPPPRP
                     TAKKPPTDSSRPKKKPAPRKPVAQDDPAPRRVSSRLRGIAADSEVAKRKADEQQEALM
                     EAERAKKVRKSDAFSFNEMVVSGQKLSLGGEGLIGVDVVTKGVAKPYERTFGDEDIKM
                     TTDEDLKALREEMSGLQLWEAWEPNRIKLTPERIYTMTFHPSETKPLIFAGDKMGHLG
                     VLDASQEKPVSVKNEDDEDAEDDPDPILTTLKPHTRTISSMTIHPAKPTHLYTASYDS
                     SIREMDLEKTTSVEKYAPTSLADDLPLSGIDMAPDDPNTVYWTSLEGAFGRHDMRAPP
                     PSSTEVVESWQLSEKKIGGFSLYPTHPHYFATASLDRTMKLWDLRKLSRDEPVPVGEH
                     VSRLSVSHAAFNSAGQVATSSYDDSLKIYDLAAQGINTWPEGHGKTLSDEQMKPDTVV
                     RHNCQTGRWVTILRPQWQQNPQSPIQRFCIGNMNRFVDVYSSSGDQLAQLDGEGITAV
                     PAVSVFHPSKNWIVGGTASGKVCLWM"
     gene            complement(<1203214..>1207092)
                     /locus_tag="ACHE_10432A"
                     /db_xref="GeneID:66977389"
     mRNA            complement(join(<1203214..1204187,1204245..>1207092))
                     /locus_tag="ACHE_10432A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279209.1"
                     /db_xref="GeneID:66977389"
     CDS             complement(join(1203214..1204187,1204245..1207092))
                     /locus_tag="ACHE_10432A"
                     /note="COG:T;
                     EggNog:ENOG410PJIU;
                     InterPro:IPR001936,IPR023152,IPR000008,IPR008936,
                     IPR039360;
                     PFAM:PF00168,PF00616;
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0043087 - regulation of GTPase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131552.1"
                     /db_xref="GeneID:66977389"
                     /translation="MESENQHGTKRSSTHQGGIYSHAVERRSSKKSSSKDRRGMVYHP
                     ESFKGTGIRAVTPESDTDKQFPLPDADYVPGSSVPSPRATHRVRTVDGDRREHQYPHS
                     VGDEAEASNAMNGRIRSRTTTTNEERTEVPSNNTMLPWRRFGSFHTSGSQVRTPDEQP
                     STMSSPATYSPSSFGERPRPGRPPGVLTGLNSLNASSLTSPISNSDSAKILHLMKTTS
                     GRMHGVLSFRTSNQTAWTSGVCAINVATGSLVYLIYQAKGEPALTKTLIPDLRGCRVR
                     TLYDPDFQNNYLTVSTFTSGLGVQLRPHVSETFDSWLAALLCWQPIRPRGVRNKMTKP
                     QPVTIGERRYPDRHRRNSEGTVQKDAAIIKVGKMLLWDKPTASGARPASSRQISSSRQ
                     QRTLKSSWQRVSCTLQENGHFKLFTESDVSLLNSVQLSQLSRCAVQQLNASVLEDEFC
                     IAIYPQYAAHANIDPSQIRPIYLSLESRVLFEVWFVLLRAFTVPELYGPESSLEDDLR
                     PVNLQPAPTPPAATASTADMFRIERSLTVKVTEAKLFRTREDTPQKGRKQSRSHGHST
                     TVRSAEGDYYTEVTLDGEIRAKTAVKYRTANPFWREDFIFHDLPPVLSQASLLVKTLN
                     PAQKDWTLIAHGTYLISQSRDISTIPLDDVEVCAHDLTYGRVELRLDDLEPGVETEKW
                     WPILDDKDQPVGEMLMRARMEETVVLMSQEYEQMSELLHSFTNGLTVNMAQIISSELN
                     QLSETLLNIFQVSGQAVEWISALVEDEIDGVHKESTVNRLRYTTRIQSNDARESNQER
                     EFLVRDLGRTATVEANLLFRGNSILTKALDFHMRRLGKDYLDETIGDRLRSIDEENPE
                     CEVDPSRVHRSDDLERNWNHLISLTTGVWKAIASSASRCPPELRLIFRHIRACAEDRY
                     GDFLRSVTYSSVSGFLFLRFFCPAILNPKLFGLLKDHPRPRAQRTLTLIAKALQGLAN
                     MTTFGSKEPWMEPMNRFLISNRVEFKEFVDSICAIPADRPAPIVTPSYATPIQILGRL
                     PPTSREGFPSLPFLLDHARSFSNLVRIWLEVAPPRLAELEEIDPVLQNFHETAIRLHQ
                     RTRECLDRAEEAERPNGNLVVKWEELVELMERSATFYDDANSSMPATPAADSALASSA
                     TVTNNHRNSIGYFARPYLPRRSTDYEQQQQQVDDETPPSSSSATWDASRVPFTIPRWS
                     EARDSASSSKNSSTFSLDSPEITTRSGRRSSVSRESSGRYRGLFEFPRRKAKERDHSQ
                     HQPREEVRNES"
     gene            <1209854..>1212777
                     /gene="ATG9"
                     /locus_tag="ACHE_10433S"
                     /db_xref="GeneID:66977390"
     mRNA            join(<1209854..1210602,1210665..>1212777)
                     /gene="ATG9"
                     /locus_tag="ACHE_10433S"
                     /product="autophagy protein atg9"
                     /transcript_id="XM_043279220.1"
                     /db_xref="GeneID:66977390"
     CDS             join(1209854..1210602,1210665..1212777)
                     /gene="ATG9"
                     /locus_tag="ACHE_10433S"
                     /note="BUSCO:EOG092615CC;
                     COG:U;
                     EggNog:ENOG410PH3Z;
                     InterPro:IPR007241;
                     PFAM:PF04109;
                     TransMembrane:5
                     (i243-262o295-313i461-481o547-568i650-671o);
                     go_process: GO:0006914 - autophagy [Evidence IEA]"
                     /codon_start=1
                     /product="autophagy protein atg9"
                     /protein_id="XP_043131553.1"
                     /db_xref="GeneID:66977390"
                     /translation="MMKSNILSRILPPAGSPSVYEAIQEQDADSNASDVEERAGLAWD
                     EKRGGDHYNDQELEEAIADAQGSVLSSPSNSTTAFLAQDRSSREGKGKGKATSRHRKP
                     SRPRWAQDGPPEYDADDADEDVPASLLVEGNHDDDELRSRLPPPPRSYPHHPSPDPGP
                     SSRSNRSRWETNRAAMEQGTRDGPQRQREPPAARWSIGQHPNLAFVDPKEKAMWRWAN
                     VENLDNFLEDVYAYSQGNGIWSISLGRVIGLLNFAFIVGFSTFLTNCIDYSNVRGSRT
                     LDDILIKRCTTNMSTTSTFLLWVLTFFWIERAFRYLLDLRRLKHMHDFYYYLLGISDA
                     EIQTISWQEIVSRLMALRDANPATARVSSQHRKLMGSQSKQRMDAHDIANRLMRKENY
                     LIALVNKDILDLSLPVPFVRNRQLFSKVLEWNIYLCIMDYLFNEQGQIRTLFLRDTHR
                     KALAEGLRRRFVVIGILNIFVAPFLVVYYLMHHFFRYFNEYKKNPSQIGSRQYTPLAE
                     WKFREFNELDHLFQSRTNISYPYASRYIDQFPKDKTVQLAGFVAFISGAITSVLAVAS
                     LVDPELFLGFELTNDRTVLFYLGVFGSVWAVARGLAPEENDVFDPEYALLEVIRYTHY
                     FPSHWKGRLHSDEVRKEFAMLYQMRIIIFLEEVLSIIFTPFILWFSLPKCSERIIDFF
                     REFTVHVDGLGYLCSFAVFDFKKGTNEITQGPAGRQRNAHDPSRQDPRADYFSTKDGK
                     MLASYYGFLDNYGANPRPSGRRPFHPPPAFPTLGSPSGIDLGQYPYPRSGPAAGAPGS
                     TMIGQMSTAGPRFGAPGAMDHLSPAPSMLLDPHHQPSTMNRTSAHPIYRASRAVPRVA
                     GPIEHGDEPPSITTNARRLVPQLPAHTTTASSGGIGESESNLGDSWRMNLMGSGEGEE
                     EGEEGENVDRIVEGPGVLGLIQQFQKANNDGRGRTTVGI"
     gene            <1213377..>1214652
                     /locus_tag="ACHE_10434S"
                     /db_xref="GeneID:66977391"
     mRNA            join(<1213377..1213383,1213445..1214516,1214604..>1214652)
                     /locus_tag="ACHE_10434S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279231.1"
                     /db_xref="GeneID:66977391"
     CDS             join(1213377..1213383,1213445..1214516,1214604..1214652)
                     /locus_tag="ACHE_10434S"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131554.1"
                     /db_xref="GeneID:66977391"
                     /translation="MAKLSALHTASCPRTRTITELAKVLDEHRVALVRGPPSSGKTTL
                     ARLLQSYYVSREEPVVFLTGWPRKTVDPPIYLYEKCKEAGYEEVDYMTVQYSNITFII
                     DEAQQSYNDKALWRGLIKSQSGCQSGARICLFASYGNPVMGTPEGPGGPPVHFESEQR
                     VSLLRYYASHGPHSNNLGLFYTVEEFEYVLLLWSAVNEVEIAPVARKVLYYVTGGHPG
                     AVESLVAYILVCFLSCSHFSYLRDVVHVLQAYYHCEVENNSIKTITEKHLMDSLEDGP
                     NLFASLQTTVFFRSFPTSQQLALTPAAATALRRIIQEGTIPCDLDDHGVELCFKRGWV
                     HTDYTHSSPAGVENLVCFLPTRLHVKILEDLLGINQPGSFF"
     gene            <1215264..>1217865
                     /locus_tag="ACHE_10435S"
                     /db_xref="GeneID:66977392"
     mRNA            join(<1215264..1217776,1217829..>1217865)
                     /locus_tag="ACHE_10435S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279242.1"
                     /db_xref="GeneID:66977392"
     CDS             join(1215264..1217776,1217829..1217865)
                     /locus_tag="ACHE_10435S"
                     /note="CAZy:GH47;
                     COG:G;
                     EggNog:ENOG410PKHB;
                     InterPro:IPR036026,IPR012341,IPR001382;
                     PFAM:PF01532;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0004571 - mannosyl-oligosaccharide
                     1,2-alpha-mannosidase activity [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131555.1"
                     /db_xref="GeneID:66977392"
                     /translation="MLVPRRYRGLLIFAVVFAVVFFHFVRSHDWQIVFPGDYHDHHPH
                     FPPPPGDLFSQNPPSLDFVPGPPPHQQTANTKQSHENANQVGVKTSGNGDGQAQNAGL
                     GGSGLRKQQQKQGNQGKQKQGLSMFPVKRPPPHWKKVPEIFPLAPEERITLPTGQPKS
                     LPKLQASFEVESVEEERKRLERLDDIRKTFEYAWNGYKSSAMGKDELKPLRGGYKDTF
                     NGWGATVVDALDTLWVMGLEEEFALAVEHVKSIDFTTSEKLEIPVFETVIRYMGGLLG
                     AYDISDQQYPVLLEKAVQLAEILMGAFDTPNRMPTLFYKWTPDQASRVHHASRRAVLA
                     EIGSLSMEFTRLAQLTKDDKYYDAIARITNELESVQSSSKLPGLWPTKLDATGCEKPI
                     PAHAVVRDVPSPSNSSTTPVLTPSARPAPTDIRSYTHYFERRGESGLAQDAQPADYEQ
                     LIKEKNPDSYIVPANSDCKGALITQNSYKDAFGLGAEADSTYEYLPKEYMLLGGLNDQ
                     YKSMYEKAMDTAREHLLFRPMVKHGRDIRFLATLDLSKPLAELQPNQIPTRYEATHLT
                     CYAGGMFAVGSKLFGIDGDMDIAAKLTDGCVWAYESTYTGIMPETFLVIPCKKGESCT
                     WDEARYKDALDPWREERLAAMQKLKEQAIEAKESQEVAVEADEPAATPEKNAVIYERN
                     GVKRDATASQTTETPVPTGPRVKVTRRSLLSPLPGDPASALADDYVKTRIREERLPPG
                     FVRMTDRRYLLRPEAIESVFIMYRLTGDNYWREKGWRMFEGISKHTRTNFAHSAIEDV
                     TSMHPEFQDSMESFWLSETLKYFYLLFSEPSVVSLDEYVLNTEAHPLKRPT"
     gene            <1218371..>1220703
                     /locus_tag="ACHE_10436S"
                     /db_xref="GeneID:66977393"
     mRNA            join(<1218371..1218416,1218518..1218610,1218696..1218814,
                     1218882..1219235,1219284..1219437,1219487..>1220703)
                     /locus_tag="ACHE_10436S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279253.1"
                     /db_xref="GeneID:66977393"
     CDS             join(1218371..1218416,1218518..1218610,1218696..1218814,
                     1218882..1219235,1219284..1219437,1219487..1220703)
                     /locus_tag="ACHE_10436S"
                     /note="BUSCO:EOG09264MGU;
                     COG:T,Z;
                     EggNog:ENOG410PI83;
                     InterPro:IPR018556,IPR000971,IPR030125;
                     PFAM:PF09431;
                     go_function: GO:0020037 - heme binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131556.1"
                     /db_xref="GeneID:66977393"
                     /translation="MESEVILEREQQFWDELQQIVSTPCDSEDLIDNVLRSYLSLTVQ
                     YKDEYLNSELDISRCSFKLFSSTLYASHGDYVRRQLLYGLLQEDDPKTLHLISSFLLF
                     DGRQNEATFHAMNDEGAFPRLLELLQKRKNDSHGHSDEDEDGGAGLHRMLMDLLYEMS
                     RVQRVKIGDLVLVDDDFIKGLFELIENLSDDVNDPYHYPVIRVLLVLNEQFMISAHDP
                     IDERSGFLTNKVIKVLSMQGNYYKTFGENIILLINREAETSLQLLTLKLLYLLFTTPS
                     TFEYFYTNDLRVLVDILIRNLLDLPEEASALRHTYLRVLYPLLAHTQLRYPPYYKRDE
                     LKRMLNILMRGQLSGQETDEEKIQHFEDVDETTKRLVMRCATVEWLRDVEPEVESQAA
                     SRTGSVFATTGEPLEASQITSSSSSSDRDTASPTGHQQAPGSPDVRHHHRKLSAVKRL
                     GMHLEPASTSSLSVREVASQHEKPGVITPSRADLPPETEFVHPGAKPKPKVKPEPPKA
                     RRWRGRRNHEEDENADRIPEDSPIPSSPIPRAVTPTPPPPPPIAGNRRRSTSTSSSLA
                     PPVSAHSRRSASNPPPAVPPPRRSATHPAVQSQNSQYNNQSNLNSMVQQGKYGQRPEP
                     PKTRRWGRKQAQQSEQSGTREHTVSVEEAVQNASLE"
     gene            complement(<1220849..>1222069)
                     /locus_tag="ACHE_10437A"
                     /db_xref="GeneID:66977394"
     mRNA            complement(join(<1220849..1221936,1222000..>1222069))
                     /locus_tag="ACHE_10437A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279264.1"
                     /db_xref="GeneID:66977394"
     CDS             complement(join(1220849..1221936,1222000..1222069))
                     /locus_tag="ACHE_10437A"
                     /note="CAZy:GH17;
                     COG:G;
                     EggNog:ENOG410PH6W;
                     InterPro:IPR017853;
                     SECRETED:SignalP(1-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131557.1"
                     /db_xref="GeneID:66977394"
                     /translation="MRHLTQALITLNALLVVAVAAPHGISYSHIQHHKRDVPNPNLAP
                     NLGTNVEVELHPSPRHHNNHDHHHGGHGHGHHGKPPQLPPKKRKFGISYSPYNTDSTC
                     KSQDEVNADIDRLVSLSTPPPAENNEGAESDYSFIRIYGIDCNQTATVTTAAKRHNLR
                     VFAGIFDFSDFPHSLDAIIDVAHSHSTDPEKRDERAQQNGWDIFHTIAIGNELVQTHQ
                     ATIPEVISALHQARSILRSAGYQGPVVTVDTYTMLLAHPELCEASDYCAANCHVFFDA
                     TQTPDKAGDYAIDVAKRISKGTEGKNGGRKRTVIAESGWPHDGTANGKAVPSEENQRV
                     AVDSLRRVFREQGEDEGDGDAGLVLFTAFDDLWKTDNEGTFGAEKFWGINR"
     gene            complement(<1223130..>1224821)
                     /gene="LCB1"
                     /locus_tag="ACHE_10438A"
                     /db_xref="GeneID:66977395"
     mRNA            complement(join(<1223130..1223312,1223360..1223851,
                     1223913..1224423,1224493..>1224821))
                     /gene="LCB1"
                     /locus_tag="ACHE_10438A"
                     /product="serine palmitoyltransferase component"
                     /transcript_id="XM_043279275.1"
                     /db_xref="GeneID:66977395"
     CDS             complement(join(1223130..1223312,1223360..1223851,
                     1223913..1224423,1224493..1224821))
                     /gene="LCB1"
                     /locus_tag="ACHE_10438A"
                     /note="COG:O;
                     EggNog:ENOG410PGFC;
                     InterPro:IPR004839,IPR015424,IPR015421,IPR015422;
                     PFAM:PF00155;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="serine palmitoyltransferase component"
                     /protein_id="XP_043131558.1"
                     /db_xref="GeneID:66977395"
                     /translation="MDIQETQRLLSEYLHELANLFHQLPGSAIFLRYVKSSYQDDPVR
                     SMVELFLFLFAVRYLLAPKYSTKPGVVQLSDDEVDDLVDEWTPEPLVGSPTPLEEMEV
                     EKRAVIVGPVGPKSKLSNGRTVMNLGSVNFYNFNTNESLKEKAIQTLRNYGVGPCGPR
                     GFYGTQDVHMKTEADVASYLGTPACIIYAQAFSTISSVIPAFSKRGDIIVADKGVSFA
                     VRKGIQISRSIVRWYEHNDMEDLERVLAKVTKEQARKPLTRRFIITEGIFESHGDMVN
                     LPKIIELKLKYKFRLILDETWSFGVLGRTGRGVTEHQNVDAAEVDMIVGSLAGPLVAG
                     GGFCAGSEEIVHHQRISAAAYTFSAALPAMLSTTASATINLLQSNPDIISQLREQTKV
                     LRAQLVPRSDWVYCTSAPENPVIILPLKPEVVASKRLSFEDQQFLLQDIVDECTTNGV
                     LITRVKTLDDNFEPRQLLLPALKVCVTIGLTRKEIEKAGTVIRHAITKIVSRKK"
     gene            complement(<1225515..>1231360)
                     /gene="FKS1"
                     /locus_tag="ACHE_10439A"
                     /db_xref="GeneID:66977396"
     mRNA            complement(join(<1225515..1225842,1225899..1231169,
                     1231230..>1231360))
                     /gene="FKS1"
                     /locus_tag="ACHE_10439A"
                     /product="1,3-beta-D-glucan synthase"
                     /transcript_id="XM_043279286.1"
                     /db_xref="GeneID:66977396"
     CDS             complement(join(1225515..1225842,1225899..1231169,
                     1231230..1231360))
                     /gene="FKS1"
                     /locus_tag="ACHE_10439A"
                     /note="CAZy:GT48;
                     COG:M;
                     EggNog:ENOG410PHH8;
                     InterPro:IPR003440,IPR026899;
                     PFAM:PF02364,PF14288;
                     TransMembrane:16
                     (i480-499o519-540i560-582o588-616i649-671o721-747i1326-
                     1345o1378-1399i1411-1434o1491-1513i1584-1605o1625-
                     1652i1664-1690o1702-1722i1761-1787o1821-1845i);
                     go_component: GO:0000148 - 1,3-beta-D-glucan synthase
                     complex [Evidence IEA];
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0003843 - 1,3-beta-D-glucan synthase
                     activity [Evidence IEA];
                     go_process: GO:0006075 - (1->3)-beta-D-glucan biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="1,3-beta-D-glucan synthase"
                     /protein_id="XP_043131559.1"
                     /db_xref="GeneID:66977396"
                     /translation="MSGYPGGHYDDGYGHPHGDSYYQDEHGQGYYDPNDYGDGYYDQH
                     GYYPADGYGHEGGYYDGQQDGYYGDPYYDGGNGHQSYGGGRRRGDSEDESETFSDFTM
                     RSETARAADMDYYGRGDERYNSYADSQYGGRGYSYRPPSSQVSYGANRSSGASTPVYG
                     MDYGNALPAGQRSREPYPAWSSDAQVPVSKEEIEDIFLDLVNKFGFQRDSMRNMYDHL
                     LTLLDSRASRMTPNQALLSLHADYIGGDNANYRRWYFAAHLDLDDAVGFANMKLGKAD
                     RKTRKARKAAKKAAQENPENVDETLEALEGDNSLEAAEYRWKTRMNRMSQHDRIRQLA
                     LFLMCWGEANQVRFLPECLCFIFKCADDYYQTPECQNRVEPVEEFTYLNEVITPLYQY
                     CRDQCYEIVDGKYVRRERDHNKVIGYDDMNQLFWYPEGIERIKLEDKTRLVDIPIGER
                     WTKLKDVNWKKAFFKTYKETRSWFHMVTNFNRIWVIHLGCFWFFTAYNAPTIYTKNYQ
                     QQLDNKPPGAYYWSAVGFGGALVSFIQVLATLCEWLYVPRRWAGAQHLSKRLMFLLGM
                     LIINLAPGVFVFGWGSKVKEPIPLIIGIVHFFVALATFFFFALMPLGALFGNYMKKHG
                     RQYVASQTFTASFPRLQGNDMWMSYGLWICVFGAKLSESYFFLTLSFKDPIRILSPMA
                     LKKCIGIKYVGDVLCYKQPQILLGLMFFMDLTLFFLDSYLWYVICNTVFSVARSFYLG
                     VSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIIISMYREHLLAID
                     HVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSFKTEFFPAGSEAERRISFFAQSLST
                     PMPEPLPVDNMPTFSVLIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDC
                     FVKDTKILADETSQFNGEPEKNEKDVAKSKIDDLPFYCIGFKSAAPEYTLRTRIWSSL
                     RSQTLYRTISGFMNYSRAIKLLYRVENPEVVQMFGGNSEKLERELERMARRKFKICVS
                     MQRYAKFNKEERENTEFLLRAYPDLQIAYLDEEPPANEGEEPRLYSALIDGHCELLEN
                     NLRKPKFRVQLSGNPILGDGKSDNQNHAIIFYRGEYIQLIDANQDNYLEECLKIRSVL
                     AEFEELTTDNVSPYTPGIPTTNTNPVAILGAREYIFSENVGVLGDVAAGKEQTFGTLF
                     ARTLAQIGGKLHYGHPDFLNGIFMTTRGGVSKAQKGLHLNEDIYIGMNALLRGGRIKH
                     CEYFQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYFAHPG
                     FHINNMFIMLSVQMFMIVLINLGALKHETITCKYNSDLPITDPLRPTYCANLIPVIDW
                     INRCVISIFIVFFISFVPLAVQELTERGLWRMAIRLAKHFGSFSFMFEVFVCQIYANA
                     VHQNLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYTGARLLLMLLFSTSTVWTA
                     SLLWFWVSLLALCISPFLFNPHQFAWHDFFIDYRDYLRWLSRGNSRTHQSSWIGFCRL
                     SRTRITGYKRKLLGVPSEKGAGDVPRARISNVFYSEIFVPLILVGVTIIPYFYINSRT
                     GIEKASTDKNQSDPILRIAIVAFGPIAINAGVSGAFFGMACCMGPLFSMCCKKFGAVL
                     AAIAHAIAVIVLLAIFEVMFFLEGWSWPRCVLGMIAMIAIQRFIYKLIICLALTREFK
                     HDQSNIAWWTGKWYSMGWHSVSQPGREFLCKITELGYFSADFVLGHLLLFLMLPALCI
                     PFVDKFHSVCLFWLRPSRQIRPPIYSLKQSKLRKRRVIRFAILYFTMLILFLVLLVVP
                     LVARKYKAALGLDSDPLSSVAGGGLLQPLDTKNNNTIDGYTGSNLPAGMQPITSGFGA
                     PTPSGSASS"
     gene            <1236520..>1238205
                     /gene="GAS1_1"
                     /locus_tag="ACHE_10440S"
                     /db_xref="GeneID:66977397"
     mRNA            join(<1236520..1237420,1237490..>1238205)
                     /gene="GAS1_1"
                     /locus_tag="ACHE_10440S"
                     /product="1,3-beta-glucanosyltransferase gas1"
                     /transcript_id="XM_043279298.1"
                     /db_xref="GeneID:66977397"
     CDS             join(1236520..1237420,1237490..1238205)
                     /gene="GAS1_1"
                     /locus_tag="ACHE_10440S"
                     /note="CAZy:CBM43;
                     CAZy:GH72;
                     COG:S;
                     EggNog:ENOG410PFK7;
                     InterPro:IPR012946,IPR017853,IPR004886;
                     PFAM:PF07983,PF03198;
                     SECRETED:SignalP(1-19);
                     TransMembrane:1 (n6-14c19/20o517-537i)"
                     /codon_start=1
                     /product="1,3-beta-glucanosyltransferase gas1"
                     /protein_id="XP_043131560.1"
                     /db_xref="GeneID:66977397"
                     /translation="MKLTNVVAGATLFASTVLADLDPIVIKGSKFFYKSNDTQFYIKG
                     VAYQQEYSGPKSDTDNFKDPLADADACKRDVPYLEKLGANTIRTYAIDPKADHSECMK
                     LLQDAGIYVISDLSSPSESIVRNDPKWDADLYSRYVSVIDEMSQYSNVIGFFAGNEVS
                     NQANNTDASAFVKAAVRDMKQYIKAKNYRSMGVGYATNDDADIREKMANYFNCDNADD
                     SIDFWGYNIYSWCGDSNYQKSGYKTRTEEFKDYSVPVFFAEYGCNAVQPRKFSEVEAL
                     YGKQMNDVWSGGIVYMYFQEENDYGLVSVDGDKVSTLDDFNNLSSQLAKVSATGTKKS
                     EYKPTNSALQSCPAVNSAWRAAATPLPPSPNKDLCTCMMDSLECTVKGKVDGEKVGEL
                     FGTVCGYDVCDGVSANATTGDYGAYSVCTPQEQLAYAMNLYYKQQKSKGNGASACDFN
                     GAATTKTSSSPSGTCSALLKEAGSSGTGTVTSSPTGNANQVSASGSASASGSEGAAPM
                     VAPGAVRVGVWQFGAYLATAVVAGAGMILL"
     gene            complement(<1244704..>1245151)
                     /locus_tag="ACHE_10441A"
                     /db_xref="GeneID:66977398"
     mRNA            complement(<1244704..>1245151)
                     /locus_tag="ACHE_10441A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279309.1"
                     /db_xref="GeneID:66977398"
     CDS             complement(<1244704..1245151)
                     /locus_tag="ACHE_10441A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131561.1"
                     /db_xref="GeneID:66977398"
                     /translation="MDSIQHQNHPVSSEYLHPWTTFNEDIQSTLQSLDLSKPAGKADS
                     SEGEKYLIRNQRGLATRFVHYVCDPVAKALSTTFYQYLVFENVEGVQSSDDSFLGLIN
                     QRPETEGNGYDHNTPVAAGDVKRFWISKLEKYPVMGRSIGLSSEYPI"
     gene            <1245756..>1246780
                     /locus_tag="ACHE_10442S"
                     /db_xref="GeneID:66977399"
     mRNA            join(<1245756..1246118,1246192..1246545,1246607..>1246780)
                     /locus_tag="ACHE_10442S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279320.1"
                     /db_xref="GeneID:66977399"
     CDS             join(1245756..1246118,1246192..1246545,1246607..1246780)
                     /locus_tag="ACHE_10442S"
                     /note="COG:S;
                     EggNog:ENOG410PJGK;
                     InterPro:IPR000073,IPR029058,IPR000639;
                     PFAM:PF12697,PF12146;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131562.1"
                     /db_xref="GeneID:66977399"
                     /translation="MPNTKTVHVPHLGGIDAAYQMPHPFDPAKPTLVLVNSFTTSSEL
                     YSKQYANKELTDKMNLIAIELLGHGQTRTKREHWTYWDTAEMNLQVLDSLNIEKAFVL
                     GTSQGGWITVRMSLMRPDKIAGIIPLGTSMDYESEPTRQLGCWDAPNLLTPTIDAFTS
                     NEPTPDFEPPLAYCDMLVNTGFGEDCPAETREYWRKTIRENYQGDDGRRRLRMSAINL
                     RDRDGLYSRLFDVRCPVLWLHGTKDVVYSLANAQREIGLFVNSPDAKLVPVEGGAHFL
                     SASNPKEVDAEILGFVTKYS"
     gene            <1247231..>1247464
                     /locus_tag="ACHE_10443S"
                     /db_xref="GeneID:66977400"
     mRNA            <1247231..>1247464
                     /locus_tag="ACHE_10443S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279331.1"
                     /db_xref="GeneID:66977400"
     CDS             1247231..1247464
                     /locus_tag="ACHE_10443S"
                     /note="InterPro:IPR006600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131563.1"
                     /db_xref="GeneID:66977400"
                     /translation="MAQRIRQMHGDPKPIWSHWVSQFKKRHPEVSSSLGRRIKKSKKR
                     AVPPVKIMPREDVLESMRLKKLGKKAEKAPEGV"
     gene            1247584..1247673
                     /locus_tag="ACHE_t10008S"
                     /db_xref="GeneID:66987314"
     tRNA            1247584..1247673
                     /locus_tag="ACHE_t10008S"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:66987314"
     gene            <1248011..>1250270
                     /locus_tag="ACHE_10444S"
                     /db_xref="GeneID:66977401"
     mRNA            join(<1248011..1249095,1249154..>1250270)
                     /locus_tag="ACHE_10444S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279342.1"
                     /db_xref="GeneID:66977401"
     CDS             join(1248011..1249095,1249154..1250270)
                     /locus_tag="ACHE_10444S"
                     /note="COG:S;
                     EggNog:ENOG410PINN;
                     InterPro:IPR006640,IPR035240;
                     PFAM:PF17283,PF10263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131564.1"
                     /db_xref="GeneID:66977401"
                     /translation="MARLNNTPSPRKRQEPRAPLGAQTKPERGLSNFSLPKTTGNSTS
                     RGLFAETRTTKDNGATKEPSSARTQSHKKSKSSLDFQIFPDNNALFYDEAEETEEEHS
                     DTSESHTSPTFSPSSSIGSISSHDKTKNPLKLAHVNSMLLPMPSPPSPVRQRRQTRKS
                     EILDYAKENDPIEEPGDDDLEAASLSRSSSDASSRRIPVQGNVRQIPGGRNRNNNLSF
                     SSYRQLEIEEADSEDPEDNGSDLEGFIVSDNEDLSFHDVSENESTEEEEKMPSPPPKP
                     RRRLMRGRRPASTGEPKPDPEPEEVNRKSWKVPKEQSPIMDTIPPMGPTSTRLSQESF
                     NINEELDNLNLDDNNNDPSSQLFNDLNDAVIELNTSPKKPAYEPPNLQTPPSSPSKNN
                     RLRSPTKNKVCIPPTPYRESTDAFWSQETTNDWVDQHSPKKLDQLLREFKESDDEHNR
                     ERSFDIMPRSRNVKGKEPKSPSKTAQKKAEIEHRKALMARKKSFDDKKASLAYDFLKV
                     LDIAVAGGQVQEMANETGGVKIVWSKTLQTTAGRATWKRVRDDNGCDARKPTKHYAII
                     ELAERIIDNEDRLINTLAHEYCHLANHMISKVYNNPHGASFKQWGLKCKQALQDHPVY
                     AGRIEVTTKHSYKIDYKYVWTCVDCAQNYGRHSKSIDPTKSRCGRCKGILQQIKPKPR
                     NVSPKKKPAAGASTGLGIGVGGAAAQGSRLSPVDTKAVDDVMQVLGGVSLH"
     gene            complement(<1250816..>1251589)
                     /locus_tag="ACHE_10445A"
                     /db_xref="GeneID:66977402"
     mRNA            complement(join(<1250816..1251455,1251516..>1251589))
                     /locus_tag="ACHE_10445A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279353.1"
                     /db_xref="GeneID:66977402"
     CDS             complement(join(1250816..1251455,1251516..1251589))
                     /locus_tag="ACHE_10445A"
                     /note="BUSCO:EOG09264IKZ;
                     COG:S;
                     EggNog:ENOG410PKHC;
                     InterPro:IPR016123,IPR007681;
                     PFAM:PF04603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131565.1"
                     /db_xref="GeneID:66977402"
                     /translation="MAYSGRDFYGGAIAGAIPTSWLDSSDLREVPDHQEIYLSPTTLS
                     NFILEVNEAVPNNKALAYLDQQQQQSTAPAGGVHANKETIDKAAVNYHLHDLCDEGDT
                     IQAVIPPAPISLPRFTPEQARAYKGVASFTTPKTQRKGGGRVPGSVDGSAATTTMGAS
                     NGVGGTDAPQISRLSCHYLLVRLEKQETDLLAFMNVPHDEFDAKGDPSGLSREEEMAA
                     GFIDKLVETLEVKNWGLFG"
     gene            complement(<1252166..>1252874)
                     /locus_tag="ACHE_10446A"
                     /db_xref="GeneID:66977403"
     mRNA            complement(join(<1252166..1252392,1252452..1252707,
                     1252781..1252812,1252865..>1252874))
                     /locus_tag="ACHE_10446A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279364.1"
                     /db_xref="GeneID:66977403"
     CDS             complement(join(1252166..1252392,1252452..1252707,
                     1252781..1252812,1252865..1252874))
                     /locus_tag="ACHE_10446A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131566.1"
                     /db_xref="GeneID:66977403"
                     /translation="MLIVDFERDIGPIKIKGTIEKAGQIKGEIGTHIPAFDYKSLNPF
                     AGFIKDGVHGSFDLRAGITDSYFCISVKGHAVIAQTNLPDKGHETTIFELEATVQGAI
                     RFTRHNNVAYFDSVDGSPCHFEFDFQGFNLSPLDTPIAILTYRSLQKLHGPQTVQGII
                     EPTKYSFKPQVEKI"
     gene            complement(<1256204..>1256689)
                     /locus_tag="ACHE_10447A"
                     /db_xref="GeneID:66977404"
     mRNA            complement(<1256204..>1256689)
                     /locus_tag="ACHE_10447A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279375.1"
                     /db_xref="GeneID:66977404"
     CDS             complement(1256204..1256689)
                     /locus_tag="ACHE_10447A"
                     /note="TransMembrane:1 (o77-100i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131567.1"
                     /db_xref="GeneID:66977404"
                     /translation="MTGKRYWNWIVQTEMDLTRLFYFEMFDDNDYTNTFTCNHFRILP
                     KNGTTTSTPSSNTPSASSSTSAESSDSDSGTEVGVGIGVGVSCAFFIALSAIIWYFRR
                     RKAASATAPDSNAPNQPPAWSPPSDTPDPSKQMPPPVEVPGYSAVAEAPSDRVRYELS
                     S"
     gene            <1257495..>1258565
                     /locus_tag="ACHE_10448S"
                     /db_xref="GeneID:66977405"
     mRNA            <1257495..>1258565
                     /locus_tag="ACHE_10448S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279386.1"
                     /db_xref="GeneID:66977405"
     CDS             1257495..1258565
                     /locus_tag="ACHE_10448S"
                     /note="COG:E;
                     EggNog:ENOG410PURD;
                     InterPro:IPR015424,IPR015422,IPR001597,IPR015421;
                     PFAM:PF01212;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016829 - lyase activity [Evidence IEA];
                     go_process: GO:0006520 - cellular amino acid metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131568.1"
                     /db_xref="GeneID:66977405"
                     /translation="MPGPFSEDMALPQYSFMDDYSEGAHPQLLEALVRTNSTQQLSYG
                     NDEHSNEARQLIRTKLSATEDEVAIHFVPSGTSANLICIASCLRPFEAVLTVDSGHIV
                     SKEAGAIEATGHKTIVVPGVGGKMTPDNLERAVRQNQFFPHNAKPRLVYISNATELGT
                     IYTKRELKSLSAACKRWGLLLLIDGARIGVALSAPSNDLTLRDLVDLTDIFWIGGTKN
                     GALLGEAIVVRKHLADGFAFYLKQHGALLAKSRIIGVQFAELFRKSLFFELAANANNA
                     AQMISNNFQELGYQLSAKTETNQVFAILPESLAKRLEERFRFYVWEHLDNQQVVVRIV
                     TSWATNTSMVDKFNAWVQQWTI"
     gene            <1261075..>1262286
                     /locus_tag="ACHE_10449S"
                     /db_xref="GeneID:66977406"
     mRNA            <1261075..>1262286
                     /locus_tag="ACHE_10449S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279397.1"
                     /db_xref="GeneID:66977406"
     CDS             1261075..1262286
                     /locus_tag="ACHE_10449S"
                     /note="COG:C;
                     EggNog:ENOG410PG98;
                     InterPro:IPR012133,IPR037396,IPR037350,IPR008259,
                     IPR013785,IPR000262;
                     PFAM:PF01070;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131569.1"
                     /db_xref="GeneID:66977406"
                     /translation="MNIAPNPAPYTYEVEVYQEGLRDKRPAITFNAFEWEKLAKERLS
                     AESFGYVWGSAGSRETDDNNRAAFKKWGIVPSRLVKSDFPSLKTTLFGDKYDYPLAIA
                     PVGVQRIFHRDGEVAAASAAQQENVTYILSTASATSIEDVAMANGSGPRWFQLYWPQN
                     NQSDITVSLLRRAKAANYKVLVVTLDTYILGWRPSDLGNAYNPFLRKDSIGVELGFSD
                     PVFRRKFQEKHGKTIEEDMSKAAAEWAHTIFPGTSHGWEDLRFLRENWDGPIVLKGIQ
                     TVEDAKLAVEYGMQGIVVSNHGGRQQDGGVGSLDVLSEIVDAVGKKLEVLFDSGVRCG
                     ADVIKALALGAKMVLLGRPYVYGLAIGGAEGVRHVLRSILGDIDLNLHLSGIKSVSPE
                     HLNRSVLRRVA"
     gene            <1264097..>1265329
                     /gene="ROM2_1"
                     /locus_tag="ACHE_10450S"
                     /db_xref="GeneID:66977407"
     mRNA            join(<1264097..1264214,1264275..1264699,1264755..1265189,
                     1265249..>1265329)
                     /gene="ROM2_1"
                     /locus_tag="ACHE_10450S"
                     /product="RHO1 GDP-GTP exchange protein 2"
                     /transcript_id="XM_043279409.1"
                     /db_xref="GeneID:66977407"
     CDS             join(1264097..1264214,1264275..1264699,1264755..1265189,
                     1265249..1265329)
                     /gene="ROM2_1"
                     /locus_tag="ACHE_10450S"
                     /note="COG:T;
                     EggNog:ENOG410PFP7;
                     InterPro:IPR001180;
                     PFAM:PF00780"
                     /codon_start=1
                     /product="RHO1 GDP-GTP exchange protein 2"
                     /protein_id="XP_043131570.1"
                     /db_xref="GeneID:66977407"
                     /translation="MIEKEYGKHTEHNHNFYCKTVLRKNYFTETNCVNCLLPINGDRD
                     LVIGTDNGIYLVNQWPIDENIGPQLIIDTVGVTQIDILEEHRLFMILSNGTLSSYPIE
                     VLNASGDQDLVSCEPQKVQDYVDFFKIGISVGRHLVCSVNTSESSTEIRVFQPTDIFN
                     RNGMRLALDSMGDGNTLNLFKVFHIPVECWSVHFLRSTLGIGCTKGFKIINLHTADIY
                     PLLDPADKSLDFVSQNENLKPFHIEKMDNGRFLLCYNGFSMFVNRNGWLAHPDWKISW
                     KGTPKSFSVSYPYILAFGLDLVEFWHIKTGKLLDTIVGHNIRMLHSRPGQTFYAFEDD
                     GGEDAVASLTFSAASGPS"
     gene            complement(<1266295..>1266600)
                     /locus_tag="ACHE_10451A"
                     /db_xref="GeneID:66977408"
     mRNA            complement(join(<1266295..1266370,1266434..>1266600))
                     /locus_tag="ACHE_10451A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279420.1"
                     /db_xref="GeneID:66977408"
     CDS             complement(join(1266295..1266370,1266434..1266600))
                     /locus_tag="ACHE_10451A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131571.1"
                     /db_xref="GeneID:66977408"
                     /translation="MSDLQDQACHLYDQADKLRSSRNCGSNTSSSQSASDWQDQSHMA
                     TQSNDYYSGSGQYATQNDNGGAKGSNGDIERRWQRW"
     gene            <1268424..>1270745
                     /locus_tag="ACHE_10452S"
                     /db_xref="GeneID:66977409"
     mRNA            <1268424..>1270745
                     /locus_tag="ACHE_10452S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279431.1"
                     /db_xref="GeneID:66977409"
     CDS             1268424..1270745
                     /locus_tag="ACHE_10452S"
                     /note="COG:S;
                     EggNog:ENOG410PKSA;
                     InterPro:IPR011009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131572.1"
                     /db_xref="GeneID:66977409"
                     /translation="MQDDIAELRRQLEEERRAREEAEQRQEEERRAREEAEQRQEEAE
                     QRQEEAEQRQEEAEQRQEEERRAREEAEQRLQPNSLFRLLDRCHESLSQTIRVETNAT
                     LTTQGNVTDPVNRLFPKRIVPWLDFPQIQEQIWKKLERAVGFTSRPLFPSDNQLDYVA
                     TNVQDRPIYSEATLRNFERDTVDNFVEKIVEALRGDETLQREFGIEGRVAFYDRTNST
                     SLDDNLEMHLDDAPCQPTNTSRGRGRRKGKGKQMGQSQTRARSRRRRNRRADQFCVHV
                     VADERQIPVYAVEFKAPHKLTVAELVAGLHEMDLARDVIDQEGDTFEFHTTRLVAAVV
                     TQIFSYMHDLGIQNGCIRTGEAFVFLHIPEDPTIVQYYLCFPNQDVQAGDESRLHRTA
                     VGQMLAFTLQALAAEAPSQEWHNTAHEQLSTWKVEYLDVLRDIPETIRKEPPPSNYRP
                     SYWKPNPKTHNTRSYARCNPGVSTPVGSPSESSDSDEDMPSPSTAPAARSRSSRGKGK
                     HLSTGRRERAPPDRKTKQTPSQRVQRPYCTMACIRGMVNGGPLDKKCPNWQHHGGQRH
                     PMGPQEFTRKLHRQLVQNRNKGFEPLHIRGRTGYLMKATLLSHGYTVVMKATTKENQH
                     ALKTEVDNYRKLRSLQGYQIPVCLGDFEPSIAYWYHGQVMAHMMILSWSGTRLQRIIK
                     DENMDFFHKEREKALKSLQKYGVEHKDKEWRNMLWDEQTRSLVVVDLEDMEWLKRPRP
                     FQPTPGNSLGRRIVLRRKNGRRRLSSRAAVCTS"
     gene            complement(<1271921..>1273505)
                     /gene="DLD1_1"
                     /locus_tag="ACHE_10453A"
                     /db_xref="GeneID:66977410"
     mRNA            complement(join(<1271921..1272013,1272081..1272256,
                     1272317..>1273505))
                     /gene="DLD1_1"
                     /locus_tag="ACHE_10453A"
                     /product="D-lactate ferricytochrome c oxidoreductase"
                     /transcript_id="XM_043279442.1"
                     /db_xref="GeneID:66977410"
     CDS             complement(join(1271921..1272013,1272081..1272256,
                     1272317..1273505))
                     /gene="DLD1_1"
                     /locus_tag="ACHE_10453A"
                     /note="COG:C;
                     EggNog:ENOG410PGHW;
                     InterPro:IPR016171,IPR006094,IPR036318,IPR004113,
                     IPR016164,IPR016166;
                     PFAM:PF02913,PF01565;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="D-lactate ferricytochrome c oxidoreductase"
                     /protein_id="XP_043131573.1"
                     /db_xref="GeneID:66977410"
                     /translation="MTKPPSHDKSPENLKAALTEFIEILGQDNVMTDHEIMKSYAGSD
                     WSSYAPKENEVPAIVLTPGSTEDVSRIMKVCHKRVIPVTAYAGGTSLEGHFAATKGGV
                     SIDFQRMDQIVALHKDDLDVVVQPGVEWEALNEELAQTGLFFPPDPGRGAKVGGMVAT
                     GCSGTNAYYYGTMREWVLSLVIVLADGTVIKTRQRPRKSSAGYDLTKTFIGNEGTLGL
                     VTEATLKLTNYPENQTVAVASFPSIHSAAGCASAVVRKGVHIAAVELLDDVQMETINA
                     SGLTSHPFEEFPTLFFKFSGTPSGTQEQISMIKDLAEREKVKTFQFARDPDEVDKLWG
                     TRKSVLDSIVQRKKDPSDRVWTTDVAVPISRLPDIIEETREDINKSGVVGGIAGHVGD
                     GNFHAMLVFSNQEQKIVEELIHRMVKRAIEMEGTCTGEHGIGLVKRDYLPHEVGESTV
                     DAMRKMKQAFDPLCLLNCDKVIRMQVPKREEVSEW"
     gene            <1274770..>1275253
                     /locus_tag="ACHE_10454S"
                     /db_xref="GeneID:66977411"
     mRNA            join(<1274770..1275144,1275212..>1275253)
                     /locus_tag="ACHE_10454S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279453.1"
                     /db_xref="GeneID:66977411"
     CDS             join(1274770..1275144,1275212..1275253)
                     /locus_tag="ACHE_10454S"
                     /note="COG:C;
                     EggNog:ENOG410PG98;
                     InterPro:IPR000262,IPR013785;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131574.1"
                     /db_xref="GeneID:66977411"
                     /translation="MLAFPCCKIFTFCTICERNFIIMNATPNSTPHSYEVDVYQEGLR
                     DKRPAITFNAFEWEKLAKERLLAESFGYVWGSAGSRETDGNNRAAFKRWGIVPSRLVK
                     SDFPSLKTTLFGDEYNYPMAIAPSFEDFYFQTIGEI"
     gene            complement(<1276393..>1278588)
                     /locus_tag="ACHE_10455A"
                     /db_xref="GeneID:66977412"
     mRNA            complement(<1276393..>1278588)
                     /locus_tag="ACHE_10455A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279464.1"
                     /db_xref="GeneID:66977412"
     CDS             complement(1276393..1278588)
                     /locus_tag="ACHE_10455A"
                     /note="COG:S;
                     EggNog:ENOG410PV1W;
                     InterPro:IPR000719,IPR011009;
                     TransMembrane:1 (o330-348i);
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131575.1"
                     /db_xref="GeneID:66977412"
                     /translation="MASDDIPDYKKLFLEAEKQRKQEEERRKQEEQRRKQAEERQKQA
                     EEQNRPTTFGELIRYGHNNVARSLRVANQSRCTSGKISAPIGKKCPVKLRPWTECQTQ
                     QEDIYRSVCNHLGSTGDTARRAFPPLVALEYEGQNVKERPISSERDLEGYERSAVENH
                     VRNIIAELCKIPAARDEFRLGDGVQFDSHANSLDLQTNQPSRSGSSRPDQYCIHRIDD
                     GTSTLLTTVEYKPPHKLPVESLRRGLKSMDFWEQVVKAHSVPNTEDEKAERVVGSVIA
                     QEYHVMIQEGLEYSYVTNGLALILLRVPYEDPGTLYYHLCEPNEEVNPEDEQSFLQPA
                     TAIARVLCLCLMSFRSRPRSQQWRNEADAQLPIWKSSFGSFDGTWFPVSEFESPQSTP
                     NSKHTYPSPKSTTSEFLPPSSSSAESPTAEGRRAPTRSRPGCSPSTTTYHDESSDPDS
                     DFEASGQKGQKRGLSEISSSPVQRTVRRAGSRHFSQSDGQHGRHDADFCTQRCLLGLQ
                     QGGQLDDDCPNVMLHKQGGDGRRHAIQSTTFLQGVKKQLDKNIDRNCTPMGGCGASGA
                     PFKVTYAKYGYTVVGKGTTSCRWPELLREAEVYRVLQQAQASAVPVFLGAIDLEKTYF
                     LHGAGAIRHMLLMGWGGNSISSIENALSCPEFTEELNREISRSVKKIRSLGVLHEDLR
                     PDNILWNAELQQALIIDFHWARLDRRPKRKRMLSCAAEARQPKRPRTIC"
     gene            <1280513..>1282783
                     /locus_tag="ACHE_10456S"
                     /db_xref="GeneID:66977413"
     mRNA            join(<1280513..1280620,1280668..1281248,1281298..>1282783)
                     /locus_tag="ACHE_10456S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279475.1"
                     /db_xref="GeneID:66977413"
     CDS             join(1280513..1280620,1280668..1281248,1281298..1282783)
                     /locus_tag="ACHE_10456S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131576.1"
                     /db_xref="GeneID:66977413"
                     /translation="MGLTESKIVLERFSAACFEADCHRRDDIRDLLSDDNFLRLLNNL
                     WKQIPPVSRKRIIKANRRKSAKYATPPKVDNVSDDVPESLMKFIPQWKNNIQSFFTEE
                     DALDLNLDHPVAESYRLLLQLENRGERDTWRTRFLKVVFHRLMKQISSGQYTQSADVT
                     RATTIIKNSGIGDNSEQIGERFIAWGKAGQRLELLCRDLLDARDRCDDGRKKEEHLGF
                     LFRLPKYMTDNYLRKLPKTGVTRNQEIRRLKDSGLHAGTQYSTLGDLAFNIFHHLWGF
                     IERSLAQEAFIIQEGPILSRQAVSRSRSKRSACGTADAVRDDMPLSNVSTRPSSEQTL
                     NYQSAPESKRVDEVFRHNSPPSAASPIFEEAGEQTDYTLPHTSQRLDVPQNSLHQQSL
                     MVSLDSNHQPEQIQMDTSPDDFNQQATPEPSSQTSSQHADTDQNTFIQQQQQQQHMKI
                     PHSDGQPEQIQTDGAVKGFYPQLYLLDNSQSQFNAQQLDAVHNPFPQQSYMAPPYSNG
                     QPEQIQTEGAVKGFYPQLYLLDDSPGQFTPQQSDAVHNPFPQQSYMSSPYSNGRPEQI
                     QTNGAASDFHPQLYLLDDSPSQFTPQQSDAAHNPFPQQSYMAPPYSNGQPEQIQTDGA
                     VKGFYPQLYLLDDSPGQFNQQSDTAQHAMDLQVQDSLVESNARSNYPDAQRHQQPSNL
                     MQRWANQAVGQVGSGRIEANGFDRLDPFQNHLFRTQSMITGV"
     gene            complement(<1282896..>1283358)
                     /locus_tag="ACHE_10457A"
                     /db_xref="GeneID:66977414"
     mRNA            complement(join(<1282896..1283111,1283161..>1283358))
                     /locus_tag="ACHE_10457A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279486.1"
                     /db_xref="GeneID:66977414"
     CDS             complement(join(1282896..1283111,1283161..1283358))
                     /locus_tag="ACHE_10457A"
                     /note="COG:S;
                     EggNog:ENOG410Q1JS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131577.1"
                     /db_xref="GeneID:66977414"
                     /translation="MSRHLEPDAEKVRKQIKEMISETATEDNSNLKKVDCLRSDDGRV
                     MYAGEELAKQVVTLRHYLGLGPDWGWTLWHFPAPRELINDSSMYLVPLSGSASIPQDE
                     SLTEGSFMCTTNNSMLSPRTTVLIFMKRNSHSQSC"
     gene            <1288687..>1291032
                     /locus_tag="ACHE_10458S"
                     /db_xref="GeneID:66977415"
     mRNA            join(<1288687..1290882,1290934..>1291032)
                     /locus_tag="ACHE_10458S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279497.1"
                     /db_xref="GeneID:66977415"
     CDS             join(1288687..1290882,1290934..1291032)
                     /locus_tag="ACHE_10458S"
                     /note="COG:S;
                     EggNog:ENOG410PHB6;
                     InterPro:IPR018834,IPR011990;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131578.1"
                     /db_xref="GeneID:66977415"
                     /translation="MSLDSLNSDGKTLLGICWNLETNGYSREEDINHLNTNSILDEHI
                     KCVSKDIADDDLFKLAILTWSVDANSQLLSQELFYFLINLREKNDILYPILHTTYSKF
                     AQKCSTYRSFRRDFTKWLNSLEDCLTHEWNVIWKYTSLERQTPAPYPKLSQDHLLAMD
                     NSSSRDVGGCHTISASAVYSNLQNEGTRPGQPEHPDVLPSKEGEDNGGEERGLSSNIN
                     EVQNHTVPGAEREQQILLQLDTRPVTEKQLAIDVHGIYAGLVMAEEKCIEMTKQQAES
                     PEKPSDYQWQALISLHQTLFCEHHDFFLASQHPSASPALKRSPEEYAMPARMWRYGIH
                     SFLELLHHRLPDSLEHTLTFLYWAYSMMTLFLESVPAFEDTWIECLGDLARYGMAVED
                     SVARDHENWAGVARYWYHKAADKNPNFGRIQYHLAVLAYPDILQELSYYTKSLVSVDP
                     FPPAGESIQLLFRPLLNEPKPYNQPAVAVFMTIHGKLFMQRPLSDFKTLMNAYLLCLD
                     GYIRQHRSAFKMHGVFIASCNFAAIFQYGSTDAVLSNEFKEGLAQDETSLTASKNWTP
                     VGNLDTIEAEFCENQNSQSQKKLVYYGAHLTFKTLSALLDQIGNKNVFPAVHAYLAFI
                     WCMAQNNTNIMHIELVVPWRKLTIFLNTMICSDTDSRVMERNEFPVAEDRKCFPEDFL
                     LRGQVWSQRYFSADYFEGCLAEDDGRSIEVPSLTVARMYRCLWLGVRLAVYNRWIEYI
                     STSQRFSVKPFALELEKRAQNCEI"
     gene            complement(<1292328..>1292651)
                     /locus_tag="ACHE_10459A"
                     /db_xref="GeneID:66977416"
     mRNA            complement(<1292328..>1292651)
                     /locus_tag="ACHE_10459A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279508.1"
                     /db_xref="GeneID:66977416"
     CDS             complement(1292328..1292651)
                     /locus_tag="ACHE_10459A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131579.1"
                     /db_xref="GeneID:66977416"
                     /translation="MVQAAGSGSILLFIPDKPAQYSAAPAVSATKYRNLTPKHAHVVI
                     GMVREARQLPCSLFKDEDLFNSFLFHRPPQIMYRLELLTDDEIRQEPIDSDQLFTISK
                     PLKTK"
     gene            complement(<1292664..>1293891)
                     /locus_tag="ACHE_10460A"
                     /db_xref="GeneID:66977417"
     mRNA            complement(join(<1292664..1293535,1293599..1293701,
                     1293758..1293814,1293865..>1293891))
                     /locus_tag="ACHE_10460A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279520.1"
                     /db_xref="GeneID:66977417"
     CDS             complement(join(1292664..1293535,1293599..1293701,
                     1293758..1293814,1293865..1293891))
                     /locus_tag="ACHE_10460A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131580.1"
                     /db_xref="GeneID:66977417"
                     /translation="MFALLIHLPEPLEKYTEHPDMVFEVKQKVATFHRILSQLLILLE
                     WLAPHFPRSFYIGSIKSPDQETGSLSAPLPPEAHCGKLYRTDDAEAQFYCHDDSTTQG
                     SFGFNNLSGIPGSEELSDEEFNRLVDTMYPIESCANQSLGLTDYKAGIETETTAGNKD
                     KDIQGTGKPHAKGISGGVCLGEEESKNLAIATKWEQLQHEHNFAGNLFTIFRRFVPDI
                     GAQVTNRLLQLALALFLPETLLRVKKHIEFLRQKTEFRTEMYGPVPTWIYRTAVQCCQ
                     GRNPNQFSMRLFQWYVYQYIETQRGLWDPAIARHPSRDHIINQIATSEINGPRAPDYA
                     PSGLDLVKRKIQSWHDQG"
     gene            <1297275..>1297872
                     /locus_tag="ACHE_10461S"
                     /db_xref="GeneID:66977418"
     mRNA            join(<1297275..1297347,1297393..1297460,1297524..1297713,
                     1297766..>1297872)
                     /locus_tag="ACHE_10461S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279531.1"
                     /db_xref="GeneID:66977418"
     CDS             join(1297275..1297347,1297393..1297460,1297524..1297713,
                     1297766..1297872)
                     /locus_tag="ACHE_10461S"
                     /note="COG:P,Q;
                     EggNog:ENOG410PW93;
                     InterPro:IPR039261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131581.1"
                     /db_xref="GeneID:66977418"
                     /translation="MIYGYNTCTLQIRRLHLVWQVKSIDMTTAAQGLLNNLLEDDIID
                     EGYILNISIYVENGLAHNKTPFGKHERVCLYQGVPDYRSIISLEASGDQIERLPNIRD
                     EQGRTLVMVSTADDLRDHIREIVRGYLHQGVKLSEMEYQPNAG"
     gene            <1298463..>1300628
                     /locus_tag="ACHE_10462S"
                     /db_xref="GeneID:66977419"
     mRNA            join(<1298463..1298489,1298539..1298586,1298639..1298830,
                     1298882..1298932,1298981..1299137,1299208..1300258,
                     1300310..>1300628)
                     /locus_tag="ACHE_10462S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279542.1"
                     /db_xref="GeneID:66977419"
     CDS             join(1298463..1298489,1298539..1298586,1298639..1298830,
                     1298882..1298932,1298981..1299137,1299208..1300258,
                     1300310..1300628)
                     /locus_tag="ACHE_10462S"
                     /note="COG:S;
                     EggNog:ENOG410Q1UX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131582.1"
                     /db_xref="GeneID:66977419"
                     /translation="MITITVGLQDIQNKGPDLDEDSGSDLVNQIGKKLEHIARLNDSQ
                     KTDTFIRAQSGGFIRWHILSAGETIISSTHRDGCMDVFFALVTLEDRSRVMPLDLNKT
                     QLCQLVRGLGSDLEQLQKLKRSQVADIWYGLEHAGFVERGCVESSQVQEVIQDNLQGN
                     CNTDVVQPTLSPPLALSLPMSDPTTSDPANDTLQFDFEHDSWTLWTDDMYACGDYPGS
                     VFDTALGTRTPDNSAVPMALNMIPLVNPHPVSGISSPAETTSTPGLHQSVSSYSTPST
                     TYVDSPHMGEQLLPGLGATMLNQAVKRKRRDSDQSMQSKSTAVKLNPTIFQLLQSCAF
                     YKVDKPEEERFQKALSILKAEVHLFMDPCGMLQPLLGGRDKNMLLSFHALGLPAVWRG
                     KEGAVDYIRLLDRHASQSCLHPIAERIAQVLLYFNYKELCKHPQKYLPPGSKPNVTSV
                     LNCIVDAYHDDPRKSMPLQSRRNRISGHHVRGGRRWWDLAGTWGAGILLTGDALLMSI
                     MCNDSFSILQTNALVTFVLNTRPGTIRIFRALEPVVKSLMFEQVTDDLTALFNDESGL
                     LGQNELTHAHAEDEAALACQRIENPWTEIDANECAMAKMREFVNVLTM"
     gene            complement(<1301339..>1301589)
                     /locus_tag="ACHE_10463A"
                     /db_xref="GeneID:66977420"
     mRNA            complement(join(<1301339..1301398,1301449..>1301589))
                     /locus_tag="ACHE_10463A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279553.1"
                     /db_xref="GeneID:66977420"
     CDS             complement(join(1301339..1301398,1301449..1301589))
                     /locus_tag="ACHE_10463A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131583.1"
                     /db_xref="GeneID:66977420"
                     /translation="MMELMQKYVKDDGAVGIDNPDRWRNCPAAIEFLSATTSAGSFKE
                     LKRQHLLAEIRWAPGCHGALLG"
     gene            complement(<1301700..>1302460)
                     /locus_tag="ACHE_10464A"
                     /db_xref="GeneID:66977421"
     mRNA            complement(join(<1301700..1301816,1301867..>1302460))
                     /locus_tag="ACHE_10464A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279564.1"
                     /db_xref="GeneID:66977421"
     CDS             complement(join(1301700..1301816,1301867..1302460))
                     /locus_tag="ACHE_10464A"
                     /note="COG:S;
                     EggNog:ENOG410Q2M9;
                     InterPro:IPR000719,IPR011009;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131584.1"
                     /db_xref="GeneID:66977421"
                     /translation="MQPVDNKRATQYRADQVPLLQQPPPDTEAAVPSSPHELKSKHKG
                     PVPSSARLAKRPLAPSLVEPSRKVIRGSPRALALPETNRLGNSSGSDLVIRQEPPWDT
                     FKKYYECDLAGTVAVCVRRSGRRGVWAIRQYPCKDADRILGILRSTSHKNVVSAFECF
                     RTSDALYMLSQFHPLTLDHVVACKAFPDQRQLAAIMSQFVDGLSYLDAQSLQHTSLDC
                     ASVLMSLDGEVQIGNPIA"
     gene            <1302732..>1303001
                     /locus_tag="ACHE_10465S"
                     /db_xref="GeneID:66977422"
     mRNA            <1302732..>1303001
                     /locus_tag="ACHE_10465S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279575.1"
                     /db_xref="GeneID:66977422"
     CDS             1302732..1303001
                     /locus_tag="ACHE_10465S"
                     /note="COG:S;
                     EggNog:ENOG410PNU7;
                     InterPro:IPR022198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131585.1"
                     /db_xref="GeneID:66977422"
                     /translation="MRRALFTEEEIRLATERRLKYLGAAKVNIYQIQFNPPLPRDLDP
                     KNLDRLREVFHKNRCRRLDVDNHVPATVSRQDLADALRQAWLQVT"
     gene            complement(<1303445..>1306827)
                     /locus_tag="ACHE_10466A"
                     /db_xref="GeneID:66977423"
     mRNA            complement(join(<1303445..1303673,1303739..1303868,
                     1303932..1304053,1304118..1304316,1304367..1304582,
                     1304628..1304804,1304859..1305039,1305096..1305292,
                     1305342..1305563,1305612..1305813,1305867..1305963,
                     1306014..1306255,1306303..1306391,1306440..1306476,
                     1306538..1306563,1306743..>1306827))
                     /locus_tag="ACHE_10466A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279586.1"
                     /db_xref="GeneID:66977423"
     CDS             complement(join(1303445..1303673,1303739..1303868,
                     1303932..1304053,1304118..1304316,1304367..1304582,
                     1304628..1304804,1304859..1305039,1305096..1305292,
                     1305342..1305563,1305612..1305813,1305867..1305963,
                     1306014..1306255,1306303..1306391,1306440..1306476,
                     1306538..1306563,1306743..1306827))
                     /locus_tag="ACHE_10466A"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131586.1"
                     /db_xref="GeneID:66977423"
                     /translation="MSQAVSSCGLDPPHVSAKSLIKPIYPARALRSPPEIKEPDMLIP
                     LTRAKEYPTTHIHGYTYVIASKGRTQVEMEHLPDTIQYAKRQPFGRKRPVYCPFLGFQ
                     VKKWTWKCSGIYACEFLSPFLQSYHHTSVDEGTWQEIQKSQKDVQILESDIRKRNAYS
                     YYRSKASFFKKGHACIDQLPTCKAVFKRYNQMDVHGEYAPFIGCINGSYGGLTKHHMG
                     QIQGHTAIDLQFLEDLFNKEILPATEECGVFEPLSSRRKYCDRDHPQGSGRLKHTPCD
                     VIFNALVPTNIEQCPYIIFTSHGVHKHPPPPPSKAPERILGGVKRIIEQIRDPNLTTA
                     QFLRNPQLEEFCRQYNASTLAEIHSSFCNKDRIAAIIQKQRLISYPNGQDINGLIFLQ
                     NTDRHLKDYIQEYYHDPQGIMVLCAFREQIQLLSRLSSFEIDMSYKRIRSKDINEVLF
                     ATFLPDQCKIITLLRVFTSTDSTEGYYLLFKRVFDLVQRVSSQPVLFDSIHGSGIHGI
                     IVDMDSKQYTGLGQYLSEIDPQHQDIIWHLQRIIVFCRVHFQRSILKAIGTNNQGSPL
                     WSRMMSLLDCRSEDDYDRLLDLLITYENANVQNWAVQKKGKVIKAGLNKACSKIQPHY
                     FDVLRNHTNAVEQSHQKSYASGKYLTLVQAVKNSAKLDRDDIVQYNNFQDFNIHHSYR
                     TSNMEANYLRHMSRERSRKRRRSALSISSEIESGSSASPLLPGNTRSRSQTSSRNGDN
                     ESMRSSDLRRTISTNVLNLEQRRQVIELENLEIELQQKKANLKKQEEDIRLQQLQNEK
                     LELDLMERRMRIQEHDST"
     gene            <1307320..>1309880
                     /locus_tag="ACHE_10467S"
                     /db_xref="GeneID:66977424"
     mRNA            join(<1307320..1307367,1307430..>1309880)
                     /locus_tag="ACHE_10467S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279597.1"
                     /db_xref="GeneID:66977424"
     CDS             join(1307320..1307367,1307430..1309880)
                     /locus_tag="ACHE_10467S"
                     /note="COG:S;
                     EggNog:ENOG410PU90;
                     InterPro:IPR022198;
                     PFAM:PF12520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131587.1"
                     /db_xref="GeneID:66977424"
                     /translation="MRISMLHRLIATGCVEEILTYLDHIEDFWSSLVGSDPVLMKKID
                     RDTIDALQLLAPGKSRTDGKTACGRVLSGQAFAEFSDEERRIIWDRMKDFDGLVPSLY
                     TFFEDFKYLESCAHCVKRLFGPLTESVWETMKSIFIPSSNSEAESVIQTSESTFRRQR
                     ATDLERLERGYLQVWLYTMRHYPLMPPDPKKDDDLLAKPARAKADERAIYEMAELARR
                     LGFKSPEIDALIDGSPDHQIAQAALLQARKPGRFRYDAQQFDILVSRIVDCFAEAVPD
                     QPDMGHDLLADSAMKPRARCGMPRIRTHKQDSPLLFLDRLHADDAGVSDTTTSFFVRR
                     CVYFAFFGKPTQPGLTDSDPTGGSPGDMPWSPLFVTEDDPSGGHGFAMQAALPREPPQ
                     QDREEPQGQRARQDREQRTLRCQQSLRRERGREVLKRRRTRKAQMRRRQLRPMAGSDQ
                     EPMELEWLSTEPSDQDMSDQGRSSPELPIEGLQDESIPFDPATALTLHSTHGPAGPGE
                     ADTFSYCTRISLEATPLERVSEDRPTVEGQNHDEGLEEQAQVDHPSQRQSTKAEDGNS
                     SSVGDTGGQQPVLEEYLDQLMRAQEEQEKLEAELERERLEEELGLSNQEQPAPDLSPR
                     PQEGQNSPARPPDKQLTEVTHTRDPDLAQAALPEPTQDPSPGSRLEGQPEPPAENLEL
                     VALTTRDGDSNPESQNPPADDAGPLTMMEAPPPTLVEISFWTFEQEEWKQSDRLQVDP
                     SDPSPVERVARKYTWKNYSLYDWKLQSLSPAQCYRAATVDGNNAIFLISEHEEQKLAA
                     EGRFVKDRKLLSLVSRVLNRTEPKSTTKRHRLQH"
     gene            complement(<1313109..>1315843)
                     /locus_tag="ACHE_10468A"
                     /db_xref="GeneID:66977425"
     mRNA            complement(join(<1313109..1314355,1314465..1314820,
                     1314881..1315600,1315665..>1315843))
                     /locus_tag="ACHE_10468A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279608.1"
                     /db_xref="GeneID:66977425"
     CDS             complement(join(1313109..1314355,1314465..1314820,
                     1314881..1315600,1315665..1315843))
                     /locus_tag="ACHE_10468A"
                     /note="COG:S;
                     EggNog:ENOG410PV9D;
                     InterPro:IPR021842;
                     PFAM:PF11917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131588.1"
                     /db_xref="GeneID:66977425"
                     /translation="MTPPPLPPANPDEHQYWTDPILCEETRTRLEHFRNLGWLPPNYK
                     PRTLEGLAVVERYWRRYCAHSNEDYVEYLLSEDKAIYMNFLDWMSRTSREKRLQTYDE
                     YWRRLCQYFGLFARRPVNHHVHEQMRRVCLSFLFHSYTWILNRQQYLEQVFPAERKIN
                     RRVKKKSTLDIDDFCVLLRHHWVHSSFFRHGSMIIQQAVIMLWSSITGTRPGVLLPQR
                     DATNDPNASQDGSLSLGPRKRKRGDSFKSDLPQRISPDDLPNTICYRDIELFYLRNPD
                     DGRDVLCAIIEFRNLKGRPEGADGTKFFMHGDYQLAYCPIVQIVSLAFRDDAFENELT
                     PELIWRIKVPKRTRALPLRWKKDKLNLPLLRRVVRTQYGYGVHPTLPMTYDSSRLALK
                     DLGEDGGFEDNLGHYNFRRWTANEANRHFTSQERKRVLGQSGDFIFEKHYQAEFIQRD
                     LQHVVLLRPPQEGLLQRAAGMLRNRDPLAPSNITDEQLRAIRRHPEILELRREKRELK
                     EEMRSLAGTIQNARNHFPDLYQRHDEISRKLTKLRKALRDNTRQTARKDYFHTAPVLE
                     IDRQIQQLLGKSGAENCDDDSTKDGDEDWQPPIPDYVFPERARLVESFYGPEGECFDE
                     DRLLAKRIQVTEDLVALSHLCEPNRRGKRANWDGDDEQSETSGGKEAFLSEEKSPECP
                     MDVCIICCGISRRSPSNPHPHNFPSKRKDSLRRHLIGHLMNAHDGVRCTWETCSKLPT
                     FIDIAEFLAHAANIHHYDLHIKLERIPKRQKPSRDETPSFSSSSMSLRSSRSATETPA
                     SSVGIEIGKIDPRLLAASNTKYNETCRRSQRLNPH"
     gene            <1316613..>1318455
                     /locus_tag="ACHE_10469S"
                     /db_xref="GeneID:66977426"
     mRNA            join(<1316613..1316997,1317046..1317619,1317696..1318056,
                     1318105..>1318455)
                     /locus_tag="ACHE_10469S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279619.1"
                     /db_xref="GeneID:66977426"
     CDS             join(1316613..1316997,1317046..1317619,1317696..1318056,
                     1318105..1318455)
                     /locus_tag="ACHE_10469S"
                     /note="COG:S;
                     EggNog:ENOG410PNA2;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:1 (o303-325i);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131589.1"
                     /db_xref="GeneID:66977426"
                     /translation="MGSSDDDPQIASSNPVASLSPSTLISACDTYRKKFPVANFLHYP
                     SLIANISTNPSSVDPVFVAALLSLCARFLPEHNLDSGETYAEYARSELAHKAFESPSL
                     SLAQSSVMLVFYEWGSGRPYKAWMYSGMATYMIQSLLKTADDSMEHNPDEFHASQIQY
                     EQLVRTYWVCFAQDCELSSGARQHFALSFRHISVPLPVSDYDYNFGRRGPPRLMPADL
                     TRGSPLCVKLTIEHGLTVVTRGFDIFVRILRFANESRRGRVSLTTTALSSPQQTWQVL
                     KEELDEWRSLQDSTLQYPATSVQVHVALGYGELFAYINLIYFMSILFLYRDQLLSSLK
                     QIHDPRHDPQSSTSLDGTTWSEGAIDRLFEAAQNIGGILSVLQTCSAPVITPYAGFSV
                     FVAAHINMYGTVSPLQYPGGQGRAEKEKKANFSYLERLCEFWPVGHNWWRAAQDANKF
                     YETARNNQEHALSGDRPGHITLAGTLDEYGDIRSSRPRNETSSNTSHITLPRGQTDSP
                     TQTRLPFNDQFILDAQELETDMLQWPFIDETWSSGFDTGFDAAWPNFG"
     gene            <1320881..>1323612
                     /locus_tag="ACHE_10470S"
                     /db_xref="GeneID:66977427"
     mRNA            join(<1320881..1321240,1321297..1322372,1322430..>1323612)
                     /locus_tag="ACHE_10470S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279631.1"
                     /db_xref="GeneID:66977427"
     CDS             join(1320881..1321240,1321297..1322372,1322430..1323612)
                     /locus_tag="ACHE_10470S"
                     /note="COG:Q;
                     EggNog:ENOG410PH02;
                     InterPro:IPR017871,IPR027417,IPR003593,IPR039421,
                     IPR011527,IPR003439,IPR036640;
                     PFAM:PF00005,PF00664;
                     TransMembrane:11
                     (o20-38i82-107o119-138i150-170o199-221i290-307o327-
                     345i413-433o439-458i530-547o559-580i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_function: GO:0042626 - ATPase-coupled transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131590.1"
                     /db_xref="GeneID:66977427"
                     /translation="MDPTYTTRQFREYLQFSYPAATLLVFLIGFITNSVLIAKSSQNG
                     GAVRCGLEEKPLSKGLRSTIHKIADAQKHQFSSSARYAFVWLVVGVLVTLVADVSVHI
                     SHAIAGHEERWWCGQATVIYVVGSFFSHVIIFLSLLDTNPAPTFAQFIPWSMTIPFEL
                     AIVATSLSIYTNTHHDPIVGNAFGGPLRERITKWELLEVISGVIRLLFLVFLVALYVL
                     HFVRANSAEGSREDSPMEQIGLLDSETKAGAENNEGDDAPEKPTTAPNTWWQYLSGYS
                     VLFPYLWPSKSRRLQIIVIICFGLLILQRIVNVLVPYQVGVITEALSIEGNNIHLPWL
                     QICLYIIYRWLQGSQGLLESLRSYLWIPISQYAYMETSTASFEHVHGLSLDFHLNKKI
                     GEVLYALNKGSDSVNTFLEQVTFQVVPMVIDLGVAVGYFLIAFDAYYGLVVAIVTFFY
                     LYVTVRIAQWRAEMRRKQVNAHRQENAIKNDSLSSYETVKHFNAELLEHTRYRTAVST
                     FQSAEYHSLYAQSFMTAAQNTVFTLGLLLTCFIAAYQVSIGQRPVGQFMTLLTYMAQL
                     QTPLSYFGTFYRYIQTAMINSERLLELLRERASVVDRVSARPMDACQGRITFEDIGFA
                     YDARKHKNALNGLSFHCEPGTITALVGESGGGKSTIFRLLFRFYNPQTGRILVDNNDV
                     QDITIASLREHIAIVPQDTSLFNESLLYNLRYASPSATDEDIHNACRAACIHDKIMTF
                     PEAYETKVGDRGLRLSGGEKQRVAIAQTILKNPQIILLDEATAALDSETEGHVQEALG
                     NLAKGRTVIMIAHRLSTVTEANQILVLHEGRVVERGTHGELLGLGGRYMGMWRRQSRQ
                     GAGEELRRRNPQQRLL"
     gene            complement(<1323725..>1326049)
                     /locus_tag="ACHE_10471A"
                     /db_xref="GeneID:66977428"
     mRNA            complement(join(<1323725..1325582,1325638..1325762,
                     1325828..1325884,1325969..>1326049))
                     /locus_tag="ACHE_10471A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279642.1"
                     /db_xref="GeneID:66977428"
     CDS             complement(join(1323725..1325582,1325638..1325762,
                     1325828..1325884,1325969..1326049))
                     /locus_tag="ACHE_10471A"
                     /note="BUSCO:EOG09260RS7;
                     COG:J;
                     EggNog:ENOG410PFJ7;
                     InterPro:IPR003307,IPR016021,IPR029044,IPR016024,
                     IPR005835,IPR011004,IPR044123,IPR001451,IPR035543;
                     PFAM:PF00483,PF00132,PF02020;
                     go_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016779 - nucleotidyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0031369 - translation initiation factor
                     binding [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131591.1"
                     /db_xref="GeneID:66977428"
                     /translation="MAPKKGGGGAPKQRNAAEEVEETLQAVVLADTFETRFEPFTLDK
                     PRCLLPLANTPLIEYTFEFLANAGVEEVFLYGGAHSDQLEKYINASKWRALSSPFKQL
                     TFLKSTSTSVGDVMRDLDGKHVITGDFIVVSGDVISNMPIEGALATHRARREADKNAI
                     MTMVLREAGRNHRTKSSSVSPVFVVDPTKDRCLHYEEIDHHAEQSEHGARLNIDTEII
                     ASHPEIDIRQDLIDCSIDICTPDVLSLWSDSFDYQAPRKQFLFGVLKDYELNGKTIHT
                     YIIKDHYAARARNLKAYDAISKDVISRWTYPLCPDTNLLPGHNYELRKSNLYQEQNVT
                     LARSCVVGRRVVIGQGTSIGEKTTVKNTVLGRNCKIGRNVTLNGAYIWDNVVIGDNTI
                     VNQAIVANGAVVGNQCKVESGALLSYGVKIADGITIGEGIRITKSPKEDDEVAPESDP
                     AVVGAGGEGYEFTRDEDSDDEEDDASDTSSGLVYNMANLSLSTESISTLSSETSDFAG
                     SRAGSYGTSVSEEEKEDHFVQDAAVSLYDGLREGVSPDVVQLELVSLRMTANASDNQV
                     RRAVVSAFMKRIQNLIDESQKSASQAVRDIFGTYREIVERCMFDRETAAKPDQVDLLL
                     LLQQDLVTRPKGDTVLLFTAKELYDLELIEEEAYEQWWDDERSSGTEDMRKIRVQTQQ
                     FVDWLANAEEEDSDEDEEEESDDE"
     gene            complement(<1326955..>1328443)
                     /locus_tag="ACHE_10472A"
                     /db_xref="GeneID:66977429"
     mRNA            complement(join(<1326955..1327475,1327530..1327719,
                     1327769..>1328443))
                     /locus_tag="ACHE_10472A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279653.1"
                     /db_xref="GeneID:66977429"
     CDS             complement(join(1326955..1327475,1327530..1327719,
                     1327769..1328443))
                     /locus_tag="ACHE_10472A"
                     /note="COG:K;
                     EggNog:ENOG410Q4IY;
                     InterPro:IPR011006,IPR001789,IPR014402,IPR027725;
                     PFAM:PF00072;
                     go_function: GO:0000156 - phosphorelay response regulator
                     activity [Evidence IEA];
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131592.1"
                     /db_xref="GeneID:66977429"
                     /translation="MLQEVMRVQKTVLNHENVIHQLMTYLLSVDARQRRDSKAAAPFQ
                     PQGQAGSTLSPSQVTPMEDEPSSPLQQASKLLNDLHSEMQFNLTGVDQLGEAKQTPVV
                     STPTTGMVRAPTTGANSSALVYPTTTPKMNGEMDTVVYPVGATNGIDPMYSEHVNNVP
                     YPMPPKPEIESSDARRQFPDNRKKSTNVDPGWMRSPHILLVEDDATCRQIGGKFLYSF
                     SCVIDTAFDGLEAVNKIQDGSKYDLILMDIIMPNLDGVSACHLIRQFDRTPIIAMTSN
                     IRSDDIQLYFQHGMDDVLPKPFTRKSLLDMLEKHLVHLKSIPQGMEAPQPAPAVTMAA
                     QGSAAQSVKEDSSPGQSPAASMSNWQSPGQFHGMAVHPSIPHVQGQYAAATPAAPVAY
                     TVDQNGVQYPAPAVALAPAGAAPAAVRPPHRRQVSEMSSAPDNPNMAKRPRMYAQPAQ
                     AMVNPVQARTG"
     gene            <1330353..>1331118
                     /locus_tag="ACHE_10473S"
                     /db_xref="GeneID:66977430"
     mRNA            join(<1330353..1330560,1330614..1330713,1330773..1330818,
                     1330875..1331040,1331090..>1331118)
                     /locus_tag="ACHE_10473S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279664.1"
                     /db_xref="GeneID:66977430"
     CDS             join(1330353..1330560,1330614..1330713,1330773..1330818,
                     1330875..1331040,1331090..1331118)
                     /locus_tag="ACHE_10473S"
                     /note="COG:O;
                     EggNog:ENOG410PN2B;
                     InterPro:IPR036249,IPR037944,IPR013740;
                     PFAM:PF08534,PF00578;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131593.1"
                     /db_xref="GeneID:66977430"
                     /translation="MFATRRVATSLPRAFSQRALFHNTAPAFVQKGDSIPDLDVLVEN
                     SPGNKVNLAKEIKGKGVIIGTPAAFSPACSSTHVPGYINHPKLKEAGQVFVVSVNDPF
                     VTKAWGTSLDPTGKSGIRFLGDPTGKFSEALDVTFDSTSVFGNQRSKRYALTVENGKV
                     TGTYIEPDNTGVNASTAEKVLG"
     gene            complement(<1331318..>1331788)
                     /locus_tag="ACHE_10474A"
                     /db_xref="GeneID:66977431"
     mRNA            complement(join(<1331318..1331493,1331560..>1331788))
                     /locus_tag="ACHE_10474A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279675.1"
                     /db_xref="GeneID:66977431"
     CDS             complement(join(1331318..1331493,1331560..1331788))
                     /locus_tag="ACHE_10474A"
                     /note="COG:T;
                     EggNog:ENOG410PRF5;
                     InterPro:IPR002634,IPR036065;
                     PFAM:PF01722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131594.1"
                     /db_xref="GeneID:66977431"
                     /translation="MFSRSTTIFRRSCRYLLRAPIHNPQVKKSPFSLSARSFAAVDAA
                     MADSSTGVTAELVRNKLIEKLQAQHVEIEDLSGGCGQAFMAIIVSPQFESKNMLARHR
                     LVNAALKEEIAAIHAWTPKCYTPEQWQSMMQQ"
     gene            <1332082..>1333376
                     /locus_tag="ACHE_10475S"
                     /db_xref="GeneID:66977432"
     mRNA            join(<1332082..1332185,1332235..1332278,1332327..1332455,
                     1332523..>1333376)
                     /locus_tag="ACHE_10475S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279686.1"
                     /db_xref="GeneID:66977432"
     CDS             join(1332082..1332185,1332235..1332278,1332327..1332455,
                     1332523..1333376)
                     /locus_tag="ACHE_10475S"
                     /note="BUSCO:EOG09263UQF;
                     COG:S;
                     EggNog:ENOG410PK0I;
                     InterPro:IPR002678,IPR036069;
                     PFAM:PF01784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131595.1"
                     /db_xref="GeneID:66977432"
                     /translation="MSIPRTLRRFSNMPSSSPAYCSPFTRAVVSSMRKLYPESLADKS
                     WDNTGLLLEAPFDGSRYRQRNSVLLAIDLTKAVVDEAINRGDSVVVAYHPIIFRGLKS
                     LTLNDSQQTSLLRLAQAGISVYSPHTAIDAAPGGMGDWLCDVVTGCFISKPQDLPPAP
                     AEQKPIPQLYTKPTYPQPTGITANPPELKHTRKTIHPSSPPVPEGCENAGMGRLVTFS
                     EPQPLSTIIDHIAAGVGNPGGIPIAIPQGSQLEDIRIRTVGVCPGSGSSVLMKGVSEI
                     PDLMFTGEMSHHEALAAIENGKVVVSLSHSNTERGYLHAVMKEKLQSALRGEWESVRQ
                     EGIKAFEDGGSVQELEMFEDGTCEVDVSKADRDPYGIMIRRI"
     gene            complement(<1333435..>1335703)
                     /gene="COG6"
                     /locus_tag="ACHE_10476A"
                     /db_xref="GeneID:66977433"
     mRNA            complement(join(<1333435..1335339,1335407..>1335703))
                     /gene="COG6"
                     /locus_tag="ACHE_10476A"
                     /product="Golgi transport complex subunit 6"
                     /transcript_id="XM_043279697.1"
                     /db_xref="GeneID:66977433"
     CDS             complement(join(1333435..1335339,1335407..1335703))
                     /gene="COG6"
                     /locus_tag="ACHE_10476A"
                     /note="BUSCO:EOG09260KCB;
                     COG:U;
                     EggNog:ENOG410Q13F;
                     InterPro:IPR010490;
                     PFAM:PF06419;
                     go_component: GO:0017119 - Golgi transport complex
                     [Evidence IEA];
                     go_process: GO:0006891 - intra-Golgi vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Golgi transport complex subunit 6"
                     /protein_id="XP_043131596.1"
                     /db_xref="GeneID:66977433"
                     /translation="MASYFPPGANFSHASTRTPSPANSPLSPPTQRSNALSNRLTSVL
                     SASYADSDIRDALETLSLRGVHNTVETRRQLRLDVQKEVVDCNAEVVNDFGKVAEQLK
                     RIGTVITSLNQTCDEMRKHIVLAKQDTSPVLDEATSLMNQKQEAETKQQLLNAFMQHF
                     IISDEDLLALTSAEVPIDDHFFDVLARVKQVHHDCEVLLGGENQRLGLEIMERSSRNL
                     NSAYQKLYVWIQKEFRSLNLEDPRISSSIRQALRVLAERPSLFHSCLDFFAEARDYIL
                     SEAFHYALSDAVSGAGGDRSVKPIEFSAHDPMRYVGDMLAWVHSTAVSEREALEALFV
                     ADGEELAKGIQAGLSSEPWSRIDEDEETVAFDGRKALSDLVNRDLTGVSRSLRQRVEL
                     VIQGHDDPITCFKVVNLLSFYRTTFSRLVGQHSNLAELMQTLEKFTFSHFEALMHEQT
                     TTLSNDHPALTPSRDLSAPQFLLDALEGLTSLMKAHEVSFAEDTETPGGNQFTPVLRV
                     ALDPFVKLAESSAEDLQDETARTIYKTNILLTTRTNISAYPFASATHLQPLSTSISTI
                     RIDLLEIQHRYLLSSSGLQVLLEALEPYSPSTSTTQTSNHKRQPSTNLASITTLPAFQ
                     PSSLIAASQQLDDFLPSALMDATENLKRVQSAAFVKSVTEEAVEAFCRDFEFVEGMII
                     GADEARGISLVNEHVDWSGSEYEGEGEEGQEKYSLRALFPRTTGEIRVLLS"
     gene            <1335919..>1336767
                     /locus_tag="ACHE_10477S"
                     /db_xref="GeneID:66977434"
     mRNA            <1335919..>1336767
                     /locus_tag="ACHE_10477S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279708.1"
                     /db_xref="GeneID:66977434"
     CDS             1335919..1336767
                     /locus_tag="ACHE_10477S"
                     /note="COG:S;
                     EggNog:ENOG410PQ2N;
                     InterPro:IPR026243;
                     go_component: GO:0070652 - HAUS complex [Evidence IEA];
                     go_process: GO:0051225 - spindle assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131597.1"
                     /db_xref="GeneID:66977434"
                     /translation="MDPLVSPAKARQAAIQAKDWAYVNSWLSRQCAPKPVPAFERNED
                     TLRTLLALAAASDAADEEATLVHRAREEVVQGFKAREEAEDKQKLELLDEVEMCLDDK
                     GRRNLDYLAETSAVLGALSTEAPNLGQSIIELTKEEFDTHEQISKVDALQKYLEKELA
                     SLQEQLETLKSDEAYDTSSDLPALTAEWTRNTKLLTAKVREYRDRIASLERSEHKGAT
                     IEELIAEEGSVLQIKGMVETLEKRVRMFLDLPEDIPSARSQYRQLERELGQLIQQRNS
                     MLEPSG"
     gene            complement(<1336927..>1337305)
                     /locus_tag="ACHE_10478A"
                     /db_xref="GeneID:66977435"
     mRNA            complement(join(<1336927..1336972,1337026..1337218,
                     1337272..>1337305))
                     /locus_tag="ACHE_10478A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279719.1"
                     /db_xref="GeneID:66977435"
     CDS             complement(join(1336927..1336972,1337026..1337218,
                     1337272..1337305))
                     /locus_tag="ACHE_10478A"
                     /note="COG:O;
                     EggNog:ENOG410PRTR;
                     InterPro:IPR007250,IPR038399;
                     PFAM:PF04119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131598.1"
                     /db_xref="GeneID:66977435"
                     /translation="MSDYGRKDFTTKAKEEITPDSAKSTQDKVKETVTDTTDRFTRGA
                     QSDKDKSAPQEAWDKTQRVHDNEHHGGAGQSIGDKVKDTLGLGGNK"
     gene            <1338142..>1339691
                     /locus_tag="ACHE_10479S"
                     /db_xref="GeneID:66977436"
     mRNA            join(<1338142..1339014,1339071..>1339691)
                     /locus_tag="ACHE_10479S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279730.1"
                     /db_xref="GeneID:66977436"
     CDS             join(1338142..1339014,1339071..1339691)
                     /locus_tag="ACHE_10479S"
                     /note="COG:S;
                     EggNog:ENOG410PNSA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131599.1"
                     /db_xref="GeneID:66977436"
                     /translation="MPASITSNWDFTPVINLLRSPAYTAGDSSAPSRHSEDHVATPPA
                     EELKDINNDPGCVTPKNTNNVDTTTPKLGDFGSLWDFLGQGTAVASATTIAVEGPQGS
                     ESSNTTPRPRSPQPSTPIKILQRPSPKPLVPEVLNKGPSSISRRILVPKSRKNKLEVG
                     VEFGSGNEHNTQKATLEATSSDSTAESDSIFDPPLSKKGGVASSAQPAKSELYDSPPS
                     SFDELDGALTSETIKKSHESGVIRVQSNVYKSVDERRDGLHSKLLKKFPDYAGIVSGK
                     GSSPRPVHVFVDISNIMVGFHDSVKLSRNIPIPTRIRRLPLSFKNFSLILERDRPAAK
                     RVLVGSDRFAAIDEGEKLGYETNILDRVHKAKQITRRQVKFRKNARTASQEAATSSET
                     NEVAAQRWVEQGVDEILHLKILESLLDTDEPATIVLATGDAAEAEYSGGFMKMVERAL
                     QRGWTVELVSFSQVTSQAYRRKEFRSKWGNRFRVIALDDYIEELLAM"
     gene            complement(<1340814..>1343493)
                     /locus_tag="ACHE_10480A"
                     /db_xref="GeneID:66977437"
     mRNA            complement(join(<1340814..1341034,1341096..1343271,
                     1343410..>1343493))
                     /locus_tag="ACHE_10480A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279742.1"
                     /db_xref="GeneID:66977437"
     CDS             complement(join(1340814..1341034,1341096..1343271,
                     1343410..1343493))
                     /locus_tag="ACHE_10480A"
                     /note="COG:O;
                     EggNog:ENOG410PFDY;
                     InterPro:IPR003959,IPR003960,IPR027417,IPR003593,
                     IPR015415;
                     PFAM:PF09336,PF00004;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131600.1"
                     /db_xref="GeneID:66977437"
                     /translation="MAKTTSSLQKTYDECYLTCSTAVYFEGKNNEAEALRSWRSALET
                     INYHNAYRLSATYTPRTETEKALQDSIRQLEAQCRERVDLLEALRESRKEAQKDNNPS
                     INGNGTGNGNGNSKPTSPTGLSSLKGKFSSKSPTSPTNNTSHNNTTPGWIGDGTIPAV
                     HYADLSKPPTLPGRPQPQTRISSESIAPRHATTTSSAVSPPSQVLSNSSSRPKSKPKP
                     KPQSQSRILSPERKAPDNIPPMLSTLRKGYPKKDPKKDPKKQAKKKASSPRISPERTS
                     RPAASQAAAGLAWDSNYRSPSSSDRGASDAALVSSRISVSDSRYSSGEEVPTRRTFAD
                     ETEPSSPRTSDQAIRRVPAKTPVTISSAASGGARSHSASRERSYSGSAPRSSPKPSVK
                     PKPAELKTSQQAPVRPKLNRAASGSGTPRSSRTSQPAPRTRITPTSTGNNDAGLSGSM
                     DRMDISDPAIRRKPQVRRETPPSSDAESPGPRSTDADEDNEEDDEDEDGDEDDAIMDI
                     MNKLPKGVDTMAARQILNDIVVRGDEVHWDDIAGLEGAKKALKEAVVYPFLRPDLFSG
                     LREPARGMLLFGPPGTGKTMLARAVATESKSTFFSVSASTLTSKWHGESEKLVRALFG
                     LAKTLAPSIIFVDEIDSLLSARSSGAENEASRRSKTEFLIQWSDLQRAAAGREQGKAD
                     KKVGDASRVLVLAATNMPWDIDEAARRRFVRRQYIPLPEHGVREQQIRKLLSHQVYEL
                     ADDDIEVLVQVTEGFSGSDITALAKDAAMGPLRNLGEALLHTPMDQIRPIRFADFEAS
                     LYAIRPSVSQEGLKQYEEWAKNFGERGG"
     gene            complement(<1344558..>1345920)
                     /gene="MRS3/4"
                     /locus_tag="ACHE_10481A"
                     /db_xref="GeneID:66977438"
     mRNA            complement(join(<1344558..1344609,1344660..1345104,
                     1345168..1345447,1345500..1345535,1345592..1345661,
                     1345883..>1345920))
                     /gene="MRS3/4"
                     /locus_tag="ACHE_10481A"
                     /product="Fe(2+) transporter"
                     /transcript_id="XM_043279753.1"
                     /db_xref="GeneID:66977438"
     CDS             complement(join(1344558..1344609,1344660..1345104,
                     1345168..1345447,1345500..1345535,1345592..1345661,
                     1345883..1345920))
                     /gene="MRS3/4"
                     /locus_tag="ACHE_10481A"
                     /note="COG:C;
                     EggNog:ENOG410PGAR;
                     InterPro:IPR018108,IPR023395,IPR002067;
                     PFAM:PF00153;
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Fe(2+) transporter"
                     /protein_id="XP_043131601.1"
                     /db_xref="GeneID:66977438"
                     /translation="MAAPDQVPGEEYDYEALPSNYGLGRNMLAGAFAGIAEHAVMYPV
                     DLLKTRMQILHPSGALYTGLTNAVSTIYRIEGWRTLWKGVSSVIVGAGPAHAVYFGTY
                     EIVKEFAGGNVDEGHHPLAAALSGASATIASDALMNPFDVIKQRMQVHGSVHKTLAQC
                     ARSVYRTEGLQAFYVSYPTTLCMTVPFTATQFVAYESLSKVMNPSQEYDPFTHCIAGG
                     LAGAFAAGLTTPLDVVKTLLQTRGLAQNEEVRSAKGLINAATIIKRQFGWGGFLRGAR
                     PRIISTMPSTAICWTSYEMAKAYFKRQVNE"
     gene            complement(<1347360..>1349023)
                     /locus_tag="ACHE_10482A"
                     /db_xref="GeneID:66977439"
     mRNA            complement(join(<1347360..1347388,1347456..1348871,
                     1348936..>1349023))
                     /locus_tag="ACHE_10482A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279764.1"
                     /db_xref="GeneID:66977439"
     CDS             complement(join(1347360..1347388,1347456..1348871,
                     1348936..1349023))
                     /locus_tag="ACHE_10482A"
                     /note="BUSCO:EOG092627XA;
                     COG:O;
                     EggNog:ENOG410PHQN;
                     InterPro:IPR001841,IPR002867,IPR017907,IPR018957,
                     IPR031127,IPR044066,IPR013083;
                     PFAM:PF00097,PF01485;
                     go_function: GO:0004842 - ubiquitin-protein transferase
                     activity [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0016567 - protein ubiquitination [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131602.1"
                     /db_xref="GeneID:66977439"
                     /translation="MDSDDDFMSDASSNADFLDDQGSDIESMDDFGDDIDVGFSQDKD
                     IIGKTKKPYEVDHKVLSPEDIEREQNVQVNEVSSILGLPPESCAILLRYGRWNREKVI
                     ESYMDRPEKTLEDAGLGTNFEGAAKTEVIRGFMCDICCEDGDDLETYAMRCGHRFCVD
                     CYRHYLAQKIREEGEASRIQCPGDSCHMIVDSKSLSLLVTENLKDRYHTLLTRTYVDD
                     KENLKWCPAPNCEYAVDCPVRQRELNRIVPTVQCGCKHNFCFGCTLNDHQPTPCALVK
                     KWLKKCEDDSETANWISANTKECPKCHSTIEKNGGCNHMTCRKCKHEFCWMCMGLWSE
                     HGTSWYNCSRFEEKSGSEARTDQARSRASLERYLHYYNRYANHEQSAKLDRDLYLKTE
                     KKMTSLQSQSGLSWIEVQFLDTASQALQQCRQTLKWTYAFAYYLARNNLTEIFEDNQK
                     DLELAVENLSEMFEKPVPELANLKVDILDKTAYCNKRRVILLSDTAENLKDGEWSFNV
                     EW"
     gene            complement(<1350151..>1351107)
                     /locus_tag="ACHE_10483A"
                     /db_xref="GeneID:66977440"
     mRNA            complement(<1350151..>1351107)
                     /locus_tag="ACHE_10483A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279775.1"
                     /db_xref="GeneID:66977440"
     CDS             complement(1350151..1351107)
                     /locus_tag="ACHE_10483A"
                     /note="COG:I;
                     EggNog:ENOG410PJW8;
                     InterPro:IPR011042,IPR000033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131603.1"
                     /db_xref="GeneID:66977440"
                     /translation="MTDYPRILVLDIGLSAEPPLLQAGQVLELNPNDNTKQLRVLVSS
                     QSLPDGIAVDSASQRMFWTCMGFPGKWDGAVYSSALDGSDVQTLVAPGKVNTPKQLAL
                     DEAAKKVYFCDREGLGVYRCNFDGSDLEALILNGEPTTPPDVAEWCVGITVAPSLGKF
                     FWTQKGYSKSGQGRIFSADIDTPAGQSATSRDDIQVVLPGLPEPIDLEFDESSNTLYW
                     TDRGEVPFGNSLNRARLDESGMPKTIVTSSASFTAEVQERKYEILTRNLNEAIGLKLD
                     VERGHVYLTDLGGSVYRCDLEGKGKERLYLEDSRAFTGIALL"
     gene            <1351848..>1352896
                     /locus_tag="ACHE_10484S"
                     /db_xref="GeneID:66977441"
     mRNA            join(<1351848..1352105,1352156..1352540,1352598..>1352896)
                     /locus_tag="ACHE_10484S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279786.1"
                     /db_xref="GeneID:66977441"
     CDS             join(1351848..1352105,1352156..1352540,1352598..1352896)
                     /locus_tag="ACHE_10484S"
                     /note="COG:I;
                     EggNog:ENOG410PVDS;
                     InterPro:IPR006176,IPR006108,IPR036291,IPR008927,
                     IPR013328;
                     PFAM:PF02737,PF00725;
                     go_function: GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131604.1"
                     /db_xref="GeneID:66977441"
                     /translation="MNTIKTIGVVGTGVIGASWTALFLAKGYKVIVTDPAPGAEEKLQ
                     AYLQKEWPTLTKIGLVPGASLQNYQFVENIDEYLGEVDYIQENGPERLDIKRPLITHL
                     DANTRPDITIASSSSGLPSSQFVTDCTKNPSRILIGHPFNPPHLIPLVEVVPHPGTNA
                     ETISTAMNFYPKLGKDPVLVKQETPGFIANRLQAAVCNEAYSLVGRGVISAEDLDKTM
                     TSGLGLRWAVNGPLMTNALGGGRSFRHFIDHIGPAVKSWGDDMKQYEFGHEPEKRDKV
                     TEKVEEYVGGVDLDEVEKRRDEFILNSIQFKSSARGA"
     gene            <1353593..>1355341
                     /locus_tag="ACHE_10485S"
                     /db_xref="GeneID:66977442"
     mRNA            <1353593..>1355341
                     /locus_tag="ACHE_10485S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279797.1"
                     /db_xref="GeneID:66977442"
     CDS             1353593..1355341
                     /locus_tag="ACHE_10485S"
                     /note="COG:I;
                     EggNog:ENOG410PV78;
                     InterPro:IPR023606,IPR003673;
                     PFAM:PF02515;
                     go_function: GO:0008410 - CoA-transferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131605.1"
                     /db_xref="GeneID:66977442"
                     /translation="MATHTVIPGDDIYGPGSYIDKQPIPVPQDARRIFEYLAKTTPGF
                     TQDQRHWDNVTFNGRPEPSIPGPIKAPVVAAALHAMCGVVANEIVEDRDNQKQSSEQA
                     KVSVNTDHAAIWMGSIFTPHINGTDVQDLFKANKLGALFEKDLEHGWMDSFMNLRTTA
                     IYKTATPGVWYQLHGSLDAAPVLRSMGMDPEYPAKTPYEAYEYIASHVEKWMADELEM
                     HNVRNGFCGEICYTPGDWRKTEMGKRLAEHPLINYKRQSHAIPTPPTPFPSRIGSSDR
                     RPLAGVKVVELVRIIAGPVIGNTLAAFGADVIRVGCDKLRDLNVLQLSLNTGKRTINL
                     DLNSPEDKQRLHDLLQDADVFVQGFRPKTIARKGFGLNDLLSLAGTRGKGIVYVEENA
                     FGPDGIFHERPGWQQIGDAASGSSYVTGRSLGYTDGTSVLPPLPISDMTTGLLGALGT
                     MLALRDRARTGGSYHVLSSLVAADEIALRPEIGLYSPEVVAKNVETFKWGTMGPSQYV
                     TEVLNLVMDGWKRVFPEHLTPGTEQSFMVGFEESVWGKMEMLKPVVKIGDEAVSPRWE
                     TPTVPNCGQDKGITWL"
     gene            complement(<1355466..>1356122)
                     /locus_tag="ACHE_10486A"
                     /db_xref="GeneID:66977443"
     mRNA            complement(<1355466..>1356122)
                     /locus_tag="ACHE_10486A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279808.1"
                     /db_xref="GeneID:66977443"
     CDS             complement(1355466..1356122)
                     /locus_tag="ACHE_10486A"
                     /note="COG:S;
                     EggNog:ENOG410PZJ2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131606.1"
                     /db_xref="GeneID:66977443"
                     /translation="MSADSQYEFQVFTSQELQEHPCLLSLWSMINSAFISHRKGFLQP
                     SHRDSDRFQTPQDVISDLGPHGLCCVLFIADDTYTPIAYAGVKPYKEHFRLEVGGDVD
                     YSGSRPTHWYSIIDWELSSVVVQDDARYARKGFAARCCTKVESALVNRFRDERSKQQD
                     DRGMPEKITIWIQAIRELAGAYWSRRGYQEVSVKRVGAGRWGAARPFDLITGKKELAM
                     "
     gene            complement(<1356522..>1360021)
                     /gene="CDC60"
                     /locus_tag="ACHE_10487A"
                     /db_xref="GeneID:66977444"
     mRNA            complement(join(<1356522..1357326,1357379..1359876,
                     1359947..>1360021))
                     /gene="CDC60"
                     /locus_tag="ACHE_10487A"
                     /product="cytosolic leucyl tRNA synthetase"
                     /transcript_id="XM_043279819.1"
                     /db_xref="GeneID:66977444"
     CDS             complement(join(1356522..1357326,1357379..1359876,
                     1359947..1360021))
                     /gene="CDC60"
                     /locus_tag="ACHE_10487A"
                     /note="BUSCO:EOG092601KZ;
                     COG:J;
                     EggNog:ENOG410PGGF;
                     InterPro:IPR009080,IPR013155,IPR004493,IPR009008,
                     IPR002300;
                     PFAM:PF08264;
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0002161 - aminoacyl-tRNA editing activity
                     [Evidence IEA];
                     go_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0004823 - leucine-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA];
                     go_process: GO:0006429 - leucyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="cytosolic leucyl tRNA synthetase"
                     /protein_id="XP_043131607.1"
                     /db_xref="GeneID:66977444"
                     /translation="MAAAAASAAALDPGNSSKNTLKLENTQRRDALIELEKKYQEKWK
                     NEKVFEVNAPSLSEVPAGSMTAAELREKYPKFFGTMAYPYMNGTLHAGHSFTASKVEF
                     MTGFARMEGKRALFPLGFHCTGMPIKACADKLRDEVQKFGQNFEGYKEESEQVEETAA
                     PTQEVKAEQEKFSGKKSKAAAKTVKMKYQFQIMLAIGLPIEEIHKFADADHWLQHFPP
                     LAIRDLDSLGARVDWRRQFVTTDANPYYDAFVRWQMNRLHELGKIMYGNRYTIYSPKD
                     GQPCMDHDRTEGEGIGPQEYTAMKLQVKEWAPELAELVKGKIEDDAKVYFVPATLRPE
                     TMYGQTCCFVGPKINYGLYKVSEKEYFVVTKRAAWNMAFQGHFFDSENFPKSQDQLPL
                     VVEAPGSAFVGTLVNAPLSLHTEGVRILPMDTVSATKGTGVVTSVPSDSPDDYATLMD
                     LAKKPEFYGIKKEWAELEILPLIDTPNYGNLTAPTLVKQLKINSPKDVNQLAKAKELA
                     YGEAFYKGTMIVGEFKGEPVSSVKDKIRQSLYKSGDAIPFADPMGKVTSRSGDDCVVA
                     YLGQWFLNYGENDAQWQQDTLNHVVNTLNTYSNETKNGFEKNLSWLNRWACARTYGLG
                     SKLPWDPQFLVESLSDSTVYMAYYTIAHLLHGDRYGSQPGLLGLKPEQMTDEVWDYVF
                     TRRELSDELVSKSGISKESLQVMRREFEYFYPLDVRISGKDLIQNHLTFFLYIHLALF
                     PSEYWPRGVRANGHLLLNGDKMSKSSGNFLTLRDAVDKFGADATRIAFADAGDGIEDA
                     NFEETVANSNILRLYTLKDWIEETAKDQSLRTGPADTFFDKVFDNELNSLVRETRQHY
                     SDTNFKLALKSGLYDLTHARDTYREAATGAGIGLHRDMVFRYFELQALLLSPIAPHWA
                     EYIWLEVLKKPESIHFARFPEVPEPSPELTAATNYVRSTSSTITSSEATLAKKLSKGK
                     GSTFDPRKPKKITIYAAKKYPEWQEKYIDLVREAFDAVSISINDKELNAKVGKLGEMK
                     KAMPFVQTLKKRLITSREQPDAVFERKLPFDEFAVLTEMIGNLKRITGAKEIEIVAVD
                     EGGKSGEVVGTGEKREGISAENAVPGQPTFQFVNIAE"
     gene            <1360500..>1361336
                     /locus_tag="ACHE_10488S"
                     /db_xref="GeneID:66977445"
     mRNA            join(<1360500..1360538,1360617..1360619,1360758..>1361336)
                     /locus_tag="ACHE_10488S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279830.1"
                     /db_xref="GeneID:66977445"
     CDS             join(1360500..1360538,1360617..1360619,1360758..1361336)
                     /locus_tag="ACHE_10488S"
                     /note="COG:J;
                     EggNog:ENOG410PQK7;
                     InterPro:IPR040049,IPR036249,IPR007741;
                     PFAM:PF05047;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131608.1"
                     /db_xref="GeneID:66977445"
                     /translation="MVNLFKRMRKLRSKILHVTVGPGAAILPSPQTATKEFPAITRLH
                     LTYAQKIYNGHQGARHFWRQCLPRLKYHNPSIPMTVKQTQDQDGPAALTIYFAEQVSN
                     AATLNAAKDVNDKYAPAAGESEKTAVVDLKDLDWKRIWDKVRIMTGAKEVQASQKEEE
                     EVKKLEQMAVQSVKDRERNAKIRQAKKDQERMLQEARGEVERLRQT"
     gene            complement(<1361679..>1362862)
                     /locus_tag="ACHE_10489A"
                     /db_xref="GeneID:66977446"
     mRNA            complement(join(<1361679..1362399,1362459..>1362862))
                     /locus_tag="ACHE_10489A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279841.1"
                     /db_xref="GeneID:66977446"
     CDS             complement(join(1361679..1362399,1362459..1362862))
                     /locus_tag="ACHE_10489A"
                     /note="COG:S;
                     EggNog:ENOG410PGNB;
                     InterPro:IPR035952,IPR013861;
                     PFAM:PF08551;
                     TransMembrane:7
                     (o6-27i48-65o77-94i106-128o134-153i173-191o197-214i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0006890 - retrograde vesicle-mediated
                     transport, Golgi to endoplasmic reticulum [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131609.1"
                     /db_xref="GeneID:66977446"
                     /translation="MVRVNIPPATRICLVSLLTLSLLYNIARWRQISSISGTTGKTQL
                     TMPIVVPYLTLVPLRLFYYPWTLLTATFVEQNIFTVLLNLATLFYGGKYLERAWSSRE
                     FAKFIVTIAVIPNVVIVPFYLLWAAIRGDPSIGLTQICGGISIQASFLVAFKQLVPEH
                     TVTVFKGLVQMRVKHFPALFLFLNTISGVVLGTESAAILSWLGLLTSWTYLRFFKRQP
                     DLTGTSTDGMGIKGDASETFAFACLFPDVIQPPIAAISDQIYNLLVSLKICTPFSEEA
                     IASGNQQVLARGEAGLPTLLSSHRASSMRGTGKREEAERRRALALRALDQRLQAAAAG
                     RAQSHSPSSAASSQPTRAATPTVSAGQGMLGGTNYTPDNA"
     gene            <1364301..>1364717
                     /locus_tag="ACHE_10490S"
                     /db_xref="GeneID:66977447"
     mRNA            <1364301..>1364717
                     /locus_tag="ACHE_10490S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279853.1"
                     /db_xref="GeneID:66977447"
     CDS             1364301..1364717
                     /locus_tag="ACHE_10490S"
                     /note="TransMembrane:1 (o94-112i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131610.1"
                     /db_xref="GeneID:66977447"
                     /translation="MSCSCPGPLNHHHLTIFNCFNHFPLLAATLSVNRLAASFPGLSA
                     REKSNDRPTPPDFNASPEYFRRACLYPSLSSHCFDLPSFDSLLLLTPFSILYYILSLL
                     LLLSPLPLSVPHPLTNRKNPVLACERFLRHSSLPHM"
     gene            <1364720..>1366811
                     /locus_tag="ACHE_10491S"
                     /db_xref="GeneID:66977448"
     mRNA            join(<1364720..1364769,1364868..1364884,1364943..1365091,
                     1365145..1366713,1366785..>1366811)
                     /locus_tag="ACHE_10491S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279864.1"
                     /db_xref="GeneID:66977448"
     CDS             join(1364720..1364769,1364868..1364884,1364943..1365091,
                     1365145..1366713,1366785..1366811)
                     /locus_tag="ACHE_10491S"
                     /note="COG:S;
                     EggNog:ENOG410PSPM;
                     InterPro:IPR036322,IPR015943,IPR001680,IPR006594,
                     IPR017986;
                     PFAM:PF08513;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131611.1"
                     /db_xref="GeneID:66977448"
                     /translation="MSHPDLTSHHVNYLIWRYLQESGLGDAAVMLQRAWNHDPQSLPF
                     APYIRTHALVSLVQKGLQYHELEKSLDKEGNPVPFTPSSYFFGPQPLESDLLRTPAGP
                     AEAADHAALVSPTSKVARDAATNGHLTAETGKKSRKGDRADTAVAAANGEESSMEIDT
                     NGIHKDHDESPVADATIDGDGDVSMIRSESQGQEPAAPPPPPPPPTLATGHSVGVQIS
                     PAKAADLSPGTALLNVAGKDHVTRTLWRPRDPTVVVAAGDTFCSLWKLSSSSQPAPEN
                     LVDGSREDTCVSAVAWDPTGQKLAVATYNDMRGSITMYDVHGHAVDLLPEVPRMITGL
                     HWAESGSHLVVVASDSRVSELALWDDSLRPDVFPAPQVIDGSIYDLSWIGPNQAFACS
                     DGSVYQCQVDSSIHITRTFSSGAPDTTWTFIRCASAGPSSSMAVAASSSTASFWIPTH
                     DMRLDEAHQGDITAIELRADSRQSPFVLASSSADDTVKIWHIDPGSKRFECIHRLFLG
                     PSIPALAGCFSPDGYALAAASKERLYIWNAERGGSAMATWALPSSEDAKEGPDQAVNG
                     HNGTGDSLPDRSLSWDTNGKKLAFGVGHQMAIVNLQR"
     gene            complement(<1367451..>1368562)
                     /locus_tag="ACHE_10492A"
                     /db_xref="GeneID:66977449"
     mRNA            complement(join(<1367451..1367802,1367865..>1368562))
                     /locus_tag="ACHE_10492A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279875.1"
                     /db_xref="GeneID:66977449"
     CDS             complement(join(1367451..1367802,1367865..1368562))
                     /locus_tag="ACHE_10492A"
                     /note="COG:S;
                     EggNog:ENOG410Q5AV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131612.1"
                     /db_xref="GeneID:66977449"
                     /translation="MHRTTYDMDLPPTLTRHPQNHDNGPLSPSFADSGIDMELETELP
                     QTQTHIQTSEASTEPDTNFDAGETETESLHLAARLAKLAMNARKSDNGIKSRSFSKTD
                     TAILHRCLETIENTLSLPDDDDDDDDPRPTLTQEIAKHRPQSLNLTPHYPSPPSSTVA
                     EPSPPAVSHTTEPRSEPHPTESQLTAVLEEVTALGSELDKRRRETFQIYELYTQKCQG
                     LERRIAGLEGEVCELQADILENSIEREGFRGTVYGLQNWVVGWQRDHELAIIQAREAR
                     KGWTKRKPARREDDADALFDGITAWMRGWKDVEEGFQAREREREQRRDKRQKQQSLDT
                     IRDNCLPLSSTGENS"
     gene            <1369091..>1370840
                     /gene="TRP2"
                     /locus_tag="ACHE_10493S"
                     /db_xref="GeneID:66977450"
     mRNA            join(<1369091..1369102,1369162..1369307,1369386..1369459,
                     1369528..>1370840)
                     /gene="TRP2"
                     /locus_tag="ACHE_10493S"
                     /product="anthranilate synthase component 1"
                     /transcript_id="XM_043279886.1"
                     /db_xref="GeneID:66977450"
     CDS             join(1369091..1369102,1369162..1369307,1369386..1369459,
                     1369528..1370840)
                     /gene="TRP2"
                     /locus_tag="ACHE_10493S"
                     /note="BUSCO:EOG09262L1P;
                     COG:E;
                     EggNog:ENOG410PHJG;
                     InterPro:IPR005256,IPR005801,IPR019999,IPR006805,
                     IPR015890;
                     PFAM:PF00425,PF04715;
                     go_function: GO:0004049 - anthranilate synthase activity
                     [Evidence IEA];
                     go_process: GO:0000162 - tryptophan biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="anthranilate synthase component 1"
                     /protein_id="XP_043131613.1"
                     /db_xref="GeneID:66977450"
                     /translation="MAPPAIVPTLETAADVITSTRNTTFPPNLLPLTASIPADLLTPT
                     LAYLKISEKSKLSFLYESAATTETIGRYSFVGADPHKVLKTGPGHGPACDPLPALESE
                     LSQYRVATVPGLVLPPLTGGAIGYVGYDCVKYFEPKTERPLKDVLGIPESFFMMYNTI
                     VAFDHFFQVVKVITFISIPNSNAELEAEYRKGAEVIQRTIDTLLQPEYPLPLQGPIVP
                     NQEYTSNIGREGYESHVTKLKEHIGKGDIFQTVPSQRLSRPTSLHPFNLYRHLRTVNP
                     SPYLFYIDCEAFQLVGASPELLAKEEKGRIISHPIAGTVKRGKTVEEDEALADELRGS
                     LKDRAEHVMLVDLARNDVNRVCDPMTTQVDRLMVVEKFSHVQHLVSQVSGVLRPEKTR
                     FDAFRSIFPAGTVSGAPKVRAMQLIAELEGEKRGVYAGAVGYFGFNMSSTDGSKELPG
                     AMDTCIALRTMMLKDGVAYLQAGGGIVFDSDPYDEYVETLNKLGANIQCIKGAEAKYL
                     SLEREA"
     gene            <1371722..>1373566
                     /locus_tag="ACHE_10494S"
                     /db_xref="GeneID:66977451"
     mRNA            join(<1371722..1371794,1371847..1371916,1371976..1372196,
                     1372248..>1373566)
                     /locus_tag="ACHE_10494S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279897.1"
                     /db_xref="GeneID:66977451"
     CDS             join(1371722..1371794,1371847..1371916,1371976..1372196,
                     1372248..1373566)
                     /locus_tag="ACHE_10494S"
                     /note="BUSCO:EOG09264881;
                     COG:F;
                     EggNog:ENOG410PHV8;
                     InterPro:IPR008942,IPR013809,IPR003903;
                     PFAM:PF01417,PF02809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131614.1"
                     /db_xref="GeneID:66977451"
                     /translation="MSKVVRSVKNVTKGYSGVQVKVRNATSNDPWGPTGTDMAEIAAM
                     TFGSPTDFYEIMDMLDKRLNDKGKNWRHVLKSLKVLDYCLHEGSELSVTWARKNVYII
                     KTLREFQYVDEEGRDVGQNVRVAAKELTSLIMDEDRLRSERSDRKLWKSRVSGLDDYQ
                     QMGYEPPRRAERPRRRQHDDEDDTEYRLAIEASKAEAEEERRRRAKAMEAAEDDEDLA
                     RAIRLSKEEEELRKRELEESNAQSLFDDTPMQAAPAQATGYNQGYQQQNAVDWFGNPI
                     NPQQPLTTGYLNNQYAQPTGFQSQPTGMNGYGTSVFDQNPYGQQNNFLQPQATLQPQH
                     TAFNTNNPYGMDVYSQQAQQQQQMMLQQQQQQQQQESYPSAGSNNPWASSQPADALKP
                     MPTGSNNPFAGRTQFRPTSPLTQGPPSLNTLAEDRATTQFTASTTNPIANFQPSPMAA
                     PQPPKSTPPQLNNPHHARLNALLSSGEGQDTFGNVGDLRIPAQHTAPGTFVNSAGQGL
                     SRLQATQTGNNPFFGQQQQQQQFVPQQTGFVNNPWGGQPPQQQQQGGSLIDL"
     gene            <1374178..>1375689
                     /locus_tag="ACHE_10496S"
                     /db_xref="GeneID:66977453"
     mRNA            <1374178..>1375689
                     /locus_tag="ACHE_10496S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279908.1"
                     /db_xref="GeneID:66977453"
     CDS             1374178..1375689
                     /locus_tag="ACHE_10496S"
                     /note="COG:C;
                     EggNog:ENOG410PFKP;
                     InterPro:IPR013118,IPR036291,IPR000669,IPR013131,
                     IPR008927,IPR013328;
                     PFAM:PF01232,PF08125;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131615.1"
                     /db_xref="GeneID:66977453"
                     /translation="MAPLKLNSKNLSQISAAGEAQVKVPSYQRGGAVKEGIVHVGVGG
                     FHRAHLAVYVDQLMQNHGVNDYAIAGVGLQPFDVAMRDALGSQDHLYTVIERSAKGSF
                     ANVVGSINSFLFAPDDREAVIAKMAHPDTHIVSLTITESGYYYNENSHELQSEHPDIQ
                     FDLDPANDKAPRTTFGFLYAALARRYQQGLKPFTVMSCDNMQKNGSITRHMLESFARL
                     RNNPEIANWIAEQGAFPNAMVDRITPQTSAADKTALVDTFGIEDSWPVVTEPFMQWVI
                     EDQFSDGRPPFEKVGVQVVKDVHAVEEFEKHKLRLLNGSHSAIGYPGQLAGFKYVHEV
                     MENPVFHKFVWQMMQEEVKPLLPEIPGVNIDEYCNTLIERFSNPTIMDQLPRICLNAS
                     GKIPQFIMPSIAESIWVTGPFRRLCFVAAAWFRYVNGVDDNGNTFAVDDPMREELQAK
                     ARAGGTNPAELLSIKSLFGDDLRGDKRFLQEITTAMEDIARDGILKTLPKYVD"
     gene            complement(<1376197..>1377912)
                     /locus_tag="ACHE_10495A"
                     /db_xref="GeneID:66977452"
     mRNA            complement(join(<1376197..1376233,1376284..1376529,
                     1376584..1376751,1376804..1376883,1376936..1377141,
                     1377205..1377616,1377687..1377728,1377787..>1377912))
                     /locus_tag="ACHE_10495A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279919.1"
                     /db_xref="GeneID:66977452"
     CDS             complement(join(1376197..1376233,1376284..1376529,
                     1376584..1376751,1376804..1376883,1376936..1377141,
                     1377205..1377616,1377687..1377728,1377787..1377912))
                     /locus_tag="ACHE_10495A"
                     /note="COG:T;
                     EggNog:ENOG410PHFK;
                     InterPro:IPR004839,IPR015424,IPR015421,IPR015422;
                     PFAM:PF00155;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131616.1"
                     /db_xref="GeneID:66977452"
                     /translation="MLSSRGTSRAEMLDIPWRYAAPHTYDKETNPNGTISFGMAEHSP
                     MRTEIANYINQKVTFTTDSVGYRPSPLSSTRLPAALSTHLNEILHPHPSNTPITPETI
                     FVASSPTALGHMLGFSIAEPGDGILVSRPVYGRFELDYGVEAGVEMVYADNDVEEGFT
                     PGVVEKFESSLKEAGERGVRIRGVLIVNPHNPVGRCYPAETLSEIVKFCSRYQLHLIS
                     DEVYASCIFNSGHPDAVPFTSVLSLDLPALIDPNLVHLLYGFSKDLASGGLRLGFLIS
                     QNKELRRACQAILRLHNTSTAAVTIGATILEDREFVSNFFAKASQHLASTYKITTSTL
                     EKEGINYVKGGNAGFFIYIDLSPYLALLPDTITNGINGTSKAGTGTNREVTLAQKFLD
                     AGVFLHPGEEHGKAPGWFRLVFSHEEEVLEEGLRRFVGVLGSLRQV"
     gene            complement(<1378247..>1380280)
                     /locus_tag="ACHE_10497A"
                     /db_xref="GeneID:66977454"
     mRNA            complement(join(<1378247..1379751,1379815..>1380280))
                     /locus_tag="ACHE_10497A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279930.1"
                     /db_xref="GeneID:66977454"
     CDS             complement(join(1378247..1379751,1379815..1380280))
                     /locus_tag="ACHE_10497A"
                     /note="COG:S;
                     EggNog:ENOG410PJ7Q;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131617.1"
                     /db_xref="GeneID:66977454"
                     /translation="MAPCLRGIASRAIKPRHIISTPLYRTRLIPRVLPSRSLLSSPKI
                     QSPGHSTINQQRSFSSTTQPCANLDTATDTLPICCPGCGAYAQTIEPDELGYYSEGRR
                     RKFAAKEQQAPKEGDEDAEITEELKTEGEAAAERIEKVLRDAEEKGYNKPAPRHGAMI
                     EEAASTASRYLEASASRAPVCDRCHDLVHHNKAVSAPSPTIDSVREFLDESPYKHNRV
                     YHILDAADFPMSVIPNIYEALSLQEQRARNRRATDNKYRGNRKLPTISFIITRSDLLG
                     ATKEQVDTKMEYMRSVLRQALGKEAEDVRLGNVHMISAHRGWWTRKVKDEIQDHGQGI
                     WVVGKANVGKSSFIEACFPKDSRNLEKITELVERRRQEGLGVADQSQAQAPVLGPDSL
                     LPPAPREDLYPVLPVVSSLPGTTVSPIRIPFGRGKGEMIDLPGLDRGQLEDYVRDEHK
                     RDLIMSKRPKPERLSIKGGQSLLLGGGLIRITPVNPDDVLMAACFVPLDTHITKTDKA
                     IEMQAETRPYPGKVIAKEGLSQVIKSAGTFDLKHDVTKSHLPTSIAKAVKDNKASPPP
                     LPYKVMSTDLLIEGCGWVELTVQVRAKSMSADAGSPRSLPQVDVFSPNGQHIGSRMPI
                     ECWEFIAQKKASDKRKRGPRGRQNIGLQRRAR"
     gene            complement(<1380589..>1381494)
                     /locus_tag="ACHE_10498A"
                     /db_xref="GeneID:66977455"
     mRNA            complement(<1380589..>1381494)
                     /locus_tag="ACHE_10498A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279941.1"
                     /db_xref="GeneID:66977455"
     CDS             complement(1380589..1381494)
                     /locus_tag="ACHE_10498A"
                     /note="COG:S;
                     EggNog:ENOG410PGT0;
                     InterPro:IPR024974;
                     PFAM:PF13019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131618.1"
                     /db_xref="GeneID:66977455"
                     /translation="MAERVNVLLSSFPGLSLHSTVSFSLPSISTISDLTEKVVSLLPS
                     SVPFQSLSLTTTNNKQVVPSSDRLQSLLVARDGESAITSNLLPLRLTVPLCGGKGGFG
                     SQLRAAGGRMSSKRKRTQGDDNASSRNLDGRRIRTVNEAKALAEYLAVKPEMDQKEKE
                     ERRRRWQSVVEVAEKRQEELKNGGGKHKIDGQWMDDKEEMNEKAREAVLLAMKEGAWT
                     DNLRDTIMGGSSTSASEGSENAASSSSEAESEEENKAESSSGSNQTSAAPRKFIGFDD
                     DDEFMSDSEEEEEESEGKGKGKGKA"
     gene            <1391087..>1392161
                     /locus_tag="ACHE_10499S"
                     /db_xref="GeneID:66977456"
     mRNA            join(<1391087..1391095,1391424..1391437,1391514..1391563,
                     1391687..1391847,1391907..>1392161)
                     /locus_tag="ACHE_10499S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279952.1"
                     /db_xref="GeneID:66977456"
     CDS             join(1391087..1391095,1391424..1391437,1391514..1391563,
                     1391687..1391847,1391907..1392161)
                     /locus_tag="ACHE_10499S"
                     /note="COG:J;
                     EggNog:ENOG410PNYK;
                     InterPro:IPR005326,IPR037447,IPR036388;
                     PFAM:PF03501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131619.1"
                     /db_xref="GeneID:66977456"
                     /translation="MGIELATMLIPKDDRKKIHEYLFREGVLVAKKDFNLPKHGDIDT
                     KNLYVIKACQSLNSRGYVKTQFSWQYYYYTLTPEGLDYLREWLHLPAEVVPATHIKQQ
                     RSHAPPRGMLGGEERERRPRAPREGGYRRREEGGKEGGAPGEFNPSFRGGFGRGRGAP
                     AS"
     gene            complement(<1392387..>1393678)
                     /locus_tag="ACHE_10500A"
                     /db_xref="GeneID:66977457"
     mRNA            complement(join(<1392387..1393332,1393383..>1393678))
                     /locus_tag="ACHE_10500A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279965.1"
                     /db_xref="GeneID:66977457"
     CDS             complement(join(1392387..1393332,1393383..1393678))
                     /locus_tag="ACHE_10500A"
                     /note="COG:E;
                     EggNog:ENOG410PG7Y;
                     InterPro:IPR010158,IPR002933,IPR036264;
                     MEROPS:MER0026469;
                     PFAM:PF01546;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016813 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds, in linear
                     amidines [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131620.1"
                     /db_xref="GeneID:66977457"
                     /translation="MQRLSLSQEDKQVRDWFIETTKALKCNVIVDEMGNIFAVRPGRR
                     KDVSPTFIGSHLDTQPTGGRYDGILGVLSGIETLKVIDEMGLETEGGIGVVNWTNEEG
                     ARFPISMISSGVWAECIPLSRAHDLKEVPTVASLPTASSAPETMKSALEKINYLGTVP
                     CSYKETPMAAHFELHIEQGPHLVSAGQRIGVVTAVQAYRWFRLNIVGRDTHTGTTSFE
                     HRADALYAFARMMVRAREVAAAKSCLASVGIVEAKPGSVNTVPGLVSFTLDIRGPETD
                     MVQAVEVELRKEFDAIAAEEGKGIGKPCRVEWTLDFDSPAVKFHESCIDCVQQSAEAV
                     IADAETLEPKSLVRTIMSGAGHDSVFTSKRAPTSMIFVPCRDGLSHHPEEFCSAEDCA
                     TGTSVILQAVIRYDRKRFAPT"
     gene            <1394865..>1395900
                     /gene="HNT1"
                     /locus_tag="ACHE_10501S"
                     /db_xref="GeneID:66977458"
     mRNA            join(<1394865..1394907,1395024..1395106,1395283..1395351,
                     1395543..1395635,1395703..1395717,1395793..>1395900)
                     /gene="HNT1"
                     /locus_tag="ACHE_10501S"
                     /product="adenosine 5'-monophosphoramidase"
                     /transcript_id="XM_043279976.1"
                     /db_xref="GeneID:66977458"
     CDS             join(1394865..1394907,1395024..1395106,1395283..1395351,
                     1395543..1395635,1395703..1395717,1395793..1395900)
                     /gene="HNT1"
                     /locus_tag="ACHE_10501S"
                     /note="BUSCO:EOG092658WY;
                     COG:T;
                     EggNog:ENOG410PQ3X;
                     InterPro:IPR011146,IPR001310,IPR019808,IPR039384,
                     IPR036265;
                     PFAM:PF11969,PF01230;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="adenosine 5'-monophosphoramidase"
                     /protein_id="XP_043131621.1"
                     /db_xref="GeneID:66977458"
                     /translation="MSSSAACIFCKIIKGDIPSFKLYDSEKVFAFLDIGPLSRGHALV
                     IPKFHGKKLTDIPDEDLLEILPVAKKIAQASGAEDFNILQNNGRIAHQVVDHVHFHMI
                     PKPNETEGLGVGWPSQPADMDKLKALHEELKAKM"
     gene            complement(<1396127..>1397835)
                     /locus_tag="ACHE_10502A"
                     /db_xref="GeneID:66977459"
     mRNA            complement(join(<1396127..1396675,1396730..1396771,
                     1396825..>1397835))
                     /locus_tag="ACHE_10502A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043279987.1"
                     /db_xref="GeneID:66977459"
     CDS             complement(join(1396127..1396675,1396730..1396771,
                     1396825..1397835))
                     /locus_tag="ACHE_10502A"
                     /note="COG:I;
                     EggNog:ENOG410PG8S;
                     InterPro:IPR011074,IPR036865,IPR036273,IPR001251;
                     PFAM:PF00650,PF03765,PF13716;
                     TransMembrane:1 (i73-91o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131622.1"
                     /db_xref="GeneID:66977459"
                     /translation="MHNCLFPRRRLVKFSANTIRSSSSVPRRAQFPSLSSPSRPLKRS
                     PTRRTPPTRPFSTFPLPFVRAPKRASQSFWAFAFTVLLIGGGSWIYFDPEKDSLQPSN
                     SEKSPPDQSQEPFLGIVDLLQNMPVEQPPGTVGNLTHEQEAKLQEFWQLALKTFGVKS
                     RETEQSSVSSLNVAADDDKHGQSKEFQQALADMSAEEIRITFWNMVKHDNPDSLFLRF
                     LRARKWNVNKAFIMFISTIRWRSKEIKVDDDIMRNGEALAQKQSQSADPAEKKKGQDF
                     LDQMRLGKSYLHGVDKNGRPICVVRVRMHKAGEQSEESLERFTVYVIETTRMMLPPPV
                     ETATIVFDMSNFSLANMDYAPVKFMIKCFEANYPESLGAVLVHKAPWLFSGVWSIIKG
                     WLDPVVAGKVHFTKNANDLEKFIPRDRIVKELEGDENWDYKYVEPQPDENKAMEDIAK
                     RDALIAERQEMAKEIQDATVSWLSASASKDKDAISLAEERRNGLINRLREHYWVLDPY
                     IRSRSLYDRTNVIKGDGKVDFYPGA"
     gene            <1398176..>1398989
                     /gene="DAM1"
                     /locus_tag="ACHE_10503S"
                     /db_xref="GeneID:66977460"
     mRNA            join(<1398176..1398493,1398565..1398622,1398682..1398736,
                     1398794..>1398989)
                     /gene="DAM1"
                     /locus_tag="ACHE_10503S"
                     /product="DASH complex subunit dam1"
                     /transcript_id="XM_043279998.1"
                     /db_xref="GeneID:66977460"
     CDS             join(1398176..1398493,1398565..1398622,1398682..1398736,
                     1398794..1398989)
                     /gene="DAM1"
                     /locus_tag="ACHE_10503S"
                     /note="BUSCO:EOG09265J36;
                     COG:D;
                     EggNog:ENOG410PPUU;
                     InterPro:IPR013962;
                     PFAM:PF08653;
                     go_component: GO:0042729 - DASH complex [Evidence IEA];
                     go_component: GO:0072686 - mitotic spindle [Evidence IEA];
                     go_process: GO:0008608 - attachment of spindle
                     microtubules to kinetochore [Evidence IEA]"
                     /codon_start=1
                     /product="DASH complex subunit dam1"
                     /protein_id="XP_043131623.1"
                     /db_xref="GeneID:66977460"
                     /translation="MDPSTSRSSSRQRLPSRPTTPLRPSSRSSFREAHGYGGSISNAG
                     YSQPAINALEPQFAELADSMADLEANFMHLQLLHESLSRFSESFASFLYGLNMNAFCV
                     DFPEAPIPDSFRRAKQTEAEKEREAEAEEARPTVNDGETTFMTTDTSFLENPPTTVSS
                     KPTPKYSVPRTRGSSTRGTTRETAGGRYTTRGTSRARPSALPRGRGMR"
     gene            <1400117..>1401926
                     /locus_tag="ACHE_10504S"
                     /db_xref="GeneID:66977461"
     mRNA            join(<1400117..1400168,1400230..1400466,1400530..1400637,
                     1400690..1401012,1401073..1401492,1401546..1401749,
                     1401810..>1401926)
                     /locus_tag="ACHE_10504S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280009.1"
                     /db_xref="GeneID:66977461"
     CDS             join(1400117..1400168,1400230..1400466,1400530..1400637,
                     1400690..1401012,1401073..1401492,1401546..1401749,
                     1401810..1401926)
                     /locus_tag="ACHE_10504S"
                     /note="BUSCO:EOG09261I8J;
                     COG:O;
                     EggNog:ENOG410PI3B;
                     InterPro:IPR038765,IPR001607,IPR037798,IPR001394,
                     IPR018200,IPR028889,IPR013083;
                     MEROPS:MER0001877;
                     PFAM:PF13423,PF02148,PF00443;
                     go_function: GO:0004843 - thiol-dependent
                     ubiquitin-specific protease activity [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA];
                     go_process: GO:0016578 - histone deubiquitination
                     [Evidence IEA];
                     go_process: GO:0016579 - protein deubiquitination
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131624.1"
                     /db_xref="GeneID:66977461"
                     /translation="MASINSVSLLSEAAFGCEHLATVMKSGQTAGQFKESFIKANRAL
                     APLGDSPAALLPSKSRFQSSALLRPRYICLSCSEPCLSNERRAHTEKTGHQFYMDSRA
                     RNVYCQGCDDFVYDHELERLRSPAPEVSLKASKRKIENSADELFVRSNASKRPCARQG
                     VRGLWNLGQSCFMNVILQALLHDPILHAHFLGNGHQTQECTIADCVGCSVAEAFTEFN
                     TTDKPESFVILNLLAATWRGSDALAGYRQQDAHEFYQFLVDKLHSSDDDHVDDYECPC
                     FFHKTFHGKLRSTVTCDKCGNVTQTEDPMVDLSLDVQVQAKKRAMGSGIGPSSTATLK
                     GCLDSFTSPEHLMADAYNCDQCGTPQKATKQLRIKKLPAILCLQLKRYEHTFAVSEKV
                     EGRIDFPLSLNMLPYTTNPDVRVDRSKYVYDLSTAVVHKGKLDAGHYYAYCRQGDQWV
                     LFNDDRVTVASEAEVLNADAYLLFYNLRTLAATAGS"
     gene            complement(1406052..1406123)
                     /locus_tag="ACHE_t10009A"
                     /db_xref="GeneID:66987315"
     tRNA            complement(1406052..1406123)
                     /locus_tag="ACHE_t10009A"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:66987315"
     gene            <1409243..>1411206
                     /locus_tag="ACHE_10505S"
                     /db_xref="GeneID:66977462"
     mRNA            join(<1409243..1409504,1409568..1410199,1410273..1410962,
                     1411021..>1411206)
                     /locus_tag="ACHE_10505S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280020.1"
                     /db_xref="GeneID:66977462"
     CDS             join(1409243..1409504,1409568..1410199,1410273..1410962,
                     1411021..1411206)
                     /locus_tag="ACHE_10505S"
                     /note="COG:S;
                     EggNog:ENOG410PG2I;
                     InterPro:IPR018827,IPR018825;
                     PFAM:PF10355,PF10348;
                     SECRETED:SignalP(1-22);
                     TransMembrane:11
                     (n8-17c22/23o70-91i98-119o139-157i278-297o317-338i359-
                     380o392-409i443-460o480-497i509-527o547-567i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131625.1"
                     /db_xref="GeneID:66977462"
                     /translation="MWRKTANAAFNAAFLLASLANALPHGDGHSIDDMNMDMGGHGHN
                     ATSESSEPAEDSPMSYFAYGKHSGTIIAHIGLMVLAWCFILPAGVMLSVARSRLALPT
                     QFAFLVFNAVGLLIGIIYNSQTPDLYENNAHHKVGWIVTWVASAQVVMTLLFAYAGRG
                     ETEVSSHERAAFLPVATEDTPSPLQSYPSGSFHDYRWSRDSGQGSERNSSSLHSRPGS
                     PSDEYDGFEKPEEDHAKPAESRRWFEGTVVDRFLSSRVPSMVSSRVLRTLNIIHMVIE
                     RIIMPFGFAAIATGGVTYGGIMRGHEVFNGLAHFIKGGIFFWYGLLTLGRWMGCWADL
                     GWAWNVKPKSPIVSKWKANIASGEFTESSVIFTYGITNVFLEHLAGWGKEWSATDLEH
                     VSISIMFLGGGLCGMLFESKRIKSWLNETILQAPGRGSMDSTWKLPDTQGVSLNPMPA
                     LVILLLGMMMGSHHQDSMVSTMIHKQWGNLLVGFALARGATYVLLYIKPPTSYLPARP
                     PTEIISSFCLIAGGLIFMLSTRTVVESIEYYQLDAMFTFTVGMGFTAFIMACAILSIA
                     LKAWAVKRESKPQLPPFQFPATA"
     gene            complement(<1414042..>1414371)
                     /locus_tag="ACHE_10506A"
                     /db_xref="GeneID:66977463"
     mRNA            complement(<1414042..>1414371)
                     /locus_tag="ACHE_10506A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043280031.1"
                     /db_xref="GeneID:66977463"
     CDS             complement(1414042..1414371)
                     /locus_tag="ACHE_10506A"
                     /note="TransMembrane:2 (i43-63o69-91i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043131626.1"
                     /db_xref="GeneID:66977463"
                     /translation="MTRGSINENKRSPDENIQAQTSTTVMYTTPICRFHPRKSNANLF
                     LVAIGLTSSFLQSLQLLNIQDHRAGIPMTAVIIDNMSCMDIEVVYLMPKYRPNGKMEF
                     EKTIMVQ"
     gene            <1418031..>1418903
                     /locus_tag="ACHE_10507S"
                     /db_xref="GeneI