GenomeNet

Database: RefSeq
Entry: NC_057363
LinkDB: NC_057363
Original site: NC_057363 
LOCUS       NC_057363            4305110 bp    DNA     linear   CON 15-SEP-2021
DEFINITION  Aspergillus chevalieri M1 DNA, chromosome 2, nearly complete
            sequence.
ACCESSION   NC_057363
VERSION     NC_057363.1
DBLINK      BioProject: PRJNA727462
            BioSample: SAMD00269937
            Sequence Read Archive: DRR262018, DRR262019, DRR262020
            Assembly: GCF_016861735.1
KEYWORDS    RefSeq.
SOURCE      Aspergillus chevalieri
  ORGANISM  Aspergillus chevalieri
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1
  AUTHORS   Kadooka,C., Mori,K. and Futagami,T.
  TITLE     Aspergillus chevalieri M1 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4305110)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4305110)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus chevalieri M1 genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP024417.
            Please visit our web page
            URL:https://chem.agri.kagoshima-u.ac.jp/honkaku/index.html.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Canu v. 2.0; Flye v. 2.8-b1674
            Assembly Name         :: AchevalieriM1_assembly01
            Genome Coverage       :: 357.6x
            Sequencing Technology :: MinION; Illumina NovaSeq 6000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4305110
                     /organism="Aspergillus chevalieri"
                     /mol_type="genomic DNA"
                     /strain="M1"
                     /db_xref="taxon:182096"
                     /chromosome="2"
                     /country="Japan:Kagoshima, Makurazaki"
                     /collection_date="2018"
     gene            complement(<880..>1047)
                     /locus_tag="ACHE_20001A"
                     /db_xref="GeneID:66978902"
     mRNA            complement(<880..>1047)
                     /locus_tag="ACHE_20001A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284255.1"
                     /db_xref="GeneID:66978902"
     CDS             complement(880..1047)
                     /locus_tag="ACHE_20001A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133065.1"
                     /db_xref="GeneID:66978902"
                     /translation="MGGWWMGMVDGDGSEAVGQVWRQGLDGFGVDVEDDSGVVGFVGE
                     EHGAAAWVGGG"
     gene            <3869..>4204
                     /locus_tag="ACHE_20002S"
                     /db_xref="GeneID:66978903"
     mRNA            <3869..>4204
                     /locus_tag="ACHE_20002S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284256.1"
                     /db_xref="GeneID:66978903"
     CDS             3869..4204
                     /locus_tag="ACHE_20002S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133066.1"
                     /db_xref="GeneID:66978903"
                     /translation="MVLANPPSLCLLTPTPTQPPDSPAAANKTPQTTGYGPPGCAAPA
                     TQSPPQCPRRRPAIPPVAAAMPPECPPPMAHAASSPPWGSKPPGTDTGRPAPTRRISS
                     AASHRKNTR"
     gene            <4277..>5041
                     /locus_tag="ACHE_20003S"
                     /db_xref="GeneID:66978904"
     mRNA            <4277..>5041
                     /locus_tag="ACHE_20003S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284257.1"
                     /db_xref="GeneID:66978904"
     CDS             4277..5041
                     /locus_tag="ACHE_20003S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133067.1"
                     /db_xref="GeneID:66978904"
                     /translation="MNINRAGHPPGPWRRYNIDPATAEPPAPQTPHPAMPGTVAGGIE
                     CRPRPTGAGVGGGLRTGAAAGGGSGSGAGAGVGSGSGSGSGYGLGLSYRCGAGADLGL
                     GSGLGSGSGSGYGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADL
                     GLGSGSGYGSGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADLGL
                     GCGSAYGSGSGVGYGSGFGLGCMSPLLCWNHTPFRA"
     gene            <5136..>5486
                     /locus_tag="ACHE_20004S"
                     /db_xref="GeneID:66978905"
     mRNA            <5136..>5486
                     /locus_tag="ACHE_20004S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284258.1"
                     /db_xref="GeneID:66978905"
     CDS             5136..5486
                     /locus_tag="ACHE_20004S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133068.1"
                     /db_xref="GeneID:66978905"
                     /translation="MVQAHTPGLMPSLMPGLITTHVPYMPLHITPITCLLVPVIPAML
                     PPVSIHCPIQIIVQYHPPAPPTCHHPHVLLHQLHLRCAQLSLILRPPRRLDNDRLAGL
                     PIPPGSPAFLCIIQ"
     gene            complement(<5693..>9778)
                     /locus_tag="ACHE_20005A"
                     /db_xref="GeneID:66978906"
     mRNA            complement(<5693..>9778)
                     /locus_tag="ACHE_20005A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284259.1"
                     /db_xref="GeneID:66978906"
     CDS             complement(5693..9778)
                     /locus_tag="ACHE_20005A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H;
                     InterPro:IPR027417,IPR014001,IPR011545;
                     PFAM:PF00270;
                     TransMembrane:1 (o1167-1190i);
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133069.1"
                     /db_xref="GeneID:66978906"
                     /translation="MQEWCGPLPVYGMTARQQRKWQILWQLAMPTMARPQQAPHRARA
                     RAVHMFPGAGRILEQGGNPGSYRATEGRGVSPGDQPTAGHGVSPEHVEEAEETGNAGS
                     TEPAWMMSPMERACLEFCIELLNQRHRAHEYESPLVCAMAVLGWGETGWRDPDSYPPI
                     LSRMIKLARFMVVQKALWLDPHVGDIIQMWQAQASTANGTVNGTVNGTVNGTPASPIA
                     WPLASADAQLADIDEGCDSASPTRHTPTTVHDRPSFHDHVQQMVSRFMIRGTHGPMQT
                     LLDWRTYGLKIHYNSTAPGHVAWMGADELLYKDLHFTMGEFRGFIHGLVGATRELLCE
                     LLCIADGSSSAHTPSTMPLPAIPWQGLYDDPTQGHPGWNFLHDRRTRWPVDGRWWMIQ
                     RLRTERPVQQQFMRRGAIHGPLVAQYLARVARFKEKLAVAIHMTAGQPARAPELLSVQ
                     YVNTPNNQFRNVFIEDGMVTLVTAYHKGFHASNDSKLIHRYVPRAVGELVVWYMWLAM
                     PFIGQLTAWQAGTAHGTVNGTSNGMSNGTSNGTWNGMSNGTSNGMSNGTSNGTLNGTR
                     AGTVNGTVNGTVNGMSNGTSNGTLNSTLNSTWNGTQAGTLNGTLNGTANGILNGTLIG
                     TQAGTANGTRASTVNGTSNSTLNGTWNGTRAGTVNGTLNGRANGTLNGTSNGTANGIS
                     NDTLNGTSNSTLNGTSNSMLNGTTNSIPIGTRAGTVNGTSNSTLNGTWNGTPNGTVNG
                     MLNGRLNGTSNSTSNSTPIGTPIGTQAGTSNAMSNGTTIGTPNGTANGTLNGTLIGTS
                     NGTPAWQPPSPYLWGPDPGMQRPWTPERFREVLKRETQARLGQALNIPAYRDIAIGIS
                     RRFLRASSTFTSDRQDETEQAAALDADCEDGMDADQWMAHMTDLQAGHSSHVAGMVYG
                     RQLMEQAGTTSHRRAMFRQSSVDWHQFLGFGCGTGVPGDVHADIDAGGLRAGLVDEGS
                     CPSRRPGQEQVRARLVDDPGQEWVRACLVDDPGQEWVRACLVNDPGQERVRARLVSDP
                     SQEGVRARLVDEGNRPIHHPGQERVRARLVDEGSCPIHHPGQERVRACLVNDPGQERV
                     RARPVLGKRKRAPWQVEAEEHHMERRHQLQTMDMAAALQQMTGQAGMQFQGIQAPAMA
                     AIQQGKSPVVAVMPTGGGKSMLFMLPAWAVPGGTTIVVVPLISLRQDMQQRCRRLGIP
                     CMAWDRQQPCDEAAIVLVTPESAVTPDFHSFINRLVVMQRLDRVVIDECHIIMNQQKN
                     FRSAMAQLGKLVRARTQMVFLTATLPPRWNRSSASAFTTHRIRSIYIGPARAAAMWHM
                     GCGGHRFHTLHHMDMDGSRMPGLFSSCRRSSSGPGPGGGRW"
     gene            complement(<17011..>17589)
                     /locus_tag="ACHE_20006A"
                     /db_xref="GeneID:66978907"
     mRNA            complement(<17011..>17589)
                     /locus_tag="ACHE_20006A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284260.1"
                     /db_xref="GeneID:66978907"
     CDS             complement(17011..17589)
                     /locus_tag="ACHE_20006A"
                     /note="COG:S;
                     EggNog:ENOG410Q1H7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133070.1"
                     /db_xref="GeneID:66978907"
                     /translation="MPKSNPRRDRLADKIDKEGFFSPPCLRCSEMSASNMSCECKRIS
                     SNRKCNNCVRSGVKCERDFHNERKWQNLERDRMRLAADLEDAERSNDEALARLSETSA
                     KLARLRKHKRFLEARNKAMLENDVALLEELDSQVSWPVAETASLDAQLAAVTDDPSLS
                     QMMNSPSFWENFDSAVAGGIPSPTGGNQSSSQ"
     gene            complement(<18345..>19121)
                     /locus_tag="ACHE_20007A"
                     /db_xref="GeneID:66978908"
     mRNA            complement(<18345..>19121)
                     /locus_tag="ACHE_20007A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284261.1"
                     /db_xref="GeneID:66978908"
     CDS             complement(18345..19121)
                     /locus_tag="ACHE_20007A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133071.1"
                     /db_xref="GeneID:66978908"
                     /translation="MAGLRGFVRTQVELAQVELEGLFLLHEEETREAVVPRLALVELA
                     DDPTNNRRGWNFLQDHRTRAALPTTGEQWLMDRVVATDWLRAEWVGVRPHDHQVMWHT
                     TVVDAYLGQVDQFLERLLLLMHLTAGQPARATELLGIRHSNTVCGQHRNLFIEHGVVS
                     LVTAYHKGYSMTGSTKIIHRYLPAEVSELVVYYLWLILPFARAVQALAHGTRQARSPF
                     LWPRGPNLAAGAWDSGRLRGCSSVRPTYICVTTWLLSCRT"
     gene            <22712..>24688
                     /locus_tag="ACHE_20008S"
                     /db_xref="GeneID:66978909"
     mRNA            <22712..>24688
                     /locus_tag="ACHE_20008S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284262.1"
                     /db_xref="GeneID:66978909"
     CDS             22712..24688
                     /locus_tag="ACHE_20008S"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR012337,IPR000953,IPR016197,IPR041588,
                     IPR001584,IPR036397,IPR043128;
                     PFAM:PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133072.1"
                     /db_xref="GeneID:66978909"
                     /translation="MRRLNERQMRWADLLSRYNFTLHYRPGKLAGRPDALSRREQDVP
                     VLGDERLKHREQRLFDPEILKDGPVEGSSKRGLVEEPHPINVSRILLAPVGMEPYNSE
                     PSAPQGYEQANEPTNLNSERPSLEELLDMTLDEHWARVEPLDEKYGRIREAVQVGAHQ
                     FPRELGIKASISECSIEPNNRLCYRGRRWVPDIESLRTRLLQETHDSVLTGHPGRSAM
                     YAILARRVYWPAISEDVRRFVRNCDKCSANNVWRDRRQGLLKPLPIPDRKWRYIAIDF
                     IEKLPISNGYENIMVIVDRLGKGVIPIPCEKIDTYTVAQKLIQSFIGYHGIPASIVSD
                     RGRQFTNEMWKRFCELLGIKRQLSTAYHAETDGQTERMNATIELFLRSFCDHTQSNWA
                     SLLPMAQLAICSRDAASTGVSPFFLDHGYHVDPFQLEEDVEINLSAPDLGTMRERGER
                     IAAKLRGALDIATTELAVAQQKQEDYANRQRDVAPEYQVGQKVWLDLRNIQTERPSKK
                     LGSRQAKFTVLEKIGSHAYRLNTPGTIHNVFHTALLRPAAMDPFPSQRKDDYQPPAEM
                     INGNEEYMVERILDERFRRWGRGERHEFLVKYIGWQEPEWNDARNMEDTIALDDWETY
                     KTMNGIVVQSALSIPNEPPHAGGRSRRRRGRGVM"
     gene            complement(<24931..>25755)
                     /locus_tag="ACHE_20009A"
                     /db_xref="GeneID:66978910"
     mRNA            complement(<24931..>25755)
                     /locus_tag="ACHE_20009A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284264.1"
                     /db_xref="GeneID:66978910"
     CDS             complement(24931..25755)
                     /locus_tag="ACHE_20009A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133073.1"
                     /db_xref="GeneID:66978910"
                     /translation="MIISNGWLTLFNPVHQIRINSFLQRPRVWDRPILIQLRPSTYRA
                     YRQVWQRLICFAYRTSRPNAAVQLGHQLTTAQLAALDRMETAAAELLSLPSPPLCTPG
                     PGAADHPPWTTGGGPWVVIQTPRGGDRDRDPEGDRRTERRHAAYEQLDHACLDLSIAL
                     LDHPLKGDLFESAVVAFLAVLGVDVEKQTFRDPYAFTSSLSGLIKMAQMLVAQRAVQM
                     ADHGQVEHPADALEAMRERFLLPGVAAPFNWLTRAAHVWQAHPEHHHQSGIYLLER"
     gene            complement(<25861..>26790)
                     /locus_tag="ACHE_20010A"
                     /db_xref="GeneID:66978911"
     mRNA            complement(<25861..>26790)
                     /locus_tag="ACHE_20010A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284265.1"
                     /db_xref="GeneID:66978911"
     CDS             complement(25861..26790)
                     /locus_tag="ACHE_20010A"
                     /note="COG:S;
                     EggNog:ENOG410QEA6;
                     InterPro:IPR022698,IPR013087;
                     PFAM:PF12013;
                     antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133074.1"
                     /db_xref="GeneID:66978911"
                     /translation="MDLFLYNDTHRLWICGPCGFAVRPAHLAAHLANRHPKHPSAATP
                     ALRRAACALMLKRPCWDPAREPDRPVPPPPAPGSPPVPGLPVHPGYRCPHPDCAYIVC
                     NPESLLRHRTRIHADRRPRGRQPPASQVSPLPLYRTVSCQRFFPSGAGSGFFQVTPPA
                     HTERARQAATMGEVEFIRRQVAGALAEDAAAAEAGAQQVPDPDAKAPTEISPWLELTR
                     WPEFLHGHAFTAVAPLAAPPDPTAEPLLTVFSASVERLIEAAYQSIKTRRINEFDQVS
                     RQASEKYIYIGTPTPHALPHHMHARAHPYAICM"
     gene            complement(<27027..>28160)
                     /locus_tag="ACHE_20011A"
                     /db_xref="GeneID:66978912"
     mRNA            complement(<27027..>28160)
                     /locus_tag="ACHE_20011A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284266.1"
                     /db_xref="GeneID:66978912"
     CDS             complement(27027..28160)
                     /locus_tag="ACHE_20011A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ;
                     antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133075.1"
                     /db_xref="GeneID:66978912"
                     /translation="MQPCSSATSSPLHSWRPWTGWRRRQRSCCHCPRHHSAHPGPGRR
                     IIHHGPQEGAHGSSSRRPVGDRDRDPEGDRRTERRHAAYEQLDHACLDLSIALLDHPL
                     KGDLFESAVVAFLAVLGVDVEKQTFRDPYAFTSSLSGLIKMAQMLVAQRAVQMADHGQ
                     VEHPADALEAMRERFLLPGVAAPFNWLTRLRTFGKRIQNTTTSLGYIYWSDDQQTLSY
                     KELHLTMAGLRGFVRTQVELAQLELEGLFLLHEEETREAVVPRLALVELADDPTNNRR
                     GWNFLQDHRTRAALPTTGEQWLMDRVVATDWLRAEWVGVRPHDHQVMWHTTVVDAYTL
                     VRHRSRARSVFSNPHWSVRPVSGPTPSSRPSVDPSISICLSGY"
     gene            complement(<28453..>29382)
                     /locus_tag="ACHE_20012A"
                     /db_xref="GeneID:66978913"
     mRNA            complement(<28453..>29382)
                     /locus_tag="ACHE_20012A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284267.1"
                     /db_xref="GeneID:66978913"
     CDS             complement(28453..29382)
                     /locus_tag="ACHE_20012A"
                     /note="COG:S;
                     EggNog:ENOG410QEA6;
                     InterPro:IPR022698,IPR013087;
                     PFAM:PF12013;
                     antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133076.1"
                     /db_xref="GeneID:66978913"
                     /translation="MDLFLYNDTHRLWICGPCGFAVRPAHLAAHLANRHPKHPSAATP
                     ALRRAACALMLKRPCWDPAREPDRPVPPPPAPGSPPVPGLPVHPGYRCPHPDCAYIVC
                     NPESLLRHRTRIHADRRPRGRQPPASQVSPLPPYRTVSCQRFFPSGAGSGFFQVTPPA
                     HTERARQAATMGEVEFIRRQVAGALAEDAAAAEAGAQQVPDPDAKAPTEISPWLELTR
                     WPEFLHGHAFTAVAPLAAPPDPTAEPLLTVFSASVERLIEAAYQSIKTRRINEFDQVS
                     RQASEKYIYIGTPTPHALPHHMHARAHPYAICM"
     gene            complement(<30132..>30790)
                     /locus_tag="ACHE_20013A"
                     /db_xref="GeneID:66978914"
     mRNA            complement(join(<30132..30200,30260..>30790))
                     /locus_tag="ACHE_20013A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284268.1"
                     /db_xref="GeneID:66978914"
     CDS             complement(join(30132..30200,30260..30790))
                     /locus_tag="ACHE_20013A"
                     /note="COG:S;
                     EggNog:ENOG410QEA6;
                     InterPro:IPR022698,IPR013087;
                     antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133077.1"
                     /db_xref="GeneID:66978914"
                     /translation="MLKRPCWDPAREPDRPVPPPPAPGSPPVPGLPVHPGYRCPHPDC
                     AYIVCNPESLLRHRTRIHADRRPRGRQPPASQVSPLPPYRTVSCQRFFPSGAGSGFFQ
                     VTPPAHTERARQAATMGEVEFIRRQVAGALAEDAAAAEAGAQRVPDPDAKAPTEISPW
                     LELTRWPEFLHGHAFTARQRRAADRGGLPVHQDAADQRV"
     gene            <33402..>33938
                     /locus_tag="ACHE_20014S"
                     /db_xref="GeneID:66978915"
     mRNA            <33402..>33938
                     /locus_tag="ACHE_20014S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284269.1"
                     /db_xref="GeneID:66978915"
     CDS             33402..33938
                     /locus_tag="ACHE_20014S"
                     /note="antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133078.1"
                     /db_xref="GeneID:66978915"
                     /translation="MPRPRNTVASTRTNRNETNDDDTNRNEANTNTEQENRHNPIFID
                     GDEHEERRMVTLEEFLQYASDEPEWLYEKLQVTHQRYDDSLDDHKVRLAEEELRGQTK
                     DGEIALLRHETEEMKGQLQDIKKQLTDVNAERDAFGSQIARLVMDSASGRQASPMPIN
                     SKSTKIPDPPMLTDGKEP"
     gene            <34113..>34565
                     /locus_tag="ACHE_20015S"
                     /db_xref="GeneID:66978916"
     mRNA            <34113..>34565
                     /locus_tag="ACHE_20015S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284270.1"
                     /db_xref="GeneID:66978916"
     CDS             34113..34565
                     /locus_tag="ACHE_20015S"
                     /note="antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133079.1"
                     /db_xref="GeneID:66978916"
                     /translation="MLNHLKTIYDDPNCVTTAKHQFRQLYMKNSDKFHDFFSEFLYLA
                     AEAGVAEDDWKDELYTKLMTKLQELCISSSIGDGTFQEFSSAVSQTASRLEVINYRTQ
                     KNRTFTPNKEMSKGISGTGTTFKKELTPSWSTTPHTSNAERDRLMKEG"
     gene            <35339..>35668
                     /locus_tag="ACHE_20016S"
                     /db_xref="GeneID:66978917"
     mRNA            <35339..>35668
                     /locus_tag="ACHE_20016S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284271.1"
                     /db_xref="GeneID:66978917"
     CDS             35339..35668
                     /locus_tag="ACHE_20016S"
                     /note="antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133080.1"
                     /db_xref="GeneID:66978917"
                     /translation="MSRALQGQEISTITTSPKLQRKMTSQSAIQIDIAAIGAAPFQRH
                     LKRKDTEVFIASLSEIDRIIEEKRENGRQKEDHNEQELVQHLLPKQYQEYADVFSKAA
                     SDELPPQ"
     gene            <44971..>52920
                     /locus_tag="ACHE_20017S"
                     /db_xref="GeneID:66978918"
     mRNA            join(<44971..45698,45766..46153,46345..46885,46936..51593,
                     51651..51971,52030..>52920)
                     /locus_tag="ACHE_20017S"
                     /product="type I iterative PKS"
                     /transcript_id="XM_043284272.1"
                     /db_xref="GeneID:66978918"
     CDS             join(44971..45698,45766..46153,46345..46885,46936..51593,
                     51651..51971,52030..52920)
                     /locus_tag="ACHE_20017S"
                     /note="COG:Q;
                     EggNog:ENOG410PKA1;
                     InterPro:IPR016036,IPR016035,IPR016039,IPR018201,
                     IPR042104,IPR014030,IPR011032,IPR013968,IPR013154,
                     IPR001227,IPR014031,IPR006162,IPR014043,IPR020806,
                     IPR020807,IPR020843,IPR020841,IPR009081,IPR013149,
                     IPR029063,IPR036736,IPR036291,IPR013217;
                     PFAM:PF16197,PF00109,PF08659,PF00550,PF13489,
                     PF13649,PF01209,PF08240,PF02801,PF00698,PF13602,PF14765,
                     PF00107,PF00106,PF08242,PF08241;
                     SMCOG1093:Beta-ketoacyl synthase;
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0004315 - 3-oxoacyl-[acyl-carrier-protein]
                     synthase activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_function: GO:0031177 - phosphopantetheine binding
                     [Evidence IEA];
                     go_process: GO:0006633 - fatty acid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="type I iterative PKS"
                     /protein_id="XP_043133081.1"
                     /db_xref="GeneID:66978918"
                     /translation="MRVQSLCRDESIDINGHPPIVDGDERPARMAIVGMACRLPGQVT
                     SPEDFWKLCSRGRSAWSEVPRTRFNHAGFHHPDPQRAGTLNPQGGHFLDEDLGRFDAP
                     FFNITLQEARSLDPQQRLLLECTYEALENAGIPKQSLAGRNVGVFAGASFADYDVRNM
                     RDPETIPMHEATGNAVSLQANRISYYFDLNGPSLTVDTACSSSLTAVHLACQSLRARE
                     CSVAIVGGAHLNITPEAFISMSSAGVFSDSGRSYAFDHRASGFGRGEGVGCFVLKPLD
                     AALSAGDAVRAVIAGSGVNQDGRTRGITLPNSAAQESLIRSVYKTAHIDPSETGYVEA
                     HGTGTRAGDPLEAAALHAVFGKGRTPKEPLFVGSVKTNIPKKLVPWPRGKRYASINNF
                     GFGGANAHVVLEQVSSLHDGGVNEETPALKRKIITLSGHDENAVKQQVKRLGFYLEQN
                     PAVFQESVFNNLAYTLAQRRTVFPWRLAVAGCSTLEIGQQLSADPAPSRAQGLPTIGF
                     VFTGQGAQWFAMGRELLTSYPVFRRTMKVVDSCLVSLGAKFSVIDEIESGDATSNSIS
                     KAYISQPACTAIQLALTDLLGSWGVFPSAVTGHSSGEIAAAYAAGVLTIEECVRVAYA
                     RGTAAALLTKDTSNGKGSMMAVGSSCAAVQPYIDRVGSHRAVVACINSESSVTVSGDA
                     GAISELQSTLDKEGIFARKLQVDVAYHSHHMQRVAKQYRQLIGEIAPQGSSVPFHSTV
                     RGRTIPSCDLNATYWVDNLVSRVEFVMGVRSLLGQKVGETERPVSTVIEIGPHCALQT
                     PIKQIIEHHFSDAKIEYFPSLKRKVDAVEAMQQLAIALWMRGLSLDFESINFPDLRTK
                     PAVLTNLSPYPWNHSESYWHSARLSDNIYHRQFPRNDILGSLSMENIDLEPRWRNVIS
                     ADAQPWIRQHRIHNNSVYPMAGFLAMAVEAVAQQAALHQLALDRIEIREVTVGRALTV
                     PEASFVETMLSMRPCTSTSGNSPNVWHEFRIFSWSESRGWDEHCHGFIIGLENKEPNP
                     VDSLRQQSSKVLDAAHQAAAIQAACTTAVDSNSLYQNVAQCGAVYGPLFRGLTDIAVS
                     NSHEAMAKLTVPDTKLCMPKEHETSSIVHPTLLDICVQLIWVLFGCYKPGSKTTHLPS
                     LVKHISIVPYHGLQPGSELQVYGNRINAISTRHPLSHRIFATRPGDPVNAIIEIDGCV
                     TIPLPYDEVGVSEAKPLCYREHYEPCFDFLSGADSDLLRGPDSGDGPGAQRTRLLDEV
                     SYLYLQRAVKSIGKNEVLSFKPHLQRVFRWAQKLCSATTFDTSLCAHHGDQEKLIRKV
                     RTMNAVGELTCKLGERLPEVLRGNLDPLAVMMEDDLLSRHYEDNDHLLQNYARATKCI
                     DAMAHQNPHLKFLEVGAGTGGVTLPILQTLGGEAGSTPRFSHFTYTDISPGFFEKAKD
                     KFQAWRPLMSYQTLDVSSDPVPQGYEPHSYDVVIACNVLHATSLIGQTVANIRRLLKP
                     GGKLLLIEETRLKSSHFIYALLPGWWLSEDPDRKNGPLLDPGLWERVLKDNSFSGIDI
                     GIDDYPGAPQRACTLMVSTATDTRIRPSSNNVVVMNTGFLIPSLCRALQQKLKDVTGG
                     VVNTRDFTTDPTGKLCIFVDDPDTPLLSSLTKESFRALQKMLARSSGVLWVIQKGNTG
                     PESLGAHLAVGLARTVRSETSLPFATLDVGVKGSLPESQVADRIRDVFNDIFCNSSVL
                     RHGDMDYVVQQGRICVSRIVDDPELNEHLFQDTEHAPPQHQALWQPSRPLKMVPAADG
                     VLADCFFTDHDVVRSPLPDDQVEIKVEYVGLNFRDVLVAMSQIQGGQLGQECSGVVTA
                     IGAAVDDFRVGDRVCSTAPGCLASHVRSAASNVWRVPNTMDLELAASAPLVFATAYYS
                     LVDIGRLTSGETVLIHAAAGGVGQAAIMLAQEVGAKVFATVSSEHKKRFLMDTYQLAE
                     DQIFFSRDTSFASGIYKATGGQGVDVALNSLTGDALRSTFECLAPFGRFVELGKRDII
                     QNSQLEMVHFDKNVSFSSVDVSLIIRTRPALMKRLLGESFRLFGKPETQARWSITCYS
                     ISELESAFRALQGGRNTGKIVIQMEKDAMVKVHPARRPEDILSRDASYIVTGGTRGIG
                     LDIARWLPEKGARHLILISRSGAATEESQQTLRALEAEGVKVKVCRCDVGDPDDLAQA
                     LVPVLKQMPPARGVVYGAMVLRDMLFEKMGLEDYNAVIRPRMHGILNLQRILQRQREP
                     KLDFFINLSSLSSIVGTMGQAAYTSSGTFMAAMARYPSLAGVPCRTIDLPMVRDVGYL
                     AADQKRQEEASHQLGGVSIDASDIRAVLAAAMRNEMGHSTNNHCLLGLNGVKTTPVKE
                     LPFWAQDPKLSHLLRSSILSEIDSTQTQQHDTKVSPATAVRHATSYSSAESLVVDAVV
                     HKIASTLMRPVDEVDPSAHISGYGLDSLVAIEVRNWITRELEANLQILEILTSDSVHA
                     LARTILSKSTLVSPNVRAEWNSETPKNA"
     gene            complement(<53378..>55442)
                     /locus_tag="ACHE_20018A"
                     /db_xref="GeneID:66978919"
     mRNA            complement(join(<53378..53430,53483..53984,54037..54910,
                     54961..54990,55045..>55442))
                     /locus_tag="ACHE_20018A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284273.1"
                     /db_xref="GeneID:66978919"
     CDS             complement(join(53378..53430,53483..53984,54037..54910,
                     54961..54990,55045..55442))
                     /locus_tag="ACHE_20018A"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410PJ5E;
                     InterPro:IPR012132,IPR036188,IPR000172,IPR007867;
                     PFAM:PF05199,PF00732;
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133082.1"
                     /db_xref="GeneID:66978919"
                     /translation="MRYQHILGYLASSVVVGAVTGPVDNHPDSVLESRDLVDLIGDTE
                     FDYVVVGGGTAGNVIATRLAQQSFSVALVEAGGLYQLESFQAIPGADVLPVGSDPDSK
                     SAVDWGFVAENQPGANGRAIHYARGKCLGGSSALNFMIYQRPSIESMQQWANTVNDSS
                     YTFDNLLPYYKKSVKFTPPNEKTRFDNATANFDSTAFDDQGGPLHVSYSNYAMPFSTW
                     MKLGMDAIGIEEQEDFNLGTVMGAQYCSSTIRPSDETRSSSQSFLESIKPASRKIYSN
                     TLAKKILFDDNKRATGVQAQGPLGTFKLTAKKEVIVSAGAFQSPQLLMVSGIGPKETL
                     HEHNIDPVVELPGVGQNMWDHPFFAPSHRVNVQTLTQTASSLLSLLKQFLDKAIPHTG
                     PLTNPISDYLAWEKIPDSLRSKFSDSTENDLRQFPKDWPEAEYISGAGYIGNVSDLLR
                     DQPKDGYQYASMLGVLVAPLSRGNVTLQSADTSDLPIINPNWLDSKTDQEMAIAMFKR
                     MRQAFGSDAMAPVVIGEEYYPGKQVQSDEEILEFVKNNIMTLWHAACTCKMGTSDDRM
                     AVVDHEAKVFGVQGLRVVDASAFPFLPPGHPQSTVYMLAEKISDLIINSEKK"
     gene            complement(<56326..>58002)
                     /gene="PLB1_3"
                     /locus_tag="ACHE_20019A"
                     /db_xref="GeneID:66978920"
     mRNA            complement(<56326..>58002)
                     /gene="PLB1_3"
                     /locus_tag="ACHE_20019A"
                     /product="lysophospholipase 1"
                     /transcript_id="XM_043284275.1"
                     /db_xref="GeneID:66978920"
     CDS             complement(56326..58002)
                     /gene="PLB1_3"
                     /locus_tag="ACHE_20019A"
                     /note="COG:I;
                     EggNog:ENOG410PFXA;
                     InterPro:IPR016035,IPR002642;
                     PFAM:PF01735;
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0004620 - phospholipase activity [Evidence
                     IEA];
                     go_process: GO:0009395 - phospholipid catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="lysophospholipase 1"
                     /protein_id="XP_043133083.1"
                     /db_xref="GeneID:66978920"
                     /translation="MKDFLDRISIPSFDAVSYINNHANNVSELPNIAIAVSGGGYRAL
                     TNGAGALKAFDSRTENSTSSGHLGGLLQSSTYVSGLSGGSWLLGSVYLNNFTTISALQ
                     THGKGDVWQFSRSILKGPDDGGIKILDSAQYWRDLVHMVDGKKDAGFNTSLTDYWGRA
                     LSYQFINDTDGGVDYTWSSIAQTDDFKAGKMPMPLVVADGRAPGELVVGSNSTVYEFN
                     PWEFGSFDPTIFGFAPLEYLGSPFENGELPQGASCVRGFDNAGFVMGTSSTLFNQGLL
                     RLNKTDLPDVIKSVAEHILEDIGEANDDIAIYSPNPFYRYRNSTAAYSNANDLDVVDG
                     GEDQQNIPLHPLIQPQRQVDVIFAVDSSADTSYNWPDGHSLVATYERSLNSTGIANGT
                     VFPAVPDRHTFINQGLNERPTFFGCDAANLTGPAPLVVYLPNSPYSAYSNTSTFQLKY
                     SDEERDSIITNGYEVVTMGNATEDKDWPTCVGCAILSRSLNRTGTAVPEACQTCFQRY
                     CWNGTVDSRDPGDYEPSLLLSTSTSGSSKMSSLNRTAAVIALAAVVFTTV"
     gene            complement(<58517..>59389)
                     /locus_tag="ACHE_20020A"
                     /db_xref="GeneID:66978921"
     mRNA            complement(join(<58517..58859,58916..59359,59385..>59389))
                     /locus_tag="ACHE_20020A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284276.1"
                     /db_xref="GeneID:66978921"
     CDS             complement(join(58517..58859,58916..59359,59385..59389))
                     /locus_tag="ACHE_20020A"
                     /note="COG:G;
                     EggNog:ENOG410PK1X;
                     InterPro:IPR011701,IPR036259;
                     SMCOG1106:major facilitator transporter;
                     TransMembrane:5
                     (o90-109i121-139o145-167i179-199o211-231i);
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133084.1"
                     /db_xref="GeneID:66978921"
                     /translation="MLISLPNYPANTSWLDEEEQAYAQWRLIHDAGEADDTGAGNISE
                     ALRLVLTDPRIYLFTLLQHTSLLSQNFQYFFPTIVQTLGYGNIETLLITAPVWIATFL
                     VSLVVTWTSGKTNDRGIHIILLMLVSVAGAIICTATTNIGARFFAMFLMPMGAVSAYQ
                     IIIAWIANSFPRPLVKRSAAIAIANMLGNTASIYGSYMWPSSSGPRYIPGGSATAGVA
                     LLVAVLATVIRMVHARMNLQLQEQEESNESGENTPQHPVGFRYIL"
     gene            complement(<59607..>60242)
                     /locus_tag="ACHE_20021A"
                     /db_xref="GeneID:66978922"
     mRNA            complement(join(<59607..59655,59703..59993,60043..>60242))
                     /locus_tag="ACHE_20021A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284277.1"
                     /db_xref="GeneID:66978922"
     CDS             complement(join(59607..59655,59703..59993,60043..60242))
                     /locus_tag="ACHE_20021A"
                     /note="COG:G;
                     EggNog:ENOG410PK1X;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     TransMembrane:4 (i47-64o90-110i117-136o142-163i);
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133085.1"
                     /db_xref="GeneID:66978922"
                     /translation="MDKTTEEFVEYRGTKDDQTEQDILYQAYAAKGPEWHQRMTRKVL
                     RKVDWHLLPFLVLMYLLNFLDRNNLSQARLGTLEKDLGMKGTDYNLATSILFVGYLLM
                     QLPSNLLLTKIRPSLFLGISMAIWGVISACQAAVTSFTGLVVARFFLGFVEAPFFPGA
                     VMLMSSWYTRQEVCLPNTQ"
     gene            <61177..>61450
                     /locus_tag="ACHE_20022S"
                     /db_xref="GeneID:66978923"
     mRNA            join(<61177..61288,61341..>61450)
                     /locus_tag="ACHE_20022S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284278.1"
                     /db_xref="GeneID:66978923"
     CDS             join(61177..61288,61341..61450)
                     /locus_tag="ACHE_20022S"
                     /note="COG:S;
                     EggNog:ENOG410PZJX;
                     antiSMASH:Cluster_2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133086.1"
                     /db_xref="GeneID:66978923"
                     /translation="MDKLSGLASKLGGKGQSNQQGGSSSGGSGNQEDYVDKGLDSVEK
                     KFGADPSKLRDTNEKVTDAGRQQFESRTG"
     gene            complement(<61779..>62787)
                     /locus_tag="ACHE_20023A"
                     /db_xref="GeneID:66978924"
     mRNA            complement(join(<61779..62047,62114..62153,62209..62319,
                     62371..>62787))
                     /locus_tag="ACHE_20023A"
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /transcript_id="XM_043284279.1"
                     /db_xref="GeneID:66978924"
     CDS             complement(join(61779..62047,62114..62153,62209..62319,
                     62371..62787))
                     /locus_tag="ACHE_20023A"
                     /note="COG:Q;
                     EggNog:ENOG410PMB4;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     SMCOG1001:short-chain dehydrogenase/reductase SDR;
                     antiSMASH:Cluster_2.1;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /protein_id="XP_043133087.1"
                     /db_xref="GeneID:66978924"
                     /translation="MTATENGTNNGEQSYVNTMPSSNFTWQITLAEKVIAITGANRGI
                     GLGIAEVCFANSAKVVYSLDLMEPGEDFAGLQKKHPNFRYIQTDVTSEESIQKAVDQI
                     VEENGRVDGLVANAGMTKHQPALQFDRPELEKLFNLNVFGAYFCAQIFARKFMELGIK
                     GSIVMTASMTSYRPNRAAPSAPYGATKAAVRNMCHTLAMEWSKHGIRVNSISPGFVRT
                     AMTYYVEHAPDWDLKMQYYGGMPRLADPRELGGAYVYLLSDGSSYTTGIDIPIAGIVG
                     AW"
     gene            <63671..>65354
                     /locus_tag="ACHE_20024S"
                     /db_xref="GeneID:66978925"
     mRNA            join(<63671..63852,63914..64030,64082..64140,64260..64687,
                     64738..65148,65202..>65354)
                     /locus_tag="ACHE_20024S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284280.1"
                     /db_xref="GeneID:66978925"
     CDS             join(63671..63852,63914..64030,64082..64140,64260..64687,
                     64738..65148,65202..65354)
                     /locus_tag="ACHE_20024S"
                     /note="COG:G;
                     EggNog:ENOG410PJKB;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     SMCOG1106:major facilitator transporter;
                     TransMembrane:11
                     (o36-55i76-95o115-135i147-169o181-203i252-273o293-311i318-
                     341o347-369i381-398o410-431i);
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133088.1"
                     /db_xref="GeneID:66978925"
                     /translation="MTASLDIEEKGEITSKEIENAGPDAPFWSPEEEKSLVRKIDLVL
                     LPMVWIMYLLSYMDRTNIGNAKISGMETDLDLTSNQYSIALVVFFIGYVVFEVPSNML
                     LSRIRPSLFLSGIMTLWGCVEAGFAPGVLMVIASWYKRTEQSKRFGIYISAAILSGAF
                     GGLLAAVIVKGLEGTHGIRGWRWLFIVEGAATIGVALVAAFVLPDFPATSKRFSERQR
                     SVAVARLADDVTAMTQDSEQISPQRAMVDSVKDWRTWMFVVGYMVIVGSSTLSYFYPT
                     LIEGLFGDSSTERTNFLTIPIYGVAFVCTLITSYFSDKIPSWRGLIISCWLIFSLICS
                     IAVCAVYDYTARYAFLVLMASGLWTTNGMSLAYASSAFSNMHPQTRGVSLALVNALGN
                     LAQIYGSYLFPDSDSPKYIMGFSVISAMLALGVVVYLALHFWFRRRAKRAENERPEG"
     gene            complement(<65765..>67870)
                     /locus_tag="ACHE_20025A"
                     /db_xref="GeneID:66978926"
     mRNA            complement(join(<65765..65916,65974..67645,67701..67737,
                     67797..>67870))
                     /locus_tag="ACHE_20025A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284281.1"
                     /db_xref="GeneID:66978926"
     CDS             complement(join(65765..65916,65974..67645,67701..67737,
                     67797..67870))
                     /locus_tag="ACHE_20025A"
                     /note="COG:S;
                     EggNog:ENOG410PI00;
                     InterPro:IPR036864,IPR021858,IPR001138;
                     PFAM:PF00172;
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133089.1"
                     /db_xref="GeneID:66978926"
                     /translation="MADASRGIRKPRKSRGRGLRATTGCLVCKRRHVKCDEVRPQCGP
                     CAKGQRPCVYGGGDTASQQIDASSSDGTIHRVTSPQSQIHEPLRVLVDACHQEQPVQH
                     PTDATPRKSFTTSPGLSSARAVSRHGQGVSPLSPPGYAPSPGTESSSTSNRLAPLSWF
                     ELLANDAANADRDFLLSPPQRVPSSVAVESPVALPQSPVLQPRNQRERESFQAASFRR
                     DPEIDERLAAAPVDDAPTSLPDEYSSWNTATPIELSDQGHFMFNHFVRTLGAWMDFFD
                     PTLQLSTTLPHLALRNIGLMKALLALSARHLSLWSETNQYQHNGTAPEKVNSFDIADS
                     EKEVASTVNRNVAVQYYYETLQYLNKAMQYPSYTRSAELICTALLISTYEMVDGSNYD
                     WERHLKGVFWIQRFQNNNGESGGVRQGVWWAWLRQDVWVAMRERRRVFSFFQPRKQYS
                     MLNAAEFTCRAYYLLSQCVNYASREESETIDIQQRLERGNELLFMLQEWQDYLPREFR
                     PLPLKQTSEVFPPIWIHPPPYAAAVQLHSLARILVVLHRPSIGGLQDYRAAQRLLAAS
                     VNTVCGIARMVKENDVPASLVSLNCLLGAGMSVHAPHERTALLDLIEIFQCRVRWPAD
                     SLRKELESEYQKDELSAFAG"
     gene            <68273..>69286
                     /locus_tag="ACHE_20026S"
                     /db_xref="GeneID:66978927"
     mRNA            join(<68273..68355,68403..68782,68843..68966,
                     69019..>69286)
                     /locus_tag="ACHE_20026S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284282.1"
                     /db_xref="GeneID:66978927"
     CDS             join(68273..68355,68403..68782,68843..68966,69019..69286)
                     /locus_tag="ACHE_20026S"
                     /note="COG:G;
                     EggNog:ENOG410PIGI;
                     InterPro:IPR000771,IPR013785;
                     PFAM:PF01116;
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016832 - aldehyde-lyase activity
                     [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133090.1"
                     /db_xref="GeneID:66978927"
                     /translation="MAWRSRNKTLQILEAAEKGRYGILAAIVYNVEHITAFVRAAESR
                     KSPLIIQLFPSALTQTPSLIHAAAAAAKTASVPISVHLDHAQNYDQIKSVADNLPFDS
                     IMVDMSHYEKEENLSKTKVLREYCHVRGIAVEAETGRIEGGEDGISDTGDLAGILTNA
                     EDVEEFISAGIDLLAPSVGNLHGDYGPKGPHLDMDRLQSIFDALNGRVRLVLHGTNDF
                     PPDLCKVCIEAGVTKFNVNKLVLQPWQDYLRRNVNKPLTQVMDEGIDVLTKEVERWMD
                     IMGSSGKA"
     gene            complement(<69576..>70771)
                     /locus_tag="ACHE_20027A"
                     /db_xref="GeneID:66978928"
     mRNA            complement(join(<69576..69711,69769..69854,69902..70378,
                     70511..>70771))
                     /locus_tag="ACHE_20027A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284283.1"
                     /db_xref="GeneID:66978928"
     CDS             complement(join(69576..69711,69769..69854,69902..70378,
                     70511..70771))
                     /locus_tag="ACHE_20027A"
                     /note="CAZy:GH43;
                     COG:G;
                     EggNog:ENOG410PH4A;
                     InterPro:IPR016840,IPR023296,IPR006710;
                     PFAM:PF04616;
                     SECRETED:SignalP(1-18);
                     antiSMASH:Cluster_2.1;
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_function: GO:0046558 - arabinan
                     endo-1,5-alpha-L-arabinosidase activity [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133091.1"
                     /db_xref="GeneID:66978928"
                     /translation="MYTICAAALSLFVLQVHGYANPGSCSGACNVHDPGLIQRDDGVY
                     FRFSTGNKISYAQSSSIEGPWTAVGSVVPDGSSINKAGNDDLWAPDVQNVNGVYHVYY
                     TVSTSGSQDSAIGLATSDTMDEGSWNDHGATGISSSSSKSYNAIDANLLNDDGTYYLT
                     FGSFWQDIFQAPMNSAATKAASSSYNIAFDPNGEHAVEGAYLYKYGGYYYLFYSAGAC
                     CGYDTSRPADGDEYKIKVCRSSSATGGFVDATGTACTEGGGTVVLESHDNVYGPGGQG
                     VFTDPDLGPVLYYHYVDTTVGYADNQKLFGWNAIDFSSGWPVV"
     gene            complement(<71564..>73968)
                     /locus_tag="ACHE_20028A"
                     /db_xref="GeneID:66978929"
     mRNA            complement(join(<71564..72865,72929..73637,73688..73831,
                     73892..>73968))
                     /locus_tag="ACHE_20028A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284284.1"
                     /db_xref="GeneID:66978929"
     CDS             complement(join(71564..72865,72929..73637,73688..73831,
                     73892..73968))
                     /locus_tag="ACHE_20028A"
                     /note="COG:K;
                     EggNog:ENOG410Q1YA;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o540-558i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133092.1"
                     /db_xref="GeneID:66978929"
                     /translation="MSSEAPRNSSEQPRTRKRARYTQVACNECKRRKLKCSGEIVCAR
                     CERDGVQCVYTTNAHVATRTPDVGESQDGRVDSQFRIVDRKIETLQREMQLMAARMRE
                     METVLGHRDSNRTTNPQVSSVYTPAAASASGTGTTSSSTGAALGRILNPPKSPTYIGP
                     TSAEFGLTARRRSVSDGEESSPSASEVILTTGDPITELGLAESLRLLSVYEQSVGIMY
                     PCVDLDSVRTYIVDFFRGGGNASAVSNATDQDWFFARDASVIKMILATALLAESHGRS
                     ERAAQLADIVEDEFATRVKIADVDMKELLILALLSIFHSYRDDEVIAWRQIGLAVRGS
                     MQLGLHRQETWLRTGGVFPGELQCNWASRLFWCIYVLDRKWSFGTGLPFAIQDSDMDT
                     NLPEPGAATPYLTCMINYARLSTKIWGLVVGWPSRPRSSTSDRCSYLDFQVQQWIQSI
                     PPELRFDPSQFQSPGSDPPPDSIVMQQVLLALQANQLRILVYRQNLLSTESIEADFSG
                     ASVAVETAKRTVHMLDCFSRVSVLYFQRPEPFNYFLLSALAALFLAVLHAPNRFSQVC
                     RPEFYSAVDLVRRSSTRARTSRRLQKVIRSLKLIPLHWDGGKPRTHDQGNKNAASASA
                     HAYQASSISNHMAHTSNPVSTSSSPHIQSAIHSVPTEQPSTAWSTATPVTLPTDTNNG
                     CEDLTSFFELAGGLYFDPQIETEVNADGNGHGAFVQTSDARLSDAIHAEDEALTRVMA
                     GLL"
     gene            <74508..>75287
                     /locus_tag="ACHE_20030S"
                     /db_xref="GeneID:66978931"
     mRNA            <74508..>75287
                     /locus_tag="ACHE_20030S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284286.1"
                     /db_xref="GeneID:66978931"
     CDS             74508..75287
                     /locus_tag="ACHE_20030S"
                     /note="COG:S;
                     EggNog:ENOG410PNB3;
                     InterPro:IPR023149,IPR029063,IPR041698;
                     PFAM:PF13489,PF13649,PF08242,PF08241,PF00891, PF13847;
                     go_function: GO:0030798 - trans-aconitate
                     2-methyltransferase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133093.1"
                     /db_xref="GeneID:66978931"
                     /translation="MAQTDWSASQYLKFMNERTTPARDLLARVPLQDPKTIVDLGCGP
                     GNSTAVLAHRYPNAHLVGMDSSPDMIKKAQSALPNVEFTAKDLRSYTPPQSVDLFFSN
                     AVLHWLGRDERITLIRRLMISQPSGGVFAFQVPYNLTEPSHVLMREVAADGPWAGTLK
                     HAGRDAFQTPREIYDQLIPLSSEVHIFRTDYNHPLENHRAVVEWVQGTGLKPYLDPLS
                     PGEKEAFINEYLKRLEAAYPKSVDGRVLLGYPRLFVVAVKK"
     gene            complement(<75434..>77600)
                     /locus_tag="ACHE_20029A"
                     /db_xref="GeneID:66978930"
     mRNA            complement(join(<75434..75569,75624..76594,76642..77218,
                     77269..>77600))
                     /locus_tag="ACHE_20029A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284287.1"
                     /db_xref="GeneID:66978930"
     CDS             complement(join(75434..75569,75624..76594,76642..77218,
                     77269..77600))
                     /locus_tag="ACHE_20029A"
                     /note="COG:Q;
                     EggNog:ENOG410PF88;
                     InterPro:IPR000269,IPR015798,IPR016182,IPR036460;
                     PFAM:PF01179;
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0008131 - primary amine oxidase activity
                     [Evidence IEA];
                     go_function: GO:0048038 - quinone binding [Evidence IEA];
                     go_process: GO:0009308 - amine metabolic process [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133094.1"
                     /db_xref="GeneID:66978930"
                     /translation="MTPHPLSGLTPDEINVARDVVVASHPDTIVYFREIYLSEPPKAQ
                     LREFLGLEHSGRLSPTTQRPSRLALCQYNVIGREKSTEYHESIVDIRLRRHVKHQIVD
                     KKFHAALVVDEFDVFVDRCKASPLFQQALADFDLPKGFDVVIEPWPYGGLDLSDDNRR
                     YMQGLIFAQDQTKNNEDANFYSYPLPVIPVMDCATEEIVRVDRPATGGKGDGLYDQTF
                     SRDIIGHANASDYVPELLPGGTRKDLKPLNVVQPDGPSFRVTNESLVEWQKWRFRVGF
                     NPREGATIHDVWYDGRSVLYRLAVSEMTVPYADPRPPYHRKQAFDFGDGGGGNTANNL
                     SIGCDCLGVIKYFDALLTETDGSATKLPNAICLHEQDNGIGWKHSNWRTGRAVVTRSR
                     ELVVQFIITLANYEYIFAYKFDQSGAITVEARATGILNVVNIDPCKTSEYGNVVSGGV
                     LAQNHQHIFCVRIDPAVDGHDNSVVVEESHPVPMNEATNPNGNFYRVIDYTVDRAGWL
                     DAAPDLNRVVKMTNPHRSNPVSGKPVAYKFTPLATQKLLADPNSVQARRAQFAQHHIW
                     VTKYRDGELYAGGNYTLQSQVEIGGVSDAVKRGDRVADTDVVVWSSFGLTHNPRVEDW
                     PVMPVDIYQLNIRPSDFFTANPSLDVPSSRNASSRVIQSDCCRDAHI"
     gene            complement(<78409..>80148)
                     /locus_tag="ACHE_20031A"
                     /db_xref="GeneID:66978932"
     mRNA            complement(<78409..>80148)
                     /locus_tag="ACHE_20031A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284288.1"
                     /db_xref="GeneID:66978932"
     CDS             complement(78409..80148)
                     /locus_tag="ACHE_20031A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133095.1"
                     /db_xref="GeneID:66978932"
                     /translation="MVDQFLQFAIGNGLPLAEKNAKDTEHLLLVSLTDLEDVDETSLV
                     QHFQRFLQDKNVNIHPWQQSTEVLQSITHQGQNRDSQANLYAMAILAHRAGWSSLIVA
                     DDLTKRQLKGNCRVGESPSISVVMISIRPCTAQEDHEVRVVAKRTTGEKDNTELMETL
                     QDFEPQEVASRNNEVFMNDGLVLHDADRGVFTDDIVAKLGWEEYSNSGSTTKDGSWVI
                     NHGAQPVALPPWVRQDNRHLNIFLMFPTAEDELANIKSTLQSAARNFTQEDGAEDPEM
                     EIQLISWEYHRVQSRRGFLNLWNGYQQQILANDYSSSVYFLLEPTRDTENALIGTLYY
                     DMIGPAIVSWVSLKEVISTAQSWGLSAKECLDRPEPYILERRESDVTELMYRPEQPFY
                     VENPPWLPADDCIYWVPVFYLTSKLTREQDQAIRAELHTMNQIDSEYWDRKHCCFVPW
                     KDDQRDGTLEDMWDVFWDVYTYKRGRATAVTSPLPMFFIDQQSGHDLTVIAVDSDTLY
                     TRKSNTAAAEILKDTPARKVRGFFHGRLSGRDAHIAHANLSIANLNFDEFTEPNQFPR
                     PGWPGHGILEDDD"
     gene            complement(<80451..>82106)
                     /locus_tag="ACHE_20032A"
                     /db_xref="GeneID:66978933"
     mRNA            complement(join(<80451..80781,80835..81009,81064..81384,
                     81441..81590,81644..81674,81728..81846,81893..>82106))
                     /locus_tag="ACHE_20032A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284289.1"
                     /db_xref="GeneID:66978933"
     CDS             complement(join(80451..80781,80835..81009,81064..81384,
                     81441..81590,81644..81674,81728..81846,81893..82106))
                     /locus_tag="ACHE_20032A"
                     /note="COG:S;
                     EggNog:ENOG410PKRB;
                     InterPro:IPR036851,IPR000028;
                     PFAM:PF01328;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0004601 - peroxidase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133096.1"
                     /db_xref="GeneID:66978933"
                     /translation="MRAWKSALPLALLGMGASIVDAMPTAENLHKLMNGAGQIPKNCP
                     YSDIQGGSVKSSLNKRLLVNSLRTPVDVSGDHAFQAPDYDNGDQRGPCPGLNALANHG
                     YIPRSGIVSFAEVIPAINKVYGMGVDLATVLAVMGTVWGGNPLSLNPSFSIGGKDDRV
                     NNLLDNLGGLLGDPQGIIGTHNFVESDSSLTRDDLYMTGNNYALNMTKFEEFYAMSTD
                     GTFDMDLMAERAKIRMDQTKATNPNFYYGPVTGLLARNAGYLFVGRIFRNHSEEHPEG
                     VLTKDIVKSFFAIEGEEGNFTYNEGWERIPYNWYKTPVDYGLVQLNLDTVSFVTKYPE
                     LGSIGGNTGTVNSFTGIDLSDLTGGVLNLSTLLEKNNLLCFVFEVLKFASPSALSGLY
                     KTLSVPLEMVTKAIAAPLLNMTCPAFDDLKMGGQDFFSGIQSQYPGANRTGGGL"
     gene            <84308..>85922
                     /locus_tag="ACHE_20033S"
                     /db_xref="GeneID:66978934"
     mRNA            join(<84308..84361,84417..84552,84608..84792,84848..84884,
                     84943..85010,85063..85445,85498..85565,85618..>85922)
                     /locus_tag="ACHE_20033S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284290.1"
                     /db_xref="GeneID:66978934"
     CDS             join(84308..84361,84417..84552,84608..84792,84848..84884,
                     84943..85010,85063..85445,85498..85565,85618..85922)
                     /locus_tag="ACHE_20033S"
                     /note="COG:S;
                     EggNog:ENOG410PIUV;
                     InterPro:IPR008427;
                     PFAM:PF05730;
                     TransMembrane:7
                     (o83-104i116-139o159-184i196-217o245-265i277-296o316-
                     336i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133097.1"
                     /db_xref="GeneID:66978934"
                     /translation="MAAASSIQELATALPPCALKCLVAGIEQSSCGMTNQTCICTDTE
                     LNTNVEACVLMSCTIKQSLTTKNVTKTACDAPIRDRTKIVSVAGVVGGVLSVVAFILR
                     VAARFRCLGGQFGWDDATMVFTMMMVIPLSAFSVVLADTGLGKDMWTLPFKNITHILY
                     IYMIDEVLYLSILPMTKISILCFYLRVFPKKEIRMATYVVMALCVGYLISFVLISVFQ
                     CDPINGAYLRWDGEHNFKCNNINAQGWAAAIANMILDIIVMALPLRELYNLNLSLRKK
                     LGVLCMFSLGIFVTLVSILRLESLIKFATTQNVTWDYVEIGYWSTIECHVGVICACLP
                     AIRSLLRRVFPAAFGDTTKGASKGTSNTYSTSRSGAGSRLEGKFSAKVKGGDEDHFVP
                     LVDMDNSSHAHLGHAHSQA"
     gene            <87758..>89903
                     /locus_tag="ACHE_20034S"
                     /db_xref="GeneID:66978935"
     mRNA            join(<87758..87813,87874..88305,88367..>89903)
                     /locus_tag="ACHE_20034S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284291.1"
                     /db_xref="GeneID:66978935"
     CDS             join(87758..87813,87874..88305,88367..89903)
                     /locus_tag="ACHE_20034S"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410PI4D;
                     InterPro:IPR007867,IPR012132,IPR000172,IPR036188;
                     PFAM:PF05199;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133098.1"
                     /db_xref="GeneID:66978935"
                     /translation="MLVIRGFSFLSLLSAVLASAHGSNHEWLHKRSNNTQTTSGTDVE
                     YDYVVVGSGPGGGPLASRLAIAGHKVLLLDAGDDQFDAPVIQAPALQLQSTEYEGTKW
                     DYFVNHYQDLSRQEEDTKMTYKTPSGELHVGPNPPANSDPLGILYPRAGTLGGCSAHN
                     AMITIYPYEKDWEDLVSITGNDTWAPDVMRKYFEKLERNRYLPSSLSGHGYDGWLTTS
                     LTQLTLVVEDRKLLSLVIAAATAAGKSLIGKLLTTVTGLGEVLLRDLNSDAKDRDQET
                     GPYQVPLAVDVPDYRRTGPRDFILDTQKATNSDGSRKYHLDVQMNTLVTNVRFDTSGS
                     KPKATGVDYLKGQSLYRADPRSGNATASSSGSVKAAREVILAAGAFNTPQLLKLSGVG
                     PKQELDKLGIDTLVNLPGVGKNLQDRYEVSVIGESPTNFTLTEKCTFLATTPDPCMEQ
                     WQNNGALLKGTYTTNGIAIAVTRNSSTSDGDPDLLVSGAPAYFKGYYPGYSYNALKES
                     NHWAWITLKARARNTAGTVELRSKDPRDTPVINFNSFDTGSTEDDVDEKDLQAVIEGM
                     KFSRDIFDSLVPLDGDFDEVWPGKNVSTDAELKDFAKKEAWGHHACCTAPIGSDDDDN
                     AVLDSDFRVRGVEGLRVVDASVFPKIPGYYIALPIYILSERAADVIISSA"
     gene            complement(<92723..>93022)
                     /locus_tag="ACHE_20035A"
                     /db_xref="GeneID:66978936"
     mRNA            complement(join(<92723..92853,92902..>93022))
                     /locus_tag="ACHE_20035A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284292.1"
                     /db_xref="GeneID:66978936"
     CDS             complement(join(92723..92853,92902..93022))
                     /locus_tag="ACHE_20035A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133099.1"
                     /db_xref="GeneID:66978936"
                     /translation="MATNLLIYLLKNGDSDPLPKRRKVEDDSWRLQANLIRVVDRNGT
                     LYNSAAARARANLLSTVEHPNDESLVRSAHDPLRDCDPV"
     gene            <93319..>93547
                     /gene="TFB5"
                     /locus_tag="ACHE_20036S"
                     /db_xref="GeneID:66978937"
     mRNA            join(<93319..93337,93390..>93547)
                     /gene="TFB5"
                     /locus_tag="ACHE_20036S"
                     /product="TFIIH complex subunit tfb5"
                     /transcript_id="XM_043284293.1"
                     /db_xref="GeneID:66978937"
     CDS             join(93319..93337,93390..93547)
                     /gene="TFB5"
                     /locus_tag="ACHE_20036S"
                     /note="COG:K;
                     EggNog:ENOG410PTG7;
                     InterPro:IPR035935,IPR009400;
                     PFAM:PF06331;
                     go_component: GO:0000439 - transcription factor TFIIH core
                     complex [Evidence IEA];
                     go_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IEA];
                     go_process: GO:0006367 - transcription initiation from RNA
                     polymerase II promoter [Evidence IEA]"
                     /codon_start=1
                     /product="TFIIH complex subunit tfb5"
                     /protein_id="XP_043133100.1"
                     /db_xref="GeneID:66978937"
                     /translation="MPRAVRGVLIECDPSVKAIILKYDEERHDYIVEDLDDDRHLVIK
                     ESQLQNLKLRLGKV"
     gene            <94469..>95005
                     /gene="HSP30_1"
                     /locus_tag="ACHE_20037S"
                     /db_xref="GeneID:66978938"
     mRNA            <94469..>95005
                     /gene="HSP30_1"
                     /locus_tag="ACHE_20037S"
                     /product="heat shock protein"
                     /transcript_id="XM_043284294.1"
                     /db_xref="GeneID:66978938"
     CDS             94469..95005
                     /gene="HSP30_1"
                     /locus_tag="ACHE_20037S"
                     /note="COG:O;
                     EggNog:ENOG410PQI6;
                     InterPro:IPR008978,IPR002068;
                     PFAM:PF00011,PF17886"
                     /codon_start=1
                     /product="heat shock protein"
                     /protein_id="XP_043133101.1"
                     /db_xref="GeneID:66978938"
                     /translation="MSLFHISSPGDFAPFFSLLDNRDLHRTNRGQFSSLRSFSPRFDF
                     RESDDAYYLDGELPGISQENIDIEFSDHQTLVIKGRSEREFHDSNDTPQDQAGQKGQD
                     KTDDVAKTGEQSVVKSKKNNKHRYWVSERSVGEFHRAFSFPGRVDQNNVRASLKNGIL
                     SVVVPKDAVSGTKKITIQ"
     gene            <95593..>96546
                     /locus_tag="ACHE_20039S"
                     /db_xref="GeneID:66978940"
     mRNA            join(<95593..95779,95834..>96546)
                     /locus_tag="ACHE_20039S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284295.1"
                     /db_xref="GeneID:66978940"
     CDS             join(95593..95779,95834..96546)
                     /locus_tag="ACHE_20039S"
                     /note="COG:S;
                     EggNog:ENOG410PWVT;
                     InterPro:IPR007568;
                     PFAM:PF04479;
                     TransMembrane:7
                     (o27-45i52-69o89-106i126-144o164-185i206-224o244-262i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133102.1"
                     /db_xref="GeneID:66978940"
                     /translation="MDFTFHPGVNGSHPWVEFYPYYPSREAGYAFMAMFGLSTVAHFV
                     LMIPYKAAYFIPLVLGGICETFGYYGRAWSHDDRTRIGSWALQEMLIMCAPPLIAATI
                     YMFLGRVIRSFDAEHHASIRPKWLTPIFVLNDVITFITQIAGAGVQVTGDAHVMDIGK
                     KATLAGLIFSLIVFCLFVLIAAVFHRRCNRDPTPVLLHNPNLNWKRYMWALYISCFAI
                     MLRNLIRLIQFGSDKESPLNTKEAFIYVFDAVPMLISVVVLMVYHPGLLIKRARNAQK
                     GEMLMADRNSGDVPLTQYAGARV"
     gene            complement(<96648..>98015)
                     /locus_tag="ACHE_20038A"
                     /db_xref="GeneID:66978939"
     mRNA            complement(join(<96648..97859,97932..>98015))
                     /locus_tag="ACHE_20038A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284298.1"
                     /db_xref="GeneID:66978939"
     CDS             complement(join(96648..97859,97932..98015))
                     /locus_tag="ACHE_20038A"
                     /note="COG:S;
                     EggNog:ENOG410PX46;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133103.1"
                     /db_xref="GeneID:66978939"
                     /translation="MEPSSIRSRRTHQKSRLGCRNCKRRRIKCDEKKPACSNCQHHGI
                     SCDFTASLPASPSPATSDPDEPQQRPASKYRFRASGYQSQLSRTSTPVSETLTASTGV
                     QCDDPSIRPDGLSLADLQLFHHFVTSTYRTLAEDAHGWELWQVHVPQWSMTFSSILHL
                     LLAFSALHCGHQQPASAPELRNRCIAQADQHFTFGVSTVTSILSQFELTPENAQPIYI
                     AAILICFVYFARGPPPGEYLVFSDTGQAEWLVLLRGVRLIVTTRRQNIFKGVMAPSDA
                     DEGMMKQRYISPGWLEIWRGDQRQLLEVRQLVRQRSADFVQGDMYVSLVDSLMQTFED
                     AYVKMSAHRERVGLTQIIVGWLYRLPEAYISLLQEKQPPALVILAHWSILLQYMRSVW
                     YMRGWDYHVIDGVQRFLPWDWKEWASWPLRRIQSIEHPG"
     gene            <98641..>99226
                     /locus_tag="ACHE_20040S"
                     /db_xref="GeneID:66978941"
     mRNA            join(<98641..98752,98809..98856,98907..>99226)
                     /locus_tag="ACHE_20040S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284299.1"
                     /db_xref="GeneID:66978941"
     CDS             join(98641..98752,98809..98856,98907..99226)
                     /locus_tag="ACHE_20040S"
                     /note="COG:S;
                     EggNog:ENOG410Q26X;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133104.1"
                     /db_xref="GeneID:66978941"
                     /translation="MKFSIAAAAGLFAALTTALPEAFTLVADGGKTVLTDGQKLLIGA
                     DPASHEILILRSSNATTGVSFTSKDQTPTGFQTLYVVDGQVAPVGLTLPHSGATPEGA
                     SLDGFGVDKDGYFTHDGKNYFGIEGYGDNPERVINWVDGHSSTQRIANLWVKECKGC"
     gene            <99665..>100604
                     /locus_tag="ACHE_20041S"
                     /db_xref="GeneID:66978942"
     mRNA            join(<99665..99768,99817..100442,100495..>100604)
                     /locus_tag="ACHE_20041S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284300.1"
                     /db_xref="GeneID:66978942"
     CDS             join(99665..99768,99817..100442,100495..100604)
                     /locus_tag="ACHE_20041S"
                     /note="COG:I;
                     EggNog:ENOG410PKMS;
                     InterPro:IPR001753,IPR029045,IPR014748;
                     PFAM:PF00378,PF16113;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133105.1"
                     /db_xref="GeneID:66978942"
                     /translation="MADYSYKYYNITFPQQYVAHVEINRADKMNAFFEAMWVELSQVF
                     NHLSQDPSVRAIVLSGAGDKAFTAGLDVKAASEGFLMDKKTDNDPARKAAHLRRHITS
                     FQDCISAVERCEKPVIVVMHGFSLGLAIDLSTAADVRVCARNARFAVKEVDIGIAADI
                     GTLSRLPKVVGNFGWVKEVALSARIFGADEALRVGFVNSVYDSKQDAVREAVGMATLM
                     ASKSPVAVQGTKEILNWSRDHSVQDGLRYTSVWNSAALQTEDVSSALLSGIQKRTPTF
                     EKL"
     gene            <101097..>101901
                     /gene="RHA1"
                     /locus_tag="ACHE_20042S"
                     /db_xref="GeneID:66978943"
     mRNA            join(<101097..101208,101261..>101901)
                     /gene="RHA1"
                     /locus_tag="ACHE_20042S"
                     /product="rhamnogalacturonan acetylesterase"
                     /transcript_id="XM_043284301.1"
                     /db_xref="GeneID:66978943"
     CDS             join(101097..101208,101261..101901)
                     /gene="RHA1"
                     /locus_tag="ACHE_20042S"
                     /note="CAZy:CE12;
                     COG:V;
                     EggNog:ENOG410PNVV;
                     InterPro:IPR013830,IPR036514;
                     PFAM:PF00657,PF13472;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="rhamnogalacturonan acetylesterase"
                     /protein_id="XP_043133106.1"
                     /db_xref="GeneID:66978943"
                     /translation="MKSIAFFLFLLPSTLGATIYLAGDSTMAAGGGGSGTNGWGEYIS
                     SSISGTVTNKAIGGRSARSYTREGRFEEIANSLQQGDYVVIEFGHNDGGSLSSSDNGR
                     TDCGGTGEETCTTEYDGQTETVLTFPAYLENAAKLFQEKGASVVISSQTPNNPWETGE
                     FVYKATRFVEYGKLAADTAGVEYVDHGAYVASIFESLGEDTVNGFFLNDHTHTSAEGA
                     QVVAEAFLKGVVCSDVSLKAVLTTTDFDGECL"
     gene            complement(<102044..>104434)
                     /locus_tag="ACHE_20043A"
                     /db_xref="GeneID:66978944"
     mRNA            complement(<102044..>104434)
                     /locus_tag="ACHE_20043A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284302.1"
                     /db_xref="GeneID:66978944"
     CDS             complement(102044..104434)
                     /locus_tag="ACHE_20043A"
                     /note="COG:L;
                     EggNog:ENOG410PJ37;
                     InterPro:IPR005123,IPR000868,IPR036380,IPR032854,
                     IPR036282,IPR027450,IPR037151,IPR004046;
                     PFAM:PF14497,PF13532,PF00857;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0051213 - dioxygenase activity [Evidence
                     IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA];
                     go_process: GO:0006307 - DNA dealkylation involved in DNA
                     repair [Evidence IEA];
                     go_process: GO:0035552 - oxidative single-stranded DNA
                     demethylation [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133107.1"
                     /db_xref="GeneID:66978944"
                     /translation="MDFLAAFGGVPTVQTRKALLLLDFQNDFVRPSGALYVPNTADFL
                     DTLPQLANSFRSIGTVFWIQSYYESRRELFDANEQELVVLGRGGEVHSKKHKSQSHTA
                     NISKDEEAFLSAESPRCGDSHSPGGQLPAPIVAAFDSQHDILTTKSDYSALRNDRLVL
                     TLRSQLVTEIYICGSLSNISVYATVLDAASLGFSVTLVEDCLGFRNFERHEEAMRRMA
                     DIFGANGITSEELMQELDWQETDRIAEKGGSKPRPARSTGIEDVLDNFDFRATDGCEP
                     DRVNDEEEEDDKPGLKIARAKDRYGPPPGHADKKVRARVRRARRPDERPETNSRSDAR
                     RARRSKQSQELRGPGDVIGEGDSRIIYDLDLPSDAFERIRREVAWQKMYHMSGQVPRL
                     VAVQGKAQADGSIPIYRHPADESPPLHPFTETVDRVRFIVEQILGHPLNHVLIQLYRD
                     GQDRISEHSDKTLDIARDSYICNVSLGAQRAMALRTKTSEEDSTRQSQRIPLPHESLF
                     VLGQKTNMRWLHGIRPDKRPESEKSVEERAYGGERISLTFRHIGTFLNLTGDTIWGQG
                     AVSKKQGQARPVIHGDAAETQRLIHAFGQENHATEFDWDGIYGSGFDVVNFVSASTAH
                     MIPGDDPVTNLRVRLCLSESSLRYDVMTAEQASAKPSDKRPVYIGTDGTIVAGDFEIM
                     NNFAQQAHLEAPRPGIDRLQGGAHLPKIEELLTYWRQHRDCANALDILRTWEKALDGK
                     HYLGGNVFTIDDCSLWPVLREIVQTRGKLPSRFSNLCHYYNRVEKRGLVKAVLEEE"
     gene            <104908..>106110
                     /gene="ILV5"
                     /locus_tag="ACHE_20044S"
                     /db_xref="GeneID:66978945"
     mRNA            <104908..>106110
                     /gene="ILV5"
                     /locus_tag="ACHE_20044S"
                     /product="bifunctional acetohydroxyacid reductoisomerase"
                     /transcript_id="XM_043284303.1"
                     /db_xref="GeneID:66978945"
     CDS             104908..106110
                     /gene="ILV5"
                     /locus_tag="ACHE_20044S"
                     /note="BUSCO:EOG09262N3C;
                     COG:E;
                     EggNog:ENOG410PHY1;
                     InterPro:IPR013023,IPR000506,IPR013116,IPR036291,
                     IPR016207,IPR008927,IPR013328;
                     PFAM:PF01450,PF07991;
                     go_function: GO:0004455 - ketol-acid reductoisomerase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0009082 - branched-chain amino acid
                     biosynthetic process [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional acetohydroxyacid reductoisomerase"
                     /protein_id="XP_043133108.1"
                     /db_xref="GeneID:66978945"
                     /translation="MASRGLPRALRCARVAAPRSVLSSALPRPALAKAAAAAVPRMTI
                     NQQPIRGLKQITFADSTETVYEREDWPREKLQEFFKNDTLALIGYGSQGHGQGLNLRD
                     QGLNVIVGVRKDGASWKEAVQDGWVPGKNLFDVDTAVEKGTVVMNLLSDAAQSETWPA
                     LKPKITKGKTLYFSHGFSPVFKDLTKVDVPEDVDVILVAPKGSGRTVRTLFREGRGIN
                     SSIAVFQDVTGQAKEKAIAMGVAVGSGYLYETTFQKEVYSDLYGERGCLMGGIHGMFL
                     AQYEVLRERGHSPSEAFNETVEEATQSLYPLIGGNGMDWMYAACSTTARRGAIDWSSR
                     FRDNLKPLFNELYDRVQDGTETQRSLDYNSQKDYREKYEKEMQEIRDLEIWRAGKAVR
                     SLRPENQK"
     gene            <106322..>107507
                     /locus_tag="ACHE_20045S"
                     /db_xref="GeneID:66978946"
     mRNA            join(<106322..106634,106705..>107507)
                     /locus_tag="ACHE_20045S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284304.1"
                     /db_xref="GeneID:66978946"
     CDS             join(106322..106634,106705..107507)
                     /locus_tag="ACHE_20045S"
                     /note="COG:E;
                     EggNog:ENOG410PFC0;
                     InterPro:IPR036052,IPR001926;
                     PFAM:PF00291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133109.1"
                     /db_xref="GeneID:66978946"
                     /translation="MLPSPSAIHAAHSLIHPYIHHTPLLTSRTLNTIASTPQSAESLV
                     GTPFEGQTPAHPRLRFFFKCENYQRIGAFKARGAFHALLRLVEERGEDEIKRRGVITH
                     SSGNHAQALALAASTLNIPAYIVMPSISTPSKIAGTQSHGAEVVFSGSTSVEREAVVA
                     DIQGRTNAILVPPYDDYNIICGQGTTGLELEEQYRDSVREKPELSAHGGTGGGLDAVI
                     TPIGGGGLNAGVATFFSDKSTRVFGAEPNFEGADDCRRGLEAGERVPAVSTLTIADGL
                     RTPVGLLNWAVISDPKKVAGVYAVTEEQIKAAMRLVLERMKVVVEPSAVVGLAVCLYN
                     EDFRRRVATEAGQEGWDVGIVFSGGNTTVEAIGKFYS"
     gene            complement(<107514..>108664)
                     /locus_tag="ACHE_20046A"
                     /db_xref="GeneID:66978947"
     mRNA            complement(join(<107514..108557,108605..>108664))
                     /locus_tag="ACHE_20046A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284305.1"
                     /db_xref="GeneID:66978947"
     CDS             complement(join(107514..108557,108605..108664))
                     /locus_tag="ACHE_20046A"
                     /note="COG:L;
                     EggNog:ENOG410PX0C;
                     InterPro:IPR013632,IPR027417,IPR030547;
                     go_component: GO:0005657 - replication fork [Evidence
                     IEA];
                     go_component: GO:0033063 - Rad51B-Rad51C-Rad51D-XRCC2
                     complex [Evidence IEA];
                     go_process: GO:0000724 - double-strand break repair via
                     homologous recombination [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133110.1"
                     /db_xref="GeneID:66978947"
                     /translation="MAASFGEKLLGEVTEARLDEILHDLRNICPNETSNRLGVKALDD
                     LLEIFMPAPAPAPQHPDENFNLQPEDRQAHRAVKARTDPVVEISSTSSVAGKSQLLYY
                     LAAIAVLPSTIDNVQIDGRNAAAVFIDTDGRFDADRLLSVAQGILYQKLKQHMVEQLP
                     DTESILYNSLQHVHVFRPTSSPSLLATLQSLESYLFDTARHLSANRPLHAIFIDSATV
                     FFWQDKLRDQIARVEEIGRPHTEIEHDRRSKRSFYIGDMYAELVRELKRVRSLFGCAV
                     VYTTTAWIGRAASASASASGEDLVAFRCSLPPPWGLFPTLRVVVRANGQGRFLGCVNG
                     LGKEQWPRRVVEGLERQSRGTFVFSADKHGVLV"
     gene            <108899..>109258
                     /locus_tag="ACHE_20047S"
                     /db_xref="GeneID:66978948"
     mRNA            join(<108899..109119,109177..>109258)
                     /locus_tag="ACHE_20047S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284306.1"
                     /db_xref="GeneID:66978948"
     CDS             join(108899..109119,109177..109258)
                     /locus_tag="ACHE_20047S"
                     /note="COG:S;
                     EggNog:ENOG410PTUR;
                     InterPro:IPR024645;
                     PFAM:PF11093;
                     go_component: GO:0042720 - mitochondrial inner membrane
                     peptidase complex [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133111.1"
                     /db_xref="GeneID:66978948"
                     /translation="MAPLVPVFSSESLPSHVNTIRRNFHEEKRRKGPAVDLKECPLLE
                     MVQYSCNPPQDGIPKPGTIVCKPVVRLFRRCAGLTVETTSWEPIRLAKEEEAKRAA"
     gene            complement(<109412..>110251)
                     /locus_tag="ACHE_20048A"
                     /db_xref="GeneID:66978949"
     mRNA            complement(<109412..>110251)
                     /locus_tag="ACHE_20048A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284307.1"
                     /db_xref="GeneID:66978949"
     CDS             complement(109412..110251)
                     /locus_tag="ACHE_20048A"
                     /note="COG:S;
                     EggNog:ENOG410PQEU;
                     InterPro:IPR019473,IPR037818;
                     PFAM:PF10406;
                     TransMembrane:1 (o6-25i);
                     go_component: GO:0005669 - transcription factor TFIID
                     complex [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133112.1"
                     /db_xref="GeneID:66978949"
                     /translation="MLNCFWTFGLTWFIVADLVTFVSYVQQSMLSSRRIQPIPQDFEH
                     ALTRNHLSPGDLLPYLKYPTVKPTPTLLSSPQPEEDAFKAISFLGPQLSGEDDRARSA
                     HIPKHFPEFPSKHTYRHTPVFTERESDPRKIRERATEDGRHGEEALRKLARAAFQDNQ
                     LGSAGREKKLWGRRMESMDSMFEKTVKGLAKKSSKNTAVSGMAAPMEIDSGAGADVEL
                     KTSRSKMSLNLELPPIINCERDLWRRTTASRGGENHSKPEEKLNGKPETGNISRMDSW
                     VST"
     gene            <110976..>111489
                     /locus_tag="ACHE_20049S"
                     /db_xref="GeneID:66978950"
     mRNA            join(<110976..111005,111129..111171,111317..111352,
                     111413..>111489)
                     /locus_tag="ACHE_20049S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284309.1"
                     /db_xref="GeneID:66978950"
     CDS             join(110976..111005,111129..111171,111317..111352,
                     111413..111489)
                     /locus_tag="ACHE_20049S"
                     /note="COG:O;
                     EggNog:ENOG410PT0P;
                     InterPro:IPR014368;
                     TransMembrane:1 (o16-36i);
                     go_function: GO:0004129 - cytochrome-c oxidase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133113.1"
                     /db_xref="GeneID:66978950"
                     /translation="MASAIPPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLDRVR
                     ERDTYYAKLEQERAAQK"
     gene            complement(<111771..>112515)
                     /gene="UBC12"
                     /locus_tag="ACHE_20050A"
                     /db_xref="GeneID:66978951"
     mRNA            complement(join(<111771..111923,111976..112265,
                     112349..112439,112495..>112515))
                     /gene="UBC12"
                     /locus_tag="ACHE_20050A"
                     /product="NEDD8-conjugating protein ubc12"
                     /transcript_id="XM_043284310.1"
                     /db_xref="GeneID:66978951"
     CDS             complement(join(111771..111923,111976..112265,
                     112349..112439,112495..112515))
                     /gene="UBC12"
                     /locus_tag="ACHE_20050A"
                     /note="BUSCO:EOG09265FCK;
                     COG:O;
                     EggNog:ENOG410PN5Z;
                     InterPro:IPR016135,IPR023313,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="NEDD8-conjugating protein ubc12"
                     /protein_id="XP_043133114.1"
                     /db_xref="GeneID:66978951"
                     /translation="MLKIWSMKQQQQQAENADAAAGKKKKKVTSAQLRVQRDLQELTL
                     GSTMKMSFPNPDDILNFTLTIEPDEGMYKGGVFHFTFAVNQNFPHDPPKVKCTQKIYH
                     PNIDLEGNVCLNILREDWKPVLNLNAVIVGMQFLFLEPNASDPLNKEAAEDLRTNREA
                     FKRHVRSSMAGGSVKGNDFERVLR"
     gene            complement(<113130..>116068)
                     /gene="CHS2_1"
                     /locus_tag="ACHE_20051A"
                     /db_xref="GeneID:66978952"
     mRNA            complement(join(<113130..113267,113317..114993,
                     115047..115408,115464..115932,115985..>116068))
                     /gene="CHS2_1"
                     /locus_tag="ACHE_20051A"
                     /product="chitin synthase, class 2"
                     /transcript_id="XM_043284311.1"
                     /db_xref="GeneID:66978952"
     CDS             complement(join(113130..113267,113317..114993,
                     115047..115408,115464..115932,115985..116068))
                     /gene="CHS2_1"
                     /locus_tag="ACHE_20051A"
                     /note="CAZy:GT2_Chitin_synth;
                     COG:M;
                     EggNog:ENOG410PFUV;
                     InterPro:IPR029044,IPR004835,IPR004834,IPR013616;
                     PFAM:PF01644,PF08407,PF13632;
                     TransMembrane:7
                     (o538-557i578-602o622-643i655-681o701-724i838-858o878-
                     898i);
                     go_function: GO:0004100 - chitin synthase activity
                     [Evidence IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0006031 - chitin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="chitin synthase, class 2"
                     /protein_id="XP_043133115.1"
                     /db_xref="GeneID:66978952"
                     /translation="MAYHGSGAQSPINYDDAGHRLQDIPSTDYGHEHEEEAAHGLLTS
                     QGPFDDAHQRSLSPARPASGYSLTETYAPEASYHDPYSAGSVYSGQSADNPAAAFGVP
                     GRVASPYARSETSSTEAWRQRQAPGGSGGGGGLRRYATRKVKLVQGSVLSVDYPAPSA
                     IQNAIQAKYRNDLEGGSEEFTHMRYTAATCDPNEFTLHNGYNLRPAMYNRHTELLIAI
                     TYYNEDKTLTARTLHGVMQNIREIVNIKKSEFWNKGGPAWQKIVVCLVFDGIDPCDKD
                     TLDVLATVGIYQDGVMKRDVDGKQTEAHIFEYTTQLSVTPNQQLIRPTDDGPSTLPPV
                     QMMFCLKQKNSKKINSHRWLFNAFGRILNPEVVILLDAGTKPGHKSLLALWEAFYNDK
                     DLGGACGEIHAMLGKGWKNLINPLVAAQNFEYKISNILDKPLESSFGYVSVLPGAFSA
                     YRFRAIMGRPLEQYFHGDHTLSKQLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGS
                     KWHLSYVKASKGETDVPEGAAEFISQRRRWLNGSFAAGIYSLMHFGRMYKSGHNIVRM
                     FFLHIQMLYNMFNTFLTWFSLASYWLTTTVIMDLVGTPSDSNGHKGFPFGATATPIVN
                     TIVKYAYLGFLLLQFILALGNRPKGSKYSYLASFIVFGVIQIYVVIDALYLVIHAFSG
                     QDAMDFDTSNGLGGFLKSFFSSSGAGIIIIALAATFGLYFVASFMYLDPWHMFTSFPA
                     YMGVQSSYINILNVYAFSNWHDVSWGTKGSDKADALPSVTTTKDGGKDAVIEEIDKPQ
                     ADIDSQFEATVKRALTPYVAPVEHEEKSLDDSYKSFRTRLVTFWIFSNALMAVCITSD
                     GVDKFGFTNTATDRTQRFFQALLWSNAAVALVRFIGACWFLGKTGIMCCFARR"
     gene            <119010..>120333
                     /locus_tag="ACHE_20052S"
                     /db_xref="GeneID:66978953"
     mRNA            join(<119010..119034,119084..>120333)
                     /locus_tag="ACHE_20052S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284312.1"
                     /db_xref="GeneID:66978953"
     CDS             join(119010..119034,119084..120333)
                     /locus_tag="ACHE_20052S"
                     /note="COG:S;
                     EggNog:ENOG410PPS0;
                     InterPro:IPR018571;
                     PFAM:PF09463;
                     TransMembrane:1 (o77-100i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133116.1"
                     /db_xref="GeneID:66978953"
                     /translation="MSFDSSPNVFSARDIFKRCVKCESAAPSCPACDEGYTCTMISQS
                     CDQCATTKCIRTSSSSSSSSGNSGSSGGSNAGAIAGGVIGGLAFVTIVVGLVWWFYMR
                     KKKNSNEYSLGGTSTQEKRGANAQGSRKSTGSIASTVLTRASNVIQIAYIPGVTNRSP
                     PDTPSLVPPVPPLPGAAPDQHFFMPGDLRDSSFTEMSNDRRSGAPSVSPSLRSSVATT
                     IYRNNAIVSPMPAQQAMLTRAAVVSIHGNQPTQTAAITPPDAPAVPAITPAQLAKAGV
                     TDANNNGDNNNNSSIVARPMMAKPVMVKTVGGKKNNNATPAVQTIEEQSEASSSAPVS
                     RSASTKKQADPAASGFDDSSDEEDEPSGKTAKAKSTEKPPTVAEAPEEQGPFTDRAST
                     HLETNDGPGSNRSSRTPPARVESPFSDANEVR"
     gene            complement(<120768..>122663)
                     /locus_tag="ACHE_20053A"
                     /db_xref="GeneID:66978954"
     mRNA            complement(join(<120768..122093,122146..122384,
                     122451..122559,122610..>122663))
                     /locus_tag="ACHE_20053A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284313.1"
                     /db_xref="GeneID:66978954"
     CDS             complement(join(120768..122093,122146..122384,
                     122451..122559,122610..122663))
                     /locus_tag="ACHE_20053A"
                     /note="COG:O,U;
                     EggNog:ENOG410PR05;
                     InterPro:IPR017916,IPR016135,IPR008883,IPR037202;
                     PFAM:PF09454,PF05743;
                     go_process: GO:0006464 - cellular protein modification
                     process [Evidence IEA];
                     go_process: GO:0015031 - protein transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133117.1"
                     /db_xref="GeneID:66978954"
                     /translation="MAAVPQRTLNWLYSILIRDHYDPKQTYQDPNRTYYDVANALAQY
                     PSLSPRTDVYTYETGFSTLLLLIAGTIPVSFRGTLYKFPVALWIPTTYPREPPMVYVT
                     PTHDMVVRVGQHVTLEGRVYHHYLAHWLEAWDRSSIADLLSILRDVFATEPPVKYKHP
                     IQQPQPQSMPTPPPVPPLPPGFGSPTVQRMPSPRPETQVPPPPPPKPGQMVAAEQQQQ
                     TPPAGRYNSPPPLPPLPPEEQARRQSFSPQTGMSPGGMASPYRVPQQPHMTGPAYPSG
                     TPVSPAQNLGWQQSRQYPPHQIPRHPVYQQSPVAPYPHSPMPHQRQLSQATPTTQPMP
                     TPTLAPAQTAPKQQAPAPDLLTSPFELELPSFAPTGPAPPIPPNPEKDALVKAVSKTL
                     AETVQSNVSQSESAAHSLTSQSHSLHNAIATLQAEISSLNSLNTTLQSNTSILQQSLQ
                     RADTVIADAQTRISSSQLPTSASASASPLPTSSTDTTTSTPTSVQGLPSIDEILVAPT
                     VVGKQLYDLVAEEAGIQQAIYALQVALVKGVIGVETWSRHTRGLAREAFLKRALGRKV
                     AVGLGCEGV"
     gene            <122976..>124056
                     /locus_tag="ACHE_20054S"
                     /db_xref="GeneID:66978955"
     mRNA            join(<122976..123089,123138..123370,123418..123764,
                     123815..>124056)
                     /locus_tag="ACHE_20054S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284314.1"
                     /db_xref="GeneID:66978955"
     CDS             join(122976..123089,123138..123370,123418..123764,
                     123815..124056)
                     /locus_tag="ACHE_20054S"
                     /note="COG:S;
                     EggNog:ENOG410PWHY;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF13460,PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133118.1"
                     /db_xref="GeneID:66978955"
                     /translation="MLVVAVAGGTGDVGQTIVDELLRVAKFRIVVLTRENPESQKRQA
                     QHGTVPVTINYNDSDSISRRLEENAVHTIISTLPMTSEECSQSQVNLIRAADKSTCTK
                     RFIPSEYAHINTPELLEIDPTTQWWLDAVECLKKSDLQYTRFATGFFMDYWGMPYVET
                     HLAPFTFGIDMGNCQAAIPGDGNDHLSLTYSKDLAKFVVRTLDLDEWPDLSIGVGDDI
                     TFNEMLRLAEEARGKKFQVTYDRVDSLNEGKATMLPIPEGAPFSADEMTEYNALFGQF
                     TVRGIFHVPTENRLKFPDLKPLTFKEFLSKTWGGH"
     gene            complement(126081..126152)
                     /locus_tag="ACHE_t20001A"
                     /db_xref="GeneID:66987335"
     tRNA            complement(126081..126152)
                     /locus_tag="ACHE_t20001A"
                     /product="tRNA-Met"
                     /note="tRNA-iMet"
                     /db_xref="GeneID:66987335"
     gene            <126835..>131269
                     /locus_tag="ACHE_20055S"
                     /db_xref="GeneID:66978956"
     mRNA            join(<126835..126929,127009..>131269)
                     /locus_tag="ACHE_20055S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284315.1"
                     /db_xref="GeneID:66978956"
     CDS             join(126835..126929,127009..131269)
                     /locus_tag="ACHE_20055S"
                     /note="COG:K;
                     EggNog:ENOG410PH1P;
                     InterPro:IPR007066,IPR035697,IPR007081,IPR007080,
                     IPR007083,IPR038120,IPR035698,IPR000722,IPR042102,
                     IPR006592;
                     PFAM:PF05000,PF04998,PF04997,PF04983,PF00623;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003899 - DNA-directed 5'-3' RNA
                     polymerase activity [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133119.1"
                     /db_xref="GeneID:66978956"
                     /translation="MQPSEGAQVDLGKAQVIDRVPKVIKELKFGVMSNDDIVSQGVVE
                     VSDRKFFDLEHDRAVVPHGPLDGRMGISNKSGTCQTCGLSLQACNGHFGHVRLVLPAF
                     HVGYFKRVIGILQEICKECSRILLPEAERRSYLREMRRPGLDNLRRLQIAKRINERCR
                     KTRSCETCGAVNGVVKKAGTSALKITHDKFRAFNASASAKKVPPPSKIVFDDSFNEAR
                     ASNTDVEKHFKKAQDDMNALRVLNLFKKVSDTDCELLGLNPSEARPEMFLWQFIPAPP
                     VCIRPSVGQDAASTEDDLTAKLGDIVQSNINLKNALLKGAPVQTIMECWDYMQLQIAV
                     YINSDVPGLNKADLGKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRVD
                     EVAVPELVAKNMTYPELVTRYNKEKLQQRVRNGTKKWPGANYLVKKGQTFKVFLKYGN
                     LNMIADQLQEGDLVERHIEDGDIVLFNRQPSLHKLSILSHFAKVRPHRTFRLNECVCN
                     PYNADFDGDEMNLHVPQTEEARAEAMELMGVKNNLATPKNGEPIIAAIQDFISAAYLI
                     TVKDNFFDRRTFTQICLYMLGPETPFDLPPPSVLKPQMLWTGKQVFNILMHPNKKDPV
                     MVNLDAACRQFKAPKDGSPRDLDPKDSWLVVRNSEVMCGVMDKATIGDGKKDNVFYIM
                     LRDFGPAAAAEGMNRLARLSSRWFSNMGFSIGITDVYPSEKLLKSKHDLVETAYAQCD
                     EVIAKYKAGTLEKYPGCDELQTMENQLSGILSKVRQQAGDECIAQLSKYNSPLIMATS
                     GSKGSSINVSQMVALVGQQIIGGQRVQDGFQDRTLPHFPKNARQPPSKGFVRNSFFSG
                     LEPTEFIFHAMSGREGLVDTAVKTAETGYMSRRLMKSLEDLSTMYDDTVRNSSAAIVQ
                     FQYGDDKLDPVDMEGKAKPVHFDRTFIHSESTTYSNEERSLLPAEIMDVCEEMLSKER
                     AKLDRKDLMGKPLAYMERTDHGIDQYESARDFLESIQDYVSTKADKLLSRGGDNDPTD
                     VRRQKSLSHTGKLTERTLRTFITACLSKYKRAQVEPGHAVGAVGAQSIGEPGTQMTLK
                     TFHFAGVAGMSITQGVPRIKEIINASKEISTPVVACELVTKDNIIAARIVKGRIEKTY
                     LRDIIHYIREAWTGKEAYLTVKINWKTIQDLALELNVRDILAAIKNHRRFKAGDLKFR
                     HSRSHIHIYMDLDPATKTNLSKTEIAATSTDPFLRLKHLKRILPDIQVLGHPLANRAI
                     IRTDETSTTNTLLVEGYGLRECMTTLGVDGLKTTTNNVMEARDVLGIEAARTTIVTEI
                     SEVMKDMDIDPRHMQLLADVMTYKGEVLGITRFGLAKMRDSVLQLASFEKTADHLFDA
                     GGAGRTDLIEGVSECIIMGKTVGLGTGAMEVVRRMNFYEGQIGPKKTVFEDTWSEVCE
                     APFEAKARAKRRVRT"
     gene            <131687..>133203
                     /locus_tag="ACHE_20056S"
                     /db_xref="GeneID:66978957"
     mRNA            join(<131687..131972,132038..>133203)
                     /locus_tag="ACHE_20056S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284316.1"
                     /db_xref="GeneID:66978957"
     CDS             join(131687..131972,132038..133203)
                     /locus_tag="ACHE_20056S"
                     /note="CAZy:AA7;
                     COG:C;
                     EggNog:ENOG410PKT2;
                     InterPro:IPR006094,IPR036318,IPR016166,IPR012951;
                     PFAM:PF08031,PF01565;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133120.1"
                     /db_xref="GeneID:66978957"
                     /translation="MGNKASTTTTTTTTAAAVHRCLLSAVDGNSALVSFQNDFLYGVT
                     AVHEYNLNFPVTPAAVTFPETSEQVAAIVKCAAAHKYKVQARSGGHSFGNHGLGGADG
                     AVVVDMKHFQQFSMDEATHVATIGPGLSLGDIDTMLYNAGGRAMSHGLCPEIRAGGHL
                     TIGGLGLTSRQWGMALDHIEEVEVVLPDSRIVRASEIENADLLFAVKGAAASFGIVTG
                     FKVRTQTAPRGAIRYSYSFKLGSAAQRARLFADWQDFILSEDLSRKFTSDFICLQDNV
                     ILKGVFFGSEEEYHALGLDHRFPGSDSSKLLFLDDWLGTVTHVVDDLAVHLGGFMSSY
                     FYAKSLGFTRETVMPPSTINDLFTYLDKTNKGTLTWFVTFSLVGGAINDYPKNATAYP
                     HRDVMYWMQSFAINALGPVLDSTYDFLDGINGLITRDVPGSAGHAYLGCPDPRLNHAK
                     RAYWGGNLRRLEEMKGVFDPGDVFWNPQGVGVV"
     gene            133461..133532
                     /locus_tag="ACHE_t20002S"
                     /db_xref="GeneID:66987336"
     tRNA            133461..133532
                     /locus_tag="ACHE_t20002S"
                     /product="tRNA-Met"
                     /note="tRNA-iMet"
                     /db_xref="GeneID:66987336"
     gene            complement(<133794..>136095)
                     /gene="SLY1"
                     /locus_tag="ACHE_20057A"
                     /db_xref="GeneID:66978958"
     mRNA            complement(join(<133794..135271,135333..135715,
                     135785..135998,136056..>136095))
                     /gene="SLY1"
                     /locus_tag="ACHE_20057A"
                     /product="vesicle trafficking between the ER and Golgi"
                     /transcript_id="XM_043284317.1"
                     /db_xref="GeneID:66978958"
     CDS             complement(join(133794..135271,135333..135715,
                     135785..135998,136056..136095))
                     /gene="SLY1"
                     /locus_tag="ACHE_20057A"
                     /note="BUSCO:EOG092619MJ;
                     COG:U;
                     EggNog:ENOG410PI5M;
                     InterPro:IPR001619,IPR043127,IPR036045,IPR043154,
                     IPR027482;
                     PFAM:PF00995;
                     go_process: GO:0006904 - vesicle docking involved in
                     exocytosis [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="vesicle trafficking between the ER and Golgi"
                     /protein_id="XP_043133121.1"
                     /db_xref="GeneID:66978958"
                     /translation="MASQSMSLRDRQVASIQKILNLNQDPPSTEDNPHDTSALTHATP
                     ILNQDGDPIWKVLVFDNMGRDVISSVLRVNDLRTWGVTIHLNLTSARYPIPDVPVIYI
                     VEPTLESIKTITDDLSRGLYTPAYVNFLSSVPRPLLEDFAGEIATTGTAEHIAQVYDQ
                     YLNFIVAEPDLFSLGLGNDAYWKINSPQTSDEDLDGVVDKIVSGLFSVSVTMGAIPII
                     RCPKGGAAELIATKLDRKLRDHILNSKDNLFSGQKKGTAGVPSSRPVLVIVDRNVDLV
                     PMLSHSWTYQSLVQDVLQMRLNRITMEVEDEANPGKVTKKSYDLTSNDFFWKRNAGAP
                     FPQVAENIDAELTRYKEDANDITKKTGASSIEDLQNDTSASAQHLKAAITLLPELRER
                     KAILDMHMNIATSLLKGIKDRQLDNFFELEENITKQSKAQILELVNDPAKGNQPSDKL
                     RLFIIWFLSTETELSRSDMSQFEEALTKAGVDDVSSLAYVRQVREITRMTMMTTAAPQ
                     EQSSDLFKGFSSLSNRLTDRFTSGALGANFDSLISGVKNFLPANKDLTLTKITESIMD
                     PTAASSSAIAKTENYLYFDPRSANARGAMPPASASRTQPPGSMGAPGPGTGASFGQRR
                     QAFNEAIVFTVGGGSMDEYGNLQDWVRQHNHPGGDPSAAGGRTGAGSLNAPRRRVVYG
                     STDLMNANEFIAESLGRLGKES"
     gene            <137242..>141471
                     /locus_tag="ACHE_20058S"
                     /db_xref="GeneID:66978959"
     mRNA            join(<137242..137871,137933..138105,138175..138293,
                     138347..138833,139289..139391,139456..139994,
                     140045..140451,140504..141324,141379..>141471)
                     /locus_tag="ACHE_20058S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284318.1"
                     /db_xref="GeneID:66978959"
     CDS             join(137242..137871,137933..138105,138175..138293,
                     138347..138833,139289..139391,139456..139994,
                     140045..140451,140504..141324,141379..141471)
                     /locus_tag="ACHE_20058S"
                     /note="COG:S;
                     EggNog:ENOG410PPB4;
                     InterPro:IPR035441,IPR000571,IPR036855;
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133122.1"
                     /db_xref="GeneID:66978959"
                     /translation="MDQTPSQTPTGLPRSSVTASSLPPEYWNTLDSLYPAPDLQQQQQ
                     QQPQLPQQSQLPQQPTPSQQPLGISWDHPIFHQQQPQPRNQFPRHQEQNHGIYSPTPQ
                     PWQPNPLYQPLMPSSKPQGLVVQPQYSQVHQFPQSQLAFDPQSIPSDSTTLDAIPFPQ
                     DFFPSQLSTQPSSQRATPSQPTPAAPYQSNAQQNPINQYSIPAGFPEEASHTPINFPN
                     GFSDPGTSQQTINPLFLNTPHQSGNQQHAPINDNFLYLGPADFERPNNSKPFNYYRND
                     LQAPPSNHHAIGNQSIPSQFPTVEVVIDNSQAPAFAPDKKPLDPQKKTAAQRQAKTQA
                     KRVGKQAGDRSSSSSDSDDSDIEITLPPEELSPIPETRPSDPLGAARYDALRAVWSPR
                     NRSPNAEKVKNALVAFKNVVKAVRDTWKELSQAMKTAENQGENDKATQLKNEVVFQRR
                     LMDVVVSTTLEMGHPMIVEKLGEHPMAVSAMYSFLLDRHQAADVDGTLTVNILKLLSQ
                     FVTVDEDVLQKTNVAKLLPRFSKKGGQTVKDLAKKIQENAAASTKRKQGSKEDSPSKN
                     TTPDATATNGSRVEAAGSKRPRDGESKEGSVQPAAKRMVVTSNTKNPGSTGTANGATA
                     KRPQETGQDAKATAAAAARPKANIVAPKPTNLFGSLSSAKKRPGTSNAERAAAAAAAK
                     TNVPTEKKREAGPPPPKPAFSLGDIMADLDKPKDPGPVEPTEDKPPETEEERKKRLRK
                     EGRRRLRVSWKPDHSLTEVRLFTHDPEEELGPDDRRQRQAGDVKGEGRILRLHKGLDE
                     LGEEDEGGIKEENLLGYHEPSEIDNADITPDDRARNYVKRGGTQEPTSPEKQAQEHRE
                     ATTLMVFYTSLADIPPSPKEPPPPSDDEIVPDVQQFGELPDHVKARQERYFAYVNPKP
                     APAAQPAAPTNQFDISNLLKIIQSATQQQQPQQPAQPLPPQQPVSQAPTSDLERTVNM
                     FRQQPAPAPLPQMPQFPMPQPQATQGMDFGNILSIMNAQNQMQPPPVFPPAPQSQPGI
                     ASNLAAIISQLSNQNQGGPKPPSQVYEDPERKRMRETSGFDGAGDEKFNSSKRNRPNG
                     PHKKHPKVGIVPCRYWKEGKCLKGDDCTFRHDPLI"
     gene            <142054..>143034
                     /locus_tag="ACHE_20059S"
                     /db_xref="GeneID:66978960"
     mRNA            join(<142054..142145,142206..142313,142375..142426,
                     142483..>143034)
                     /locus_tag="ACHE_20059S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284320.1"
                     /db_xref="GeneID:66978960"
     CDS             join(142054..142145,142206..142313,142375..142426,
                     142483..143034)
                     /locus_tag="ACHE_20059S"
                     /note="COG:S;
                     EggNog:ENOG410PNAF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133123.1"
                     /db_xref="GeneID:66978960"
                     /translation="MQQQRCNHLIIVCCHAIYLGGPTRGLSEDEWAIEPFQRGETSTF
                     TEHAKAGLQALANYPRGLLVFSGGPTKRGRTDLAEGESYMYLVKDNDYFGYSQRINPS
                     QVTTETHATDSYQNVLFSLLRFRFYTGSYPARVTVVTHEFKRKRFIDFHFPAVGLVPV
                     TVPSRKDEENRRVALIGINPPESVTLVESLIAGEEKSGISLWKRDRYGVQSELAGKRV
                     KRGWQAGMENGLFVDVGLEPVVEDLVRWDGGRSGNEWFDKMEQLPWYSP"
     gene            complement(<143170..>144228)
                     /gene="MAD2"
                     /locus_tag="ACHE_20060A"
                     /db_xref="GeneID:66978961"
     mRNA            complement(join(<143170..143455,143522..143589,
                     143651..143796,143847..143875,143933..143971,
                     144022..144047,144105..144130,144183..>144228))
                     /gene="MAD2"
                     /locus_tag="ACHE_20060A"
                     /product="mitotic spindle checkpoint component Mad2"
                     /transcript_id="XM_043284321.1"
                     /db_xref="GeneID:66978961"
     CDS             complement(join(143170..143455,143522..143589,
                     143651..143796,143847..143875,143933..143971,
                     144022..144047,144105..144130,144183..144228))
                     /gene="MAD2"
                     /locus_tag="ACHE_20060A"
                     /note="BUSCO:EOG09264BJC;
                     COG:D;
                     EggNog:ENOG410PFQB;
                     InterPro:IPR036570,IPR003511,IPR027097;
                     PFAM:PF02301;
                     go_process: GO:0007094 - mitotic spindle assembly
                     checkpoint [Evidence IEA]"
                     /codon_start=1
                     /product="mitotic spindle checkpoint component Mad2"
                     /protein_id="XP_043133124.1"
                     /db_xref="GeneID:66978961"
                     /translation="MGDKDKSKVHKLSLKGSAKLVAEFFEYSINSILFQRGVYPPEDF
                     TTVKKYGLNMLVTSDDQVKAYIKKIMSQLNKWMAGGKISKLVVVITSRETGEHVERWQ
                     FDVEIFNKHKRSKSAQKTGDKENSGDAESAAPIEKTEKEIQDEIQAIFRQITASVTFL
                     PVLDGDCTFNVLVYADADSEVPVEWGDSDAKEIKNAEKVQLRSFSTNNHRVETLVSYR
                     LAD"
     gene            <144439..>146495
                     /gene="GUF1"
                     /locus_tag="ACHE_20061S"
                     /db_xref="GeneID:66978962"
     mRNA            join(<144439..145181,145232..>146495)
                     /gene="GUF1"
                     /locus_tag="ACHE_20061S"
                     /product="translation factor guf1 mitochondrial"
                     /transcript_id="XM_043284322.1"
                     /db_xref="GeneID:66978962"
     CDS             join(144439..145181,145232..146495)
                     /gene="GUF1"
                     /locus_tag="ACHE_20061S"
                     /note="COG:J;
                     EggNog:ENOG410PJNW;
                     InterPro:IPR000640,IPR035654,IPR005225,IPR038363,
                     IPR027417,IPR000795,IPR031157,IPR006297,IPR013842,
                     IPR009000,IPR035647;
                     PFAM:PF06421,PF00009,PF00679,PF01926;
                     SECRETED:SignalP(1-19);
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="translation factor guf1 mitochondrial"
                     /protein_id="XP_043133125.1"
                     /db_xref="GeneID:66978962"
                     /translation="MRGCLHLARWLRAAPTCLAARSLARSLPSGIALRATTRSFTNTS
                     LWQAARSHAAKPLGELEQRIAAIPIERYRNFCIVAHVDHGKSTLSDRLLELTGTIQPG
                     TNKQVLDKLDVERERGITVKAQTCTMIYNHNGEDYLLHLVDTPGHVDFRAEVSRSYAS
                     CGGALLLVDASQGVQAQTVANFYLAFAQGLELIPVLNKVDLPSAEPERALEQMKNSFE
                     LETDNAVWVSAKTGLNVPKVLPTVVEKIPAPVGECKKPLRMLLVDSWYDSYKGVICLV
                     RIFDGELRPGQQVVSFATGIKYYVGEVGIMYPNETSQTVLRAGQVGYIFFNPGMKRSK
                     EAKIGDTYTTVGSEEAVEPLPGFEEPKPMVFVAAYPVDADHFEHLEDSINQLILNDRS
                     IHVQKESSEALGAGFRLGFLGTLHCSVFEDRLRQEHGASIIITPPSVPVKVLWKDGRE
                     DIITNPAKFPDEDELRGKVAEIQEPYVLATLTFPDEYLGKAIELCEANRGEQESLDYF
                     TSTQVILKYQLPLAQLVDDFFGKLKGSTKGYASLDYEDSGWRAGHIVKLQLLVNKVPV
                     DAVSRVMHASQVDRTGRKWVTKFKEHVDRQLFEIVIQAAVGKKVVARETVKPYRKDVL
                     AKLHASDVSRRRKLLEKQKEGRKKLKAVGNVVIEHKAFQQFLAK"
     gene            complement(<146698..>147897)
                     /locus_tag="ACHE_20062A"
                     /db_xref="GeneID:66978963"
     mRNA            complement(join(<146698..147077,147129..>147897))
                     /locus_tag="ACHE_20062A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284323.1"
                     /db_xref="GeneID:66978963"
     CDS             complement(join(146698..147077,147129..147897))
                     /locus_tag="ACHE_20062A"
                     /note="COG:T;
                     EggNog:ENOG410PQXS;
                     InterPro:IPR027458,IPR000366;
                     PFAM:PF02116;
                     TransMembrane:7
                     (o41-68i80-103o123-147i159-185o205-224i244-265o271-294i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0004932 - mating-type factor pheromone
                     receptor activity [Evidence IEA];
                     go_process: GO:0007186 - G protein-coupled receptor
                     signaling pathway [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133126.1"
                     /db_xref="GeneID:66978963"
                     /translation="MASETTQSFGSNGFDPFEQNITMHQADGTPFLVPVNSVDAWLQY
                     CIRICINYGCQMGASAVLLIVLILLTRAEKRSSAIFWLNTLALVTNVARLLCQLIYFT
                     GPLVRLYPIFASDYSRVPQSTYAGSIVGAAFAFLAVVFMEVSLVLQIQVVCATLRRWY
                     RLMLLVASTLVAMIPIGFRFALLVINSMSIMDLEVISSTWLENAANVVVTVSICFFCT
                     VFVVKLGFAIKLRKKLGVREYGPMKVIFVMGCQTMIIPAIFSILQYIVHVPELYSNVL
                     TVVIISLPLSSIWAGYTFEQKSRVASRTSDSHRHLMNLNSYNPMRTKMLSTSLSTDAT
                     ARNSIDANATCYVTLSPTRQIDPELSKYGISVKHDYSVQSHHKDGGEV"
     gene            complement(<151073..>152119)
                     /locus_tag="ACHE_20063A"
                     /db_xref="GeneID:66978964"
     mRNA            complement(join(<151073..151759,151808..>152119))
                     /locus_tag="ACHE_20063A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284324.1"
                     /db_xref="GeneID:66978964"
     CDS             complement(join(151073..151759,151808..152119))
                     /locus_tag="ACHE_20063A"
                     /note="COG:Q;
                     EggNog:ENOG410PVG3;
                     InterPro:IPR026992,IPR027443,IPR005123;
                     PFAM:PF03171,PF14226;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133127.1"
                     /db_xref="GeneID:66978964"
                     /translation="MSLDLSLLNSPTQSQSFCNDLLATLKSRGVARLTNHGIPEETIN
                     KLFDMTRNFFAASHEDKMIAKHPPESTPNRGYSYVGQESVGNISGFEKGVSQVKSVKD
                     IKETFDMGSPTDTLVDNIWMPEDKLPGFRHFMEDFYAQCFALEKTILIALARALNVPE
                     SQLLSLHSAAENEFRLLHYPAIPVSLLKDGTSTRIAEHTDFGTITMLFQDSTGGLQVE
                     DQMCLGTFHGIESNKTDIILNIGDSLQRLTNDTFRAACHRVTYPPTVKINEGEGENED
                     EVIPERYSIAYFAKPNRNASLLPFSEFVTESRPCRYDDMTAWEYNNLRITKLYQAA"
     gene            complement(<152639..>153239)
                     /locus_tag="ACHE_20064A"
                     /db_xref="GeneID:66978965"
     mRNA            complement(join(<152639..153070,153138..>153239))
                     /locus_tag="ACHE_20064A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284325.1"
                     /db_xref="GeneID:66978965"
     CDS             complement(join(152639..153070,153138..153239))
                     /locus_tag="ACHE_20064A"
                     /note="COG:S;
                     EggNog:ENOG410PTBP;
                     InterPro:IPR036629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133128.1"
                     /db_xref="GeneID:66978965"
                     /translation="MADNNSSTLKSYVDSATGLAQRAVGAVTGSTSTQAEGQSTQDHS
                     KSEHAASHDTAKLGHVTADPQTGATAQDSSTRTTGSWDQTVGSAKESVGNFIGNENLR
                     RQGVEQNAAGKEAEAKGQLKDLGEGVTDRAQGKLGGIGAAIVGDREEEEKWRQVHDEG
                     KVKQRGAEADIDKKGGY"
     gene            complement(<153685..>155191)
                     /locus_tag="ACHE_20065A"
                     /db_xref="GeneID:66978966"
     mRNA            complement(join(<153685..154839,154901..>155191))
                     /locus_tag="ACHE_20065A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284326.1"
                     /db_xref="GeneID:66978966"
     CDS             complement(join(153685..154839,154901..155191))
                     /locus_tag="ACHE_20065A"
                     /note="COG:E;
                     EggNog:ENOG410PFRQ;
                     InterPro:IPR037217,IPR000898;
                     PFAM:PF01231;
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0019441 - tryptophan catabolic process to
                     kynurenine [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133129.1"
                     /db_xref="GeneID:66978966"
                     /translation="MLAPVPELADYGISPDHGFLPSELPLTTLPDPYYARWEAIASNL
                     QGLLLSKRIRETVDRLPTLSTSYLQSESEWRRAYVVLVFILHAYVWGGHKPQERIPPQ
                     LTIPLLEICDHLELPPVATYAGVCLWNYKPVFPDEPAGHLNNLASVNTFTGSLDEQWF
                     YLVSVAIESRGGPTLPLMLRAISAARKGQSGVVTECLHELAERLDDIGALLERMYENC
                     DPYVFYNRIRPYLAGSKNMAEAGLPNGLLYDDGSDPKYGQYGGGSNAQSSLIQFFDIV
                     LGVEHRPTGEKPQAPASDKEGVAGRPRHGFIQEMRSYMPGPHRRFLEHVNAVANIREF
                     VEARRSDKALCIAYDACLYMLRTMRDKHIQIVSRYIIIQSKGAREQTQPAARGSAKPQ
                     NLASSRPVDKKKLRGTGGTALIPFLKQARDETGEPAIDAWARRLLGDAPVPSGFAALS
                     KIGENSDGHIEVVGLSGTWAADESEGGICHW"
     gene            complement(<156508..>158290)
                     /gene="NFS1"
                     /locus_tag="ACHE_20066A"
                     /db_xref="GeneID:66978967"
     mRNA            complement(join(<156508..156930,157181..>158290))
                     /gene="NFS1"
                     /locus_tag="ACHE_20066A"
                     /product="cysteine desulfurase"
                     /transcript_id="XM_043284327.1"
                     /db_xref="GeneID:66978967"
     CDS             complement(join(156508..156930,157181..158290))
                     /gene="NFS1"
                     /locus_tag="ACHE_20066A"
                     /note="BUSCO:EOG09261Y04;
                     COG:E;
                     EggNog:ENOG410PFTC;
                     InterPro:IPR010240,IPR015424,IPR000192,IPR020578,
                     IPR015421,IPR015422;
                     PFAM:PF00266;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_function: GO:0031071 - cysteine desulfurase activity
                     [Evidence IEA];
                     go_process: GO:0044571 - [2Fe-2S] cluster assembly
                     [Evidence IEA]"
                     /codon_start=1
                     /product="cysteine desulfurase"
                     /protein_id="XP_043133130.1"
                     /db_xref="GeneID:66978967"
                     /translation="MSSVTPSVLRQASRAYARRLSTQHGSLFPRRVAAATPVTRRGYV
                     TETKAGNAQVSVDTAIKQEQKAFMNQTGVQPQNVDLPGSGVSGDASMSPSAGILKQAT
                     VMDQGTRPIYLDMQATTPMDPRVLDAMLPYMTGIYGNPHSRTHAYGWESEKAVEQSRQ
                     YVADLIGADPKEIIFTSGATESNNMSIKGVARFFGRSGKKKHIITTQTEHKCVLDSCR
                     HLQDDGFEVTYLPVQNNGLIRMEDLEAAIRPDTALVSIMAVNNEIGVIQPLEAIGKLC
                     RSKKVFFHTDGAQAVGKIPLDVNKMNIDLMSISSHKIYGPKGMGACYVRRRPRVRLEP
                     IISGGGQERGLRSGTLAPHLVVGFGEACRLSKQEMEYDHKHIERLSKRLSEGLLSMEH
                     TNLNGDPDHHYPGCVNVSFAYIEGESLLMALKDIALSSGSACTSASLEPSYVLRALGT
                     SDESAHSSIRFGIGRFTTDSEIDYVLKAVQARVHFLRELSPLWELVQEGIDLSTIEWS
                     QH"
     gene            <159275..>160664
                     /locus_tag="ACHE_20067S"
                     /db_xref="GeneID:66978968"
     mRNA            join(<159275..159458,159508..160581,160642..>160664)
                     /locus_tag="ACHE_20067S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284328.1"
                     /db_xref="GeneID:66978968"
     CDS             join(159275..159458,159508..160581,160642..160664)
                     /locus_tag="ACHE_20067S"
                     /note="BUSCO:EOG09262PPU;
                     COG:T;
                     EggNog:ENOG410QE91;
                     InterPro:IPR004148,IPR027267,IPR036028,IPR001452;
                     PFAM:PF03114,PF00018,PF14604,PF07653;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133131.1"
                     /db_xref="GeneID:66978968"
                     /translation="MSFKGFQKGLVRAPQTFKAKFNIGEHTKDAVYSDAERRFQELEK
                     ETKRLHDESQKYFNAINGMLNHQIEFSKAMTELYKPISGRASDPSTYTIEGNPEGIHA
                     CEEYEAIVRELQESLAPELDMIDSRIISPADQLLEVIKVIRKVGVKRDHKQLDYDRHR
                     TTLKKLQDKKDKSLKDEKALYKAESDVEQATQEFNYYNDLLKDELPKLFALEAEFIRP
                     LFQSFYYMQLNVFYTLHDKMQGMNIGYFDLTLDVEEAFEKKRGDVKERTEELTIVHYK
                     TTGGRRPGSKPPIPGAKPSFAKEKFGSDGGSEYKSTYSRPNNASDGVDHPPPPYSAAA
                     AGSSASSASSMAAAAKGKPAPPPPKPKPSQFRAAVETVTALYDYEAQAHGDLSFSAGD
                     VIEIVQRTDNQNEWWTGKVGGREGQFPGNYVQLR"
     gene            <161185..>162294
                     /locus_tag="ACHE_20068S"
                     /db_xref="GeneID:66978969"
     mRNA            join(<161185..161256,161313..161323,161370..161427,
                     161482..161663,161717..162086,162142..>162294)
                     /locus_tag="ACHE_20068S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284329.1"
                     /db_xref="GeneID:66978969"
     CDS             join(161185..161256,161313..161323,161370..161427,
                     161482..161663,161717..162086,162142..162294)
                     /locus_tag="ACHE_20068S"
                     /note="COG:S;
                     EggNog:ENOG410PJMQ;
                     InterPro:IPR018170,IPR020471,IPR036812,IPR023210;
                     PFAM:PF00248;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133132.1"
                     /db_xref="GeneID:66978969"
                     /translation="MVNLSLSTKYRMNSGHEIPVLGFGSYLISNSQIPTVLQGAFNAG
                     YRHIDSAVMYRNEKGCGLAIKDSGIDRSEIFYTTKILPSAMGHRRTAKQVDDCLRESE
                     LDYIDLILIHAPYGGKEARLGSWRALTEAQQAGKVKSIGVSNYGIHHLEELQEYIDST
                     GGSKIDVGQYEIHPWCDRRNIIDWLKKHNIVVEAYSPLAHGSRFNESILKTLGKKYNK
                     SPAQIMIRWVLQNGIVPLPKSSSAERIKGNADVFDFELSEDEVNMLHTGEYSPTDWDP
                     TLDYD"
     gene            <162499..>163545
                     /locus_tag="ACHE_20069S"
                     /db_xref="GeneID:66978970"
     mRNA            join(<162499..162521,162597..>163545)
                     /locus_tag="ACHE_20069S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284331.1"
                     /db_xref="GeneID:66978970"
     CDS             join(162499..162521,162597..163545)
                     /locus_tag="ACHE_20069S"
                     /note="COG:E;
                     EggNog:ENOG410PJZC;
                     InterPro:IPR032963,IPR023210,IPR036812;
                     PFAM:PF00248;
                     go_function: GO:0035226 - glutamate-cysteine ligase
                     catalytic subunit binding [Evidence IEA];
                     go_process: GO:0006750 - glutathione biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133133.1"
                     /db_xref="GeneID:66978970"
                     /translation="MKLVLSTSNLMKGGGSSVIRRPTTEKSNVELINALRSNFQASQH
                     ESSNGSSNGTSSTATNGYKSWTSEHDGTLYIPARDLSQPGLSEERPQYDITVKLFYLP
                     GIPVSRRCAHTREAIDLVLKELGVDSIDLLIVSFPGILFDAEDDSEDEDEATEGEGTG
                     ANEGQVQQSDDFDSMVQTWRTLEKLQSEGMISQLGVAEFGSERLARFLTHTNVKPSVD
                     QINLKDCCVVPKSLILYAKQEHIQLLTHNDCNDILPVGTTRELLGPGESGAGILASAP
                     DKNDGIQGDVEPQWVVKYTAVVKDRGVVENKGYFALADIGNCVRTES"
     gene            complement(<163620..>164462)
                     /gene="BUD32"
                     /locus_tag="ACHE_20070A"
                     /db_xref="GeneID:66978971"
     mRNA            complement(<163620..>164462)
                     /gene="BUD32"
                     /locus_tag="ACHE_20070A"
                     /product="serine/threonine-protein kinase bud32"
                     /transcript_id="XM_043284332.1"
                     /db_xref="GeneID:66978971"
     CDS             complement(163620..164462)
                     /gene="BUD32"
                     /locus_tag="ACHE_20070A"
                     /note="COG:K;
                     EggNog:ENOG410PQ9A;
                     InterPro:IPR000719,IPR022495,IPR011009,IPR008266;
                     PFAM:PF06293;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="serine/threonine-protein kinase bud32"
                     /protein_id="XP_043133134.1"
                     /db_xref="GeneID:66978971"
                     /translation="MSEYKPPRLPSPFTHTTPPPTLLTQGAEAHLYKTTYLTPTTPAA
                     LKIRPSKPYRHPILDRRLTRQRILQEARCLSKLVREGVSVPAILALDWEPQWQEEKDA
                     LEGRAGGAWLLMEWIEGLVVRVVLERWEGWMKRNTQIGEEQRKGEESRVRYLMRRIGH
                     VVGGLHKAGVVHGDLTTSNLMLRPTAAPGNGVEEVDGGNPSMEGEVVLIDFGLAGQSN
                     QDEDRAVDLYVLERAFGSTHPRTEPFFDELLQGYREVYRGAVSTLKRLEDVRMRGRKR
                     SMIG"
     gene            166434..166505
                     /locus_tag="ACHE_t20003S"
                     /db_xref="GeneID:66987337"
     tRNA            166434..166505
                     /locus_tag="ACHE_t20003S"
                     /product="tRNA-Met"
                     /note="tRNA-iMet"
                     /db_xref="GeneID:66987337"
     gene            complement(<167218..>168294)
                     /locus_tag="ACHE_20071A"
                     /db_xref="GeneID:66978972"
     mRNA            complement(<167218..>168294)
                     /locus_tag="ACHE_20071A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284333.1"
                     /db_xref="GeneID:66978972"
     CDS             complement(167218..168294)
                     /locus_tag="ACHE_20071A"
                     /note="COG:S;
                     EggNog:ENOG410QEFF;
                     InterPro:IPR015943,IPR036322,IPR018391,IPR001680,
                     IPR019775,IPR020472,IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133135.1"
                     /db_xref="GeneID:66978972"
                     /translation="MKSVMRNTFKEDRSRWIHSLPRVESSWSAELQNLEGHSGWVWSV
                     AFSPDGQRVVSGSSDQTVKLWDVTTGSEVQSLEGHSDLVRSVAFSPDGQTVVSGSDDR
                     TVRLWDVTTGSEMQSLEGHSDSVWSVAFSPDGQRVVSGSSDRTVRLWDVTTGSEMQSL
                     EGHSDSVWSVAFSPDGQRVVSGSSDRTVRLWDVTTGAEVQSLEGHSDSVWSVAFSPDG
                     QRVVSGSRDETVKLWDVTTGSEVQSLEDHSNWVRSVAFSPDGQRVVSGSRDGTMKLWD
                     VTTGSEVQSLEGHSDHDCSPTSHKPGFQISVKASWVAFRGEKVLWLPLHYRQPSCFAI
                     KNDTLSLGYRDGRVLILGFCALVD"
     gene            complement(<169336..>170966)
                     /locus_tag="ACHE_20072A"
                     /db_xref="GeneID:66978973"
     mRNA            complement(join(<169336..169386,169463..170368,
                     170427..>170966))
                     /locus_tag="ACHE_20072A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284334.1"
                     /db_xref="GeneID:66978973"
     CDS             complement(join(169336..169386,169463..170368,
                     170427..170966))
                     /locus_tag="ACHE_20072A"
                     /note="COG:A;
                     EggNog:ENOG410PIUX;
                     InterPro:IPR027417,IPR031359,IPR007111;
                     PFAM:PF17100,PF05729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133136.1"
                     /db_xref="GeneID:66978973"
                     /translation="MHHLKKLFNHGKEQKGRGPNRPKKAQSANHPPHQHKIQADDWVS
                     RSSVSIPAHQPNITKIEGSPPPRDLWKSAYDKLDQKEQDILSKIPVLTQPGIDEKKHK
                     TKAIIDKVVETTKEQYEKYQEGGLKIRRSTGNDIDLRKLSHKIINAAFSFKEIISTVV
                     GFDPTHHAASAWAVVSIGLTMAKNSSDLRDALFQSSEYMADILARHAYIEEKFYHQSG
                     QNAQTGHALVKVYKAILQYAAKVLAAQDSNVGKWMLDSVTGITNQDLMELKKSVKDQE
                     QELHHCVEREQHLHHNEQAEQLLTQGDQIMRSFQALIQKFNLPIAEGASYDSFDNQHG
                     EKCLPGTRKELRCQIANWAEELDSKVIFWLNGMAGTGKSTIARTVAQSFDEKGLLGAS
                     FFFKQGEADRGNAKRFVSTITRQLMTSNRELAHGISRAIEDDPDLSTKALSQQFDKLL
                     LQPLLKLELNETTSMVIVIDALDECEKEGDIRNFLFVMVSSKMMIIRT"
     gene            complement(<172266..>174272)
                     /locus_tag="ACHE_20073A"
                     /db_xref="GeneID:66978974"
     mRNA            complement(join(<172266..173228,173277..174109,
                     174164..>174272))
                     /locus_tag="ACHE_20073A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284335.1"
                     /db_xref="GeneID:66978974"
     CDS             complement(join(172266..173228,173277..174109,
                     174164..174272))
                     /locus_tag="ACHE_20073A"
                     /note="COG:S;
                     EggNog:ENOG410PUZ2;
                     InterPro:IPR021858;
                     PFAM:PF11951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133137.1"
                     /db_xref="GeneID:66978974"
                     /translation="MTTSTSPSIKLRFVNDDEIRNLNAEHAAKHRRCLFSDTQRRQMS
                     DELIDAVVAQDQDPGQFMLDLEQDCLETYPKASQSFEVFRGPFGVARWLGSVEEVHDG
                     DSELIGFDATDGEEPDEDLTRWLLDTSPGDNIRSTEDMFVDLLPVSPIPQTSPPRVNE
                     SLNDIDLGTPISLDNHRMTFSINEDPKAWLLLSYYRDRIIRLISLCQQQHPQHDEVND
                     PWSNLVMPCAMTTMAELTIGGSANNARLALLSALLATSAFHLQNSSTTLTAEEWMVAG
                     EEYTARARGYLETCLGMDKSKCKYKEVLMAILCLANTFMVKGDPDTRLTYLLYAERFI
                     RANGFNKPTLSRKRRTLHHYYAYMRIMAETTRSSGHLPSTASPSADKGSEDDNDQFRV
                     CRWTSLSESMMGREKDPDTARRDLHLEVPGNWTSTLFPELYGIAESFLLLLSQVIRLA
                     NERDLAMDQDENLSLKEFTLRAKALEKSIYRLISSSACGPVSSPSASSTSTSTADENA
                     MQAMYTALLIFFYRRVHNVDVMLLQREVLTVQDYLMQIEQAQDSTRGNGRMVALMWPA
                     FVAACEALLPETQGYFAEWFEELFAKTGLVSVSLAKGVCEFVWARRREQDGLSWPEVL
                     RNRGVKALCT"
     gene            complement(<174459..>175922)
                     /locus_tag="ACHE_20074A"
                     /db_xref="GeneID:66978975"
     mRNA            complement(join(<174459..174534,174585..174661,
                     174710..174963,175016..175090,175135..175287,
                     175347..175684,175743..175776,175829..>175922))
                     /locus_tag="ACHE_20074A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284336.1"
                     /db_xref="GeneID:66978975"
     CDS             complement(join(174459..174534,174585..174661,
                     174710..174963,175016..175090,175135..175287,
                     175347..175684,175743..175776,175829..175922))
                     /locus_tag="ACHE_20074A"
                     /note="COG:C;
                     EggNog:ENOG410PKHE;
                     InterPro:IPR012133,IPR037396,IPR008259,IPR013785,
                     IPR000262;
                     PFAM:PF01070;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133138.1"
                     /db_xref="GeneID:66978975"
                     /translation="MAHRGETLHKHISCIADLKALGSKNLPVMVKDYYNEGAMDLITL
                     RENEAAFDRYKIRPRILVNVDQVDTSTEILGTKVTLPLGFSPAASQRLAHPDGEVGAS
                     RAAAKYGICMGLSSYSNYSLEDVAAQGSGNPYVMQMCVLRDRSITVQLLERAEKAGYK
                     ALFLSVDVPVLGKRLNEYRNEYQLPEDMSWPNILSNGSDTSSRTEYDPSLDWENTIPW
                     LRKHTKLPIWLKGVHTPEDIELAIKYGIDGIVISNHGGRQLDGVPATLDALRDCAPVA
                     AGRIPLAIDGGIRRGSDIFKALALGASCCFVGRIPIWGLAYGGQEGVELAIKILHQEL
                     KITMALAGCRKISDIHKSHLSIIKSDGVLARL"
     gene            <176349..>177598
                     /locus_tag="ACHE_20075S"
                     /db_xref="GeneID:66978976"
     mRNA            join(<176349..176365,176417..176622,176677..176754,
                     176807..177270,177332..>177598)
                     /locus_tag="ACHE_20075S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284337.1"
                     /db_xref="GeneID:66978976"
     CDS             join(176349..176365,176417..176622,176677..176754,
                     176807..177270,177332..177598)
                     /locus_tag="ACHE_20075S"
                     /note="COG:S;
                     EggNog:ENOG410PUC2;
                     InterPro:IPR036291,IPR016040;
                     PFAM:PF13460,PF01118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133139.1"
                     /db_xref="GeneID:66978976"
                     /translation="MAKIFLTGASGYIGGEVLHVLQTAYPEHDYVVLLRDKEKAEQVS
                     NAYPKVRVVFGDLDSAALLEEEARKADIVVHLAHAKHIGSVEAIARGLTTLNRAKPGH
                     WIQVSGATLLSFPDIEQNAYGEPTNKVYNDFEGVEEVRQLIQRYSSKRLVDSFILNLA
                     KSPTSPKTALVFPPLIYGRGRGPVNQRSVQVPELAKATLQRRAGLQVGKGQSIWSNVH
                     ITDISQIFAKLVGKALQGEEGDLWNENGLYFAENGALTFKEISQLVTQESHKLGLIDS
                     TSVAELTHQEADELSAHAGILWGTNAREQAQRARTLLDWAPKANPLDKEIPEAIHVEA
                     DRLGLKSNL"
     gene            complement(<179891..>181089)
                     /locus_tag="ACHE_20076A"
                     /db_xref="GeneID:66978977"
     mRNA            complement(join(<179891..180267,180315..>181089))
                     /locus_tag="ACHE_20076A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284338.1"
                     /db_xref="GeneID:66978977"
     CDS             complement(join(179891..180267,180315..181089))
                     /locus_tag="ACHE_20076A"
                     /note="COG:S;
                     EggNog:ENOG410PRK9;
                     InterPro:IPR000210,IPR011333;
                     PFAM:PF00651;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133140.1"
                     /db_xref="GeneID:66978977"
                     /translation="MFNSDPRLSGQPTSQPTNAKVKVPRSGYRGTTSHPSNVNEPDPN
                     GDVTLVVSPPVHPPLYKQHPSSFGTNVKSSFSFSATLASAPATSIGPTVSSTPTESKP
                     PKTRFRVSSKQLMLASAYFEKMLTPRWQEGQALGAGGSIELNIPETDPYTLLIILDII
                     HCRRARVPRVVNFDKLIDLAVLADYFQCHEALEPYPSIWLESLREEVPSVHSNMLVKW
                     IFVSWVFNYDAIFSRVTRIAQRQATYDIYLLELPIPESIYGAINHARKTALASIFGAL
                     KRRREYLETNTRPTCCDDCDSLHLGALIRLMKSNNLNLEYPYIGLSVEAAAEKVSGFK
                     QPRSIHPTPAPVAFASYNRLCETNSRLLGEGTKQEVENAISVLQGLDLS"
     gene            <182362..>184076
                     /locus_tag="ACHE_20077S"
                     /db_xref="GeneID:66978978"
     mRNA            join(<182362..183024,183069..>184076)
                     /locus_tag="ACHE_20077S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284339.1"
                     /db_xref="GeneID:66978978"
     CDS             join(182362..183024,183069..184076)
                     /locus_tag="ACHE_20077S"
                     /note="COG:S;
                     EggNog:ENOG410PHC5;
                     InterPro:IPR021858;
                     PFAM:PF11951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133141.1"
                     /db_xref="GeneID:66978978"
                     /translation="MPSLALSPSSMMIGSLAQMDDFLHWSDLFDLGPDPLQLTPHPFL
                     ESVDGFDFAMASTFAQTNTLEHNNSSRIMTPQQSPLDTGSLSVDVMPDAPFLLKHFQD
                     NVIAQMMAMPLGEKSPWKILNVPAAVLAYSDLTFLGAQNISHARLANLYSLLACSAYH
                     LASNPDVITTNSAEYWRMVTEQANIQAKNHIQMSLKHEIHQPKKAKYKDQLMAICGMT
                     GFAILCGQQKDARCYMIDAERLLRLRGLSKPKISQKARLLHHIYTWLRIVGESTYVLH
                     DYNPSSSFIESFNRHFRTDQNTVSHRNPRLDDFLHLQPRQSDSDLDIDQPKDNDVALH
                     DIHLQDSRQFPGTLYNQIYGIPETWLSLVSQTTRMANVLDSLRIARRTHKNLSAEAWD
                     TVHRRRIRLENMICSFDLNLARDDCDGSPNSHMLRALSSALVIFFHRRICQVHPAILQ
                     GHVDSIIISLANFDNALEQCQNPGPGTAWPAFIAGCEAITTSRREAIMRWVEKGGAKC
                     GFIAFTRAKEVMLETWKRQDEHLAARRGDDIPTWVEVAKEWQLWPIFC"
     gene            complement(<184151..>185041)
                     /locus_tag="ACHE_20078A"
                     /db_xref="GeneID:66978979"
     mRNA            complement(<184151..>185041)
                     /locus_tag="ACHE_20078A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284340.1"
                     /db_xref="GeneID:66978979"
     CDS             complement(184151..185041)
                     /locus_tag="ACHE_20078A"
                     /note="COG:E;
                     EggNog:ENOG410PNE3;
                     InterPro:IPR002220,IPR020624,IPR013785;
                     PFAM:PF00701;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016829 - lyase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133142.1"
                     /db_xref="GeneID:66978979"
                     /translation="MSLTGIMVALITPFTDDRTQIDESRLKAHIDHLLAAGVHGLVPA
                     GSTGEFTTLSFAERKQLTELCVKYAAGRVPVVTGVGSTSTSEAVELAKHAADVGAAAT
                     MVVPPFYDPVNLEQLTEMLSEIHEASRGLPIVYYNIPSASGLTLSPKEIASLSRVGVK
                     YLKDTSGNAPAFTELVFGLSDQITAFNGWDTLTFYGLAAGTPGAIWGAANLIPELAVE
                     LWDAVSVKGDLKKGRELWAKAWPVCKFLEEHNYAAAVKTGVELAGQSTGGLRKPFALL
                     EGDIKEELRKLLSNAGVKTV"
     gene            <185391..>187012
                     /locus_tag="ACHE_20079S"
                     /db_xref="GeneID:66978980"
     mRNA            join(<185391..185509,185567..185766,185826..>187012)
                     /locus_tag="ACHE_20079S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284342.1"
                     /db_xref="GeneID:66978980"
     CDS             join(185391..185509,185567..185766,185826..187012)
                     /locus_tag="ACHE_20079S"
                     /note="COG:C;
                     EggNog:ENOG410PJ9J;
                     InterPro:IPR015590,IPR029510,IPR016161,IPR016162,
                     IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133143.1"
                     /db_xref="GeneID:66978980"
                     /translation="MSFVEITTPNGHRYQQPTGLFINNEFVPSSGGTIVSLDPATDTP
                     IATVQAASADDIDRAVKAARTALGHPSWKLLPATDRGRLMAKLADLIEEKKELFASID
                     AWDNGKPYHVALSDDLTEAITTIRYYSGWADKTFGQTINTTPEKLAYTLRQPIGVVGQ
                     IIPWNYPLSMATWKLGPALACGNTVVIKAAEQTPLSILVLGTLIKEAGFPPGVVNIIN
                     GYGKEAGSALVQHPDVDKVAFTGSTGTAQQIMKMAAGTLKNITLETGGKSPLLIFPDA
                     DLDQAVKWSHMGIMSNQGQICTATSRLFVHRDIFDNFLTQFQEQIRSTSKIGDQWDES
                     TYQGPQVTRAQYERILSYIECARSDGATIFSGGSAHKLDNPKYANGYFVQPTVITNTT
                     DDMAIYREEVFGPVVVVVPFSDEEEAIRRANDTSYGLGAAVFTRDLERAHRVAGAIEA
                     GMVWVNSSQDCDPRIPFGGVKQSGIGRELGEAGLEAYSQVKAVHVNMGSRL"
     gene            <187874..>188158
                     /gene="BOT3"
                     /locus_tag="ACHE_20080S"
                     /db_xref="GeneID:66978981"
     mRNA            join(<187874..187929,187993..>188158)
                     /gene="BOT3"
                     /locus_tag="ACHE_20080S"
                     /product="cytochrome P450 monooxygenase Bot3"
                     /transcript_id="XM_043284343.1"
                     /db_xref="GeneID:66978981"
     CDS             join(187874..187929,187993..188158)
                     /gene="BOT3"
                     /locus_tag="ACHE_20080S"
                     /note="COG:Q;
                     EggNog:ENOG410PMQB"
                     /codon_start=1
                     /product="cytochrome P450 monooxygenase Bot3"
                     /protein_id="XP_043133144.1"
                     /db_xref="GeneID:66978981"
                     /translation="MDQYLLPFTEESQSCLGINLAWAELYLATAMVFRPGGPKLSLYD
                     MNESDIEFARDFLTGFPKHDSRGIRVMVN"
     gene            <188483..>189103
                     /locus_tag="ACHE_20081S"
                     /db_xref="GeneID:66978982"
     mRNA            join(<188483..188592,188641..>189103)
                     /locus_tag="ACHE_20081S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284344.1"
                     /db_xref="GeneID:66978982"
     CDS             join(188483..188592,188641..189103)
                     /locus_tag="ACHE_20081S"
                     /note="COG:S;
                     EggNog:ENOG410Q1FN;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133145.1"
                     /db_xref="GeneID:66978982"
                     /translation="MNLTWLLFAASTLAATTPTPTTPPSTDSGWSSVENALHSMTIPS
                     LALPTNSGNLANISPPPRSLINQVISAVPASVLVDLFDPSKRRALGSEIQAGSTPTWY
                     QNLPTDVKNYMAVVKSQISEGALTASPTASNSVSGSGSGSVSNEATATAAETTTGAAS
                     DTNSGGRIQPGGIEVAIAGAIAIMGMMPLL"
     gene            <190042..>190474
                     /locus_tag="ACHE_20082S"
                     /db_xref="GeneID:66978983"
     mRNA            join(<190042..190365,190424..>190474)
                     /locus_tag="ACHE_20082S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284345.1"
                     /db_xref="GeneID:66978983"
     CDS             join(190042..190365,190424..190474)
                     /locus_tag="ACHE_20082S"
                     /note="COG:S;
                     EggNog:ENOG410Q29G;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133146.1"
                     /db_xref="GeneID:66978983"
                     /translation="MHFKFLILPLVTLGLASPAPAPSGGLLSDLPDIVDNVKDLLSQD
                     TIDDLQTIVKGGAVLLGGDTPQNLRNLLSKENIDKLQDVIDNAHTLITTSFVNDTSEL
                     VADAAPLVADVSKLLGGILASV"
     gene            complement(<190548..>191444)
                     /locus_tag="ACHE_20083A"
                     /db_xref="GeneID:66978984"
     mRNA            complement(<190548..>191444)
                     /locus_tag="ACHE_20083A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284346.1"
                     /db_xref="GeneID:66978984"
     CDS             complement(190548..191444)
                     /locus_tag="ACHE_20083A"
                     /note="COG:S;
                     EggNog:ENOG410Q2VJ;
                     InterPro:IPR018713;
                     PFAM:PF09995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133147.1"
                     /db_xref="GeneID:66978984"
                     /translation="MSEEIEKLPDEKSIPASSSPDTHSDNASGKENGNQYPLDALDKL
                     EILPHMLQEGILFAGSGSALLLQAALPDIRSDNEQHHNNLANELGDALQAILGYIACL
                     VFGTRDEKRILLDLLARRQPPLKGSEYYTRRPDVHLWIAATLYATATDFYQRIYGRVN
                     LKTAEKAYREYSLLCHVLGIPRGTWPENREAFWKYWDERIETLHVTDHANEFAKDLMY
                     RTEFPRWVQTLKPFLRVVTIEMLPPRIREQYGLQSTMGTRGLYRFTMGFSVAVYPALL
                     KSVRRYPVQYYLKELRKHLNVI"
     gene            <191886..>193375
                     /locus_tag="ACHE_20084S"
                     /db_xref="GeneID:66978985"
     mRNA            join(<191886..192151,192201..192622,192673..192794,
                     192845..>193375)
                     /locus_tag="ACHE_20084S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284347.1"
                     /db_xref="GeneID:66978985"
     CDS             join(191886..192151,192201..192622,192673..192794,
                     192845..193375)
                     /locus_tag="ACHE_20084S"
                     /note="COG:S;
                     EggNog:ENOG410PXTB;
                     InterPro:IPR022185;
                     PFAM:PF12505;
                     TransMembrane:1 (i71-97o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133148.1"
                     /db_xref="GeneID:66978985"
                     /translation="MGKAKDLAEKPAYLSSAAAKYALGVHRGPFAPKESLDGNDLEHI
                     ETADTITLENIKRTPTQNLRRHWFRFWCCYVFWSIIFLAIFLPIFFLICIPAISQNVL
                     NRSTLLLVEAAILEPRPDSLVLSMTSALNLPVSLPVRIDPMTLELFNREQPMNNTWSK
                     VYLGPYLIKGNTTLGVTNQPTPIDPEQWYNYVWKFVHLHHPPLSVRGKTTSYLGELVS
                     KVTMDKDIPQTTLNNFTGFSIDDSTLIEAREDGTNLLANATLPNPSVVTLEIGNTTLN
                     LFSGDLLLGNATLPNLFLRPGNHATPVEGILDIKKLFNKDNLSQIVKDQAESLKKGNL
                     KLKTIGTNVMWNGVQVPYYTKVMQGLTLEADVPIAGLLGNTVHSLLNGKDNPLANISI
                     TEPETDDSDGSILDGTGLDNLRKLKRAMSDVDLSKYSGRKRGMEMTIADLMATL"
     gene            <195608..>195988
                     /locus_tag="ACHE_20085S"
                     /db_xref="GeneID:66978986"
     mRNA            <195608..>195988
                     /locus_tag="ACHE_20085S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284348.1"
                     /db_xref="GeneID:66978986"
     CDS             195608..195988
                     /locus_tag="ACHE_20085S"
                     /note="COG:S;
                     EggNog:ENOG410PJV0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133149.1"
                     /db_xref="GeneID:66978986"
                     /translation="MARQLKLERAVCSFIGNLGMVNYQSSQRTSDGVLLDLAIQQLTE
                     RVDMVRYIKKSMTPDATNEATIWEAIGLSRLSLCYTARGLSQEAIKSALGSVEAAASL
                     KDPTVITMPRFFYGHALLGSAKKH"
     gene            <199516..>199923
                     /locus_tag="ACHE_20086S"
                     /db_xref="GeneID:66978987"
     mRNA            <199516..>199923
                     /locus_tag="ACHE_20086S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284349.1"
                     /db_xref="GeneID:66978987"
     CDS             199516..199923
                     /locus_tag="ACHE_20086S"
                     /note="COG:S;
                     EggNog:ENOG410Q0VM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133150.1"
                     /db_xref="GeneID:66978987"
                     /translation="MEQIPFNQVPSTKRSPSFTNAAFQPDSTFRAQVQGQVPVPLPAQ
                     SQNTSLNSTATANMPANSSTLGANPSQQPQSQSQKQTQIQTQQPEDESTEQTQKGGPT
                     ATAPFLRDFSLVAEAAKRAQMAVVMRDLEGISL"
     gene            complement(<200583..>201236)
                     /locus_tag="ACHE_20087A"
                     /db_xref="GeneID:66978988"
     mRNA            complement(<200583..>201236)
                     /locus_tag="ACHE_20087A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284350.1"
                     /db_xref="GeneID:66978988"
     CDS             complement(200583..201236)
                     /locus_tag="ACHE_20087A"
                     /note="COG:S;
                     EggNog:ENOG410Q2S1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133151.1"
                     /db_xref="GeneID:66978988"
                     /translation="MSSSPESQSPSSPDSPRHLAWPVPSVPITVTHYNTHTRQHTTST
                     TTTTTTSPTAGPSPTGGPTMIKSRRFYSSPLSDTSSTPDPKTPLQAYGLEQREPSIAE
                     EKPHLLRRVSHALDDIKEDFSLGLDARGTAEKIRSRRRGSVFFEAPPSSSLAPRPESA
                     RPLSIFSTAGSVDHGSGSAGKRMSRRLSMFGGGFSQRRKRVGESISQPNLIGSSTHL"
     gene            complement(<201962..>203387)
                     /gene="MCA1_3"
                     /locus_tag="ACHE_20088A"
                     /db_xref="GeneID:66978989"
     mRNA            complement(join(<201962..201987,202061..202624,
                     202675..202719,202769..203131,203180..203301,
                     203347..>203387))
                     /gene="MCA1_3"
                     /locus_tag="ACHE_20088A"
                     /product="Ca(2+)-dependent cysteine protease"
                     /transcript_id="XM_043284351.1"
                     /db_xref="GeneID:66978989"
     CDS             complement(join(201962..201987,202061..202624,
                     202675..202719,202769..203131,203180..203301,
                     203347..203387))
                     /gene="MCA1_3"
                     /locus_tag="ACHE_20088A"
                     /note="COG:D,O;
                     EggNog:ENOG410PGJT;
                     InterPro:IPR029030;
                     MEROPS:MER0114503;
                     PFAM:PF00656"
                     /codon_start=1
                     /product="Ca(2+)-dependent cysteine protease"
                     /protein_id="XP_043133152.1"
                     /db_xref="GeneID:66978989"
                     /translation="MYHHRSNSWWPEYGHQYPPQGYYQQPPPPPQGYGYPPYHTPTPP
                     SHSPSPYSHHRQQSWNDNLPPPPPQVPQHFGHGAPSNYHFQYSTCTGRRRALLIGINY
                     LGQPNQLKGCINDVANMSTFLHEKHGYRREDMVILTDDQENPMSIPTKANMLRAMQWL
                     VRDAQPNDSLFIHFSGHGGRTPDLDGDEDDGYDDVIYPVDYRTAGHIVDDDMHAIMVR
                     PLRPGVRLTAIFDSCHSGTALDLPYVYSTQGVLKEPNLAKEAAQDLFSAITSYGNGDL
                     SSMAETAIGFFKKAAIGSSARERTVMTKTSPADVVMFSGSKDTQTSADTFQDGEARGA
                     LSWAFIKSLERWPYQSYLQLLNTIRSELEDRYTQKPQLSCSHPLDTNLRFVM"
     gene            <205415..>207476
                     /locus_tag="ACHE_20089S"
                     /db_xref="GeneID:66978990"
     mRNA            join(<205415..205573,205629..>207476)
                     /locus_tag="ACHE_20089S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284353.1"
                     /db_xref="GeneID:66978990"
     CDS             join(205415..205573,205629..207476)
                     /locus_tag="ACHE_20089S"
                     /note="COG:S;
                     EggNog:ENOG410PP0Y;
                     InterPro:IPR001810,IPR036047;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133153.1"
                     /db_xref="GeneID:66978990"
                     /translation="MTDLSRSLDSIPYDVFYQIASKLDCYDFISLSRVNRSLNHAMSS
                     EPIARKTIENNLLHTKEGQDADRSKSGYRKAVGRLFDIKESFSTAQPYSASVIAYGTT
                     FLYDSGSLCYVHDDDIRVLDVHGAAQKEQVMNISNVVARVLPHYAPGTSPIRLSLLHY
                     SDGILAFLVELAEGPEAWLFAIDLRRRPANARNGRLRLRTQLSSTRRLFVRHNGSYLY
                     YGTHSSLGYDGYPLWAIHCVDLQTGRHMSEKPVELAHFAGNEIGQTVCFGLHQDHLYA
                     VSTQVDCEEEEVDWTSFYIWVCLAPEPNTRRRVTPNRTWRRQHREGPINDTWTDLSLR
                     HDEATKRLMILECRREWRNGGSENCRTYYMQALPSPNEINTGKQRTGPTDARVPHHEP
                     LIKVHDPSSKPNQQPPKKRLRRHYHPEYQLGGTGPNDSSAQPQRRDFILAKTKYHAYN
                     LSASSFVDLVNDPSPDPTKDSTSLIPHDRLRLRTVSRKRKCPIDETGEEGPRGLLYRP
                     DLSDTNGQPIDHSEERFLSRGVHMWPPDNAPPELNNLLCPSERAGRVQAMADERSIVY
                     SVNHDGLTDGKQALILINFDPSIKFPGLTRLHRYNHHLGEMFSSAQDPAGVAVGVEQP
                     QFGGPSRERHGMSVVRTMGMNVGLPSVREEAAMYLRINWGYWLR"
     gene            <209937..>211387
                     /locus_tag="ACHE_20090S"
                     /db_xref="GeneID:66978991"
     mRNA            join(<209937..210268,210325..>211387)
                     /locus_tag="ACHE_20090S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284354.1"
                     /db_xref="GeneID:66978991"
     CDS             join(209937..210268,210325..211387)
                     /locus_tag="ACHE_20090S"
                     /note="COG:S;
                     EggNog:ENOG410PJ9N;
                     InterPro:IPR008886,IPR029058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133154.1"
                     /db_xref="GeneID:66978991"
                     /translation="MAGQDSLDDAPSPTHPDILLNRPGTGTENYLDHSASNLSLPHRP
                     ESGNRRLLLIYIHGFNGSEASFHAFPAHVHSLLTDALAASHEVYTRIYPRYKSRGDMK
                     IARDQFSSWLSPHEADDLDIILLGHSLGGILAADVALLPSSPIYSHQHRKHNILGLIN
                     FDVPFLGLHPGIIQTSCKSLFQRDRPAENETETVPETQITTEAITAAFSPSHYDPPFF
                     NDIRFAERSGMQGLMHFLEKNYNRLTKSILTRIVSPYEFAGCLNNYPELRRRYKQLME
                     LEAAHDQPFRIRFVNYYTASEPPVPLKDKNNAGESENSRHASMEHSSLPVDAEEPPCK
                     QSETETENETESCSLKPTKSESGVQHKPESDQADCTCASETADCTSKQHKKKKRRKFV
                     LLPSHHWSHGDDSLWIPVNMDNMNEITAHQSLFLPHGRNYDQLVGDTMATIEQWIQVD
                     LTQRMLAQEEQEGK"
     gene            complement(<212287..>214380)
                     /locus_tag="ACHE_20091A"
                     /db_xref="GeneID:66978992"
     mRNA            complement(join(<212287..212597,212684..213021,
                     213087..214048,214378..>214380))
                     /locus_tag="ACHE_20091A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284355.1"
                     /db_xref="GeneID:66978992"
     CDS             complement(join(212287..212597,212684..213021,
                     213087..214048,214378..214380))
                     /locus_tag="ACHE_20091A"
                     /note="CAZy:GH18;
                     COG:G;
                     EggNog:ENOG410PKNR;
                     InterPro:IPR011583,IPR029070,IPR001223,IPR017853,
                     IPR001579;
                     PFAM:PF00704;
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_function: GO:0008061 - chitin binding [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133155.1"
                     /db_xref="GeneID:66978992"
                     /translation="MRIPSFGGWSFSTSLDSYSIFREGVTDANRLAFTQYVVAFVDRY
                     NLDGVDFDWEYPGAPDIPGIPAGSETDGPNYFSFFKTLRSLLPSNKSISMAAPASYWY
                     LKGFPIAEMADVLNYIVFMAYDFHGQWDWDNSFVGPGCENGNCLRSHVNLTETEYALA
                     MITKAGVPANKVVAGIASYGRSFGMEDPSCTGPNCLFTGPNSTATPGDCTDTAGYISQ
                     AELSQYSSGSSLNRRDATLWYDNESDSDMMTYEDGTWVAYMPQNTKASRINRYASYGL
                     AGVVEWALDLTQFILSATDEAATMDINEAEGTFADALALSDYDTSDEKVAITSGWQQS
                     WKIMNHIYTVVKNGIDFNEAAAVEFLGSPAFNQDEQSDFNAVFKQLSTIQPGWGGWFA
                     WQLAVRCDDFKYMCPCNIDTGVIAYTVQNDPKYQNHQPVSARDNYYPNQGVTWFHELL
                     HVDWESLNGVPHISDIKIGFEIKGVMKWFEAYCPKLTKGLARVGGATGFWTLQNADSL
                     SFARWPNTSRNAWATSIPISRWRLRRLVA"
     gene            <215065..>216351
                     /locus_tag="ACHE_20092S"
                     /db_xref="GeneID:66978993"
     mRNA            <215065..>216351
                     /locus_tag="ACHE_20092S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284356.1"
                     /db_xref="GeneID:66978993"
     CDS             215065..216351
                     /locus_tag="ACHE_20092S"
                     /note="COG:S;
                     EggNog:ENOG410Q26M;
                     InterPro:IPR014752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133156.1"
                     /db_xref="GeneID:66978993"
                     /translation="MEVQEVQLMTPQTHCTFLGPHDESYSGPLSGSVEIIIASSNIDS
                     SGYPKLSIKLTRTVAFERRCAATAPRRSNGFFKCLRRRSANQAQLIPIRGQSASSTET
                     ITQCDLWHTQHHVEHHQDRGTTSLKFNFGIPVPFDIPPTTETVLGTVSYMITATSTST
                     IGTTATTTRPIQILRRAIPGHPRTIQHVRTFRDDRMRIFLDITPKESPGPGSKASYTA
                     RLCAKQTITEGPRTAQHVVIKELKWQVEETAKALSKPSHHGTHDAIYHKERCVRQLCH
                     GRVTGRWSATGGRPKTEATDDTIQISFDVSIPTSADAVEVLEMSAVDTKQTCLLHQGP
                     CECPARTHIDEEKAAIIASHQLKLDIIAGEDVIDQETGKLVDRKPLWKSFGAFFPMPV
                     YEFMTSQEIPNAAFPANDTPPMYDDASNPPDYDVLR"
     gene            <216843..>218652
                     /locus_tag="ACHE_20093S"
                     /db_xref="GeneID:66978994"
     mRNA            join(<216843..217403,217473..217672,217765..218345,
                     218420..>218652)
                     /locus_tag="ACHE_20093S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284357.1"
                     /db_xref="GeneID:66978994"
     CDS             join(216843..217403,217473..217672,217765..218345,
                     218420..218652)
                     /locus_tag="ACHE_20093S"
                     /note="COG:E;
                     EggNog:ENOG410PMJE;
                     InterPro:IPR002293,IPR004840;
                     PFAM:PF13520,PF00324;
                     TransMembrane:12
                     (i30-47o67-88i109-138o158-178i190-212o232-253i274-299o319-
                     343i373-393o399-422i434-458o470-490i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0006865 - amino acid transport [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133157.1"
                     /db_xref="GeneID:66978994"
                     /translation="MAENKMDKPHADSNLESLGYRPELSRNRSTWQVVFMCFILASVP
                     YGLSTTMSYPMAGGGPANMFWGWVIISFIILCVAASLAEITSVYPTAGGVYYQTFVLS
                     PSWCRRVTAWICGWSYIAGNITITLAVNFATALFLVESLNVFKSSEGVGITEDFQAYQ
                     TYLIFLGITLICHAIPAFGNRWLTHLETMAIFWTLIGVSALVITVLVVAAHGRRSAEW
                     AFTGFEPQSGWPDGWSFCIGLLQAAYGLSASGMVTSMCEEVHQPAIQVPKALVGGVIA
                     NFFAGLFLLIPLNFILPDIAMLANLASGQPVPTIIKSATGNSAGAFCLLIPLLALGII
                     CGVGCVTAASRCTWAFARDGAIPGSKWFRQVNTRLEVPLNAMLLGMVIEILLGLIYFG
                     SAAAFNAFSGAGVIFLTLSYAMPVAVSLVLRRRKDVKNATFNLGVLGIFCNVICLAWT
                     LLAIPLFSMPTFSAVTLEDMNYASVVFVGFVAVSAVWYWIWGHRNYAGPPTETVEMAA
                     ECLDDVNAMDKPTELP"
     gene            complement(<219521..>220153)
                     /locus_tag="ACHE_20094A"
                     /db_xref="GeneID:66978995"
     mRNA            complement(<219521..>220153)
                     /locus_tag="ACHE_20094A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284358.1"
                     /db_xref="GeneID:66978995"
     CDS             complement(219521..220153)
                     /locus_tag="ACHE_20094A"
                     /note="COG:G;
                     EggNog:ENOG410PGUZ;
                     InterPro:IPR017853,IPR013780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133158.1"
                     /db_xref="GeneID:66978995"
                     /translation="MTGTLFLYQGQEIGRVSAPPSYPVEEYKCIRSINHYNKVWQHTG
                     GDPVALNQALHALQKVARDHARVPMQWEDSANAGFCAASVTPWMRVLDAYREINVTSQ
                     LGRKGSVLELWKAVIRFRKQYKDLAIYGQFQAIEQHEDLLIFLKEAAGGRTSLTVANL
                     SDQPREWAFPQSFPGLKPSNLALSTSDPKGFHQSTLAAFEGRVYVSDNGG"
     gene            complement(<222676..>224396)
                     /locus_tag="ACHE_20095A"
                     /db_xref="GeneID:66978996"
     mRNA            complement(join(<222676..223076,223126..223437,
                     223490..>224396))
                     /locus_tag="ACHE_20095A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284359.1"
                     /db_xref="GeneID:66978996"
     CDS             complement(join(222676..223076,223126..223437,
                     223490..224396))
                     /locus_tag="ACHE_20095A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133159.1"
                     /db_xref="GeneID:66978996"
                     /translation="MACLGITSDPRTKNQAHILRSSTSALKNHATPTTSRQIPPTYME
                     KMVSLPAEVIQLIVTLIRDAPPPKKPRSPFGNRAKPAKLAQYTIVSRQWQEIVERMIW
                     QQINISKKGSLEQLKELTSGDSYRRARAGYIRHILWSPEINTQELHAKTQGNDDVRVQ
                     LLPDWYLQQCQSSIIDLFELLDAWKDHQTNMELSLWLSDDNYLDVGDDEEIEQEEWES
                     LNLDQLWRKGKVPNLLHLTADAIQNVPTLPYITCFRLHEVRDSNVRPSAFFRFLSHFP
                     HVQHVSSGEGRVVPRGALQALADQRQEVVDHLSLVPESVDTFTYSISAQRELSINPAH
                     NAANYISSEGLDDFSIAFRTLSTRLRELHLEGVRISSALFWPVAEEKVDAKSLYWPNL
                     EVVKVLEAPPYTADGKWIIDNDPEKDWEGDLEEDSFEPWQYDSEYYAQRGVIKSYEVD
                     RLYESMGLAVQRMPRLRELKFSFRGEIGERGSHEYLEFGRDMTTDKTTLKISTEWEYK
                     MGEKVISAWGLKDEKANEFRDTWSVSLDQWP"
     gene            complement(<227618..>230397)
                     /locus_tag="ACHE_20096A"
                     /db_xref="GeneID:66978997"
     mRNA            complement(join(<227618..227748,227797..228087,
                     228141..228369,228426..228490,228552..229031,
                     229091..229207,229259..229737,229793..>230397))
                     /locus_tag="ACHE_20096A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284360.1"
                     /db_xref="GeneID:66978997"
     CDS             complement(join(227618..227748,227797..228087,
                     228141..228369,228426..228490,228552..229031,
                     229091..229207,229259..229737,229793..230397))
                     /locus_tag="ACHE_20096A"
                     /note="COG:S;
                     EggNog:ENOG410PKHR;
                     InterPro:IPR018392,IPR036779;
                     PFAM:PF01476;
                     SECRETED:SignalP(1-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133160.1"
                     /db_xref="GeneID:66978997"
                     /translation="MGPTSTLAVLAILASRTALTAAQMQLYTPEEFTSLSSECATALS
                     GNLSCSFIETGDTMYKLTVNLTSDILDSMCTDECKTSIASYRKAVQKACASDEYDDRG
                     NSTSYVGSSGVYNPIVLPDFYFTNYDQRCLKDSQGNYCYLHLKSTDSQDECDECGLQM
                     FQAEISNGYFYNDDLAEQFSSLTSNCGVSTLSVPTATSVVLSSAIAIPTTTVCSERSA
                     TIQPGDTCDTFAAANNVSTWKVLIENGLESGCANFPSNGTLCVSGNCQTHSASLNDTC
                     MSLSSQYNITITQLRTWNPVLNPLCSNFDTLVGHEICVSYPGNATSEVNTYAMSPIGA
                     TATTAAPIPTNVVAGTNVYCGKYYSTHDNDYCQAIAMAQGINLDDFLFLNPELNKNCS
                     NLYLNYSYCIQPVGNIETYSGYSTATATGSVTAISRYTGQITGTPTAWDDLPDATDIT
                     SWTPIAIPTTAHLANGTRLDCEEYEDNTYGSIPCNWLASGASTLDFANWNPSVEFYNC
                     MLTNNTRYCTLLGDGYDLGQVTVNETKPYADTPSNAAPNATTACYSWYDTGNGTACNT
                     ILAYADITIDAFYAWNPSVGSRCSNLWLNTSYCIEGTGYDDSRYISSSSSTPAATATS
                     TSALTCVSATVTAPGETQTGIPCDCNKYFLHNTDGVYCQDIATENGITLDELYKWNPA
                     LNGDCSGLWLNYAYCVGVASSTTVPTTVSATTTISASSMTTTSAASSCATVTAPGPTQ
                     TGIPCTCNKYLMQADGVYCYDMAAEEGITLNQLYEWNPALDGDCSGLWPGYAYCVGVL
                     "
     gene            <231346..>237341
                     /locus_tag="ACHE_20097S"
                     /db_xref="GeneID:66978998"
     mRNA            join(<231346..231602,231661..231686,231743..231847,
                     231899..231925,231984..232783,232871..233393,
                     233449..233607,233666..233841,233928..236175,
                     236230..236255,236324..236590,236642..236751,
                     236806..236871,236925..236967,237024..>237341)
                     /locus_tag="ACHE_20097S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284361.1"
                     /db_xref="GeneID:66978998"
     CDS             join(231346..231602,231661..231686,231743..231847,
                     231899..231925,231984..232783,232871..233393,
                     233449..233607,233666..233841,233928..236175,
                     236230..236255,236324..236590,236642..236751,
                     236806..236871,236925..236967,237024..237341)
                     /locus_tag="ACHE_20097S"
                     /note="CAZy:GH18;
                     COG:G;
                     EggNog:ENOG410PVH7;
                     InterPro:IPR036861,IPR011583,IPR029070,IPR001223,
                     IPR017853,IPR001002,IPR001579,IPR018371;
                     PFAM:PF00187,PF00704;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_function: GO:0008061 - chitin binding [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133161.1"
                     /db_xref="GeneID:66978998"
                     /translation="MRISNFLGLSLWIAEATAAHGNLRHAYLHDKHHSSSSTTSVTTR
                     PTLPAPAKHVLTRRAPENDDYTCGPNKPCKNKACCGKNNVCGFGDLYCGDGCQSHCDA
                     KAECGRDAAIPGQTCPLNICCSEFGFCGTTSEFCGSGCQSNCKDPNRPTGGSSSDVRN
                     KIIGYYESWRAVGQKCGMMTPEEIPVEYLDQVNMAFVYIDPDDYHIIAMDDEPFATDL
                     YKRVANIKTRNPSAEVWVSVGGWTFNDPGTYQSVFSTIASDKDKTNKFAGHLMEFMDK
                     YGFDGVDLDWEYPGADDRGGKDEDVKNYVSMMKILKKNLKSGNDYSKKWGISITVPTS
                     YWYLRWFDIEGLESQIDTFNLMAYDLHGTWDSDDPIGPYVYAHTNLTEIEMALDLFWR
                     SNINPSKIVLGLAFYGRTYELSTPLCATSGCEWKNPGPKGKCTGTAGILSYSEIKDIM
                     SDSNINPTYDEDAGVYYMTYGKGGANWASFDDAVSFQAKIELANSFGLGGVLVWAIDQ
                     DDKFYNALRGVTGKDVEPAIDPQEGYGAFTLDQCYITNCGESCTKGDVLMTKLNEDES
                     GRGCSGKDHNARSFCCPAVNAPDSSDCYWTGGPVNCHGQCAAGEVTMVLDDWGNSKKR
                     CTNGGKKAWCCPATNGQKAIQECELATPNKDCPSDKPQEMTSVYWSADVGLGYELSYE
                     QKFCCPEKPAYDSNKCGWHGENHYCNDSECPVGQVELFRWHGSHSGPPKSAKGCNKGR
                     QQAFCCPPPLSDGSAFLPVPLENLFPTGDSFSDSVTTTFSEAFDENSDETSFGVSGTD
                     PNKKAFAWTIIVGEEEDVQSFVKRDGSHLELFECPDTHEDDFDVQKAKAVCVGGSEEN
                     NNCEDILKGGVEGTVVRLPAHCGPDDWVRAVRFERSMNQTLPGHLQKRHPSARNVYDF
                     HYDYNFQQLRRDGGEVYFRTDFSTHPGYWDEVVAASHDSSLTKRSAENWRELDRRFWA
                     ENDKESWLKRFNDLLTQGDTGLKKHYEFNQCLFHSEAKCANAQADTSAFLYGELNTTM
                     DFGTTLIGKLRNFQFTEAFSFFNQEGFSMRAGAGIRAQARLYFDSGWHSIGEFDAFGM
                     DLNLKGIFSIKPYFAVDARVEADAYLSTQATVEMKISHDRFRYYLPDSLGSNPTQITG
                     SYNLDTTTGPISGFGNIDARAGGGIVFGFKPKIAMDIDLQFRGSQYVNTSVELSTPGS
                     IRIDAALASGCSNGMQFDVTGQMDVDFAVKNGLPGWSSKSYTFKDNPAKKIYSGCVPF
                     SVLAKRELEAGNGPELTSRSTTGSDLTLPKQSNNLCAFSTNGIYCADPEENDDPSPNC
                     DLNDLSYLNDSDDDGDATLTRRGHLEKRSKKELDYCYGKTEAEGLGYQGFGTGAASYS
                     TIHFSDYPSSTELVEDYDSNAPTYDNADPQDCNNFELVKLDKTPQKPYPSKEEKKKGA
                     REYHSEHVLEAQTVQRFFNALGMAWSNLKKGPQNPNAKLYQTPKKGDTETIPWCAYMK
                     LWWNLRRNDNANNMLGSVYPGYDGHYTDEFVLYESALNSKVKQGWFSGNQLTGASKID
                     KQIDKGEWSEVAKTLKLHIVAWKYYYVDEIKNTLVKQADRVEDALRELEGTGEHSIHA
                     KVGDNDGDYDKDYIPQNLAAHWRSWVQEEHERVQLEVRRFLNKYAKKAYDLNRPEPDD
                     NDDAMIDPGQAIQKNADIVKIFETAWSEVQKLETWTIPWDGDSMDTSD"
     gene            <240116..>241967
                     /locus_tag="ACHE_20098S"
                     /db_xref="GeneID:66978999"
     mRNA            join(<240116..240203,240275..240945,241006..241316,
                     241368..241801,241855..>241967)
                     /locus_tag="ACHE_20098S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284362.1"
                     /db_xref="GeneID:66978999"
     CDS             join(240116..240203,240275..240945,241006..241316,
                     241368..241801,241855..241967)
                     /locus_tag="ACHE_20098S"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133162.1"
                     /db_xref="GeneID:66978999"
                     /translation="MAFFRNIFGVATHPPARGVPSSRSHPRVMEDPFRCPRTETVREL
                     ARILDDEQVVLVRGTPTSGKTTLAKLLDEYYERHDVPSVLIRSWPKDGYNLYTDILIQ
                     RARRKGHTFVTENNIDNCNIVFIIDEAQMSYHDQTLWLEFIKPQISRLHGPRICLFCS
                     YGSPTGGATNFDAGSPVGFIGIQKRVSLTVSNIRYAPSICLFYNRAEFDDVIHRLCAD
                     IRRPLPLDDEARDYIFDLTNGHPGAVEAVIDILKRVYHSQIKHEGITVGVDHIASLLD
                     DEESSFDLLALTGFMRCFPPRNVDTATANVLRAVLANQNVPLDRDDKGTEICYKNGWL
                     HAEPLDIDAQTIVCIFPTKLHLKFVEYYLTGSSAPFPYQKFPSIESLAETVLRGFSLR
                     NLASAARLGTGVAVRPVEASYQDEFYRSLQQVLGFSAKVTSEWTGDKDNRIDFRIDDP
                     RWGIKLLRDGNRLGEHCDRFVGNGRYTPWIQSGLLQDWLVIDCRTSFPREYRVPGTKL
                     WRAVFASDYTSVRILDASNQIVVDEFSLMS"
     gene            <246839..>247258
                     /locus_tag="ACHE_20099S"
                     /db_xref="GeneID:66979000"
     mRNA            <246839..>247258
                     /locus_tag="ACHE_20099S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284364.1"
                     /db_xref="GeneID:66979000"
     CDS             246839..247258
                     /locus_tag="ACHE_20099S"
                     /note="COG:S;
                     EggNog:ENOG410PZS0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133163.1"
                     /db_xref="GeneID:66979000"
                     /translation="MARWLEENTCIGDNTIFYTTPANERDAEQFSNQVGGTYYGVLID
                     QRMKKVNGATEDGIFWKWVDACGGTPEEENKVAHHVSQALAMKATGPTYLMLPKGATP
                     KPSSFWLVDEWPMLKKRGIKVTQVQPQTFDQTPYNGP"
     gene            complement(<247535..>248311)
                     /locus_tag="ACHE_20100A"
                     /db_xref="GeneID:66979001"
     mRNA            complement(<247535..>248311)
                     /locus_tag="ACHE_20100A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284365.1"
                     /db_xref="GeneID:66979001"
     CDS             complement(247535..248311)
                     /locus_tag="ACHE_20100A"
                     /note="COG:M;
                     EggNog:ENOG410PZYC;
                     InterPro:IPR002110,IPR036770,IPR020683;
                     PFAM:PF13857,PF12796,PF00023,PF13637,PF13606;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133164.1"
                     /db_xref="GeneID:66979001"
                     /translation="MKAKDEQLFQAASTGNLSTISSILAEYSPPPETLQQTIVKAIYP
                     NANLSVVTELLHRQFPDLPLSEDMIRWSCYTGSIPIAEAILAKDPQAYTGSFDDESGT
                     PMVLAVQSRKSYEFLSYLLSHGADPFLHHGRYAPLFPAAVLRYHGGLDAVAAMMDHGV
                     NLQHQNILLGAVSHGYLELARYLLAHGVTPENDQSMDNQSKVPVLHIAVSNGDIRMVQ
                     LLLEYGARVDVKDDQGLTTVQVAEKMQHSKIIELLKASLC"
     gene            complement(<253268..>254620)
                     /locus_tag="ACHE_20101A"
                     /db_xref="GeneID:66979002"
     mRNA            complement(join(<253268..253598,253658..253852,
                     254075..254115,254170..254377,254442..>254620))
                     /locus_tag="ACHE_20101A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284366.1"
                     /db_xref="GeneID:66979002"
     CDS             complement(join(253268..253598,253658..253852,
                     254075..254115,254170..254377,254442..254620))
                     /locus_tag="ACHE_20101A"
                     /note="COG:S;
                     EggNog:ENOG410PV9D;
                     InterPro:IPR021842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133165.1"
                     /db_xref="GeneID:66979002"
                     /translation="MTPPPLPPANPDEHQYWTDPILCEETRTRLEHFRNLGWLPPNYK
                     PKTLEGLAVVERYWRRYCAHSNEDYVEYLLSEDKAIYMNFLDWMSRTSREKRLQTYDE
                     YWRRLCQYFGLFARQPVNHHVHEQMRRYLEQVFPAERKISCPRKRKRGDSFKSDLPQR
                     ISSDDLPNTICYRDIELFYLRDPDGGRDVLCAIIEFHNLKGRPEGADGTKFFMHGDYQ
                     LAYCPIAQIVSLAFRDDAFENELTSELIWRIKVPKRTRALPLRWKKDKLNLPLLRRVV
                     RTPYGYGVHPTLPMTYDSSRLALKDLGEDRGFEDNLGHYNF"
     gene            complement(<255704..>256011)
                     /locus_tag="ACHE_20102A"
                     /db_xref="GeneID:66979003"
     mRNA            complement(join(<255704..255899,255977..>256011))
                     /locus_tag="ACHE_20102A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284367.1"
                     /db_xref="GeneID:66979003"
     CDS             complement(join(255704..255899,255977..256011))
                     /locus_tag="ACHE_20102A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133166.1"
                     /db_xref="GeneID:66979003"
                     /translation="MSRRGSSRARSSSSQVSLQRVATANSHEQYQNTELQNLEEELKI
                     NNLKAELLAKQIEIKKRERELRELELENGGQH"
     gene            <262612..>262917
                     /locus_tag="ACHE_20103S"
                     /db_xref="GeneID:66979004"
     mRNA            <262612..>262917
                     /locus_tag="ACHE_20103S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284368.1"
                     /db_xref="GeneID:66979004"
     CDS             262612..262917
                     /locus_tag="ACHE_20103S"
                     /note="COG:S;
                     EggNog:ENOG410PVJY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133167.1"
                     /db_xref="GeneID:66979004"
                     /translation="MGVGIVSSMEHFNNRGFAEQHGPITKVVVWAWDRMDGFEIWYGG
                     VGIRRLRVSLKSAKVSLWFAFLDISTNISIQFNSSSAVIPKVMYVYGWGSSEGIEQF"
     gene            complement(<270162..>270916)
                     /locus_tag="ACHE_20104A"
                     /db_xref="GeneID:66979005"
     mRNA            complement(join(<270162..270742,270793..>270916))
                     /locus_tag="ACHE_20104A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284369.1"
                     /db_xref="GeneID:66979005"
     CDS             complement(join(270162..270742,270793..270916))
                     /locus_tag="ACHE_20104A"
                     /note="COG:S;
                     EggNog:ENOG410Q05F;
                     InterPro:IPR012337,IPR008906;
                     PFAM:PF05699;
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133168.1"
                     /db_xref="GeneID:66979005"
                     /translation="MHQPSTSPTSELEMLLNSTTPRSQHSQTRKNNDELTQYLERGLV
                     YTPPRLFWKEHELEFPALSSLARDILSIPASGAGVERLFNSARDICHYRRGNLKSDTI
                     KDLMMYMCTSKFEIKQEELDLIKEYLSAGEITGIEEEKALSQPQEDLEPISDNEEDDI
                     LYNSQPAAPSERALGKRCRSISSEPRDEIDHELDDDDGDHPLPNIPEEKSSMQARSRR
                     VRKQPKMPAGFEIDRY"
     gene            complement(<273129..>276908)
                     /locus_tag="ACHE_20105A"
                     /db_xref="GeneID:66979006"
     mRNA            complement(<273129..>276908)
                     /locus_tag="ACHE_20105A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284370.1"
                     /db_xref="GeneID:66979006"
     CDS             complement(273129..276908)
                     /locus_tag="ACHE_20105A"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR021109,IPR000477,IPR000953,IPR036397,
                     IPR023780,IPR012337,IPR041373,IPR043502,IPR041588,
                     IPR001584,IPR016197,IPR043128;
                     PFAM:PF17917,PF17919,PF00078,PF00385,PF17921, PF00665;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133169.1"
                     /db_xref="GeneID:66979006"
                     /translation="MDTQRATELVKFFGIPTRQLNTPIGTKGYDGRAGSTITDAIVCH
                     LLVGKRRFLNQPFLIADLGQHDMIIGRKWFDSHDVWLNVKHRKLVWPEQRSCLDDIQS
                     KQYLEAPKQILQRPKPDPTHQADMERRDRRIEKEEQKEQYRVPRKEEADRRSDMAKMS
                     RALQGQEISTITTNSKPQGRTTDRSAIQIDIAAIGAAPFQRHLKRKDTEVFIASLSEI
                     DRIIEEKREKERQKEDHNEQELVQQLLPRQYQEYADVFSKAASDELPPQRTNDYRIEL
                     EEGKTAESEVGYSPLYKQTAEELEAARDYIVDNLHKGFIGPSAAPFASPILMAQKPGG
                     GLRFCVDYRKLNAITRKDRYPIPLVDELMERTSGAKIFTKLDIRQGFHRIRLDPKSED
                     LTTFRTRYGTYKYHVVPFGLTNGPAAFQRFINDTLMDYLDDFVTAFVDDLLIYSKNAI
                     EHELHVKKVLERLRAAGLQASIKKCEFHVTRTKYLGFILTTDGIEVDPEKTAVICNWA
                     VPTTVRGVQSFLGFCNFYRRFIKNYSRIAKPLNHLTRKDVPFTWTNVCQEAFEELKKY
                     LTDAPILRHYHPELETKLETDASDGVVAGVLSQKHGDLWHPVAYYSKNMSDAERNYEI
                     HDKEMLAIIRALQEWRAELEGLQLRERFNIYTDHRALEYFMTTKKLTARQARWAEFLS
                     RFYFLIRYRPGRENTLADALSRPVTDIQKKDEYRHQILLKPETVEAPIQVNDLEPALQ
                     VVDQILKANRNSATAEGYHKKAQEGKDDWTLQDGLLLKGNRLFVPDDDPELRTRLLDE
                     VHAQVSTAHPGRTKTQQLIRARYYWPTWRQDAERYVRNCSKCRRAENPRDHVPGLLQP
                     LPIAERPWQHISMDFRSFPVDKNGYDAALVIVDRFSKRPISIPCKKTATSEDVARMFI
                     KHVYRHRGPPSTIVSDRGPQFVSAFWDELCRILGVQLKLSTAYHAQTDGQTEIVNQHI
                     VNRLRPFINRYQDNWSDLLPMIDFAAATLPSETTEASPFLVDCGYEPRTSFDWISIEG
                     SPPRDEKISRQRAQGTAKKMKNIWTAVAEQIKHAQDQQRKQADRRRRPVDFDIGDKVW
                     LSLRHYQTDRPNKKLDSQMAGPFPILERVGNSYRLELPDSMKIHPVFSPDKLRRAAND
                     PLPGQMTEPPEPIVVADEQEWEVEEVLASRLCRRRLQYQVKWIGFDEDRTWYPATNFK
                     GSPHRIRDYHQKYPDRPGPPCRLQEWLKAWEEGVDEIEDHPDDNMPTQSLGTDSA"
     gene            <283050..>283804
                     /locus_tag="ACHE_20106S"
                     /db_xref="GeneID:66979007"
     mRNA            join(<283050..283173,283224..>283804)
                     /locus_tag="ACHE_20106S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284371.1"
                     /db_xref="GeneID:66979007"
     CDS             join(283050..283173,283224..283804)
                     /locus_tag="ACHE_20106S"
                     /note="COG:S;
                     EggNog:ENOG410Q05F;
                     InterPro:IPR012337,IPR008906;
                     PFAM:PF05699;
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133170.1"
                     /db_xref="GeneID:66979007"
                     /translation="MHQPSTSPTSELEMLLNSTTPRSQHSQTRKNNDELTQYLERGLV
                     YTPPRLFWKEHELEFPALSSLARDILSIPASGAGVERLFNSACDICHYRRGNLKSDTI
                     KDLMMYMCTSKFEIKQEELDLIKEYLSAGEITGIEEEKALSQPQEDLEPISDNEEDDI
                     LYNSQPAAPSERALGKRRRSISSEPRDEIDHELDDDDGDHPLPNIPEEKSSMQARSRR
                     VRKQPKMPAGFEIDRY"
     gene            <289680..>290117
                     /locus_tag="ACHE_20107S"
                     /db_xref="GeneID:66979008"
     mRNA            join(<289680..289891,289979..>290117)
                     /locus_tag="ACHE_20107S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284372.1"
                     /db_xref="GeneID:66979008"
     CDS             join(289680..289891,289979..290117)
                     /locus_tag="ACHE_20107S"
                     /note="COG:S;
                     EggNog:ENOG410PR4A;
                     InterPro:IPR001480,IPR036426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133171.1"
                     /db_xref="GeneID:66979008"
                     /translation="MPHPHNTLGNDEWLLTGDSLWSENGVYEFRMQDDGKVVVYENGN
                     PRWQNTKQQRSDVKGVQMQADGNLVIYTHDGEAVWHSNTAPGKDVILVIQNDGNLVLY
                     KGNPVWASSTTPSA"
     gene            complement(<292478..>292909)
                     /locus_tag="ACHE_20108A"
                     /db_xref="GeneID:66979009"
     mRNA            complement(<292478..>292909)
                     /locus_tag="ACHE_20108A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284373.1"
                     /db_xref="GeneID:66979009"
     CDS             complement(292478..292909)
                     /locus_tag="ACHE_20108A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133172.1"
                     /db_xref="GeneID:66979009"
                     /translation="MDDWAEDRDPDFEDGQNALVHGGKLPSDVKTIRLFASLEPERVT
                     RWKVVFKRFYGMPFERIDPVIHTLPDVLVDVMNKRASVHWLKKWRRPSNRDRQSTIIS
                     IANDFIRCFCEKGATGVTDQSMAAKFEILKESWLIGMTQMR"
     gene            <295736..>296283
                     /locus_tag="ACHE_20109S"
                     /db_xref="GeneID:66979010"
     mRNA            join(<295736..296111,296174..>296283)
                     /locus_tag="ACHE_20109S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284375.1"
                     /db_xref="GeneID:66979010"
     CDS             join(295736..296111,296174..296283)
                     /locus_tag="ACHE_20109S"
                     /note="COG:S;
                     EggNog:ENOG410PPVP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133173.1"
                     /db_xref="GeneID:66979010"
                     /translation="MPQRLPARFDSLPKLCKEILKKFSMMNLRHSAETEAQYRREFYT
                     GFSHVAGQGVPITSEWSTSKDGRVDFYIPEREWAVKLLRDHDRVDQHISQFKEGGKDR
                     PWLKEEMVKDWIIIDCATSLPTKKFSEPRLWHAVFINDHSELRLYDHQQALTMSVHLR
                     N"
     gene            complement(<297920..>299263)
                     /locus_tag="ACHE_20110A"
                     /db_xref="GeneID:66979011"
     mRNA            complement(join(<297920..297954,298012..298252,
                     298303..298622,298682..299019,299079..>299263))
                     /locus_tag="ACHE_20110A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284376.1"
                     /db_xref="GeneID:66979011"
     CDS             complement(join(297920..297954,298012..298252,
                     298303..298622,298682..299019,299079..299263))
                     /locus_tag="ACHE_20110A"
                     /note="COG:T;
                     EggNog:ENOG410PMT2;
                     InterPro:IPR000719,IPR011009,IPR008271,IPR017441;
                     PFAM:PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133174.1"
                     /db_xref="GeneID:66979011"
                     /translation="MPSPGPPLPPGILVDEETSPVYDSKYFYPAKPGEVLADRYQTLA
                     KVGWGVSSTVWLAHDLQGHIEEPEGVVALKIANNNASSAGHEREVEEHISTADPSHRG
                     RSLIRTLIDSFEVKVPEGSYSCLVYRPMREPLSMYQRRFDDRKMPLPVIKTYIRALLT
                     GLVYLHEECRIVHTDLKLENIMVSFEDPTVLADFMDSQLEKPMAFKIDSAGRPVYQSR
                     NDFGPLKGLRSIPQLVDFGLATRLDEDDDWGVWPIQPDHYRAPEVILGNGWQMPVDIW
                     NLGVLLWDMIEGKELFRHIHNQQGRYDAKLHIAEMIALLGPPPPEVIQRYQYMREYSW
                     LEPVRREDDRVCETAEEYFCGPFFDNNGCFLYEDLIPD"
     gene            <300063..>301213
                     /locus_tag="ACHE_20111S"
                     /db_xref="GeneID:66979012"
     mRNA            join(<300063..300599,300656..300842,300895..301008,
                     301071..>301213)
                     /locus_tag="ACHE_20111S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284377.1"
                     /db_xref="GeneID:66979012"
     CDS             join(300063..300599,300656..300842,300895..301008,
                     301071..301213)
                     /locus_tag="ACHE_20111S"
                     /note="COG:Q;
                     EggNog:ENOG410PJKV;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133175.1"
                     /db_xref="GeneID:66979012"
                     /translation="MAPYGAETTATQLVNDYADLIKGKVVLTTGISPGSLGGYFVQAI
                     AKAGPSCLILAARNPDKAQQTANEVSAAQPTVKTRILQLDLGLFKNVRRAADEVNSWD
                     DVPVIDVLVNNAGIMAPEYKATDDGFESQLATNHLGPFLFTNLIMEKILASKSPRVVM
                     VSSDGHRLNPFRFDDYNFDDGKSYNKWYAYGQSKTANMLMSISLAEKLGIKHNLLAFS
                     LHPGVIWTNLANHLDMETDFDGLRVADRTLGNREGWGEFKVKTLDQGVATHVYAAFDL
                     GLNAHNGAYLIDSRIGNPIADTIKSWATSSLEAKRLWSLSEKLVGQEFPY"
     gene            <302940..>303887
                     /locus_tag="ACHE_20112S"
                     /db_xref="GeneID:66979013"
     mRNA            <302940..>303887
                     /locus_tag="ACHE_20112S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284378.1"
                     /db_xref="GeneID:66979013"
     CDS             302940..303887
                     /locus_tag="ACHE_20112S"
                     /note="COG:E;
                     EggNog:ENOG410PVP2;
                     InterPro:IPR036052,IPR001926;
                     PFAM:PF00291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133176.1"
                     /db_xref="GeneID:66979013"
                     /translation="MRFPPTSVPTSLELIGNTPVVRLRHVVPDNCARVFLLMESFNPT
                     GSYKDRMAKSMINETERQGHLRSGMTVVEATGGSTGSSLSFVCAVKRYPFHVVSSNAF
                     SVEKLRTMTAFGANLDLIHTPTGKVTPDLIPSMIRRAEEVSEAKDYYFTNQFKNRAAL
                     LGYETIGHELVQQFPEGIDLFCGAVGTAGMMMGVARALKEKWPETHVAVLEPASSPTI
                     TESRPGTHHVEGIGIGYIPPHLDRQLYDEALRILEHDGRSMCCRLAKEEGLLVGTSTG
                     LNVVAAIKLAKEIGPDRTVVTVAADTGLKYLNGSLFANG"
     gene            <307676..>309362
                     /locus_tag="ACHE_20113S"
                     /db_xref="GeneID:66979014"
     mRNA            join(<307676..309199,309255..>309362)
                     /locus_tag="ACHE_20113S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284379.1"
                     /db_xref="GeneID:66979014"
     CDS             join(307676..309199,309255..309362)
                     /locus_tag="ACHE_20113S"
                     /note="CAZy:AA3;
                     CAZy:AA8;
                     COG:E;
                     EggNog:ENOG410PKE9;
                     InterPro:IPR012132,IPR036188,IPR000172,IPR007867;
                     PFAM:PF05199,PF00732,PF13450;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133177.1"
                     /db_xref="GeneID:66979014"
                     /translation="MRFRQTSSLVAAAIGVMSSAAAFENNAYDYIVVGGGPSGIIAAE
                     RFVEAGHKVLLLERGPGSTVSTGANNTLRWDHNLTPIDVPGLSGDIATYDLWNEYLCT
                     DTAGYASCALGGGVSINYMVFVHPPDHDFNDKWPQGWKWEDVAPAAERLYQRNPGSTL
                     PSADGKYYDQGLYNVFSNFLDNLGWKSVDMIAQPNEKHQVYSHPAWNIKDQMRAGPVR
                     TYLPLIQHNDRFTLSLGTKVIRLVRSGSQVTGVEVETASGQTEIITLACNGRVVLASG
                     ALSTPRVLFNSGIGPKAQIETAQKSGVTVPSQEEWIDLPVGVGLKDHNIFSLTVKTNG
                     TFGLLDSSSVLNGSDVANISQYKKHNGVLTQGKHRLIFHTSNEVDGQTRYYQGSCAPD
                     DDSTISLSVYMTHGLTSSGILGINEKGKTVTEKSPYMQTAGDRKAARIFIQQLVDDLT
                     APSTGFKLESYTNVSAVVEAHSPGGHYTGTARLGTDDGRNGGSAVVDTNAKVYGMDNL
                     YIVDASIHPDVPTGNTMAITMVVAEAAVSKILAQN"
     gene            <310073..>310905
                     /gene="NNT1"
                     /locus_tag="ACHE_20114S"
                     /db_xref="GeneID:66979015"
     mRNA            join(<310073..310216,310279..>310905)
                     /gene="NNT1"
                     /locus_tag="ACHE_20114S"
                     /product="nicotinamide n-methyltransferase"
                     /transcript_id="XM_043284380.1"
                     /db_xref="GeneID:66979015"
     CDS             join(310073..310216,310279..310905)
                     /gene="NNT1"
                     /locus_tag="ACHE_20114S"
                     /note="COG:S;
                     EggNog:ENOG410PNHF;
                     InterPro:IPR029063,IPR019410,IPR025784;
                     PFAM:PF10294"
                     /codon_start=1
                     /product="nicotinamide n-methyltransferase"
                     /protein_id="XP_043133178.1"
                     /db_xref="GeneID:66979015"
                     /translation="MADEIDVGDIFHDPEGYYPPEKEPTFAEHHMLSGQTVRVRLVGS
                     HPLYGDLLWNAGRTSSHYLEQHRDLVDRKNVLEIGAAAGVPSIVSAILGAKTTVMTDY
                     PDPDLVENMRYNAELAAPSIDSSKSSLYVEGYKWGNTVEPLVAHLPDNQTTFDTLIMA
                     DVVYSHREHPNLIKTMQMTLKKSPEAVALVIFTPYEPWLLPKTEKFFPLAEENGFTVT
                     KIFQKLMDDVLFEDDPGDETLRKTVFGYELRWAPERLN"
     gene            <311126..>312429
                     /locus_tag="ACHE_20115S"
                     /db_xref="GeneID:66979016"
     mRNA            join(<311126..311131,311186..311530,311590..>312429)
                     /locus_tag="ACHE_20115S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284381.1"
                     /db_xref="GeneID:66979016"
     CDS             join(311126..311131,311186..311530,311590..312429)
                     /locus_tag="ACHE_20115S"
                     /note="BUSCO:EOG09263L9T;
                     COG:F;
                     EggNog:ENOG410PNHT;
                     InterPro:IPR027417,IPR013641;
                     PFAM:PF08433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133179.1"
                     /db_xref="GeneID:66979016"
                     /translation="MPLIILSGYPSSGLTHRATQLASLLQKTQDDLFASGAIDPSRPR
                     YKVTVVPTHDASHPRSVYDNARTEKMARGVAYARAKRALGKDTFVILDGMNYIKGYRY
                     QLWCEAKAVGTTCCVVHVGTPIEQCRANNEAKLKRQAEKTPEQESSGDPSEDEGYPPE
                     LLENLIFRYEEPSTHSRWDKPLFTVPYFDAEPPIADIWTALTGIPHPSATAPQTSSIT
                     PAPTASIKTTSDTDSIATGATGAPGTGLLTRTRPKIKPHAATVLPTATDSSALYSLEK
                     RTSAIISSIRTFTLSNPFATAILSNLPPNAPNGITIEIPDVSTPIFIPAHVAALGSTD
                     ELAGAGGVLALPRLQRLKRQWIGLNRAYVGNYSGGKGGALREEEVGGAFVRFLNAEFA
                     GEGS"
     gene            complement(<312945..>313286)
                     /locus_tag="ACHE_20116A"
                     /db_xref="GeneID:66979017"
     mRNA            complement(<312945..>313286)
                     /locus_tag="ACHE_20116A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284382.1"
                     /db_xref="GeneID:66979017"
     CDS             complement(312945..313286)
                     /locus_tag="ACHE_20116A"
                     /note="TransMembrane:2 (o19-40i47-65o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133180.1"
                     /db_xref="GeneID:66979017"
                     /translation="MHTSLGSIHVSNMTTGIRPYKYCLSLSFFTFYFSFVDALFSRSF
                     DHFLCLINFTFTIVLSLFSSFDSNIEIDILDKNTPESYKARDTQKPGQPRPDKKKKKE
                     KETTKKGGKQK"
     gene            complement(<313721..>315526)
                     /locus_tag="ACHE_20117A"
                     /db_xref="GeneID:66979018"
     mRNA            complement(join(<313721..314360,314418..314666,
                     314718..>315526))
                     /locus_tag="ACHE_20117A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284383.1"
                     /db_xref="GeneID:66979018"
     CDS             complement(join(313721..314360,314418..314666,
                     314718..315526))
                     /locus_tag="ACHE_20117A"
                     /note="COG:S;
                     EggNog:ENOG410PPUY;
                     InterPro:IPR013087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133181.1"
                     /db_xref="GeneID:66979018"
                     /translation="MSHIQTDSRRLALSQTALRNMDQFSQPRHAPIGFTNLASLKVED
                     DDLSSQDNYSLCSSTNAHGNPWSLSDADVEAGPVSKAESPEVQMLSFNFSQQLVPSTV
                     GPSEVMYQPGSDFQVIQDNEMDFSQSRGDFNAYSAFLDFSAFDNDSSVHNGSQSCTDD
                     SLSVGHSSHMDDGQMSANDAWNSMLHRTSLDGLPSSIFQTAPVSPPLTEASNDFSVTS
                     SCSQSGYPSFMTQDDAMLKDVTATPSLSSHGINLGDPLFPLTPPLNEQDPNRTIRPSK
                     QARRPALQTPPQQMKQEEFFHPLPARRGSKDSTDMKNPRDHPYYSLPTNSDGKYYCPF
                     GNGEKPCSHPPTTQKCAYHKYLDSHLKPYRCKVPACMDAQLQFSSNACLFRHEREAHG
                     LHGHGDNPHLCLFEGCDRSVPGYGFPRRWNLYDHMRRVHDYTSSEHPSSPETSPTSST
                     SSHASKKKENLGRKKRVLGPSGTTTMKRTRSTSQTSAIKAAHQATAHHGQRLQNAERN
                     YYNCRSRLLEEISKIMPQDSGMHEKVNASLQELITLGLNYRHIEASQTAAKLASGLA"
     gene            <320808..>322599
                     /locus_tag="ACHE_20118S"
                     /db_xref="GeneID:66979019"
     mRNA            join(<320808..320993,321055..>322599)
                     /locus_tag="ACHE_20118S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284384.1"
                     /db_xref="GeneID:66979019"
     CDS             join(320808..320993,321055..322599)
                     /locus_tag="ACHE_20118S"
                     /note="COG:S;
                     EggNog:ENOG410Q1GQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133182.1"
                     /db_xref="GeneID:66979019"
                     /translation="MNWTGGRLQRHSKDPSTLQKQRFAKPRSRDDDAQVPEIFQSQFH
                     VPKSQKRTLSGEPDSRDQPSRNLHGLSNPPACASNEPPQALSRLDRIKRQLLGTNDWA
                     AIGVTRPVKMPFRSIEELERFGKRRKLTEADHNRLVPSGGRISHPRPRQGPRERASSE
                     FGMIGKVDIRIHRPWDSPESSSNGRNKNSNESSQPMLLDREDSDLVDRSLSTDGGAYS
                     PSKGRTISSQLLLSSQNLPRKSPSLAPSDIVLPIESVSQEQEQQYANLFGPHPYPQPS
                     RSLMRLDSYTPSLHQPVPQFPRRFTIDDQIAAELEAQPSREMRDKAQLQLSDAGDSYA
                     ASECSSKRMHDEYGLSAAAGTQFISSNQFSGWLPEPKHHVQQFVGQEDPSANTSHTVT
                     VSETVDRGQPTYDAELGLRMNASGSYTSPIKIFDHSVGLNETMEDIQNSQQPVYNTNP
                     RFNPPQSYMTPSPQHARPQEEFDPERYMLNGSIKRAMNQAFNDRPRKDFEPYRNTLFT
                     PFRQRISRQPDVNNLNFVNDVVEQQTVYEQYLSTSTSSKQEATDSRQRFIATSSPNLL
                     STERTYRKPF"
     gene            <323145..>324666
                     /locus_tag="ACHE_20119S"
                     /db_xref="GeneID:66979020"
     mRNA            join(<323145..323297,323357..323395,323457..323546,
                     323603..324243,324292..324364,324414..324460,
                     324516..>324666)
                     /locus_tag="ACHE_20119S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284386.1"
                     /db_xref="GeneID:66979020"
     CDS             join(323145..323297,323357..323395,323457..323546,
                     323603..324243,324292..324364,324414..324460,
                     324516..324666)
                     /locus_tag="ACHE_20119S"
                     /note="COG:E;
                     EggNog:ENOG410PM1T;
                     InterPro:IPR004839,IPR000796,IPR015424,IPR015421,
                     IPR015422;
                     PFAM:PF00155;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0008483 - transaminase activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0006520 - cellular amino acid metabolic
                     process [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133183.1"
                     /db_xref="GeneID:66979020"
                     /translation="MFENVQQGPVDPMFVLKRDADSDASPDKVDLGVGIYRNTEGKYH
                     EMGVLREAKRILEQNNPGHDYESTTGKPAFLKDAAAVMFGEECEALNDGRITSVQTIS
                     GTGANHLAALFLARCAGSKQNTVYVGTPTWGNYEPLCSLVGLQVVKYRYYDPETATVD
                     FTTLLNTVSSAPPNSIFILQGCCHNPTGADLTPSQWDALAEAMKKANVFPFLDIAYQG
                     LGGSMDEDAYPIRLFTEMGFEMVVCQSFSKNLGLYGERCGVLHVVNSNAAIASRVYDQ
                     LRCLIRWEFSSSPAYGSRLASIAMGPDLKGQWSDELVAMRSRLLDNRQKLYQALQNTP
                     GNWDVILTTKGLFACLPLNPLQCQQLRTTHHIYLPDNGRINVSGLNPTNVNQVAAAID
                     SVTRI"
     gene            <326344..>327375
                     /locus_tag="ACHE_20121S"
                     /db_xref="GeneID:66979022"
     mRNA            <326344..>327375
                     /locus_tag="ACHE_20121S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284387.1"
                     /db_xref="GeneID:66979022"
     CDS             326344..327375
                     /locus_tag="ACHE_20121S"
                     /note="COG:G;
                     EggNog:ENOG410PMHB;
                     InterPro:IPR030294,IPR002472,IPR029058;
                     PFAM:PF02089;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0008474 - palmitoyl-(protein) hydrolase
                     activity [Evidence IEA];
                     go_function: GO:0098599 - palmitoyl hydrolase activity
                     [Evidence IEA];
                     go_process: GO:0002084 - protein depalmitoylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133184.1"
                     /db_xref="GeneID:66979022"
                     /translation="MYSLPLLLPFLIAPSATLPHQQTNSHPETKSPDLTPLPLVIWHG
                     LGDSYQSSGLSEIASLAASTNPGTYIHIIHLSDSSTGDRQASFLGNVTEQVDFVCEQL
                     SSEPIVGTAPAINALGFSQGGQFLRAYVERCNDPPVRNLVTVGSQHNGISEFQECMAL
                     DLICKGAEALLHAGVWSDFVQGRFVPAQYFRDPRDEESLGKYLESSNFLADINNEREG
                     SRNEAYKKNLKKLNKFAMLMFEDDSIAHPKESAWFAEVNGTTGEVTPLRERDVYKEDW
                     LGLKELDEQGKLDFLALPGDHLQMEDKQLVRLFQDYFGPVEVDLPDVMPAKGAKGAKH
                     AEKVLVQQY"
     gene            complement(<327873..>331388)
                     /gene="EFR3"
                     /locus_tag="ACHE_20120A"
                     /db_xref="GeneID:66979021"
     mRNA            complement(join(<327873..331098,331174..>331388))
                     /gene="EFR3"
                     /locus_tag="ACHE_20120A"
                     /product="plasma membrane localization protein"
                     /transcript_id="XM_043284388.1"
                     /db_xref="GeneID:66979021"
     CDS             complement(join(327873..331098,331174..331388))
                     /gene="EFR3"
                     /locus_tag="ACHE_20120A"
                     /note="COG:S;
                     EggNog:ENOG410PJMM;
                     InterPro:IPR039786;
                     go_process: GO:0072659 - protein localization to plasma
                     membrane [Evidence IEA]"
                     /codon_start=1
                     /product="plasma membrane localization protein"
                     /protein_id="XP_043133185.1"
                     /db_xref="GeneID:66979021"
                     /translation="MESMRQSCRPKHQVLILKCFPQYQKGVQEVKPNASELSYLLYYV
                     STRRSKLTKVCSFLEKRAARDVWRRKLGNVQVTLQILTALMEKVPRDLPIYARYVLSV
                     IDIVLRSEDISMVEDSIATFETFCQYQDMASLAAEQELSTQYQGVVRTYASYADTKSS
                     SQKTASISPMSIRWRNAGLRAIRGVVGSDETLATDGGDSLKLILPVILENLYTGEEDV
                     LVLLQLKSQEPEKTQPELAPRRRVSVATVQTVDAAEGDPALASQTTADADRKAEMDVR
                     LLALRCLEQIIVSGSSRGQIRVTTITILRFILAKAPISNSSQEKAKGDTWATSLMELV
                     AKWCPVQVRFIILNAAMEVLLETNPTEENLDRSATMVYMVDWLLKSSVNMIGLSVMDV
                     LLGLMRYLSSVLSPGSEKVANGESEKHTNEAPLTERRKELLDLLVGSVGHLATHIYYG
                     DQITDMVRTILSLLKPGANHEHSMTAPADTLDPSAKPATPPGEHAVAFSSLTAKIAAL
                     KAVKNVLVVASGKKPAASAGVESRNRVGIHVWEDTQWLLRDQREVYYTYADALLCWLR
                     LETNETDARVSEPIGRPANLLAKQLPEISERSGKLGSNSGNHRAKAVQVAQSNFLRLL
                     HLTIYENALERSSEESETLLLHLILTNLIDRLGVNAVRYGLPMILKLQSDVSAASLHS
                     AASKVNIGSLIFGYLWKLTEKFDLDAYRVGGAINNEIDKRRNFGVWLDSVRLPPADLD
                     AITPIAGKETSPGGLESPELLNPFGDDVQELVDRIEEAYNGSIPTPVQSPPSSPERGG
                     ANGTAPAIPEKEHLPASVKDEMLAGWDKEACLAAVQKDKARTLSINGSKAGTFIMRNH
                     FHGNGFRDSSLSTASPVSALDGSGSITGGAAGLPDRRRPSVPEYTGTPVNSSSRGSAV
                     RVNELRRVLSNKHDANARRLSPLRGRLDASNDSIISSSSESMVSGYSASEFDGDGVSS
                     RPQSVVEGESTPPGDGVETPRASTFVLTDGQSKAGGIPPVPPIPPSLSIPSMPSLPGG
                     FPSDSSQASTPLGERPVTAPAPRKQASVNGSAGAYHAYRPSNAGTLNRSKSRSSTGLA
                     SAAHVDGGYTEHDHGDSQRQLNDFLSSRDAERPKGTRRTGGISSRRPAAIGGIGRPPY
                     "
     gene            complement(<332586..>333080)
                     /gene="SOH1"
                     /locus_tag="ACHE_20122A"
                     /db_xref="GeneID:66979023"
     mRNA            complement(<332586..>333080)
                     /gene="SOH1"
                     /locus_tag="ACHE_20122A"
                     /product="suppressor of hpr1"
                     /transcript_id="XM_043284389.1"
                     /db_xref="GeneID:66979023"
     CDS             complement(332586..333080)
                     /gene="SOH1"
                     /locus_tag="ACHE_20122A"
                     /note="BUSCO:EOG09265KF9;
                     COG:K;
                     EggNog:ENOG410PSFP;
                     InterPro:IPR038089,IPR008831;
                     PFAM:PF05669;
                     go_component: GO:0016592 - mediator complex [Evidence
                     IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="suppressor of hpr1"
                     /protein_id="XP_043133186.1"
                     /db_xref="GeneID:66979023"
                     /translation="MEAQPPEQPQQQPSPTLTNPRFTLELEFVSSLANPYYLSHLAVT
                     YPNLLGISRSSDDTGNEAIDSSADPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGPTLR
                     ALRLLQEEAFRRDVIRPQVIEGLAGLGLGLVGEQQQQQQQQEGAQEGGDEQGQESTEK
                     QEGV"
     gene            complement(<336998..>338880)
                     /locus_tag="ACHE_20123A"
                     /db_xref="GeneID:66979024"
     mRNA            complement(join(<336998..337779,337832..338243,
                     338309..338562,338817..>338880))
                     /locus_tag="ACHE_20123A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284390.1"
                     /db_xref="GeneID:66979024"
     CDS             complement(join(336998..337779,337832..338243,
                     338309..338562,338817..338880))
                     /locus_tag="ACHE_20123A"
                     /note="COG:S;
                     EggNog:ENOG410PN5G;
                     InterPro:IPR013226;
                     PFAM:PF08316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133187.1"
                     /db_xref="GeneID:66979024"
                     /translation="MNAPQQPLPYAYPGGVTLGPSDGQNSPQLPVNLASNNPFRNRAL
                     SPAVNAAPRPTSTNPFLDDSDAISPQSAPGVSMMSPPMQPLQPVKPVQPVPQEVMGNT
                     SDLFASLSLNQAPQSNGHRPPPPRPDDRLKQRPTTSRRPKEQSSRREKDPLDIFADPP
                     TLTKSNTTLGSRERERRPRRNSESSIMERPKAMDPEEERRRRERRRREREARHRDGKS
                     SRSKKANYHMDIIDKLDVTSIYGTGMFHHDGPFDACNPNRNRKGVRAAPMQAFPQDST
                     NMALGGAGPVNKNIDLDLFHGRTAEGWNDFATTGTAPDTVGRSAEGVSFDPKSKLEPV
                     HGPSSMGLGTSTFLDGAPASRSAMQRRASENEQGAPGGGGLQRKKSLAQRLRGINRAP
                     SSRVVSPDASYPGPAGLSGQPPRVPERNPSIQDYDEEWDKKGAKINTAEDSRPIPEAG
                     RARSSSSPKQSTFSNERSNSGFDEGKPNNGGGGLLNRMKSLRKPRPERRVSDD"
     gene            complement(<340356..>343308)
                     /gene="MCM2"
                     /locus_tag="ACHE_20124A"
                     /db_xref="GeneID:66979025"
     mRNA            complement(join(<340356..340470,340524..340693,
                     340750..343049,343098..343216,343304..>343308))
                     /gene="MCM2"
                     /locus_tag="ACHE_20124A"
                     /product="MCM DNA helicase complex subunit"
                     /transcript_id="XM_043284391.1"
                     /db_xref="GeneID:66979025"
     CDS             complement(join(340356..340470,340524..340693,
                     340750..343049,343098..343216,343304..343308))
                     /gene="MCM2"
                     /locus_tag="ACHE_20124A"
                     /note="COG:L;
                     EggNog:ENOG410PFZA;
                     InterPro:IPR033762,IPR027417,IPR001208,IPR041562,
                     IPR027925,IPR008045,IPR031327,IPR012340,IPR018525;
                     PFAM:PF00493,PF17855,PF17207,PF07728,PF12619, PF14551;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0042555 - MCM complex [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006260 - DNA replication [Evidence IEA];
                     go_process: GO:0006270 - DNA replication initiation
                     [Evidence IEA];
                     go_process: GO:0032508 - DNA duplex unwinding [Evidence
                     IEA];
                     go_process: GO:1905775 - negative regulation of DNA
                     helicase activity [Evidence IEA]"
                     /codon_start=1
                     /product="MCM DNA helicase complex subunit"
                     /protein_id="XP_043133188.1"
                     /db_xref="GeneID:66979025"
                     /translation="MSSPLRPSQSAANRGLGNLNRRKRSREPDDETSSIAAPPSSPPP
                     SSPPAPFGDDESDRDEEAEALGDVDDLEEMAEDEDGIDLFGDNFERDYRSTANDQYRG
                     EYIDDDDQVQEDIDLGARRQLEARMFKRDREAERRRRMPAAFMPDDDDGDLDLTRQPR
                     RRRNRYDEDREDVDMGEEAMEELTLDELQDVKASNLTDWILQPQVLRSIYREFKAFLT
                     EYIDAAGSSVYGNKIKTLGEVNSASLEVSYNHLAEAKAALSYFVANEPTEVLKVFDQA
                     ALDVTLFHYPQYHDIHNEIHVRMTDVPTTYTLRQLRQSHLNCLVRVGGVVTRRSGVFP
                     QLKYVMFICQKCNITLGPFQQEASAEVKISYCQNCQSKGPFTVNSEKTVYRNYQKLTL
                     QESPGSVPAGRLPRQREVILLADLIDTAKPGDEIEVTGIYRNSYDAQLNNKNGFPVFA
                     TILEANHVVKSHDQLAGFRMTEEDERQIRTLSKDPDIVDKIVRSMAPSIYGHQDVKTA
                     IALSLFGGVSKEAQGKMAIRGDINVLLLGDPGTAKSQFLKYTEKTAHRAVFATGQGAS
                     AVGLTASVRRDPLTSEWTLEGGALVLADRGTCLIDEFDKMNDQDRTSIHEAMEQQTIS
                     ISKAGIVTTLQARCAVVAAANPIGGRYNSTAPFSHNVELTEPILSRFDILCVVRDTVE
                     PTEDERLASFVVESHSRANPARPRRNEQGRLIDDDGNLIDEEGYRVDKDGIRLPLRPD
                     ERQRREEEQRKAEEEKEGEIPQELLRKYILYAREHCRPKLYQIDQDKIARLFADMRRE
                     SLATGAYPITVRHLEAIMRIAEAFCRMRLSDFCSSQDIDRAIAVTVDSFIGSQKVSCK
                     KALSRAFAKYTLSRPKPQSNRRAGFATQNPLLKRRQQQQQREQSVA"
     gene            complement(<351439..>352341)
                     /locus_tag="ACHE_20125A"
                     /db_xref="GeneID:66979026"
     mRNA            complement(<351439..>352341)
                     /locus_tag="ACHE_20125A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284392.1"
                     /db_xref="GeneID:66979026"
     CDS             complement(351439..352341)
                     /locus_tag="ACHE_20125A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133189.1"
                     /db_xref="GeneID:66979026"
                     /translation="MEALRPHGGGISHASPPGVGNVVSQFVETEDMPVTPTPTRWQSG
                     NMMQPEFNEGSMESASMDENGGQEHWQTGGSSRAPSRASEARSGIRQRKILQKSLIGR
                     PRHHTSLLDVSKQAQMLVGALETAQTQQQEIYHMVQEQVQAHLAEELSNWRAEQQTHE
                     GIYLERITNLEQEVSKLRTELTEARHTIQQPAPVRQETPAIDTQPNRVNKHVNNQTPK
                     VREMSQQLRQEPSFADLAALLSTRPGGQEWQEVTKKRPKNRQIQAVAVANQPDPTKLK
                     PAKDSPKEARRCHNLASLVSYLGF"
     gene            complement(<353318..>354319)
                     /locus_tag="ACHE_20126A"
                     /db_xref="GeneID:66979027"
     mRNA            complement(<353318..>354319)
                     /locus_tag="ACHE_20126A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284393.1"
                     /db_xref="GeneID:66979027"
     CDS             complement(353318..354319)
                     /locus_tag="ACHE_20126A"
                     /note="COG:S;
                     EggNog:ENOG410PYAH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133190.1"
                     /db_xref="GeneID:66979027"
                     /translation="MARQWKVSVLALHGASNTIYANGYMQARVYVEIKAVDSVDNLVY
                     LTPEELKTIQLIDYHTGETLGPDLIYTDRENEFNHSVDPVAISATIANESTEHPASQE
                     KLYWVSAKKVDRRDIGACIKQPDGTTISTQRGTDYDSHDTIIATNPYRYTMDSIATVE
                     KRYTEEGIWKVNFQHALREDHKWKQENFFITSKRHPFKKAEIHECYSDDPETLHNCFC
                     LRYQEKDALRLYYIWDYATEDTKHVGLHKREAKPFWFVDNDATAQIRISQKPEALCLT
                     RMVFVTADLTDLHNIIKNEEPWQRNAWFRFFDVYGNWGDFYVKPSDLGDDFVVSDKN"
     gene            complement(<355574..>356323)
                     /locus_tag="ACHE_20127A"
                     /db_xref="GeneID:66979028"
     mRNA            complement(<355574..>356323)
                     /locus_tag="ACHE_20127A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284394.1"
                     /db_xref="GeneID:66979028"
     CDS             complement(355574..356323)
                     /locus_tag="ACHE_20127A"
                     /note="COG:L;
                     EggNog:ENOG410PIMX;
                     InterPro:IPR027417,IPR041677,IPR041679;
                     PFAM:PF13087;
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133191.1"
                     /db_xref="GeneID:66979028"
                     /translation="MKEEMHQEVMNLASSHSKAKAELDNIRDEVRLRCLNEADIIGLT
                     TTGLAQNLNMLQRLQSKVVLCEEAGEVLESHLLTAFLPSIEHAILIGDHLQLRPQVQN
                     YELSRENHRGGAKYSLDVSLFERLVETESTMSSGLPFSTLETQRRMHPSIAQLVRDTL
                     YPQLIDAPSTLQYSEVAGMRKRLFWLDHRMFENDASSANAMSTSHWNDYEITMAAALV
                     NHLVQQGKYKKRRYRSPNSVSRPAPSTSPEA"
     gene            complement(<363995..>366968)
                     /locus_tag="ACHE_20128A"
                     /db_xref="GeneID:66979029"
     mRNA            complement(join(<363995..364531,364658..365145,
                     365580..366812,366866..>366968))
                     /locus_tag="ACHE_20128A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284395.1"
                     /db_xref="GeneID:66979029"
     CDS             complement(join(363995..364531,364658..365145,
                     365580..366812,366866..366968))
                     /locus_tag="ACHE_20128A"
                     /note="COG:S;
                     EggNog:ENOG410Q0U3;
                     InterPro:IPR002110,IPR036770,IPR020683;
                     PFAM:PF12796;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133192.1"
                     /db_xref="GeneID:66979029"
                     /translation="MQLLDLPLEIFRVILGKTVSTLYCEELIRLQLVNKFFAREVIVA
                     TCSTHHFRDSGCWMPFAPYYLQSKALTPGSMNDYFALTVRDTTNQMLGYLAGDENQRQ
                     QLSLAISRAAIEFKAPGIYSSLTNAETLQPQISQRSDAQEHLLSAAADIGDLALVQHL
                     AKSVNVNIGSYVFGKPLLNAAWKGHLKIVQFLLTEGADAEDGVQPQTEQDSRNGHDEN
                     AMEKITVEFENPRPGTALEAAALGGHEQVVRLLFQPDAKVSRSSYSYFKAITYAAMSG
                     NLDLLGLVSEEADFSTLSEITTQELWNHTLKGAAWHGRTKTIPFLLKAGAHINHEEPF
                     ERGWTTALGFAALRGHNDTIRLLLEKGAAVDGGRRCEEGPISLAAHVHGFPRTVELLL
                     DKGASVHPIKSRLLEQAVMYSPPSVVKVLLEKGVQRRREDGGEAALDIAVDEGLVAGN
                     GGAKKKGVVGAASPWPDHSYNHKDHDQCAHAAAILTETAELKQIADRTQGLPPRDLVI
                     RFMSSVEDLAAKVRDRTSNNGSEDHDGQKKVLEQIQTMFDKQTQEMKALQWQPPKVTS
                     SPPASSPSGHAKSFRDAALASHLTSAKSSLVSGWMQGNTNGSKEARVVERANRAIKES
                     NNNIIAHRSVSTGRILPSGDIILRAESLEDVEQLARAAKDWCLAFGDNATIRRRTYRV
                     VMNGVNCQLDLAAAPACIKADNLGRLASAPTVITYTGWLLGPRHIAEHKPETSKLIVE
                     FDNDRAANIAILLGLALNGRDHPCEYYDQTHRIQQCFNCQAYGHIA"
     gene            complement(<390805..>394311)
                     /locus_tag="ACHE_20129A"
                     /db_xref="GeneID:66979030"
     mRNA            complement(<390805..>394311)
                     /locus_tag="ACHE_20129A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284397.1"
                     /db_xref="GeneID:66979030"
     CDS             complement(390805..394311)
                     /locus_tag="ACHE_20129A"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR000477,IPR000953,IPR036397,IPR012337,
                     IPR041373,IPR043502,IPR041588,IPR001584,IPR016197,
                     IPR043128;
                     PFAM:PF17917,PF17919,PF00078,PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133193.1"
                     /db_xref="GeneID:66979030"
                     /translation="MILGLAWIDDQQVFIDPNGPKLRFTNGIVVSSMEDQPRMDIQPI
                     GANAFALWNRQKKKDSSVQIFAASLKDIEKALRPKLPTDPRTKLPPHYHKFLSVFDRK
                     EADKQPPHRGPNIDHKIELNKNADGTTPEPPWGPLYNMSRDELLVLRKTLTELLEKNF
                     IRVSNSPAAAPVLLVKKPGGGLRFCVDYRALNAITKKDRYPLPLINETLERIGKAKWF
                     TKLDVIAAFHKIRVAAGDEWLTAFRTRFGLFEWLVTPFGLANAPSTFQRYVNWVLRDF
                     LDEFASAYLDDILIFTDGTLPEHQEHVRKVLGRLQEAGLQIDIDKCEFEVKSTKYLGF
                     IIEAGKGVSMDPAKVEAIMNWAAPTTVKGVRSFLGFANFYRRFIRNYSELTTPLTALT
                     QKDKPFVWDDKCEESFQQLKRMFTTAPILMQFDPDRETVVETDSSGWATGGVLSQYDD
                     DGVLRPCAYFSKKNTPAECNYQIHDKELLAIINALKEWESELISVVNFQILTDHRNLR
                     YFTTMRRLNERQMRWADLLSRYDFTLHYRPGKLAGRPDALSRREQDVPALGDERLKHR
                     EQRLFDPEILKDGPVEGSSKRGLVEEPHPINVSRILLAPVGTEPYNSEPSTPQGYEQA
                     NEPTNLNSEQPSLEELLDMTLDEHWARVEPLDEKYGRIREAVQVGAPQFPCELGIKAS
                     ISECSIELNNRLCYRGRRWVPDIESLRTRLLQETHDSVLTGHPGRSAMYAILARRVYW
                     PAISEDVRRFVRNCDKCSANNVWRDRRQGLLKPLPIPDRKWRYIAIDFIEKLPTSNGY
                     ENIMVIVDRLGKGVIPVPCEKINTYTVAQKLIQSFIGYHGIPASIVSDRGRQFTNEMW
                     KRFCELLGIKRQLSTAYHAETDGQTERMNATLELFLRSFCDHTQSNWASLLPMAQLAI
                     CSRDAASTGVSPFFLDHGYHVDPFQLEEDVEINLSAPDLGTMRERGERIAAKLRGALD
                     IATTELAVAQQKQEDYANRRRDVAPEYQVGQKVWLDLRNIQTERPSKKLGSRQAKFTV
                     LEKIGSHAYRLNTPGTIHDVFHTALLRPAAMDPFPSQRKDDYQPPAEMINGNEEYMVE
                     RILDERFRRWGRGERHEFLVKYIGWQEPEWNDARNMEDTIALDDWETYKTMNGIVIQS
                     ALSIPNEPPHAGGRSRRRRGGG"
     gene            <401098..>402822
                     /locus_tag="ACHE_20130S"
                     /db_xref="GeneID:66979031"
     mRNA            join(<401098..401237,401306..401360,401421..402756,
                     402815..>402822)
                     /locus_tag="ACHE_20130S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284398.1"
                     /db_xref="GeneID:66979031"
     CDS             join(401098..401237,401306..401360,401421..402756,
                     402815..402822)
                     /locus_tag="ACHE_20130S"
                     /note="BUSCO:EOG09262E7W;
                     COG:S;
                     EggNog:ENOG410PKV7;
                     InterPro:IPR040204,IPR003126;
                     PFAM:PF02207;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0061630 - ubiquitin protein ligase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133194.1"
                     /db_xref="GeneID:66979031"
                     /translation="MDKSEGTRASRDQETPKATDSIAMRRDSLASHDSRTVTSEESHT
                     AKEFIENQLQLEADAREVLPYSFDSCSQVLGPLRQSLFACITCNPATNPDESYTPAGV
                     CYSCSISCHGEHTLVELFGKRDFVCDCGTTRLPPSAPCTLRYDPKTGQKGVHSQEPAA
                     NNKYNQNFQNKFCGCSEPYDAEKEKGTMFQCLGLGTVETGGCGEDWWHPECIVGLPRD
                     WHNAEQKEGEEHNEDEEPPLPPGFPAEDDFETFLCYKCIESNPWLKRYAGTPGFLPPI
                     HHQGDQSKVPENSDAGKEDSNTTSQEHEGNAKKRKLEDEEDEPAAKKPKADQTTPADP
                     EPKSEPKSKQSKPEQPQQTTNKHDTLPKTAPTGTFSLFLKEDFRDHLCRCPECYPHLS
                     IHRQLREEEETYEPPLSEAGDEEPNGGGSTGTGSLLDRGEAAFSNMDRVRAIEGAMVY
                     NHLRDKVKEFLKPFAESGTAVGAEDIKEYFAKLRGDDPAAAASGDGKSNDNESGNRHE
                     QSGY"
     gene            complement(<403158..>404951)
                     /gene="SSN3"
                     /locus_tag="ACHE_20131A"
                     /db_xref="GeneID:66979032"
     mRNA            complement(join(<403158..404235,404290..404449,
                     404819..>404951))
                     /gene="SSN3"
                     /locus_tag="ACHE_20131A"
                     /product="cyclin-dependent protein kinase"
                     /transcript_id="XM_043284399.1"
                     /db_xref="GeneID:66979032"
     CDS             complement(join(403158..404235,404290..404449,
                     404819..404951))
                     /gene="SSN3"
                     /locus_tag="ACHE_20131A"
                     /note="COG:K;
                     EggNog:ENOG410PGXB;
                     InterPro:IPR000719,IPR011009,IPR008271;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase"
                     /protein_id="XP_043133195.1"
                     /db_xref="GeneID:66979032"
                     /translation="MSLTNQQPSSSGPLTASSTRPAVATSTAVSQSLALKRSLQAAVD
                     ETIDTRRPAGTGYTSKVRVRDKYHIVGFISSGTYGRVYKALAKDGRRGEFAIKKFKPE
                     KEGEAIQYTGLSQSAIREMSLCSELDHPNVVQLAEIILEDKCIFMVFEYTDHDLLQII
                     HHHTTPQRHAIPAPMVRSILFQLLNGLYYLHTNWVLHRDLKPANILVTSSGAIRIGDL
                     GLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRP
                     IFKGEEAKMDSKKTVPFQRNQMMRIIEIMGMPRKETWPGLVSMPEYSQLQSLALSRAS
                     SGHHFSRPPSLESWYTNCLKNGGYSSTSSIGTPGAEGLDLLSRLLEYDPTKRITAQEA
                     LEHPYFKEGGPISADCFQGLEGRYPHRRVTQDDGDMRSGSLPGTKRSGLPDDSLLGRA
                     AKRLKE"
     gene            <405621..>407125
                     /locus_tag="ACHE_20132S"
                     /db_xref="GeneID:66979033"
     mRNA            join(<405621..405710,405761..>407125)
                     /locus_tag="ACHE_20132S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284400.1"
                     /db_xref="GeneID:66979033"
     CDS             join(405621..405710,405761..407125)
                     /locus_tag="ACHE_20132S"
                     /note="COG:G;
                     EggNog:ENOG410PFZ3;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:12
                     (i12-31o66-88i95-119o125-142i154-176o182-203i285-309o315-
                     338i350-371o377-399i411-432o444-463i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133196.1"
                     /db_xref="GeneID:66979033"
                     /translation="MAFSQYKVTPYLVYLVFITTLGPLQFGYHLAELNAPQSVITCER
                     QSIHSSVANLSPQCIHMNPSQFGLVSSIYTLGGLLGALLAGPVATRYGRLIVLRATTI
                     FFILGPLAMTMAGSIAVISVGRLVAGVGAGAAIVVGPIYISEIAPHSARGFFGAFTQI
                     MTNVGILLTQTLGLFMSRGNKWRQILFIAGVIGFAELLGLFFVPESPIWLAEHQKTTQ
                     ARQVLQRIRGKNADIDTEIEGWNVSTDPADPSAEEESLLEHPSGEASSKQPPVTILRA
                     ITDPEYRQAIIAVIGVMVAQQFTGINSIVMYSVSLLQTILPTTAALLTVMISAINLVI
                     TLACSPLPDKIGRRKCLLLSITGVGIDSVLLALGIYFNQKALSSIAALLFVAFFAVGL
                     GPVPFILSSELVGPEAVGATQSLALGANWIATFVVAQFFPVVNDALGGRGRVYWIFAV
                     LAAVMGSFIYRFVPETKDKANADEVWGRENRRRD"
     gene            <411087..>414727
                     /locus_tag="ACHE_20133S"
                     /db_xref="GeneID:66979034"
     mRNA            join(<411087..411221,411299..411343,411412..411627,
                     411686..412097,412157..413698,413761..414512,
                     414569..>414727)
                     /locus_tag="ACHE_20133S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284401.1"
                     /db_xref="GeneID:66979034"
     CDS             join(411087..411221,411299..411343,411412..411627,
                     411686..412097,412157..413698,413761..414512,
                     414569..414727)
                     /locus_tag="ACHE_20133S"
                     /note="COG:I;
                     EggNog:ENOG410PFCS;
                     InterPro:IPR003817,IPR011992,IPR033177,IPR035892,
                     IPR033179,IPR000008,IPR002048,IPR018247;
                     PFAM:PF00168,PF02666;
                     go_function: GO:0004609 - phosphatidylserine decarboxylase
                     activity [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_process: GO:0008654 - phospholipid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133197.1"
                     /db_xref="GeneID:66979034"
                     /translation="MVRLPIPQRLSSHLSSKTPTPGQSRTPSPSRVSEKPLILKVAVL
                     KGRDLAPKDRGGTSDPYLIVTLGDSRQSTPTIPKTLNPEWNVAFEMPVVGVPLLECIC
                     WDHDRFGKDYMGEFDIPLEDIFQEGEIQREPKWYTLESKRRPARKKDSTVSGEILLQF
                     SLVDTANPMASPQDTYRKFQNLVCFGEEEDYFPQETSQDLEDVDRDEETSDDADEPEV
                     AEKRRKRLRLRRLRNKSLAARAYQFSGVGNGVQGIVFMEIVRVTDLPPEKNVTRTSFD
                     MDPFVVTSLGRKTLRTPVIRHNLNPEYNEKMVFQVMRHEQSFTISFAVVDRDKFSGND
                     FVASAGFPLQTLIQSAPESDPETGLYKFLDPTLDPTGTEDAASKSSFRVGTSPSSSTQ
                     KLPMRPSLKSRNSGTSTSGRSISGHSQHDVPPSIPPIIVPEVGEEELAAPEEVEERDE
                     ESKGAFKASANATSDGGIAPLDTDGLKVYKIPLILKHKERWEDKHSPELVIKAKYLPY
                     RALRQQFWRLMLRQYDADDSGRIDKTELTTMLDTLGSTLKESTIESFFQRFQAENEPL
                     ETMDLSFDQVVICLEDTLQNLQKDPRVAMRAHTHTPSSGSQDSEEPSSSDDLAAENST
                     SFPSNMDTQGTSVPTLPSDEQPGPNEDDLQPDDLGDERGEEHVVEIRECPLCHQPRLA
                     KRSDADIITHIATCASRDWRQVDNLVMGGFVTSSQAQRKWYTKVITKISYGGYKLGAN
                     SANILVQDRITGQINEERMSVYVRLGIRLLYKGLKSREMEKKRIRRILKSMSIKQGKK
                     YDDPDSASQIKDFINFHQLDMSEVLLPIEQFKNFNEFFYRQLKPDARPCSAPEEPRIA
                     VSPADCRTVVFDRMSEATSIWVKGREFSLERLLGDAYPEDVNRYKNGALGIFRLAPQD
                     YHRFHIPVDGVMGTPKTIEGEYYTVNPMAIRSALDVYGENVRILVPIDSVAHGRVMII
                     CVGAMMVGSTVITRQAGEKVTRGEELGYFKFGGSTLLVLFEDDKINFDSDLVENSRGP
                     LETLVRVGMSIGHSPEIPQFEPDFPKKENVTVEEMQAAKRRIEGSLAPPTDPSGIQ"
     gene            <415672..>417619
                     /locus_tag="ACHE_20134S"
                     /db_xref="GeneID:66979035"
     mRNA            join(<415672..415909,415972..416529,416583..416747,
                     416795..416963,417016..>417619)
                     /locus_tag="ACHE_20134S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284402.1"
                     /db_xref="GeneID:66979035"
     CDS             join(415672..415909,415972..416529,416583..416747,
                     416795..416963,417016..417619)
                     /locus_tag="ACHE_20134S"
                     /note="COG:S;
                     EggNog:ENOG410PN5I;
                     InterPro:IPR013218;
                     PFAM:PF08202;
                     go_component: GO:0000444 - MIS12/MIND type complex
                     [Evidence IEA];
                     go_process: GO:0007059 - chromosome segregation [Evidence
                     IEA];
                     go_process: GO:0051301 - cell division [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133198.1"
                     /db_xref="GeneID:66979035"
                     /translation="MTITVSATTTTTTTRTKRREPLGTIDMATTQAQARPAPSAGSAR
                     GRPRRASARLSMTNQERSEENMNVNGSKAEKKRKNASFDEDVEGFQFTRLPSKKPRPS
                     IEAIPEVPSSVPEDAPRQASPPRRGRPKKQAQPQPQAQSQEKFTDVVEERPKRSTRGT
                     RASVEPEPQPEDTQRSRKRDQSDAAAAEKKRRKGRPSKSKPDERNGFVSPEQQGTKIT
                     LPMADTPVMQRNKEMRTAAKSEKGNRRSSLGMRGRRASSLIDSGASNALPHKEVNTAD
                     FYKHIGPDLPEPRRMRQLLIWCATRAMGDKPSGSRSEDESARLAARVIQEELLKDFST
                     NSDLSNWFGREDSAPPAVVVKKPHPKNVQNAEKIKELEEQIQRLQRERHSMNALLRPP
                     SIPRIKPPIPKPDEPSQPGSAQPPRPSETNTKIDISFLDPSQQKLLASLEPTTARAPE
                     PEPSSSSTSNTTPTPLPPIPPSAVASRLSRITNNLAPTLDSLAAGIHDIELYRSMSDR
                     VSSRVLRICAERLDERDARNAMYRLSIEGSSDGESEDGNDSKKEKVVLRERPREDLGV
                     ILGALSRVERR"
     gene            complement(<420392..>421078)
                     /locus_tag="ACHE_20135A"
                     /db_xref="GeneID:66979036"
     mRNA            complement(join(<420392..420879,420934..>421078))
                     /locus_tag="ACHE_20135A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284403.1"
                     /db_xref="GeneID:66979036"
     CDS             complement(join(420392..420879,420934..421078))
                     /locus_tag="ACHE_20135A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133199.1"
                     /db_xref="GeneID:66979036"
                     /translation="MRCWNLAICVLGPVVETHLDIFTALALRKVKEWKPDYDEYTEDP
                     TGSTEPFKILAFRNLIQKCQNKERKKVPQGNPRPTLPFSRPLYLPYEIRCLILDCLDY
                     TDIPILKSAVQYHIGESYWRARMAFYLIGINDELSRIENEEIAWEHLCLETEKLDATT
                     DIFKTCRRAIRILTVIKEKLFKMLHEGYIPALKDVINDVQGDDTGILGLG"
     gene            <426472..>429018
                     /locus_tag="ACHE_20136S"
                     /db_xref="GeneID:66979037"
     mRNA            <426472..>429018
                     /locus_tag="ACHE_20136S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284404.1"
                     /db_xref="GeneID:66979037"
     CDS             426472..429018
                     /locus_tag="ACHE_20136S"
                     /note="COG:S;
                     EggNog:ENOG410PFXD;
                     InterPro:IPR024528,IPR010619;
                     PFAM:PF06738,PF12821;
                     TransMembrane:10
                     (i508-526o532-550i557-578o590-614i626-649o669-687i694-
                     711o717-737i749-774o813-836i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133200.1"
                     /db_xref="GeneID:66979037"
                     /translation="MVGGYFDLPVAGSSRRSSMTDGSGGVSRSSPWPGVSPLPTPNEE
                     QPLDPTGTRSRNRNAGILKSTNRVKFSVSEYGLDQRPGRSASETATTLPQRPMPTASI
                     PSTDKVSAGAQSLPLVDISTSSPTPVNGITIHSRASSPGDETSTRAIHSAQERAQRLA
                     SLLGRSGKSPKPSPRSSVISSVASTPTEVALPSEDGDDIPMISLPEKQFKDYDDFSDN
                     ERDAIDGGSSSSSQAHRLVQRMTRRDFGFMNRIRAPSPGLCSGQTTPSRERDPDGYVE
                     RPSHYRGGILSALLKLSDQRDTNSQYQRGRYMHSQQGSTSELSARGLSPDPNWKPLPP
                     RPRKWYEKSPNVSSTSLSGSTIKDSISSPIAMLKRSRSNSGKRMGRPRLEEEIRITVH
                     IAELLARQHYLIRLCRALMKYGAPTHRLEEYMNMTSRVLEIEAQFLYLPGCMIISFDD
                     TSTHTTEVKVVRSTQGVELGKLADVHVIYKEVIHDVIGVEEATQRLDEIMKRKDQHHV
                     LFRVFIHGCAAAFVGPFAFNARPIDMPVAFALGCLLGVLQLVLAPRSELYANVFEVSA
                     AILTSFLARAFGSIRYNGEPLFCFSALAQSSIALILPGYIVLCASLELQSRNMVAGSV
                     RLVYAIIYSLFLGFGITIGTAIYGCLDSTASTDYTCPPSPIPNEYLQRFPFVILFSIC
                     LALVNQARWRQLPIMLFVSFAGYVVNYFATKRFATNTQVANAVGAFVVGILANLYSRL
                     RHGLAAAAMLPAIWVLVPSGLAASGSLISAIVAAEQMNYSPSPYAVVNNGTQGFMDAA
                     KNMTSAQTRGVTFDVAYGMVQVAIGFTVGLFLAALVVYPFGKKRSALFAF"
     gene            complement(<434825..>436564)
                     /locus_tag="ACHE_20137A"
                     /db_xref="GeneID:66979038"
     mRNA            complement(<434825..>436564)
                     /locus_tag="ACHE_20137A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284405.1"
                     /db_xref="GeneID:66979038"
     CDS             complement(434825..436564)
                     /locus_tag="ACHE_20137A"
                     /note="COG:S;
                     EggNog:ENOG410PJI3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133201.1"
                     /db_xref="GeneID:66979038"
                     /translation="MDTGGLAQMTYNSSFNGGSIGVPSSSFSSRGKGSHIKRLSVPPP
                     HISTIDESQPSAPLQTPRTSRSHLLAGLRTAPKSATIPSAHQQHLGQDTRRYAARPDR
                     VAERVPQTATGTGFPRHSFASNQNVDMNTGRPMYTLPEQVLAPPALDVGADLPMDDNL
                     YAEMMSTNLFLAAQQQRLQQQLISVTTAAQQFQGLNLGMPVAAQQSLPSLSLPSMGFY
                     QQQLQQGVQPIVQPVLGQPGLFSVFNPLTGQQNYIYDNSAEQQQDAGSSFYQEEQRDH
                     FQEDLHVPTFRAEVSPPPESRQPQRSVSPPKSSPPPQEVTPLPPPSANAFRRGHKKSS
                     SFAPRPLDTAKANNTVVNSAAPKTAALPPKTAALPQTPATGTFGPGQGRAGEHPIRQP
                     RGPPSIEELVAKPTSKHEGSKNFATRQRRRAVNNLVRAGIERRGETRSFGYHSSGGTN
                     TPASEKEFTFSDNDDATVRSGSLSSKPSLGSLRAAANGAIGSERKERSSRERKSDSPY
                     SGTPTSEDGGSFFGPSGKFADIRADHVSSPTGTPSVAAVVAGQKTAAPGPERRKTPML
                     VLSSAEKRKTPIV"
     gene            complement(<439365..>441630)
                     /locus_tag="ACHE_20138A"
                     /db_xref="GeneID:66979039"
     mRNA            complement(join(<439365..441223,441284..441470,
                     441583..>441630))
                     /locus_tag="ACHE_20138A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284406.1"
                     /db_xref="GeneID:66979039"
     CDS             complement(join(439365..441223,441284..441470,
                     441583..441630))
                     /locus_tag="ACHE_20138A"
                     /note="COG:K;
                     EggNog:ENOG410PGHG;
                     InterPro:IPR018004,IPR002110,IPR036887,IPR020683,
                     IPR029793,IPR036770,IPR003163;
                     PFAM:PF00023,PF13637,PF13606;
                     go_component: GO:0030907 - MBF transcription complex
                     [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0000083 - regulation of transcription
                     involved in G1/S transition of mitotic cell cycle
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133202.1"
                     /db_xref="GeneID:66979039"
                     /translation="MGDVDFSKIYSATYSNVPVYEYKLETDSVMRRRSDDWINATHIL
                     KAAGFDKPARTRILEREVQKGVHEKVQGGYGKYQGTWIPLTEGRLLAERNNIIDKLRP
                     IIEFVPGDRSPPPAPKHSTASKPRAPKGAANARRIANEDVFSAVKQHHPMGPPSFPHE
                     QYEMSTGLEEDESIEQATLESSSMVADEEMMPMSQHGGAYSRKRKRGMNEVAAMSLSE
                     QEHILYGDQLLDYFMTVGDAPEATRIPPPEPPANFQVDRPIDDSGNTALHWACAMGDL
                     EIVRDLLHRGADVKALSVHEETPLVRAVLFTNNYEKRTFPALLDLLFDTVSFRDWFGA
                     TIFHHISETTRSKGKWKSSRYYCEILLEKLRQTCSQDELDLLLSCQDSNGDVAALVAA
                     RNGAFRLVNLLLTYCPRASDLVNEKGETATSISQRAQTAERDIPPAPSSITMGNDHID
                     GEVTGPVNTDAQVDAPPPDPSAATSDLLSKIGVIMAEASKKLATSYGNTKPNQQDSDD
                     IANPETLYEQLEQDRQKIQRQSAALAAKEAKHDSVDAQLGRYDQLKRNYESLLEQVQQ
                     SRLLERAPTSEDNKPPSTRDHNELMTTYYLSRQLCSAQKVRRTAVKDLAQQTADAGVS
                     TKFDVHRKLVALATGLKEEELDPMAAELAETLEFDRMDGKGSGAQSPEPQRQQSSQSK
                     EPASLPFAGPVPVDA"
     gene            <442089..>442537
                     /locus_tag="ACHE_20139S"
                     /db_xref="GeneID:66979040"
     mRNA            join(<442089..442140,442231..442355,442433..>442537)
                     /locus_tag="ACHE_20139S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284410.1"
                     /db_xref="GeneID:66979040"
     CDS             join(442089..442140,442231..442355,442433..442537)
                     /locus_tag="ACHE_20139S"
                     /note="COG:C;
                     EggNog:ENOG410PQX2;
                     InterPro:IPR008698;
                     PFAM:PF05676;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_function: GO:0003954 - NADH dehydrogenase activity
                     [Evidence IEA];
                     go_function: GO:0008137 - NADH dehydrogenase (ubiquinone)
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133203.1"
                     /db_xref="GeneID:66979040"
                     /translation="MTVTETIKNTVGLGDSTAASRQEMSDARLPLQYRDSCANLLIPL
                     NRCRQAEYYLPWKCEDERHSYEKCQYEEFKKRVAKMDELRAAKDGARSN"
     gene            <443670..>446011
                     /gene="GCS1_1"
                     /locus_tag="ACHE_20140S"
                     /db_xref="GeneID:66979041"
     mRNA            join(<443670..443680,443751..443823,443879..443944,
                     444005..444144,444197..444322,444373..444958,
                     445007..>446011)
                     /gene="GCS1_1"
                     /locus_tag="ACHE_20140S"
                     /product="Zn finger-containing GTPase- activating protein
                     for ARF"
                     /transcript_id="XM_043284411.1"
                     /db_xref="GeneID:66979041"
     CDS             join(443670..443680,443751..443823,443879..443944,
                     444005..444144,444197..444322,444373..444958,
                     445007..446011)
                     /gene="GCS1_1"
                     /locus_tag="ACHE_20140S"
                     /note="BUSCO:EOG09261DGU;
                     COG:H;
                     EggNog:ENOG410PFP6;
                     InterPro:IPR014746,IPR004308;
                     PFAM:PF03074;
                     TransMembrane:1 (o462-484i);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004357 - glutamate-cysteine ligase
                     activity [Evidence IEA];
                     go_process: GO:0006750 - glutathione biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Zn finger-containing GTPase- activating protein
                     for ARF"
                     /protein_id="XP_043133204.1"
                     /db_xref="GeneID:66979041"
                     /translation="MGLLALGTALEWPEAKQRAHQVREWGIEQLLAIWNRAKGKERDA
                     LLWGDEVEYLVVAVDEHAKKARLSLAQADILKSLARDEALWKSDGGENQDGTGAGAEP
                     PHFHPEFGRFMLEATPAKPWGIDFKDLLKVEGNMKRRREVAKAHMASNEYPITMTTFP
                     RLGTKDDYIQPYYPPSGPALRSQFVPDEIANPHIRFPTLAANIRSRRGRKVELNVPVF
                     KDTNTPSPFKDPTVNYDLHIWPEDDDVRNGAAKDDHVYMDAMAFGMGSCCLQITFQAK
                     NINEGRKLYDQLSPLGPILMALTAATPIYKGFLVDTDSRWNQISRAVDDRTPEELGEL
                     PLKNDRWRIPKSRYASNSTYISQDPRLRKEYLDPDLVVDEDIKKRLIEGGMDDLLATH
                     FAHLFIRDPLVIFSEDLEELDLNKADHFENLQSTNWQHMRFKPPPPEKNDIGWRVEFR
                     SMEVQMTDFENAAFSIFIVLVTRAILSFDLNFYIPIQRTTENMETAHARDGVLDSKFY
                     FRKDPFPRRVRRQQHSSNGSNMSSATSSAVNTPPPSPPLAPVEMEYDLMTISEIINGS
                     TDGSFPGLITLVESYLDSVNVDVETRCSLASYLDLIRKRADGTLWTGARWIREYVAKH
                     PAYKQDSVVSERICYDLVKAVDEMAVKEGKNGSVGWEMLRGEKK"
     gene            complement(<446128..>446664)
                     /locus_tag="ACHE_20141A"
                     /db_xref="GeneID:66979042"
     mRNA            complement(<446128..>446664)
                     /locus_tag="ACHE_20141A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284412.1"
                     /db_xref="GeneID:66979042"
     CDS             complement(446128..446664)
                     /locus_tag="ACHE_20141A"
                     /note="COG:S;
                     EggNog:ENOG410QEAN;
                     InterPro:IPR032710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133205.1"
                     /db_xref="GeneID:66979042"
                     /translation="MCFPNQKLTTYRTPTTFPPPSNPKSTRTTKPDTATAIATSLTQQ
                     TETQAMLSVTTGFLSALSSKSREDFDRYCVRAGGMALFPPSPAIPRFCTIGSFVEQIS
                     KLRDEIDERIWDPEVTVSGDGGMGFVWAPFRARVNGVLDHVGVELFVLHKIGGEWKVT
                     GMADSCRVPTEEERVSLN"
     gene            <448072..>448296
                     /locus_tag="ACHE_20142S"
                     /db_xref="GeneID:66979043"
     mRNA            <448072..>448296
                     /locus_tag="ACHE_20142S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284413.1"
                     /db_xref="GeneID:66979043"
     CDS             448072..448296
                     /locus_tag="ACHE_20142S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133206.1"
                     /db_xref="GeneID:66979043"
                     /translation="MITRDSVEGPLPSFDLLELRWVLDRIARLAGTEEEFGHEDWEDK
                     SEDFNSNTDVERKEADAAVTPLPRKIDNAA"
     gene            complement(<455312..>457041)
                     /locus_tag="ACHE_20143A"
                     /db_xref="GeneID:66979044"
     mRNA            complement(join(<455312..455515,455567..455890,
                     455945..456809,457010..>457041))
                     /locus_tag="ACHE_20143A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284414.1"
                     /db_xref="GeneID:66979044"
     CDS             complement(join(455312..455515,455567..455890,
                     455945..456809,457010..457041))
                     /locus_tag="ACHE_20143A"
                     /note="COG:K;
                     EggNog:ENOG410PRGP;
                     InterPro:IPR000679,IPR013088;
                     PFAM:PF00320;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133207.1"
                     /db_xref="GeneID:66979044"
                     /translation="MGSLDAGPRHRDHLPAIGFLGKDAKHPAIAGTVSSPAPLISPPI
                     MYSSQPPSYPYTTPTASNGSLPSGYISPPESRRALEEEKERQIQPQRQSLPSIHEALG
                     NDNPLSYGGPPTSAPTQQVHPSYAPPPHSTSPGFTRSGTEAPTGPPGPPNPFSFSHQH
                     HQQLQAEASRSSLTSINTQDSRTASLHSFSSGRSPTQSAKTGITANSTYEYSAPPSAG
                     GIASPNGYAPPYSQSFSFQSQPTAPAYPSHYDARYGWKQGAPEPVRVEEIKNGYTRSP
                     LPGHGDSMKRHLEIYDVEASLNEISEMSTRTLDFSRHYATRAHQTQRSGPVMGSLPSL
                     HEVEEMINVQRQNQEALMRIRNAVLTQEHAMAEQMAQRKAYKTNGVDEEMAMYQEEYK
                     GSGGFAGAEAKKRRGKAAPPGRCHSCNRAETPEWRRGPDGARTLCNACGLHYAKLTRK
                     MGANKAPLGSNLKPKTPLGSASPN"
     gene            complement(<463887..>465756)
                     /locus_tag="ACHE_20144A"
                     /db_xref="GeneID:66979045"
     mRNA            complement(join(<463887..464497,464551..465177,
                     465249..465435,465484..>465756))
                     /locus_tag="ACHE_20144A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284415.1"
                     /db_xref="GeneID:66979045"
     CDS             complement(join(463887..464497,464551..465177,
                     465249..465435,465484..465756))
                     /locus_tag="ACHE_20144A"
                     /note="COG:T;
                     EggNog:ENOG410PII6;
                     InterPro:IPR019826,IPR002018,IPR029058;
                     MEROPS:MER0030934;
                     PFAM:PF00135;
                     SECRETED:SignalP(1-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133208.1"
                     /db_xref="GeneID:66979045"
                     /translation="MIRSVVGLLALWAGVQAAPTRRDTSSPVVSVKNGSYAGVTNTKY
                     NQDFFLGIPYAQQPVGDLRFTVPQSLNETWDGERDAKAYSDICVGYGTDSIWYPMSEA
                     CLTLNVIRDSSVDENSKLPVGVWIHGGGFYQGSGADERYNMSAIVSNANKIGKPFIAV
                     TINYRLSTWGFLSSHEVAESGNTNLGLRDQRLALHWIRENIASFGGDPDKVTIWGESA
                     GAMSVGYHLTAYGGRDDRLFRGGIMESGGSISASALGDETSYQDEFDALVKEIGCEGS
                     GKGALQCLREVPFEELNGALNGTGGSPAYGFSPVIDGDFIRKRGSVSLNDHEFVQVPV
                     IAGTNSDEGTSFGPTGINTTDQFYDYLTGNQSDPPLPSPVAKNLLSLYPDDPSQGIPA
                     YLGDARIASKGLQWRRTNAYAGDYMMHANRRRQCEVWAETSTPAYCYRFNVRSADMPY
                     TSGSAHFEEVAFVFNNIAGLGYHYGKPFKAETPESWVRLSEMMASMWAGFIYELDPNG
                     VGLYSGDFVRWDGYADGNEVDILFDADANATTSRMEGDTWRGDAIEYINSIADVYER"
     gene            complement(<466543..>467407)
                     /locus_tag="ACHE_20145A"
                     /db_xref="GeneID:66979046"
     mRNA            complement(join(<466543..467275,467397..>467407))
                     /locus_tag="ACHE_20145A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284416.1"
                     /db_xref="GeneID:66979046"
     CDS             complement(join(466543..467275,467397..467407))
                     /locus_tag="ACHE_20145A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133209.1"
                     /db_xref="GeneID:66979046"
                     /translation="MSMNYNSTPRINNPFKVDGEFDFRLAKASDLLDIQKISKQALRN
                     TVTVLTRDIPSTLQTLQGNMPFPNEDDNTAAYPTYLSVPILIARNTTNASGENKPRVV
                     GYAFLGPRRKSTSTTGDAWTMEVRKLAVGGGKWYIFPVEGMAGTYGVSINTAYLWFDG
                     HGGNGDGEGSEAGSAESEGSAGSEGSAASYDSYGSERSQGSQTSVSSEKNSHESDDDK
                     DEDSEDEEDDWDDDDDPYGEVEDDDIEYD"
     gene            <467628..>468757
                     /locus_tag="ACHE_20146S"
                     /db_xref="GeneID:66979047"
     mRNA            join(<467628..468241,468301..>468757)
                     /locus_tag="ACHE_20146S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284417.1"
                     /db_xref="GeneID:66979047"
     CDS             join(467628..468241,468301..468757)
                     /locus_tag="ACHE_20146S"
                     /note="COG:B,K;
                     EggNog:ENOG410PKNF;
                     InterPro:IPR002589,IPR043472;
                     PFAM:PF01661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133210.1"
                     /db_xref="GeneID:66979047"
                     /translation="MASLVPLSEIPTASLLYKLKRLAPASSQALSPSQTFNDKISLIR
                     NDITKLQVDCIVNAANESLLGGGGVDGAIHRAAGPYLYNECRTLRGCETGDAKVTSAY
                     NLPCKKIIHTVGPVYRLEEWPEYLLRSCYRRSLELAVEHNMRSIAFPAISTGVYGYPS
                     EEAALVALDEARQFLEHPDNIGQLERIVFCNFERKDEKAYEKWFPKFFPPTEQDLPHS
                     STQQNSRSKADGEFSPSPEILADKLPDPPTEDPSLDGQSEAKRQKLDSDDLGHSSITM
                     IDERSEDEWEEVNRSEDEGDKFERLRRSEIERSEETDDEPVEVDRASSAADVHSVQSS
                     GILGMDGSHEYRSVGNMLEKDW"
     gene            <469142..>470075
                     /locus_tag="ACHE_20147S"
                     /db_xref="GeneID:66979048"
     mRNA            join(<469142..469626,469703..>470075)
                     /locus_tag="ACHE_20147S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284418.1"
                     /db_xref="GeneID:66979048"
     CDS             join(469142..469626,469703..470075)
                     /locus_tag="ACHE_20147S"
                     /note="COG:O,U;
                     EggNog:ENOG410PRJJ;
                     InterPro:IPR036286,IPR037730,IPR019533,IPR000223;
                     MEROPS:MER0000598;
                     PFAM:PF10502;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0042720 - mitochondrial inner membrane
                     peptidase complex [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006465 - signal peptide processing
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA];
                     go_process: GO:0006627 - protein processing involved in
                     protein targeting to mitochondrion [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133211.1"
                     /db_xref="GeneID:66979048"
                     /translation="MLRPQPPKENTPSKPRVLAPEVAQSRSSKSPAPSPSPSEPAAAS
                     SSAANQSHPHTSNTTYKRQSFFSRFRKTYTTLPSQVRTTARVLRFLVPAIPIGIFFSE
                     HVFQVMWVRGPSMTPYLNEDYETMHTKSDMVLVNMWPWGGSGWPWERKRRLERGMVVT
                     FRSPANPAHTAIKRVVGLPGDRITTRDPCMKTSQIVPFNHVWLEGDAEDPRKSLDSNT
                     YGPVSVSLITGRVMAVLWPRWRLLNWADWERGVVEGDEGGRMGGDYRKGVRERVLKEA
                     VKMERPMLE"
     gene            complement(<471180..>471377)
                     /locus_tag="ACHE_20148A"
                     /db_xref="GeneID:66979049"
     mRNA            complement(<471180..>471377)
                     /locus_tag="ACHE_20148A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284419.1"
                     /db_xref="GeneID:66979049"
     CDS             complement(471180..471377)
                     /locus_tag="ACHE_20148A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133212.1"
                     /db_xref="GeneID:66979049"
                     /translation="MAASEKFDEKGRLEAVEDLTRALDFETTSTEAWLARWLANINWS
                     ESSPRRLVVTESKNSLLQTAQ"
     gene            complement(<471931..>475349)
                     /locus_tag="ACHE_20149A"
                     /db_xref="GeneID:66979050"
     mRNA            complement(join(<471931..472488,472542..474718,
                     474776..475166,475245..>475349))
                     /locus_tag="ACHE_20149A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284421.1"
                     /db_xref="GeneID:66979050"
     CDS             complement(join(471931..472488,472542..474718,
                     474776..475166,475245..475349))
                     /locus_tag="ACHE_20149A"
                     /note="COG:T;
                     EggNog:ENOG410PGVH;
                     InterPro:IPR029217,IPR039486,IPR001849,IPR040345;
                     PFAM:PF15407,PF15404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133213.1"
                     /db_xref="GeneID:66979050"
                     /translation="MSTQQAPDRPDVVPGTVHHERRRGLEPGSYTSKKLQHASPHHLH
                     MTNRRFFIGPIPEGWLQHHRKSWYKSGIKFKNYSSKTVSFSADPVVVHYEDDSPETDN
                     DPLSSGPEQEHTQNGIWEDEETQDDQGDQDSESNGQGPSRRSEEVDITSRRTGKSMAT
                     PTTETDAASSYMTAREIGGSVDDLGADTNANTSANAGTDKNLDRQEAGDIPPEQPVDQ
                     PSSQMLRVPSTGETDQSSPIASASESESTTALLRPKSGPKDKGMQRIIQPTLEQQEPQ
                     SEGTDLDESVPTGKFNGKGMIRGQKRMVKYSLDDNILDKQQRLLARLSRTHDSISANR
                     PHRRKLQKGEIIKAERMLVRVEQTMQRDLPDDYTENDSMRMETRVVDKWREFLVVCRM
                     ADEEYAPFTLQMYKTRVVPEVQKSGTKISPYYEVSLDNKRTRVNFYSSLDKTIVMWRP
                     SKHGTKIFIVRPKSTSHAVEWYTFMCQALGRDRPSSLQITVPDLDVSLLFKDPFARIE
                     AAIDAKNKNSQNGRNKAHPEECNVATAIIRGCMEMLENRTEWADVLREWSKSEKMGLA
                     WRRYDRLEWVLGVNEERMYGSIGMQDTHELELRPRQHYSTTVKHEGEKDHEPPPLEGF
                     LVRLTSQRGVHQRLNKMFFKRLYFFTQDHYLFFCRPAKSLPPPPPRLTSTNASNIPSS
                     QQILNEAPLCYDIDPFPLHDGDIRWTFSGNEEYLKRHDEEAYAQLHRNLHNICHSDGY
                     IDLCRVQEVRQVQRNSSPADPNIERGPDVEYNPDVRDTHQDDGATDQFDDDRTFEMLL
                     DNNLVIRLQAYNKDTRDEWIRRVDALVKYWKARTAADGAELKVVRQKNLEALDIDEEV
                     ESHIGQFALKWEVKKAVASPHLHNMCSLSHCRTIKMSGQLYRKPRRHSTFKRCNVILS
                     GGKLLIFRSSLRSRNGVEIAHIHQELETSIDLSDCYIYSGLLTDNDLLYANQTFDNSN
                     PGHHSLPRAYLSPDVFTTCDDDTAITFVIWQPLRKNYFRAKEYGKRGRTKQTLKHVST
                     LGVHGRTIVFKTKSRVEKDRWVLSIASEIDRIQEEQHENIRIVSAG"
     gene            <475814..>476592
                     /locus_tag="ACHE_20150S"
                     /db_xref="GeneID:66979051"
     mRNA            join(<475814..475937,475996..476054,476108..476226,
                     476298..>476592)
                     /locus_tag="ACHE_20150S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284422.1"
                     /db_xref="GeneID:66979051"
     CDS             join(475814..475937,475996..476054,476108..476226,
                     476298..476592)
                     /locus_tag="ACHE_20150S"
                     /note="COG:G;
                     EggNog:ENOG410PJIN;
                     InterPro:IPR014830,IPR036497;
                     PFAM:PF08718;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0120013 - lipid transfer activity
                     [Evidence IEA];
                     go_process: GO:0120009 - intermembrane lipid transfer
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133214.1"
                     /db_xref="GeneID:66979051"
                     /translation="MSTWFDTIQKSFADVPIDAANDNGISTTEFLEAAESLTTLFDVL
                     GSKAFTPVKNDLLGNIKKVKDRQQAAPAESATLQSLVVNELKEKKHTATEGLLWLVRG
                     LDFTAQALRHNLDNASKELADSFREAYGNTLKPHHSFIVKPIFSAAMSATPYRKDFYV
                     KLGEDSAKVQSSLETEVAALQQRVAILNEFLGRKEAKW"
     gene            <481644..>482978
                     /locus_tag="ACHE_20151S"
                     /db_xref="GeneID:66979052"
     mRNA            join(<481644..481796,481854..481970,482029..482411,
                     482463..482527,482578..>482978)
                     /locus_tag="ACHE_20151S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284423.1"
                     /db_xref="GeneID:66979052"
     CDS             join(481644..481796,481854..481970,482029..482411,
                     482463..482527,482578..482978)
                     /locus_tag="ACHE_20151S"
                     /note="COG:S;
                     EggNog:ENOG410PN1U;
                     TransMembrane:7
                     (o12-34i46-70o90-115i122-145o175-195i207-227o247-269i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133215.1"
                     /db_xref="GeneID:66979052"
                     /translation="MVEFAGRSESIFIVTIIFLVISLVAVCLRCFVRIRLVRAFGWDD
                     GLMVAAMVVNILFALCGIVGPIYGIGQTFEQLDMVHNLKKVQKAMFWWWLGQMSYVIV
                     VVLAKVSIALALLRLTVARVHAIILWVIIAFSIVIGLVFWFMLTLQCTPVSYFWERTG
                     SGSCIKTDYLIDIAYLYSVVATVCDFTLALLPIVLVWNLQMTTKTKAALAGILSMGCV
                     SSAAVIVRIPYLHYYKDPDFLYATTDISIWSNVEAGLGITAGSLVTLRPLFRWFRGDS
                     YARTYGAKPTTGSIPLSSMNGNLTNRSRNDPNNNHYWRSDLVPDNAQAMAITTHGSKG
                     SSQESLNPTQGQGHGHDPGYQGRGVSVQKSFYVSTEVV"
     gene            <483492..>484965
                     /locus_tag="ACHE_20152S"
                     /db_xref="GeneID:66979053"
     mRNA            join(<483492..483716,483766..>484965)
                     /locus_tag="ACHE_20152S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284424.1"
                     /db_xref="GeneID:66979053"
     CDS             join(483492..483716,483766..484965)
                     /locus_tag="ACHE_20152S"
                     /note="COG:G;
                     EggNog:ENOG410PJKR;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i55-84o96-116i128-146o152-172i184-204o216-236i257-
                     279o299-318i325-346o352-375i387-409o415-438i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133216.1"
                     /db_xref="GeneID:66979053"
                     /translation="MATGMRSDEGLIAQSSFQNDGPVSRTPGSGLDQRLEYDDSENVA
                     SQEDVPPDGGYGWVCTLCVFLINAHTWGVNSAWAVFLAHYLSNSTFPEATELQYALIG
                     GLSISQALLVSPIVSLSNRKLETRPTLLIGSILVFASLLGASFSTKIWHLFLSQGLCF
                     GYGMGFLYITATSILPKWFSRRRSLVLGMATSGAGIGGLAYNLGAGAGVESVGLPWTY
                     RILAFCSLAMNLLCSALLKDRKSPTPARSEGKAFDFREYARIQVILVVSWGFLTELGY
                     ITLLYSLPNYAISIGLSARQGSIIGAMLNLGLGVGRPLVGYYSDVLGRINMASVMTCI
                     CGILCLALWVPAKTFPVLIVFALLSGSVTGTFWSCFAPVTAEIVGMQRMPATLGMICF
                     SLVLPTTFAEPIALQIVGSFGYLSSQVFVGCMFLGGAVCTFALRAWKIYEIEMKARSE
                     MELELVEGADFWLTPRRLFTTRRV"
     gene            <486208..>490268
                     /locus_tag="ACHE_20153S"
                     /db_xref="GeneID:66979054"
     mRNA            join(<486208..486209,486275..489569,489621..489757,
                     489809..>490268)
                     /locus_tag="ACHE_20153S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284425.1"
                     /db_xref="GeneID:66979054"
     CDS             join(486208..486209,486275..489569,489621..489757,
                     489809..490268)
                     /locus_tag="ACHE_20153S"
                     /note="COG:P;
                     EggNog:ENOG410PFI2;
                     InterPro:IPR018303,IPR023298,IPR023299,IPR001757,
                     IPR036412,IPR008250,IPR023214,IPR006544;
                     PFAM:PF00122,PF00702;
                     TransMembrane:9
                     (o26-44i56-75o221-241i411-430o1051-1071i1078-1096o1116-
                     1136i1195-1215o1235-1253i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133217.1"
                     /db_xref="GeneID:66979054"
                     /translation="MAKLVDDPQIKYASLHNPLPIQLHTYVWPFLIIWPAFFAFYLSP
                     ERYDKYIQGQEWTFVWSGTIITLQSLLWLMTKWNINIETLFTATRANSLDTAQLIKVI
                     PDANAGSAEICPLVHEVKDGKKTFSFLFQKRRFLYYAERRCFAPLTYVLDDEPKPAIK
                     YFQQNRGFDTEAEINRIQEHYGDNKFDIPVPGFVELWKEHAVAPFFVFQIFCVGLWML
                     DEYWYYSLFTLFMLVAFESTVVWQRQRTLTEFRGMNIKPYDVWVYRNKKWQETTSDKL
                     LPGDLMSVNRTKEDSGVACDILLIEGSAIVNEAMLSGESTPLLKDSIQLRPADDLIEP
                     EGLDKNAFVHGGTKVLQITHPNTSAEGTEQQKPSIPAPPDNGALGVVVKTGFETSQGN
                     LVRTMIYSTERVSANNAEALLFILFLLFFALAASWYVWQEGVAKDRKRSKLLLDCVLI
                     ITSVVPPELPMELSLAVNTSLAALSKFAIFCTEPFRIPFAGRVDVACFDKTGTLTGED
                     LVVDGIAGLKLGQQGAKVEADGAHTELAKADSIDINTTLVLASAHALVKLDEGEVVGD
                     PMEKATLEWLGWTLGRNDTLTRKAGPASGSPTSFVESVQVKRRFQFSSALKRQSTIAS
                     ITSGDRKTSKRSKSTFVSVKGAPETIRTMLVETPPHYEETFKYFTRNGARVLALACKT
                     LSPEAELSQGRINDYARDEIESNLTFAGFLVLQCPLKEDAIKAVRMLNESSHRVVMIT
                     GDNPLTACHVARQVEIVDRDVLILDAPENDFSGTRLVWRSIDDKFNKDVDPTQDLDPK
                     ILDTKDICITGYALAKFKGQKAFVNLLRHTWVYARVSPKQKEDILLGLKDGGYTTLMC
                     GDGTNDVGALKQAHVGVALLNGSPEDLAKIAEHYRTTKMKEIYEKQVGMMQRFNQPSP
                     PVPVQIAHLYPPGPSNPHYQKAMERETQRRGAAALAAVNNAQSDVVETVTSPQAQALQ
                     QSMTPQQQRQQQASVAAAGFADKLTSSMMEQEMDENEPPTIKLGDASVAAPFTSKLAN
                     VIAIPNILRQGRCTLVATIQMYKILALNCLISAYSLSVIYLDGIKFGDGQVTISGMLM
                     SVCFLSISRAKSVEGLSKERPQPNIFNIYIIGSILGQFAIHIATLIYLSNYVYSIEPR
                     SNDIDLEGEFEPSLLNSAIYLLQLIQQISTFSINYQGRPFRESIRENKAMYWGLVAAS
                     GVAFSCATEFIPEVNEKLRLVPFSTEFKLTLTILMILDYAGCWVIEKVLKHFFSDFRP
                     KDIASRRPEQLQRERTRKAMEELQALAEKERQRKV"
     gene            <491029..>491499
                     /locus_tag="ACHE_20154S"
                     /db_xref="GeneID:66979055"
     mRNA            <491029..>491499
                     /locus_tag="ACHE_20154S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284426.1"
                     /db_xref="GeneID:66979055"
     CDS             491029..491499
                     /locus_tag="ACHE_20154S"
                     /note="COG:S;
                     EggNog:ENOG410Q26K"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133218.1"
                     /db_xref="GeneID:66979055"
                     /translation="MTDYTDTNTYGTTGTAYGTAGNTYDNTGTAYGTTGYGTTARDYD
                     TTGYGTTGYGTTGYGTTGYGSRYGSNAYDNTYGTTTYDNGYGTTAYDPSTGAYDQHMD
                     YRTDGSQRHHRERVNPSGTYRHRDVDRRDDGSTRVHREYDNPNTGTSYHRDFER"
     gene            <493319..>494660
                     /locus_tag="ACHE_20155S"
                     /db_xref="GeneID:66979056"
     mRNA            join(<493319..493611,493673..>494660)
                     /locus_tag="ACHE_20155S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284427.1"
                     /db_xref="GeneID:66979056"
     CDS             join(493319..493611,493673..494660)
                     /locus_tag="ACHE_20155S"
                     /note="COG:I;
                     EggNog:ENOG410PGUT;
                     InterPro:IPR013107,IPR037069,IPR009100,IPR036250,
                     IPR013786;
                     PFAM:PF02771,PF08028;
                     go_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133219.1"
                     /db_xref="GeneID:66979056"
                     /translation="MAPPASDPTVYQAHHDAFAAEGLPTSPAGWVERAQKVAGILAPD
                     AATRNIEQKVPHAEVSLLKSSGLTKILGDPKYGGGGQTWEVALRAIRELAVGDGSIGM
                     LLGYHLQWSSLTRVIGTEEQKERWEKTILETNSFVGAAVNPRDNDSRITPNGDGLVFN
                     GFKNFTTGGALSDLIVLEGVHMETGDHIFTIVPTKQPGFQFAYNWKNMGMRLTESGSC
                     KIEEIPFEWKDALGFDVEARKPIKELLESPYETLLGPIFQLVFANFYNGIARGALQTA
                     KGYTTTTTRPWPFTHNPQKSALDEHYILAKYGRYFASIRAADALCDVAGKEISDLFHG
                     YAGNKLDLTARQRGEVAESVTACKITSSHMALEVTGGVFEVTGARSTSEKYSFDRFWK
                     DIRVHTLHDPLAYKENELGRYYLTNEIPTPSWYT"
     gene            <494985..>497333
                     /gene="PEP7"
                     /locus_tag="ACHE_20156S"
                     /db_xref="GeneID:66979057"
     mRNA            join(<494985..495278,495347..495369,495437..495960,
                     496011..496385,496432..496648,496700..>497333)
                     /gene="PEP7"
                     /locus_tag="ACHE_20156S"
                     /product="carboxypeptidase Y-deficient"
                     /transcript_id="XM_043284428.1"
                     /db_xref="GeneID:66979057"
     CDS             join(494985..495278,495347..495369,495437..495960,
                     496011..496385,496432..496648,496700..497333)
                     /gene="PEP7"
                     /locus_tag="ACHE_20156S"
                     /note="BUSCO:EOG092629RT;
                     COG:S;
                     EggNog:ENOG410PG39;
                     InterPro:IPR017455,IPR036531,IPR011011,IPR021565,
                     IPR000306,IPR006642,IPR013087,IPR013083;
                     PFAM:PF11464,PF01363;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="carboxypeptidase Y-deficient"
                     /protein_id="XP_043133220.1"
                     /db_xref="GeneID:66979057"
                     /translation="MPPRTLGGGRVLGNANAFTPAAASSSPQQQQQPKGARVLSPSAS
                     SVSLGSQASASQFSSTESQDLISRISLENGDTSISAAPAAAGAQLACPICSEEMVTLL
                     QLNRHLDDVHQNLEDDRQDEVKDWFKVQMEKAKRFQPLAVLNQKLKGLDVFESNENIQ
                     PSLAGPSTRPLAPATSSSAQVPLPAPDNGPRPLDPDDVITKEHWQPRTFNDVCLEPTC
                     GKRLNATNGCVHCRKCGKLFCEEHTMYQMKLSRSAQHEPVRGLWSRVCETCYKSREGY
                     NDHNGLVRNQTDAFRAMRKPVVDKSTLEMSRLEKRLTRLTQLLANLPLEQIQSGGNKL
                     WSISWQNDQRKALEQTIVSWQDDASVPRCPFCQQDFSAYTFRRHHCRTCGRVVCGDPV
                     TGCSAEVPLSIAPMSRVPAEKGTTGLIDVDIRLCKECRATLFNRRDFEADILRKPPDL
                     RAYENLTQFERGIRILLPKFQKLLAALQDSRRPPSAAQIADASKVRKRLIDSFSQYDV
                     AARRIRDMPTDSITQKCLQKAVYQQASNFLHLHMLPLKSLPKILKHAIPNARLPSATS
                     SPTPSSSPANGHRPHESALASIKYGNPAANGSASSVTSETSSAISAMEAEEKSLRDRL
                     IVLEEQKFFVSEMIADANRRRKFDEVSSLAVNSEDLSREIDRVNGMLDGLDFEGVYTT
                     TGQPQV"
     gene            complement(497692..497764)
                     /locus_tag="ACHE_t20004A"
                     /db_xref="GeneID:66987338"
     tRNA            complement(497692..497764)
                     /locus_tag="ACHE_t20004A"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:66987338"
     gene            <499154..>499501
                     /locus_tag="ACHE_20157S"
                     /db_xref="GeneID:66979058"
     mRNA            <499154..>499501
                     /locus_tag="ACHE_20157S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284429.1"
                     /db_xref="GeneID:66979058"
     CDS             499154..499501
                     /locus_tag="ACHE_20157S"
                     /note="COG:V;
                     EggNog:ENOG410PHAF;
                     InterPro:IPR001466,IPR012338;
                     MEROPS:MER0006204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133221.1"
                     /db_xref="GeneID:66979058"
                     /translation="MSLPFLSELISALQAKIDAACDPTVNHHIPGVVSIVVDSHGAEK
                     FAYASGMRGIGSGIPMSLDNIFRIASCTKLITSIACLQLVEERLIDLDDVSFLEALLP
                     ELKDVDNCPPHIR"
     gene            complement(<500487..>503301)
                     /locus_tag="ACHE_20158A"
                     /db_xref="GeneID:66979059"
     mRNA            complement(join(<500487..502631,502711..>503301))
                     /locus_tag="ACHE_20158A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284430.1"
                     /db_xref="GeneID:66979059"
     CDS             complement(join(500487..502631,502711..503301))
                     /locus_tag="ACHE_20158A"
                     /note="COG:M;
                     EggNog:ENOG410PF8H;
                     InterPro:IPR011992,IPR010920,IPR016688,IPR006685,
                     IPR002048;
                     PFAM:PF00924;
                     TransMembrane:6
                     (i147-169o175-195i228-246o266-283i490-513o519-542i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133222.1"
                     /db_xref="GeneID:66979059"
                     /translation="MSSSTNDPKLQDQKGFNESCPTTDDDHIHHSFDNNHEPYLKPKT
                     PDDHDASSLRSRSSARETNTRLADDLAVMEAERVVSQSTHDGQSKKSRDHHSIRSRRS
                     AVDEFDEATNPLHERAALYQPPEKPTTKVARFVKTLHESSFVVRYLTYILPLVVILLI
                     PLLVGALAFPEANVGGVSLLWFSVWLEILWLTAWAGRVAAKCIPFPVGIFASIFTNNA
                     KKWRDVAKQLELPGTFFFWFLAVEISFLPTMKNHHVDGNKETRGWENTVNKIIISIFV
                     WTILNLIEKFLVQLIAMSYHSRTYSDRIDINKFQIGALAKMYAFSRTMLVDEKEDSGD
                     QQGQGPNGSHFMKPLQYAGKAQKVAKGALNKVGDVAGAVAADFTGRKATNRNDPHQVV
                     LTLLRTVPGSQGLARRLYRTYKRDGFDSIVANDLKTTFENDEEAETVFAMLDKDFNGD
                     LSMDELEAVLVEIGRERKAITSSLKDLDSVVSRLGNVLDVFVFIITLMVFLSLISTSA
                     AGVLTSAGSTILALSWLFSTTAVEFLQSVIFVFVKHPFDVGDRITVYGNTGAAGLGDD
                     YFVKQISLLYTEFKKMEGHIVQAPNSYLSTLFILNHRRSGALAEAVPIVIKFGTTIDQ
                     IETFRLRLQEFAASERRDFQSHVITEMREVTNNFSVTLNVVFFYKSSWQNEGLRLQRR
                     NKFICMLMVVLQEVGIQGPHMNWPGARLDIPFHLAGLSSLLSGSAAGHSPPSDPPTEN
                     DIPKKNTEDSGDGATHHPSILRKGMDTAAAQARGDSKPARKHVDFSLGMQNLSSADVM
                     GDVFDERTDRTEHLLRRAAAVKEEQEERELSERQSQSQSRSSSVQLPSHSDAGQGRRS
                     IESQHSRLSSASHRRFFRHRNNARSPNDPDVEQGGYDHNTQLTTAPTAPDHRDHL"
     gene            <506314..>508101
                     /locus_tag="ACHE_20159S"
                     /db_xref="GeneID:66979060"
     mRNA            join(<506314..506441,506499..506692,506747..506870,
                     506943..507159,507214..>508101)
                     /locus_tag="ACHE_20159S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284432.1"
                     /db_xref="GeneID:66979060"
     CDS             join(506314..506441,506499..506692,506747..506870,
                     506943..507159,507214..508101)
                     /locus_tag="ACHE_20159S"
                     /note="COG:P;
                     EggNog:ENOG410PM18;
                     InterPro:IPR018487,IPR036375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133223.1"
                     /db_xref="GeneID:66979060"
                     /translation="MTEPVAPSAVYSIRSEPVGLRIATGGSGQSGLLEALAKEFVKYC
                     VEKGVEPFLVEWYKSDTTFSIENLRKQIVDVGITYHAVAEQTALDDGVIDRVEYAWRD
                     HWMLVGPKDNPAGLENDQSTVYSLFTRLFSAMEESKDSPRPIKFLSRYDKSAGNIVES
                     LLWATIGQVPWADPPTSWYHMFPGFPFQAIREAANKGEYTITDKGTFWAVEKETRDKL
                     TIFAEGKDDENDPLLNPAHVLVGKHAKNKQRASEFADWIGWEHGGQQVIKDFQKNGKV
                     LYSTIPVGVDPLGRVKGIIGFSSSVKAAVPVPSHDDIYFFNNKQYTRVNPYTDTIYTY
                     VTDIFPMWPGLYQIGFAPVNAAFTTPEDPNEAYFFCETRCARVNLISGQLATGSAVFH
                     FHAKWSGLKDAGFDTVDATVSFAFIGSGYENAVCFFRKGKYALIDVYQNRTFESGDIS
                     SRFKALEKAKFKKIDAVVFKPGKQKREAYYFSGTQYVLVDLPGDYIASGPHDVGSSWK
                     SLRAAGFY"
     gene            <508518..>509678
                     /locus_tag="ACHE_20160S"
                     /db_xref="GeneID:66979061"
     mRNA            <508518..>509678
                     /locus_tag="ACHE_20160S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284433.1"
                     /db_xref="GeneID:66979061"
     CDS             508518..509678
                     /locus_tag="ACHE_20160S"
                     /note="COG:S;
                     EggNog:ENOG410PHCG;
                     InterPro:IPR025533;
                     PFAM:PF14388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133224.1"
                     /db_xref="GeneID:66979061"
                     /translation="MPVSLQTADHQAKKWTQTKQSTTEDLFKASCPNNHCASKQIIQS
                     AFSQPLDGNHISSSKHGFVYALYHAYSHHHHLTIRPDDVWVAILNQINFYVNAHAEEL
                     RSFFVAHEGQKELTVVEAGTIRTVDLGALAVKMTNEIQKNVLDPELQKWIMPEFSTTT
                     ANDKVVAAIQMMGTMQKYFSYTVCLLCGIPSVTLLGERDDWELLLKKLDKIPQLGKEP
                     AQFAELLTPVLKRFVACFDDPASPDLRDFWGRCAHYYSGGSGPTYLSGWVTAFCFWDE
                     DGKPLNHGRPGEWATGCELDGVAFHRVETEDIPAGYASVPVKLNDNGMEYDTMMLAGM
                     IGIQASSSGQLLEGASETGLDSIQPVSGWWMYEKTKESGSSVQIEEVYVTEV"
     gene            <510520..>510678
                     /locus_tag="ACHE_20161S"
                     /db_xref="GeneID:66979062"
     mRNA            <510520..>510678
                     /locus_tag="ACHE_20161S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284434.1"
                     /db_xref="GeneID:66979062"
     CDS             510520..510678
                     /locus_tag="ACHE_20161S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133225.1"
                     /db_xref="GeneID:66979062"
                     /translation="MKTLDKETNDKLNTCVAKVFAGKFAPDATAEARGEVKTILAGHA
                     DILRQVDA"
     gene            complement(<511664..>513347)
                     /locus_tag="ACHE_20162A"
                     /db_xref="GeneID:66979063"
     mRNA            complement(join(<511664..512720,512821..>513347))
                     /locus_tag="ACHE_20162A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284435.1"
                     /db_xref="GeneID:66979063"
     CDS             complement(join(511664..512720,512821..513347))
                     /locus_tag="ACHE_20162A"
                     /note="COG:S;
                     EggNog:ENOG410PVR9;
                     InterPro:IPR010354,IPR036188;
                     PFAM:PF06100;
                     go_function: GO:0050151 - oleate hydratase activity
                     [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133226.1"
                     /db_xref="GeneID:66979063"
                     /translation="MDHRQPNDMDAWILGSGVQSLAAAVYLIEEAKIPPNRVHILETI
                     GKASESTANAGDPVNGYEYRGGAVPVFSGDWIEDLLCKIPSQARSGKTALDDILELYE
                     VGPSDRTSYTRFLAEKPGGISRISTKQVSPGFRDRMDLSRLSGRTEKSLERSRISDHF
                     HGGFFKSEYWLMIATTAAEFRRYVRRFMHNSNGLNDFHPLYEGRVNIHQAVTVPIAAF
                     LESRGVDFQCHTIVTDIIMDPRDECHRISTIEWRKANEPKKGAINLAQNDIAIVSLGN
                     IMSGATTGTNTTPPDLELIEIHKDLDENWLLWLELCTKNPKFGNAYNFCTRMLQSRLE
                     VFTVTLKSPEFFNRFVALTGDQPGSVPYVTIKDSAWLFNISVPQQPFFPDQPPEVQVF
                     WGYAMHPEKTGDFIKKPMINCSGEEIMAELLHHLKFPLETITRDSITIPCILPRMTSM
                     LLPRVTSDRPQTIPEAMTNMGVIGQFVEIPNEVVCSMDYGVKGAQMVVRQLMGLQEPV
                     KPSKPKKSSVFGLSRFLML"
     gene            <515580..>517564
                     /locus_tag="ACHE_20163S"
                     /db_xref="GeneID:66979064"
     mRNA            join(<515580..515610,515664..515745,515804..516074,
                     516124..516912,516965..517301,517359..>517564)
                     /locus_tag="ACHE_20163S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284436.1"
                     /db_xref="GeneID:66979064"
     CDS             join(515580..515610,515664..515745,515804..516074,
                     516124..516912,516965..517301,517359..517564)
                     /locus_tag="ACHE_20163S"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410PFN0;
                     InterPro:IPR012132,IPR036188,IPR000172,IPR007867;
                     PFAM:PF05199,PF00732;
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133227.1"
                     /db_xref="GeneID:66979064"
                     /translation="MSSISSSSEACGTAGNVVAGRLAENPKVSVLVIEAGRGDPENIA
                     EITTPARAFECRNGPHDWKYKATMIDREDYTRVEKPNTRGKVLGGSSCLNYYTWVRGS
                     KATFDDWEEFGGSGWNWEGVKEYFDKPVTYHDDHNNYPHVRNIGLGGPLHIEHANLVP
                     ELQPFRDALLKAWQSKGLKVNDDIYSGYVSGLTHCATSIYKGVRSSSWSFLVGKPNIQ
                     VLSSSYGKRLIINGNCVTGVEVRGPNDEDIIIKARKEVIVAGGVYESPKLLMLSGIGP
                     GKELAKFSINVIVDSPHVGQNLIDHPILSHVFRLKNGLGLDDHLLRAGPQKEGAVTAY
                     NRDHAGALASGLLELVGFPRIDDRLNKIEAYVKAKQENGGKDPFGPAGQPHFEIDFVP
                     MFADAFQWHFPIPPEGTWLTTIVDLLRPMSKPGWVKLQSTNPLDHPHINVNFFENHLD
                     VIALREGVRFVDDILMTGEGIRDIIGEDYPWPMPRNSDEAMDKMILERAQIGFHPCGT
                     CRLSKDIKQGVVDERLKVYGLKNVRVIDASVFPVIPDCRIQNPVYMVGEKGADLIKAD
                     HKDLY"
     gene            complement(<517838..>518448)
                     /locus_tag="ACHE_20164A"
                     /db_xref="GeneID:66979065"
     mRNA            complement(join(<517838..518161,518239..>518448))
                     /locus_tag="ACHE_20164A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284437.1"
                     /db_xref="GeneID:66979065"
     CDS             complement(join(517838..518161,518239..518448))
                     /locus_tag="ACHE_20164A"
                     /note="COG:Q;
                     EggNog:ENOG410PFT4;
                     InterPro:IPR036291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133228.1"
                     /db_xref="GeneID:66979065"
                     /translation="MVFFGCKSVPFDPKQDIPPLNGNVILVTGGNIGLGKQCILEYAR
                     HRPELIWLAARNIEKGQTAAEKNRQQMRFLARKYPQFTCATIHPGVVRTNLMNSATGS
                     PLVIRLLGKVTEWTVTPIEQGVHDQFWASVSKDVKSGEYYEPVGIWGPVSPLGEDDAL
                     AQKIWDWTEKELAKYVV"
     gene            <519818..>521130
                     /locus_tag="ACHE_20165S"
                     /db_xref="GeneID:66979066"
     mRNA            join(<519818..519968,520050..520184,520253..520456,
                     520519..520886,520948..>521130)
                     /locus_tag="ACHE_20165S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284438.1"
                     /db_xref="GeneID:66979066"
     CDS             join(519818..519968,520050..520184,520253..520456,
                     520519..520886,520948..521130)
                     /locus_tag="ACHE_20165S"
                     /note="COG:Q;
                     EggNog:ENOG410PUZA;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240,PF13602;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133229.1"
                     /db_xref="GeneID:66979066"
                     /translation="MARDKSNTAVIVRVPDGQSPKLSKENIQIPSPESNQVLVKISHV
                     AQNPTDVQAFDSNAFGDGAVLGCDFVGEVVELGSGVTRYAKGDVIAGLVWGGETKGLG
                     GYSQYCLADERISFKIPSALSREHASTVPLALATAWLALFSKDCLAIDWSSGSTVLVW
                     GGSSSVGLYTIQLATIFGIKVVTTCSPKHANLVRSYGAKHVFDYKDPQVVEKIKQAAP
                     GLRYVFDTIGKPNSSATASNALAGKGSLCTVRPGKANTENVVDGTKITDVLVWTAFLK
                     DHAYGEFKWPASKADHELCSELFKKVSEWLEKDVVKPSNPKVFSGLDKVGYGFQEYRD
                     GKVSAYKIVYKV"
     gene            complement(<521637..>523305)
                     /locus_tag="ACHE_20166A"
                     /db_xref="GeneID:66979067"
     mRNA            complement(join(<521637..522579,522631..522825,
                     522881..>523305))
                     /locus_tag="ACHE_20166A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284439.1"
                     /db_xref="GeneID:66979067"
     CDS             complement(join(521637..522579,522631..522825,
                     522881..523305))
                     /locus_tag="ACHE_20166A"
                     /note="COG:G;
                     EggNog:ENOG410QDJ5;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i46-65o85-106i113-131o143-164i176-197o203-225i276-
                     300o312-332i339-359o371-391i403-421o433-458i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133230.1"
                     /db_xref="GeneID:66979067"
                     /translation="MANKPQTTHHENSFPIKPPNLDPTSLVRIPLTEEDSKRIRRKTD
                     RVILLILIWVYFLQILDKTVLGYGATFGMQEDAHLTGNQYSLIGSIAPIAQLAWQPFS
                     SFLIVKVPHRILMPVLCFGWGVSQAAMAACHNFGGLMATRFLLGLFEAGCLPLFSIIT
                     SQWYRRAEQPLRIAAWYSTNGAATVVAAALSYGLGHIKSNVLFPWQIIFLFVGLVTVV
                     TAPFVYWKLDNDIPSARFLTEEEKPQAMERLRANQTGTGNREFRMKHVAEAGIELKTY
                     LWIGMAMLLNIGASVTNVFGPLILSGLGFDNYKTTLLNMPFGALQLIVILVASYLAQK
                     ARLKAAILAAFMLPVVAGLAILYAIPRNQSVQGALLAGYYLLAFLFGGNPLIVTWIVG
                     NTAGTTKKSIVMSLFNAATSAGNIVGPLLFSEKDAPAYHPGLRACLGIFVALVAVVFI
                     QWGNLVVLNRMQERRRVRNGKPAKMVDRSMMNQYQEEGAQEDGEDGEQQIGDNAFLDL
                     TDRENDEFVYIY"
     gene            complement(<523624..>524453)
                     /gene="NIT2_3"
                     /locus_tag="ACHE_20167A"
                     /db_xref="GeneID:66979068"
     mRNA            complement(join(<523624..523964,524030..>524453))
                     /gene="NIT2_3"
                     /locus_tag="ACHE_20167A"
                     /product="carbon-nitrogen hydrolase"
                     /transcript_id="XM_043284440.1"
                     /db_xref="GeneID:66979068"
     CDS             complement(join(523624..523964,524030..524453))
                     /gene="NIT2_3"
                     /locus_tag="ACHE_20167A"
                     /note="COG:E;
                     EggNog:ENOG410PJIE;
                     InterPro:IPR036526,IPR044149,IPR000132,IPR003010;
                     PFAM:PF00795;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="XP_043133231.1"
                     /db_xref="GeneID:66979068"
                     /translation="MERSVAYIRNSLRYGSPEMEKIRTCALENKINVVLGFSENYHGS
                     LYIAQCIITDTGEIKAKRRKLKPTHMERTVFGDCTGDSLLNVVDTSVGRVGALSCWEH
                     INPLLKYHTYHQRELFHVAAWPPVHHHSGGSEFFSMSLEGTRILAQTYAIESSTFVIH
                     TTALIAEKGIKAMGTGEGTLMNIPGGGSSAIFGPDGRQLTEDLPEDEENLVIAEVSPD
                     KVLETRCFVDSCGHYSRPDLLWLGVDLEAKKHVRGV"
     gene            525281..525353
                     /locus_tag="ACHE_t20005S"
                     /db_xref="GeneID:66987339"
     tRNA            525281..525353
                     /locus_tag="ACHE_t20005S"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:66987339"
     gene            complement(<525768..>527917)
                     /locus_tag="ACHE_20168A"
                     /db_xref="GeneID:66979069"
     mRNA            complement(join(<525768..526207,526265..526405,
                     526454..527388,527446..527773,527842..>527917))
                     /locus_tag="ACHE_20168A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284441.1"
                     /db_xref="GeneID:66979069"
     CDS             complement(join(525768..526207,526265..526405,
                     526454..527388,527446..527773,527842..527917))
                     /locus_tag="ACHE_20168A"
                     /note="COG:P;
                     EggNog:ENOG410PGN6;
                     InterPro:IPR013122,IPR024862;
                     TransMembrane:8
                     (i232-252o264-282i294-316o336-354i375-393o435-456i490-
                     510o522-540i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005216 - ion channel activity [Evidence
                     IEA];
                     go_process: GO:0006811 - ion transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133232.1"
                     /db_xref="GeneID:66979069"
                     /translation="MGHWRDIFSVNGERARHRLHIEQRRLLPAYTVDEASPPHPSKEI
                     TKVALRLKYQIEQVVPCELQEDDLTNPNSRIITKDVIQTAKQAGTGELRGCVVIALLV
                     CLRWFKYQATVELWDSDLLESRAVASEVIAKRIIETEENQDFLFKECLLKRYSYFADG
                     EETTPANVIERAVDLHALRVIGSSGYQKCIKYLWNGWYCQEEGNPTNFVEYHKRDDPH
                     FTTHFHPDRMRAPVYQNVCQIVFSLVYLTLYSAVINTVNPTGDLDFAEGVLYVMTLAF
                     ICDELTKLWKVGRNYFDFWNAFNSTLYTLLAISFFLRIAALAHSSSADDEQRQELNRL
                     SYNFIALAGPMFWMRMMLYLDSIRFFGAMFVVLRVMMKESIIFFALLFVVLVGFFQAF
                     VGMAQVDADVPVTGSIIQGMANSIMQSPEFDTFQDFAFPFGIILYYLFNFIVMIVLLN
                     ILIALYNSAYEDISGNAVDEYMSIFALKTMQFIRAPDENVFIPPFNLLEIIFLVLPFE
                     WWLPRRYYAKINDFIMAVIYSPLLLIVASLETREARRIRWNRRRGEEDDDDVQEWEHV
                     AEEVDFEIDDTWRQTVRESTPNVNTDTCTVEIIKLQQQVKELTETVRLLTNERKNETM
                     SGVNGESSSSGSAHD"
     gene            <528444..>529328
                     /locus_tag="ACHE_20169S"
                     /db_xref="GeneID:66979070"
     mRNA            <528444..>529328
                     /locus_tag="ACHE_20169S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284443.1"
                     /db_xref="GeneID:66979070"
     CDS             528444..529328
                     /locus_tag="ACHE_20169S"
                     /note="CAZy:CE10;
                     COG:V;
                     EggNog:ENOG410PWZP;
                     InterPro:IPR029058,IPR013094;
                     MEROPS:MER0033242;
                     PFAM:PF00326,PF07859;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133233.1"
                     /db_xref="GeneID:66979070"
                     /translation="MSFFFYIYLKFAAVVIRSLARLQGKIISNPDAVRYIPSRDHQRT
                     IKAHFYRSPLHKELAPGPVLINFHGSGFVIPAHGSDDAFCRQISERTNYSVLDIQYRL
                     GPEDPFPAAVHDVEDVVKWVLKQSEEFDPSRVSISGFSAGGNLALVACSSLFPPATFH
                     SVLAFYPSVEAFVDPNTLAAPESGGTPLPAWLLRFFKQCYVPSNVDAKDPRISPYFAD
                     PIHFPRNVLIIAAGYDSLALEAERLAARLGEDADRHVVYERMEKCDHAWDKIAREGTR
                     EWELKSRAYELAIGMLEM"
     gene            complement(<532543..>533646)
                     /locus_tag="ACHE_20170A"
                     /db_xref="GeneID:66979071"
     mRNA            complement(join(<532543..533020,533082..533289,
                     533343..533505,533569..>533646))
                     /locus_tag="ACHE_20170A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284444.1"
                     /db_xref="GeneID:66979071"
     CDS             complement(join(532543..533020,533082..533289,
                     533343..533505,533569..533646))
                     /locus_tag="ACHE_20170A"
                     /note="BUSCO:EOG09263CAH;
                     COG:J;
                     EggNog:ENOG410PJGU;
                     InterPro:IPR012340,IPR022967,IPR003029,IPR044126,
                     IPR011488,IPR024055,IPR024054;
                     PFAM:PF00575,PF07541;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133234.1"
                     /db_xref="GeneID:66979071"
                     /translation="MSLTNCRFYEEKYPEVDSYVMVNVKQIAEMGAYVKLLEYDNIDG
                     MILLSELSRRRIRSIQKLIRIGRNEVVIVLRVDKEKGYIDLSKRRVSPEDVTKCEERY
                     NKSKAVHSIMRHVAEATQTPLETLYSQIGWPLDRKYGHSHDAFKIAITNPDVWKEIEF
                     PSEPVRRELMDYISKKLTPHPTKVRADIEVTCFGYDGIDAVKEALRTAEEQNTPENQI
                     KVKLVAPPLYVLTSQCLDKQIGIKMLEEAIQRIENKIKEVGGGCITKMAPKAVTEHDD
                     AALQELMDKRERENMQVSGDESQSESDEGVPE"
     gene            <534302..>536737
                     /locus_tag="ACHE_20171S"
                     /db_xref="GeneID:66979072"
     mRNA            join(<534302..534729,534785..535414,535466..535985,
                     536039..>536737)
                     /locus_tag="ACHE_20171S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284445.1"
                     /db_xref="GeneID:66979072"
     CDS             join(534302..534729,534785..535414,535466..535985,
                     536039..536737)
                     /locus_tag="ACHE_20171S"
                     /note="COG:P;
                     EggNog:ENOG410PI9V;
                     InterPro:IPR002645,IPR001902,IPR036513,IPR011547;
                     PFAM:PF00916,PF01740;
                     TransMembrane:10
                     (i143-161o167-185i197-217o247-270i282-301o336-355i367-
                     386o465-484i505-524o561-592i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0008271 - secondary active sulfate
                     transmembrane transporter activity [Evidence IEA];
                     go_function: GO:0015116 - sulfate transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0008272 - sulfate transport [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133235.1"
                     /db_xref="GeneID:66979072"
                     /translation="MADSDLPRRSIRDWLFDVVRTSYQTNASTTLEDRPATDSIPSDE
                     ATRQPPISAPDARTRLLESYDRSDPICGERKCNHGTFSPRPEDQRGLSWDASSIPPPT
                     STGDGYPGESSRRPELGPRSETVPSLESSASTLPLKNRRTLYMSYYIPFFNWITQYRL
                     SWIRGDLIAAMTVASIYIPMALSLSENLAHAPPVNGLYAFVFHPFIYAILGSSPLLVV
                     GPEAAGSLLVGQIVKNSVSQGHSGEDDPIANAMVVGVATAMAGVMILVAGLTRLGFLD
                     NVLSRPFLRGFITAIGFVIFVDQLIPEVGLTDLSKDTGVSHGTTVEKLVFFFRNIRNC
                     HGLTSAVSLGSFGIIMMFRTIKKMLERRFPQVIYFPDRLLVVILSAVLTWRFGWDQKG
                     LDILGETKNDSGGIFDFEWPFDFGDMRRVRTALSTSFIIALLGFFESSVAAKGLGEGT
                     SDGVKGMTVSANREMVALGVSNVVGGCFMALPAFGGYGRSKVNASTGARSPMSSVFLS
                     IITLVSILILLPYLYYLPKGVLSAMISVVAFSLIEECPHDVAFFIRLRGWSELVLMLL
                     IFVATMFYSLELGIALGIGLSILILIRHSTQPRIQILGKVAGTHDRFDNAELHPDKVE
                     LIEGALIVKIPEPLTFANTGDLKNRLRRLEFYGSTHAHPSLPRMRPPEHNKNIIFDVH
                     GVTSIDGSGTQVLFEIVKSYADVGTRVFFCRLANRDVFGRFERSGIVEECGGLSHFLP
                     RVDDALRMAESEERILDS"
     gene            complement(<536957..>538039)
                     /locus_tag="ACHE_20172A"
                     /db_xref="GeneID:66979073"
     mRNA            complement(<536957..>538039)
                     /locus_tag="ACHE_20172A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284446.1"
                     /db_xref="GeneID:66979073"
     CDS             complement(536957..538039)
                     /locus_tag="ACHE_20172A"
                     /note="COG:S;
                     EggNog:ENOG410PQYB;
                     InterPro:IPR025204;
                     PFAM:PF13092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133236.1"
                     /db_xref="GeneID:66979073"
                     /translation="MSQIPHHILNTSWTLHRLSPLHHNEEFQTLLDNPTAFNTYAARL
                     RDQLTGDVLSGLQTSLGASGVAEDDTLSKTGALRSCTWEGIPRFDDTFTSENEGQGQT
                     GILIILSYENTTYKAALLASPNNQQNQIKTQNTRKGVTSLPLLLTRTPTPLRQTLLSF
                     LSATFDTYPSPLRLPASFMCAGLDTYVNTFLSSGVRDAAGILQDAMRDVQLTLAFSGA
                     VAPSLRSLGVAVPKGSVGGFLRGNGAGGDDGGSFLGRLEGYLERHLAMNLDFGNGGMS
                     GNGGDLAKQHVRVSKIACGGFVIGSEGRMKLSADLRWQGDDIKDGDDGQSSQVLSEKE
                     RLELRASYAFLLGVLRRAVAGEGQMK"
     gene            complement(<538426..>539837)
                     /locus_tag="ACHE_20173A"
                     /db_xref="GeneID:66979074"
     mRNA            complement(join(<538426..539050,539104..539613,
                     539701..>539837))
                     /locus_tag="ACHE_20173A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284447.1"
                     /db_xref="GeneID:66979074"
     CDS             complement(join(538426..539050,539104..539613,
                     539701..539837))
                     /locus_tag="ACHE_20173A"
                     /note="COG:S;
                     EggNog:ENOG410PSDR;
                     InterPro:IPR001810,IPR036047;
                     PFAM:PF00646,PF12937;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133237.1"
                     /db_xref="GeneID:66979074"
                     /translation="MKPIVHLLLHVKKARSALDRGRKADTKQNNSSRHTVIGESKSST
                     SVVGKVNTLTSSPWDFLPAELQIKIFAYCGVGDLLPLRLVCRGFYQVLTSHEQLISRQ
                     YLRQRRHGTLPSPIESERTYTRNPEDDVVLLSDLFPPAKSAKGGHLYTFRYVHSLRRR
                     QKLCSRLCYYLADRVMDRFVQCENAFMKSMFPTRKEKNALVQRGIASLWFNLTPLMYY
                     TLYFLESYSLARREHTNTLLREFEAGRLPVPIPPHLRRSMYRELQVKILRSPPFTDSS
                     TLIATHHCMQLLLSYLRYTVPPEQGLQDDGWIGSLLTVSPFLRLVEYFSAEIGDGGNQ
                     RMQRKDFMYNFDNDIKMHEKDDKKSLVFERAPNWHAHHSAADIWFDAATEELALRNAV
                     PHDTEKIWIWDQIPLLLGCPHCRDESDGWYA"
     gene            <540331..>541236
                     /locus_tag="ACHE_20174S"
                     /db_xref="GeneID:66979075"
     mRNA            join(<540331..540961,541018..541114,541170..>541236)
                     /locus_tag="ACHE_20174S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284448.1"
                     /db_xref="GeneID:66979075"
     CDS             join(540331..540961,541018..541114,541170..541236)
                     /locus_tag="ACHE_20174S"
                     /note="COG:Q;
                     EggNog:ENOG410PMHZ;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133238.1"
                     /db_xref="GeneID:66979075"
                     /translation="MPYLAKKMSNNILILGATRGLGASLRKLYATNPSTKTVFATARG
                     NSPPESNESHTTWLTNIDVSQPDVGQKLTSQLPSSTEISTAIISAGYFGFESFDNPDW
                     EKQVKMYTTSAIGPVFVVQNLVKAGFLSEGSKVILVSSESGSIKLRHEKEGGGNYGHH
                     ASKSALNMVGKLLSLDLKDKGIAVGLVHPGFMRTEMTKSVGFDKFWDAGGAVTPDQSA
                     ESLASFIEDFDISKTGQYWAPRGPGDIGTADAVLGSDLPTPLQLPW"
     gene            complement(541716..541786)
                     /locus_tag="ACHE_t20006A"
                     /db_xref="GeneID:66987340"
     tRNA            complement(541716..541786)
                     /locus_tag="ACHE_t20006A"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:66987340"
     gene            <542621..>543756
                     /locus_tag="ACHE_20175S"
                     /db_xref="GeneID:66979076"
     mRNA            join(<542621..542913,542972..543464,543532..>543756)
                     /locus_tag="ACHE_20175S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284449.1"
                     /db_xref="GeneID:66979076"
     CDS             join(542621..542913,542972..543464,543532..543756)
                     /locus_tag="ACHE_20175S"
                     /note="COG:C;
                     EggNog:ENOG410PHPJ;
                     InterPro:IPR001972,IPR043202,IPR036013,IPR001107;
                     MEROPS:MER0192051;
                     PFAM:PF01145;
                     go_component: GO:0005886 - plasma membrane [Evidence IEA];
                     go_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133239.1"
                     /db_xref="GeneID:66979076"
                     /translation="MSASTDTGKHVAQNEGDRRTGGLVNVQPPRPDDLQPRYAHQIEE
                     DAQNPAAHGWYASMIHGLGSLIGCMGAVPCCFCCPNPFKPIEQGEVGLVSKFGRFERA
                     VDPGLVKVNPLSEDLKTVDVKVQIVEVPRQICMTKDNVSLTLTSVIYYQVTSPHKAAF
                     GITNIKQALIERTQTTLRHVIGARVLQDVIERREEIAQSTSEIIEDVAATWGVLVESM
                     LVKDIIFSDELQDSLSMAAQSKRIGESKVIAARAEVESAKLMRQAADILSSAPAMQIR
                     YLEAMQSMAKTANSKVIFLPAINQTVQQQLSTADSVGEGPSKYQDDGFQRAMNARVVE
                     DI"
     gene            <544344..>545387
                     /locus_tag="ACHE_20176S"
                     /db_xref="GeneID:66979077"
     mRNA            <544344..>545387
                     /locus_tag="ACHE_20176S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284450.1"
                     /db_xref="GeneID:66979077"
     CDS             544344..545387
                     /locus_tag="ACHE_20176S"
                     /note="COG:S;
                     EggNog:ENOG410PJ8B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133240.1"
                     /db_xref="GeneID:66979077"
                     /translation="MSSRISTPPIRTHSSPSPEKFTTTTTLPNFTSPTFDPAEYLNEA
                     LPPLTLASTQPNASRAPGSVPLTELSTQVQGVVSSVNAQNVKYSGQLTTLVDEILRGG
                     GRLAYEVEVLRGEVLGLVDGLVGEGDVVRFVPDRERQEKEKEKEEGERADNQTEHDLE
                     KQDKKEEKQDPDFINKLRTLNAVRSRLDEVVHTFGSAMEWPLPPSELSLTSSFISVSA
                     PDLGPESQSLEAKGQEMMKKFRTEVNELLDNEGVEAAERRVEEIGRLAGVWRGTAEEK
                     ARGRFVEGLLKIVEDRRRALEAVPGQAVPGQQGQPEKRSDGRTGHRRQESEGPGGGIF
                     RNLQRLREEIYLE"
     gene            complement(<545528..>546369)
                     /locus_tag="ACHE_20177A"
                     /db_xref="GeneID:66979078"
     mRNA            complement(join(<545528..545689,545757..545876,
                     545961..546210,546281..>546369))
                     /locus_tag="ACHE_20177A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284451.1"
                     /db_xref="GeneID:66979078"
     CDS             complement(join(545528..545689,545757..545876,
                     545961..546210,546281..546369))
                     /locus_tag="ACHE_20177A"
                     /note="COG:S;
                     EggNog:ENOG410PNCR;
                     InterPro:IPR001806,IPR027417;
                     PFAM:PF00071;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133241.1"
                     /db_xref="GeneID:66979078"
                     /translation="MAISEQLQDNTAITILLLGDPGCGKSTFLSSLKTPLARPSNTNT
                     PFPVSTTKPEILRDTDQPFLYDIRFSRKSFTLEFFDTASPNQHWTMVRPDVVVLAFDI
                     SDRRSLEGLREWRNEITLHFQHGYGEKIPVMMLGLKRDLRVEGEGVIYPQETYRIAQE
                     LRCDRYAECSAVTGELLAETFEDISRMGAMAKAGKSGEGVGGCTIL"
     gene            <546577..>548520
                     /locus_tag="ACHE_20178S"
                     /db_xref="GeneID:66979079"
     mRNA            <546577..>548520
                     /locus_tag="ACHE_20178S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284452.1"
                     /db_xref="GeneID:66979079"
     CDS             546577..548520
                     /locus_tag="ACHE_20178S"
                     /note="BUSCO:EOG09263UAJ;
                     COG:J;
                     EggNog:ENOG410PIEK;
                     InterPro:IPR020103,IPR001406,IPR020097;
                     PFAM:PF01416;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0009982 - pseudouridine synthase activity
                     [Evidence IEA];
                     go_process: GO:0001522 - pseudouridine synthesis [Evidence
                     IEA];
                     go_process: GO:0009451 - RNA modification [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133242.1"
                     /db_xref="GeneID:66979079"
                     /translation="MWRLQRRLCLSPVLLNEFIATANKQNPHTYRSLSTKQDPTAMSR
                     RAPPSCDAEEEGRPNYWAWDKDTLISRITSLERELHSRTSQHATNTTTTTTTRPAATT
                     LPSDTKVTDSEATLPPNKKLKKRCLEDDITQTPAPTRPAKAHREMDPSKYHTRFIALK
                     FAYLGQRYNGYEHANKNMTPLPTIEEELWKALRMTKLIFPANPSPAEQENVMKGNRVA
                     LLDWEGCQYSKAGRTDRGVSAFGQVVGIRVRSARPKRDVPGPKEGEEASTTDIQDAPE
                     DNWDDVADELPYINMLNRVLPEDIRVLAWCPHPPEDFDARFSCRERQYRYFFTQPAFS
                     PTPGPLGLAPRAPNASGSKHREGWLDIEAMREAAKYFEGVRDFRNFCKLDTTKQIENF
                     QRIIYRSEIELVDPKNVPLGFVNRPGFQPLADSDTQMDTDAPDTQVSEAAKVYVFKLD
                     GSAFLWHQVRHMVAILFLVAQGFEPPTVVRDLLDTTKNPRKPQYEMASDAPLVLWDCI
                     FPDQNSDNREDALEWIYAGDSKQGRSHSIKGDGKYGMGGVVDSLWSVWRRRKIDEILA
                     GSLLELAVSQGDQSSVSRWGLGDAGWEKKHRGQKVFVGSEEPRLGGKYVPVLQKRKMD
                     TVEDQNARWLAAKQRKNQATSQE"
     gene            complement(<548592..>549317)
                     /locus_tag="ACHE_20179A"
                     /db_xref="GeneID:66979080"
     mRNA            complement(join(<548592..548666,548714..548916,
                     548984..>549317))
                     /locus_tag="ACHE_20179A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284454.1"
                     /db_xref="GeneID:66979080"
     CDS             complement(join(548592..548666,548714..548916,
                     548984..549317))
                     /locus_tag="ACHE_20179A"
                     /note="COG:G;
                     EggNog:ENOG410PQ61;
                     InterPro:IPR019328;
                     PFAM:PF10181;
                     TransMembrane:2 (i38-56o88-106i);
                     go_function: GO:0017176 - phosphatidylinositol
                     N-acetylglucosaminyltransferase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133243.1"
                     /db_xref="GeneID:66979080"
                     /translation="MPGYLKVRRPSPTTASFTVSNASQCTSTPAKALSHLQFLLRAFI
                     FVTVLAVCAARLRSSFFAEDGSWVRWTAVWTSPFGELACRIADSYSPLVVTVVSVVAM
                     YGVFRKGYTEESLLVIRGLGIQTSTSSNTYLSKATTRFIPTAEIQDIVIHEAFKGFEV
                     RFYLAVIVEGERNVVVVFPNLLPRRAILEEVWRGSRHCLYDAK"
     gene            <549609..>550310
                     /locus_tag="ACHE_20180S"
                     /db_xref="GeneID:66979081"
     mRNA            join(<549609..550023,550076..550214,550289..>550310)
                     /locus_tag="ACHE_20180S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284455.1"
                     /db_xref="GeneID:66979081"
     CDS             join(549609..550023,550076..550214,550289..550310)
                     /locus_tag="ACHE_20180S"
                     /note="COG:O;
                     EggNog:ENOG410PQYQ;
                     InterPro:IPR039732,IPR029071;
                     go_process: GO:0006464 - cellular protein modification
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133244.1"
                     /db_xref="GeneID:66979081"
                     /translation="MDDRRRSRSPDRERPRKSTGGFRWKEKRRDDGDSRGAGDDRRLE
                     RGYRGGDRPRSPRRDRDRDSDRYGDRYRDGDRREDRGRERTERDEKEEKRERKREKRE
                     KKAAAAAQSAEPMIVVNVNDRLGTKAAIPCLASDPIKLFKAQVAARIGREPHEILLKR
                     QGERPFKDHLTLEDYGISNGVQLDLEVGTGD"
     gene            <551101..>552519
                     /gene="PRS5"
                     /locus_tag="ACHE_20181S"
                     /db_xref="GeneID:66979082"
     mRNA            join(<551101..552033,552082..552405,552463..>552519)
                     /gene="PRS5"
                     /locus_tag="ACHE_20181S"
                     /product="ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_043284456.1"
                     /db_xref="GeneID:66979082"
     CDS             join(551101..552033,552082..552405,552463..552519)
                     /gene="PRS5"
                     /locus_tag="ACHE_20181S"
                     /note="COG:F;
                     EggNog:ENOG410PGS4;
                     InterPro:IPR029057,IPR000836,IPR029099,IPR005946;
                     PFAM:PF00156,PF14572,PF13793;
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0004749 - ribose phosphate diphosphokinase
                     activity [Evidence IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA];
                     go_process: GO:0009165 - nucleotide biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_043133245.1"
                     /db_xref="GeneID:66979082"
                     /translation="MVRNICVIGGTSHPHLTQQICSVLGIPPADVLLSKFAVGETRVE
                     VKESVRGKDVYIIQSGGGKVNDMLLELLITISACKTASANRVTAVLPLFPYSRQSDIP
                     YNKSGAPLAKAPSAGKPGSSNGFTFESTPPTPLPGGNGTNNVESLQKGLAKAQLDELN
                     NGSPVKKRPANGLPRSDTLDSLKSESSRAAALNGVVMDDNASNTSSSKVHDFQPRPGY
                     RQWVAQAGTLVADLLTCAGADHIITMDLHDPQYQGFFDIPVDNLYGRPLLKSYIAQNI
                     PNYKQAVIVSPDAGGAKRATAIADSMGIDFALIHKERRPTKITDRQNATMMLVGDVRD
                     RTAILIDDLADTSNTITRAAKLVKKEGAAQVIALITHGILSGDAIDRINASALDKVVV
                     TNSVDQSEHLRRCPKLEVLEVGHVFAEAIRRVHHGESISVLFQYD"
     gene            complement(<552991..>554256)
                     /gene="VMA6"
                     /locus_tag="ACHE_20182A"
                     /db_xref="GeneID:66979083"
     mRNA            complement(join(<552991..553074,553129..554009,
                     554072..554160,554225..>554256))
                     /gene="VMA6"
                     /locus_tag="ACHE_20182A"
                     /product="H(+)-transporting V0 sector ATPase subunit d"
                     /transcript_id="XM_043284457.1"
                     /db_xref="GeneID:66979083"
     CDS             complement(join(552991..553074,553129..554009,
                     554072..554160,554225..554256))
                     /gene="VMA6"
                     /locus_tag="ACHE_20182A"
                     /note="BUSCO:EOG092638RC;
                     COG:C;
                     EggNog:ENOG410PJN9;
                     InterPro:IPR036079,IPR002843,IPR035067,IPR016727;
                     PFAM:PF01992;
                     go_component: GO:0033179 - proton-transporting V-type
                     ATPase, V0 domain [Evidence IEA];
                     go_function: GO:0015078 - proton transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:1902600 - proton transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit d"
                     /protein_id="XP_043133246.1"
                     /db_xref="GeneID:66979083"
                     /translation="MEGLFFNVNSGYIEGIVRGYRNSLLSNQHYNNLTQCESIDDVKL
                     QLAPAYGDFLASLPPNPSTSALAGKMTDKLVAEFRYLLAQATGSTARFLQFLTYGYMI
                     DNIALLITGTLHERDTRELLERCHPLGWFETLPVLCVATNIEELYNSVLVETPLAGYF
                     KESLSHQDLDELNIEIVRNMLYKNYLEDFHDFVNTHPDFQGTPTQDVMSEILQFEADR
                     RAINITLNSFGTELSKQERRKLYPEFGKLYPEGSLMLSRADDLEGVTLAVSVNADYKN
                     FFDAVGMTGGGGGFAGSGSDGKSLEDLFYQKEMELSKVAFTRQFTPSIVYAWMRLKEQ
                     EIRNVTWISECIAQNQKERIGNFISVF"
     gene            <554572..>556479
                     /gene="NOP58"
                     /locus_tag="ACHE_20183S"
                     /db_xref="GeneID:66979084"
     mRNA            join(<554572..554696,554789..554949,555014..>556479)
                     /gene="NOP58"
                     /locus_tag="ACHE_20183S"
                     /product="nucleolar protein 58"
                     /transcript_id="XM_043284458.1"
                     /db_xref="GeneID:66979084"
     CDS             join(554572..554696,554789..554949,555014..556479)
                     /gene="NOP58"
                     /locus_tag="ACHE_20183S"
                     /note="COG:A;
                     EggNog:ENOG410PIKN;
                     InterPro:IPR012976,IPR012974,IPR002687,IPR036070,
                     IPR029012,IPR042239;
                     PFAM:PF08156,PF01798"
                     /codon_start=1
                     /product="nucleolar protein 58"
                     /protein_id="XP_043133247.1"
                     /db_xref="GeneID:66979084"
                     /translation="MTLFILTETSAGYALLKAKDKKILKKEDLATEASTPEGVSNLLK
                     LKSFKKFDSAATALEEVASLVEGKVSPRLASLLDEIKDEKKVSLAVADPKLGNAIGKL
                     PDLSIQLIADSSTTDIYRAIREHLPTLIPGLLPQDMSTMSLGLSHSLARHKLKFSPDK
                     IDTMIVQAIALLDDLDKELNTYAMRVKEWYGWHFPELAKILNDNLAYARLVLKMGMRA
                     NWESSDLAEILPEEIEGAVKNAADRSMGTEISQDDLENIQALAEQVVGFSEYRQQLAS
                     YLTSRMNAIAPNLTALVGELVGARLIAHAGSLTNLSKSPASTLQILGAEKALFRALKT
                     KHDTPKYGLIYHASLIGQATGKNKGKMARVLAAKASLGLRVDALAEWDDDATEEDKSA
                     LGTEARYNLERKLAGMEGKPIKPRGVAIAPNGAAVQPKKFELNEARKYNADADALDSD
                     EPASAKKSKGDKKLIEEVQDEEMADAGEEESDDSDDEDSGKKKSKKSKDPELEKAAEK
                     AGLSVKRYQRKLERGEITFDADGNPTAVSKKDLKKAKKESKKSSKDDEKKRKRKDESE
                     AADDGEKKKKKKRKSDA"
     gene            complement(<556819..>557602)
                     /locus_tag="ACHE_20184A"
                     /db_xref="GeneID:66979085"
     mRNA            complement(join(<556819..557523,557597..>557602))
                     /locus_tag="ACHE_20184A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284459.1"
                     /db_xref="GeneID:66979085"
     CDS             complement(join(556819..557523,557597..557602))
                     /locus_tag="ACHE_20184A"
                     /note="COG:S;
                     EggNog:ENOG410Q0CJ;
                     InterPro:IPR038846;
                     go_component: GO:0005666 - RNA polymerase III complex
                     [Evidence IEA];
                     go_process: GO:0006384 - transcription initiation from RNA
                     polymerase III promoter [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133248.1"
                     /db_xref="GeneID:66979085"
                     /translation="MRIIDPQSATLSNIEVLAHITSHPPRRPPNPPPNINPRTFVPSP
                     DLRDHNTVIKEIHNYVSRLSPHLLGYPSYVHEEDMKRLEEVEAQIQAQAQSQGGGGQG
                     TGVMPAPRKRDLGPTEMDERLRGLVKGLQPFGLTKGEVLMILNLGVGFQQASAEGHGE
                     DGAGQEQMEVDQGQGEGKVEGEEEGQGEEGEGEGELPAEDYGALALLDTVIEEREERL
                     SNEDVGQVLAVIREALGP"
     gene            complement(<557846..>559685)
                     /locus_tag="ACHE_20185A"
                     /db_xref="GeneID:66979086"
     mRNA            complement(join(<557846..559456,559512..>559685))
                     /locus_tag="ACHE_20185A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284460.1"
                     /db_xref="GeneID:66979086"
     CDS             complement(join(557846..559456,559512..559685))
                     /locus_tag="ACHE_20185A"
                     /note="COG:S;
                     EggNog:ENOG410PR79;
                     TransMembrane:1 (i37-53o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133249.1"
                     /db_xref="GeneID:66979086"
                     /translation="MASLGAPGPSIDKQWSKLSTFTQQILPRRSRPRPTRTLLFAIAS
                     FCLLLLWLLRSSGEPAINYWTQFPSLHPFRASPEDASILIPHNSTLTRDDTLPVNLVK
                     NSPSFHVVVPARQKAPPLCRLITSAMILNYPPPTLINYGKSLPEGSTDYDAMVEKVSG
                     IYDYLSASRHVHDQDFVLLLDETDFFFQLPPEVMIGRFQNLLRERNAKLRKKYGLVGI
                     GSDASPEIVQKYSQRVLFGASKTCDLNKLNLSLDPGCVTVPQSALPPDVYGWKTDIDS
                     DIALNRPRWLNPGMAMGQVADLKLVYGQVLQFVEKQKRIKNADHVALTQMYGRQEYIR
                     ELERQRTSNGLMEWLYRQIGISDATNVTGAAIPYLKSGARYEYGIGVDSESRIFFDTT
                     HSKRDMEWLHYNNITKTSLVQMEHGVPREHRLLLPEDLTLPSPFYHPNLTKDEVSNPP
                     YNDTLDALPNPKNRSWRNLPLLTYIPSASVPALIHLDGNRVTRDGWWLKMWYQPWSRA
                     LLRKYMRTPLGFDVAQSALLGGQDWWDLRGGKGGIWTGQGEWMDYGEVCKGFERDVFE
                     DGFGAWGKEDGSEDGPVYNQFGNVVKGG"
     gene            complement(<561036..>561996)
                     /gene="RPS0"
                     /locus_tag="ACHE_20186A"
                     /db_xref="GeneID:66979087"
     mRNA            complement(join(<561036..561762,561827..>561996))
                     /gene="RPS0"
                     /locus_tag="ACHE_20186A"
                     /product="structural constituent of ribosome"
                     /transcript_id="XM_043284461.1"
                     /db_xref="GeneID:66979087"
     CDS             complement(join(561036..561762,561827..561996))
                     /gene="RPS0"
                     /locus_tag="ACHE_20186A"
                     /note="COG:J;
                     EggNog:ENOG410PGPW;
                     InterPro:IPR001865,IPR032281,IPR023591,IPR005707,
                     IPR018130,IPR027498;
                     PFAM:PF16122;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_component: GO:0015935 - small ribosomal subunit
                     [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="structural constituent of ribosome"
                     /protein_id="XP_043133250.1"
                     /db_xref="GeneID:66979087"
                     /translation="MAPSQLPPIFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKLR
                     PDGVNILNIGKTWEKIVLAARIIATIDNPADICVISARPYGQRAVLKFASHTGATAIA
                     GRFTPGNFTNYITRSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVD
                     VAIPTNNKGRHSIGLVWWMLAREVLRLRGTLASREAEWDTVVDLYFYRDPEAEENKEI
                     ADETKVPGAEEIGPAAVESGFAGENWDTQAPGAGAPGTAFAAASAVGAASWDAEGGDW
                     AASSAQPAAESWAETQPAENKW"
     gene            <562337..>563298
                     /locus_tag="ACHE_20187S"
                     /db_xref="GeneID:66979088"
     mRNA            join(<562337..562382,562433..>563298)
                     /locus_tag="ACHE_20187S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284462.1"
                     /db_xref="GeneID:66979088"
     CDS             join(562337..562382,562433..563298)
                     /locus_tag="ACHE_20187S"
                     /note="BUSCO:EOG092643JW;
                     COG:J;
                     EggNog:ENOG410PID3;
                     InterPro:IPR009068,IPR005290,IPR000589;
                     PFAM:PF00312;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133251.1"
                     /db_xref="GeneID:66979088"
                     /translation="MPPRFIIQPSLKAFTGSSHVQTPFAALALNPSKTIVRAGSAETR
                     ERKRHDPFAMAQTRQRKAANLSRQQALEAERDASLGDPIETEPTPFIQQIKSQLELQG
                     TTGAEAKPNHFIKPEEIQETMEFSKDLTSPIADVNRNIADPQLEKEAMKGHAEEAQNT
                     EEAIRRIVNLNNGNTKDRLRVNIQNCIETFGRHNTDTTLPPKPTAVSNQSGTERPEKT
                     PRVGPDTGSPEVQVAVLTTKILNLSRHLQTSNKDKHNKRNLRLLVHKRQKLLRYLRRK
                     ERGGPRWQNLMQTLGLTDAAWKGEISM"
     gene            <564307..>567818
                     /locus_tag="ACHE_20188S"
                     /db_xref="GeneID:66979089"
     mRNA            join(<564307..564883,565793..566281,566338..567256,
                     567308..>567818)
                     /locus_tag="ACHE_20188S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284463.1"
                     /db_xref="GeneID:66979089"
     CDS             join(564307..564883,565793..566281,566338..567256,
                     567308..567818)
                     /locus_tag="ACHE_20188S"
                     /note="COG:S;
                     EggNog:ENOG410PXY6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133252.1"
                     /db_xref="GeneID:66979089"
                     /translation="MRTRSQPMSPGGFLALEKEKNAPRQTRSMRARSASHASAQSNSQ
                     SETEEPQPQPTTRSRTNKKTTTTTGAKKDTTTKKTTTTRKTATTKRAAAARKTDTTAK
                     PSSKPAKAPATRAMKTRAERKTTRRTAEQSPEEESQEINDASQSPEVKAEPDTTANES
                     PKIPDENNEESQKPTEVTSSAVDVLSEPQASDLNRKRPRAESPDRASETPSVKRSRTL
                     RPPGSTSLARRLAPLSRRLSTNGVPYAERLRRRQAERQGRIHTTVFRLPELVAQTEAD
                     RRASESASPSPAPPAPQNSFDFPESSEPSRSMEESTPQEPRTPETPRGWNIRGLLSSV
                     PRFSVSRFLPRLGRSFGRTEEGEEIDPETASRQSTPSAPSTPTKTTAAPTQPPATERV
                     VTTEQWKAPGGSTPKSAPAKKPLPNLSYDLFPRPINRDLYLPRSPEPAAEAKDAEDSA
                     ANKDQRQKQEKQAQVSPETAPAEERGREITDTTDKKRKRAPSPDVIPNPPGCSYGLDL
                     DYFCYSDSDEEEEPSPSVSKPTPLAKSAVRSALRSETHPSKKVRFDASPEDTPSKKRG
                     RATDPYQGHHFLGLGDVSPTPVTDSAKTTPATPTVTGSPVQRPPGFKFNTQGSFGFDY
                     DDFSDDSSSSGASTPAILSPAGTLPETRATPRSQVQESLQSPRPAPHAAPSAPPSTPK
                     VDAEALAKVRSQAEKYKPKTPSGLRTASRYSTSPMVQSPNVEPLKKPEPKESIPEELP
                     EKENVPEKPIEKPAEKFGDDQFARDAEWLYERCPSGDFSKFTWPEKRSLVDSLEINPE
                     AVKILDNVWDSSDIEVGHTAFCRGMEEFAATFV"
     gene            <568577..>569284
                     /locus_tag="ACHE_20189S"
                     /db_xref="GeneID:66979090"
     mRNA            <568577..>569284
                     /locus_tag="ACHE_20189S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284465.1"
                     /db_xref="GeneID:66979090"
     CDS             568577..569284
                     /locus_tag="ACHE_20189S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133253.1"
                     /db_xref="GeneID:66979090"
                     /translation="MHFYNPNNPYPSCREAEATLYSFPEPSLYKTDERDCVTCHEIED
                     ITDITDMDMDASPASSEMEVASDSDNDSDESDDGGDIPFHTPHNYITPQQLQKQKQKQ
                     DRKRNMSIPTNLSSNSIPGPTTSSANSHTPRVIKPRGFFRREALSAPVMRLREKWKEN
                     VGVMAETALWSGHGDQFGYGFGGRFGFGDVIQTGIGFGIGSVGAGEGRGPGARRFYRG
                     GRGEIGLGHGLSDWVPY"
     gene            complement(<569419..>571457)
                     /gene="SPB4"
                     /locus_tag="ACHE_20190A"
                     /db_xref="GeneID:66979091"
     mRNA            complement(join(<569419..570553,570609..571115,
                     571168..>571457))
                     /gene="SPB4"
                     /locus_tag="ACHE_20190A"
                     /product="ATP-dependent rRNA helicase spb4"
                     /transcript_id="XM_043284466.1"
                     /db_xref="GeneID:66979091"
     CDS             complement(join(569419..570553,570609..571115,
                     571168..571457))
                     /gene="SPB4"
                     /locus_tag="ACHE_20190A"
                     /note="COG:A;
                     EggNog:ENOG410PIRE;
                     InterPro:IPR025313,IPR027417,IPR001650,IPR014014,
                     IPR014001,IPR011545,IPR000629;
                     PFAM:PF00270,PF00271,PF13959;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="ATP-dependent rRNA helicase spb4"
                     /protein_id="XP_043133254.1"
                     /db_xref="GeneID:66979091"
                     /translation="MAPKPPSGTSARSWDGVNPPLSEWVLEAVSSMGFTRMTPVQASA
                     IPLFMAHKDVVVEAVTGSGKTLSFLIPVVEKLLRLEEPIKKHHVGAIIISPTRELASQ
                     IYKVLLSLLEFHPASAAAINPSDDDDAHPKKHSSTYKVVPQLLLGGATSPAEDLSNFL
                     KRSPNLLVSTPGRLLELLSSPHVHCPQSSFEMLVLDEADRLLDLGFKDDLQNILRRLP
                     KQRRTGLFSASVSEAVDQIVRVGLRNPVKVMVKVKGSSGALDKRTPASLQMTYLTIPA
                     LHKFPALRKILSSVQPTPQKTIFFVSTCTGVDYLSAILPSILGDEYSLIPLHGKHPAT
                     VRQKNFNAFVNSQTPVILLTTDVASRGLDIPAVDVVVQLDPPADPKTFIHRCGRAGRA
                     GRRGLSVVLLHPGREEDYVSFLEVRKTPVTAFPYPIDITDEDAATATETARKIVLKDR
                     AYHDRGQKAFVSWLRSYSKHQASSIFRVADLDWEGLGKAWGLLKLPKMPELRNFTGDR
                     TLGVNIDWDKYAYKDKQREARRKEALAEAQNGTTEDNQQSNKRRASESVAWSNNIENR
                     NKKAKRREQKKAKQDHNRWEKMTEEEKQKVRETEKMLEEIKQKNDEERRLRREAKKAG
                     NGGGNAGDGAEEEEFEGFD"
     gene            <572004..>573149
                     /locus_tag="ACHE_20191S"
                     /db_xref="GeneID:66979092"
     mRNA            <572004..>573149
                     /locus_tag="ACHE_20191S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284467.1"
                     /db_xref="GeneID:66979092"
     CDS             572004..573149
                     /locus_tag="ACHE_20191S"
                     /note="BUSCO:EOG09263OD3;
                     COG:I;
                     EggNog:ENOG410PFIS;
                     InterPro:IPR037997;
                     TransMembrane:7
                     (i141-158o170-187i208-228o234-255i267-288o329-351i363-
                     380o);
                     go_function: GO:0004143 - diacylglycerol kinase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133255.1"
                     /db_xref="GeneID:66979092"
                     /translation="MPRSQDVPETPRVISPTSTSPDGSRLRDDYFGPTTRSAARRQRQ
                     TGVPEKKTDENDSTSKRTRTRSRNSTTPNGTARQRKPTPITPAKKEEVEANGKTNGYL
                     SPLSKVQQDLHDVSSRSPSPLGIIPLHSRYRNFIHRHEIPRKLLHVSIGFITLHLYSR
                     GVQPLQITPWLFSALVPIAATDVIRHRSETVNKLYIRCVGALMRETEVSGYNGVIWYL
                     LGAYAVLRFLPKDVGVMSILLLSWCDTAASTFGRLYGRYTFQLRKGKSFAGSLAAWFV
                     GVAAAAAFWGWFVPYIGAFPNDPEGSSMFTGSLNLIPDCVRNLLGWTTETSKAIITGP
                     LALGVMSFVSGIVAAGSEFVDIFGWDDNITIPVLSGFGLWGFLKVFG"
     gene            complement(<573690..>576402)
                     /locus_tag="ACHE_20192A"
                     /db_xref="GeneID:66979093"
     mRNA            complement(join(<573690..576297,576389..>576402))
                     /locus_tag="ACHE_20192A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284468.1"
                     /db_xref="GeneID:66979093"
     CDS             complement(join(573690..576297,576389..576402))
                     /locus_tag="ACHE_20192A"
                     /note="COG:S;
                     EggNog:ENOG410QE0J;
                     InterPro:IPR041177,IPR006086,IPR006084,IPR006085,
                     IPR029060,IPR036279,IPR037316;
                     PFAM:PF18380,PF00867,PF00752;
                     go_function: GO:0004518 - nuclease activity [Evidence
                     IEA];
                     go_function: GO:0008821 - crossover junction
                     endodeoxyribonuclease activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133256.1"
                     /db_xref="GeneID:66979093"
                     /translation="MGIPGLINAIGPGERVSLSKLAITHLEQTARPIRIAVDISIWLF
                     QVQAGRGGRNPEIRTLFYRLLKFLALPIHPLFVYDGKNKPPFKRGKAVSGQGNAPIIQ
                     ISKRLIDLFRFPRHDAPGEAEAECANLQRAGIVDAVMSNDVDAMMFGSKMTIMNFSKE
                     SGSTTSASHVTCYRMDSQAATSNVNLDRPGMVLFAMLSGGDYLPSGVPKCGSKLAAEI
                     SKAGFGSDLLDAINAKGTKRTEQLSEWRERLQYELEANESGYFNTKHKAVRIPQSFPD
                     QTILEYYASPAESNAEELALLQRRLINAWDQDIEPLEIRHFAARFFEWNYRSGARKVI
                     RLLAEPLVSYKIRLRRQLNGSKLSNSDIPMLRKVYKSRASYSTDGLTELQVDVIPINV
                     VGLDLFAEEPNPPLPSQASEEAAASGDEVDDDPEAPVESAPQSPVKKRVNKRYDPYAP
                     EKMWVFEALARIGIPDVVEQWEKEQAAKLAAKKPTNRKTGPKKKGPLDPGMKHGSILK
                     YGTLTKPRPEVSQFKQAQLFEAAIPSTPNSSQSPKMASRSHTRTASSNPHMPGPGTSW
                     ATSLDNLVDIFSPSYAIPPELSAKRRSRGRPRLESRRAAICSDGIELVDSEASGDEFT
                     LNKPSPPPIRPQRLKISVDYPVLPEVEEKPKPKAKTKITTPPSSPSPTKKSNRRALRV
                     IQDVPEDRKTVEKLGEFLSKPSSKHNPVSDGQAEAHDCVESASPKRRSPRKKTPPTPS
                     TDKPTPEHKKDNKTSSVMKYLLQELPDKKKEKKHQAPKQRAKENKEPSPSGSLEAKDS
                     KEQTKPIEDRSSTTKGTSQHVDAVIWHDSSWTVEPALESENNNDRAKDGDDLGSQGRE
                     TKAKKKRIPRVSILDLT"
     gene            <576799..>578484
                     /locus_tag="ACHE_20193S"
                     /db_xref="GeneID:66979094"
     mRNA            <576799..>578484
                     /locus_tag="ACHE_20193S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284469.1"
                     /db_xref="GeneID:66979094"
     CDS             576799..578484
                     /locus_tag="ACHE_20193S"
                     /note="COG:Z;
                     EggNog:ENOG410PHP7;
                     InterPro:IPR043129,IPR004000,IPR027127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133257.1"
                     /db_xref="GeneID:66979094"
                     /translation="MASASSISAGDSKRFSGSHVPYNLRHSQTARPSSPSTPQHQLRS
                     NNSSFASTSSGSSFRGEEDAIIFELGSRWLRAGFEGESTPMCTVRFGPEESRRTGDYR
                     GWLNYGPSTDSERFASPEQWASAYELWGMDLRKVDLGLVEDKIERVVRETYNKYLLTD
                     AGTTRLVLVLPSLLPHPLMASVLSTLFNRWRFPSITLLPAAAMSATAAGVRSALVVDL
                     GWAETTVTSVYEYREVVHKRSTRAMKHLLQETGRFLTHLTSPSTQDPTTDELSVNFEY
                     CEEVVTRFAWCKPHAQTEPTDLPNTTVSIPSPSNPGSEYIDIPFPKLAEPVEKALFAL
                     GIPECDLDDEEKPLPLLLYNTLLALPPDARGVCMSRIIFVGGGSHIPGIRKRILNEVN
                     ALIKTHGWTQVRGKAIERQRTRLQNLSLTSNPNLNTTTNNNPSSTGPSTGTTTPIQEH
                     AATASHTPSIDDEGDNEIDFVEQKLQRNRDRDFKPPVQGILREVESLGPWAGASLVTS
                     LKIRGMVEIEREKYLQHGLAGASRDLEHGYVPDRRSGLRTGGDRSSWTLAGWG"
     gene            complement(<578634..>580025)
                     /locus_tag="ACHE_20194A"
                     /db_xref="GeneID:66979095"
     mRNA            complement(<578634..>580025)
                     /locus_tag="ACHE_20194A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284470.1"
                     /db_xref="GeneID:66979095"
     CDS             complement(578634..580025)
                     /locus_tag="ACHE_20194A"
                     /note="COG:G;
                     EggNog:ENOG410Q2XP;
                     InterPro:IPR014718,IPR008183,IPR011013;
                     PFAM:PF01263;
                     TransMembrane:1 (o30-47i);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016853 - isomerase activity [Evidence
                     IEA];
                     go_function: GO:0030246 - carbohydrate binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133258.1"
                     /db_xref="GeneID:66979095"
                     /translation="MLLDPPPSSRSRIPRLLGALLCPARFSPRVLLLYCFIFFTVTVL
                     LGIRMHVGSYLSTVLYGLPVLAQAQSSVTLSAAPSSNTAESGSAVDPFKAYTIKAENI
                     TATLIPYGARLTSVLVPDRDGNQQDIVLGYDDPRDYLKDTETNHTYFGAVVGRYANRI
                     RNGTFALNGEEYEIPRNENGLNTLHGGYVGYDQRNWTVTTYSESTVTFTLLDRGFEGF
                     PGDVVTHATFTVDNNRTPDNPDGLPLLTTKLVSLALTEKTPIMLSNHIYWNLNAFKEE
                     NILDDTFLQLPLSKRFVGTDGLLIPNGTILDVHSAYNGSADFTTGKLVGEDIEDAEGL
                     CGTDCTGYDNCFIIDRPPQSAAQDSLVSILHANSSTTGISLEVKSNQQAVQIYTCPSQ
                     NGSIPIKPSQEKRNEGQGASSVNAYGCLVIEPEGWIDGINHPEWGQLPYEVYAPDTAP
                     AINWATYKFGTIA"
     gene            <580827..>584936
                     /locus_tag="ACHE_20195S"
                     /db_xref="GeneID:66979096"
     mRNA            <580827..>584936
                     /locus_tag="ACHE_20195S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284471.1"
                     /db_xref="GeneID:66979096"
     CDS             580827..584936
                     /locus_tag="ACHE_20195S"
                     /note="COG:L;
                     EggNog:ENOG410PW8Z;
                     InterPro:IPR017956;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133259.1"
                     /db_xref="GeneID:66979096"
                     /translation="MSSRSSSSSSDILGPAGDSEYLLSSPTKPPGGRQHFMSMSPAPN
                     FKFLQTPGSVKGKRQRTSLSPSKSAHSIRFDDVLLPATPALAKLAGGQPMSLSPEKDQ
                     GESGNPWRIRVTLEATQDEENEGNNQKSPTRRVLYPSTTMTTKVPLKDERDQPEPTPR
                     RRRGRPRKTEIQALPDATPTQASPGHTPGAKGANGQSRPRGRPRKGTPVPVERHVEEQ
                     PTPALPEQSSPLNLEQPTPVPVPGRQRSSQLNFGEEEQPTPASVPDQQRYDPFNLESE
                     DQPTPGPEFEQRSSPLNFEQPTTSPDSRRERHSPLNLGVEEQPNPDSELHQERYSPLN
                     LGADGDSEDDELPDAPLPAYDFQEEDETMRPDPTDWNRSSPRVTFAEPAYETPDVGAI
                     DRDDDDGKLHSTPSKMPSSIRQGSIQEPLNSSPANTVNAGRTPRPPPRLYPTPTSSSL
                     VDEENHEQDNLDEEVPSSDPHDTQGEATDHPSDDYGDPADEHRDPTDEHREYDSIVES
                     EGFSMVSLDTLPSAKQHGISTNSDRIKGPLRPFLQRESIGREKTKRKASSMGSDHNEN
                     AHANASSNPEPINEPPRKRQSRSPPKRQSRSPAHRRRPGHPATHDEAFEQRAPPSPPA
                     EPTAPTPADNRLRPISRLAKIVRAGMVLEGAFRQNPEVEERPDRKIAIEEPKKRLESV
                     FSDFDYDTQQQLRAGLGLGQEIAKKKIQAEIERERAEQEEASRNAAAHDTYDQDQYED
                     ERPEEEEEDTSETPRQQGQRSVQDTPGPETAMRRRMAEWQQERESISREIDKANSSQV
                     IVINSDDEASRSPERSRAYPGFDVGGPDSDSGSDFNQGPELEPGSEGNLPEDEAGHPD
                     EEYEANKVGEEQEDAQVEEQEEYEGEELYPQQPHMQQPEEEEEQYAREQEDDDGYSDI
                     WQQEAQEHSQISHQSSMHQGSMRQSSIRRDEDDARYRQESSPLKDDRSAAPSEYGAFS
                     PAPWTHQREKVPYLGGQSRVRQLREQEVDLSMLLGASNTPNHSRYYYGRSSPLSTGSA
                     RPSQRAAPQFSPRYGENGVHGQEQPLSELGLVSSPLKHSDDDAFQVDPTTRIEHERMQ
                     HDRRRDQEEEDFEYSDAAVAEERFIVGNVEMTPQHPRPANPANPDVQGSTWFQRLASL
                     TPGWLKAPISRSPARPSRVSEEYEDSDDDPVSDDGSAEDANAHPHGADGADVDEQDEI
                     ERTFRSSRRFTEWRQYEEPQSSPESRAAQQPDRAFSALGEESPVRSRPLAISGHFSNE
                     HYIILRRLYRLATQFPERFTYYPAPGRDQIIGDWIWTSDGRHGVPVTEGQFAVIDQFV
                     QELATGDLDSGGTGQIGWTEADLHRRLISVIIGEKIRAERKAKISGGDM"
     gene            <585939..>586642
                     /locus_tag="ACHE_20196S"
                     /db_xref="GeneID:66979097"
     mRNA            join(<585939..586337,586433..>586642)
                     /locus_tag="ACHE_20196S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284472.1"
                     /db_xref="GeneID:66979097"
     CDS             join(585939..586337,586433..586642)
                     /locus_tag="ACHE_20196S"
                     /note="COG:S;
                     EggNog:ENOG410Q2P0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133260.1"
                     /db_xref="GeneID:66979097"
                     /translation="MRVGNRVKHIFSFSFTNRRPNRSMWKEKSPAVVTDDDTSSYSDD
                     SDSDDAIHISEDEGSDPSDVDVDDDDEYATSPNKRVRIISWRLDNNNNKMVPGRCRWT
                     LEQERRLQAAQQQLARCQKAWSSEQEVWLKHIEKLHEEKEAHEDFVHLRAKQQEDERV
                     HFRKALKRREQEQGDSGTASEEDEGLRRNQSLSRLRRLRRFS"
     gene            <587009..>589245
                     /locus_tag="ACHE_20197S"
                     /db_xref="GeneID:66979098"
     mRNA            join(<587009..587067,587121..587226,587279..587334,
                     587387..588674,588724..>589245)
                     /locus_tag="ACHE_20197S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284473.1"
                     /db_xref="GeneID:66979098"
     CDS             join(587009..587067,587121..587226,587279..587334,
                     587387..588674,588724..589245)
                     /locus_tag="ACHE_20197S"
                     /note="COG:K;
                     EggNog:ENOG410PKVB;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133261.1"
                     /db_xref="GeneID:66979098"
                     /translation="MPRDGSRGRLRSYEACLNCRRKKTRCPAERPVCSSCARLNQTCL
                     YTSARRASHQSEDRLASLEEKVDFIMKGSKPCDEDPSPAKSSSNSLPSESNYVLNSLL
                     TPELGFEGPEDSSLHISSPTVAKTVDLYFQYCHRQPIWCFNYEDLEEMGFLPKELVYS
                     ILTLTSRFYAHDHNQAQFYSNTARTLIMLRVASGTVDLETIESLCLLTYSLFMDGNVS
                     LGQFHLGFAFQLCLTAMIDVEAAAPTKSPLTQRKKRVFWSLLSLERSYGHQNRLLRLS
                     AEPLCPCCVPDKTEGDETMSCSDPEIDIWSLSSHFGWVWSRVRTYVSDCAQNNLKEPW
                     RHDSMYTMILSDLTSAENKLSQNHRYDSVKFYERTASEVRLNKSYWGPWLKLQFTYHC
                     ILTMLNHPFLYIVASQHNPNLAIPNAFWRRSSELALLHATWIVRIIDMVTEKEMRLTE
                     AFFGHAAAVAATVHLYYCRAADPRLKFKSKTDLAKCRRFLEGFVEFSPACRALDQTLE
                     KIIHMAFGSENVDYDWTPSRIYLSVSLMWDILRANCMPESQEPSTTGLLHPSLAPTIT
                     RESSAQSSSTLEIIVAMSPEVTVNTADGGQAAHMPPRVRSMTATITTPAPSSPDIDLG
                     GERLVVPNDNLMLNTPWLWTDPSQFGDVDGLNRQELENSMDGLFTWWDLGNL"
     gene            complement(<589346..>590749)
                     /locus_tag="ACHE_20198A"
                     /db_xref="GeneID:66979099"
     mRNA            complement(join(<589346..589586,589641..>590749))
                     /locus_tag="ACHE_20198A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284474.1"
                     /db_xref="GeneID:66979099"
     CDS             complement(join(589346..589586,589641..590749))
                     /locus_tag="ACHE_20198A"
                     /note="COG:E;
                     EggNog:ENOG410PUIZ;
                     InterPro:IPR006076,IPR036188;
                     PFAM:PF01266,PF13450;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133262.1"
                     /db_xref="GeneID:66979099"
                     /translation="MAGDKNQKIVIVGAGIFGLGSALTLKQQGYQNVTVLDRALPPVP
                     DGSSNDISRVIRFDYGDEVYARMAKEAYDLWLTPTFKEAFHQTPCLWVTQKESPGQPV
                     QEMAEKYSRKTRDVLTKMGEPWHSVPSAEQAKREFPGFTGNLGSPGFDAFCNTSAGWA
                     DAGLATQRLAARCVNAGVSFITGPNGNVTDFEKRSDGSIKAVRTSGGNSLAADMFIVA
                     TGAWSASLIPSWNTMLAAAQIVGYMRLTPEEMVKLKDLPIYFNLSTGFFCFPPHDGTG
                     FLKVACHGYGYTQSGENNISAPPNAPPSARANFIPEDGIKRLHAGMRDIFPDLEPRGF
                     EKVGLCWYNDTPSGDFIMDYHPDHKNLFIATGGSGHAFKFLPNIGKYIVGCFDKSLPQ
                     DLLEKWKFPTEFKNQLQDDIFRGDGSRGGPERRELSPQERDTFNTALKATSSRQSKI"
     gene            <591640..>593013
                     /locus_tag="ACHE_20199S"
                     /db_xref="GeneID:66979100"
     mRNA            <591640..>593013
                     /locus_tag="ACHE_20199S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284476.1"
                     /db_xref="GeneID:66979100"
     CDS             591640..593013
                     /locus_tag="ACHE_20199S"
                     /note="COG:S;
                     EggNog:ENOG410PUTI;
                     InterPro:IPR005302,IPR005303,IPR011037;
                     PFAM:PF03476,PF03473;
                     TransMembrane:1 (o12-36i);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030151 - molybdenum ion binding [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133263.1"
                     /db_xref="GeneID:66979100"
                     /translation="MLLQLVQSLQGLNAATVLYFGITAALLLSLGFAAIVQNGNTSKT
                     RRSLRNLRRFGLSTGNSNMTDQYSPKYAIPEDIPTNGPIRIKSIYIHPVKSCGPIELN
                     RALLTKTGFMYDRCFAIAAETDGKWRFISQRTKPGMALIETELWLPHEGSDSSDVLVK
                     AAGCVVLRFRDPDVPDWTKRLEMFLHTGDFFATPEVSIVVPLQPVGELKPKTFNIHRR
                     DTNGLDMGQIPSVAVALPKLKRFLEIPEKQPFTLLRCTPESLLRTDLNLAPLDYIGSP
                     AVHGYTDQQPVNINSLSSVHAVSTLLPKENQPLNALRFRANLWVTGAPAYAEESWKRY
                     RILPKSGNTEPRADVAPALSVVCRTSRCTMPNVNPDTGRFDADMPPPGKKKGKPQPST
                     TLVEYRTIETGNKAALGYLGMHCVPEDRDFREAEEQGEGLYVEVGDEIEVLETGVHVF
                     GSTGNDY"
     gene            <593526..>594849
                     /locus_tag="ACHE_20200S"
                     /db_xref="GeneID:66979101"
     mRNA            join(<593526..594310,594369..>594849)
                     /locus_tag="ACHE_20200S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284477.1"
                     /db_xref="GeneID:66979101"
     CDS             join(593526..594310,594369..594849)
                     /locus_tag="ACHE_20200S"
                     /note="COG:P;
                     EggNog:ENOG410PH2B;
                     InterPro:IPR036922,IPR017941,IPR015879,IPR001663;
                     PFAM:PF00355;
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0051537 - 2 iron, 2 sulfur cluster binding
                     [Evidence IEA];
                     go_process: GO:0044237 - cellular metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133264.1"
                     /db_xref="GeneID:66979101"
                     /translation="MSLWKNYFGLGPVASSGATPTDKETPARSLPVSWYTSQELYELE
                     RRAIFSRKWLLTTHVLRLPNTGDWIQYKIAGYPFVLVKDRQGNINAFHNVCRHRAFPV
                     VTEESGTSRIFACQYHGWSYGLNGKLAKAPGYQDIDGFDKSKNGLLPIHVHVDKNGFI
                     WVNMDAGEKPETAWEDDFKDVDLQPRFKDFDFADYEFDHTWEMEGEYNWKILADNYSE
                     RYQCQTSQLDVPSLADSSAKPEQIEQGLKIASTYYFPNASMTASPHFFFMQRFVPTSP
                     TSCAMKYEVYRNKSSSTEDFGVINQVYKRIMSEDKDLCINTQKDLNNGELRPEMEKEP
                     SYFQTAVQGIVTEHREKEEKDGKEIWPARQRLPETAAAGVSKEDEEFCRELDFTGKRQ
                     QRDVAVEGCGMEGCCSAGKGAPASGSLVY"
     gene            <595539..>598073
                     /locus_tag="ACHE_20201S"
                     /db_xref="GeneID:66979102"
     mRNA            <595539..>598073
                     /locus_tag="ACHE_20201S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284478.1"
                     /db_xref="GeneID:66979102"
     CDS             595539..598073
                     /locus_tag="ACHE_20201S"
                     /note="COG:E;
                     EggNog:ENOG410PG4E;
                     InterPro:IPR036188,IPR027266,IPR029043,IPR006076,
                     IPR013977,IPR032503,IPR006222;
                     PFAM:PF08669,PF01571,PF16350,PF01266;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133265.1"
                     /db_xref="GeneID:66979102"
                     /translation="MSPKTVIIGAGIVGTNLADELISRGWNDITVIEQGPLNLPGGST
                     SHAPGLVFQTNGSKTMTQLAQYTVQKLSSIEMDGQNCFNDVGGLEIATTLERVEELKR
                     KYGYAKSWGIKARLLSAEECVEMYPYLNKEAVLGGLHTPNDGLALAARATQLLIERTR
                     QAGVKYLELTPVTGIEQTNSHVTGVTTPNGTIPADIVISCAGFWGVEVGAMAGVSIPL
                     LPLAHQYAKTTTVPALANREINTLPNGRNAILPILRHQDQDLYYREHGEQYGIGYYGH
                     RPMPVRAADLGLTPKHVDEQNMPSRLKFTAEDFEPAWKASQELLPALRETEVADGFNG
                     IFSFTPDGGPLIGQAPSLDGFYVAEAVWVTHSAGVARAIAEILTIGASQIDVAECELS
                     RFEEIQLSREYVDETSQQNFVEIYDILHPLQPRESPRNLRLSPFHTRQRELGAFFREV
                     GGWEQPSWYEANAELLKSLPNEWKPVERDAWSARFYSPIAAVETWKTRNAVAIYDMTT
                     FHRFEVFGPGAVSLLQRLSTGDVTVRPGSITYTLLLNKDGRIRSDIFASRLDTDLFQI
                     GANSATDLVYLSREARHQSQRSPSQWTQVRDITGSTCCIGLWGPRSFDVIKAITTDDF
                     SNNALPYMHVKKATIAGIPVTALRKSYVGEFGWEIQTSAEYGQRLWDAIFHVGKPHGL
                     TAAGRSAFNALRLEKGYRTFGTDITTEHDPFEAGVSFAIADKKEDYVGKAALERRSKK
                     PIRRLQCLTINDGHSMVLGKEPVYYNNQAAGYVTNAAFGFTIRKPIAYAWLPGTVVEG
                     ETVEIEYFGRKIQATVTSEPLYDAQMSRLHESTPILEPQKPLKSRL"
     gene            <598911..>600917
                     /locus_tag="ACHE_20202S"
                     /db_xref="GeneID:66979103"
     mRNA            <598911..>600917
                     /locus_tag="ACHE_20202S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284479.1"
                     /db_xref="GeneID:66979103"
     CDS             598911..600917
                     /locus_tag="ACHE_20202S"
                     /note="COG:T;
                     EggNog:ENOG410PKMQ;
                     InterPro:IPR000719,IPR011009;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133266.1"
                     /db_xref="GeneID:66979103"
                     /translation="MSSTTSLWWPPDRVQATLTPEYIVSQLPPSCLPHLVTPLPWGEG
                     LTNESYLDWIVTKAGRLFLILADIGIPERIFALVDASVDDVDLPFAAHSIDLLHLSPD
                     GNNPALDAKFFHAQWRFTVRGIAEGEYVKFTANEGVPIEVQRTDSTLAKEGVEKVILA
                     GAICRVYLRTQVTIGAAPHFFEEEEVLEEIRSLRRLAHDHVFSTYASYYSAIDKTVCI
                     LFNGHYERTLLSFLTDPPPSFKRLEKARRRHTLVNWPHCLANGLAWLHAHGHPHRGIR
                     PSNILIDAGFRIFLGQFEELDTLLPPLKVDDVEAYQYGAPERWQRSAAVQDTQPHQSL
                     LLPSGGRTARRPSTKSATLNLPKIRAPPKPDTTTARSDSVGSQDTAIRITSPRARFSF
                     ALSTSSTSSASSDGSNNNTNSHKRILPSIRQRPIFYTPSIASSSSSSGASTRPLSTIT
                     TTTTTDQSLNNTNNHTIIKTWHAATATATASDIFSLAAITLDILTVLCKRKLSSFTHH
                     RGAKNRTAGRGGGIADSSFHLDRNAEQVFSWVSLLEKDAEKKRKSDFAVFGVGVLGML
                     KVSRGMLSRDPAGRPSAREVEGMFGELIKRAGIEVHCQPPAPDKVSRAQRVPKWEEKV
                     DAYAAPESSSADTSGRDSPSPPDSMLEFVTTGFEDEYIHSSDSE"
     gene            complement(<601462..>601795)
                     /locus_tag="ACHE_20203A"
                     /db_xref="GeneID:66979104"
     mRNA            complement(join(<601462..601527,601581..601693,
                     601747..>601795))
                     /locus_tag="ACHE_20203A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284480.1"
                     /db_xref="GeneID:66979104"
     CDS             complement(join(601462..601527,601581..601693,
                     601747..601795))
                     /locus_tag="ACHE_20203A"
                     /note="COG:S;
                     EggNog:ENOG410PSY0;
                     InterPro:IPR021331;
                     PFAM:PF11160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133267.1"
                     /db_xref="GeneID:66979104"
                     /translation="MPQYRNGQAVHYKPVGGPDSRTSESIGTIQSILTEPGNQAGRNV
                     DASEEEPRYEIENQNTGKTTTVYERNILGGA"
     gene            complement(<602186..>604576)
                     /locus_tag="ACHE_20204A"
                     /db_xref="GeneID:66979105"
     mRNA            complement(<602186..>604576)
                     /locus_tag="ACHE_20204A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284481.1"
                     /db_xref="GeneID:66979105"
     CDS             complement(602186..604576)
                     /locus_tag="ACHE_20204A"
                     /note="COG:S;
                     EggNog:ENOG410PGPP;
                     InterPro:IPR021840;
                     PFAM:PF11915;
                     TransMembrane:7
                     (o266-285i381-400o441-462i546-567o579-598i647-671o683-
                     702i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133268.1"
                     /db_xref="GeneID:66979105"
                     /translation="MPVKMRDSDPPAESTDLGDISQAYQNGTREIDYSGADYAHSEDE
                     DNPLVQQEQRSPSSPPPAPVPRSRTRSVRFAAPEPTETPPDDSQNARPKKSLLQRLAS
                     VKRPKPDIRATIDPRRDRYSVLELDEVHDVPPEEMPGVDISFFEGFQGQYQNEALLKD
                     ENKGHAHKNSNESVTEPSGKLSLEIHPALRSKSIRQQGQDLANKTNAIVSVDQRTATV
                     DLSVLEGLGTPSESDSPHLGKKTATNLSYFYPRDPEQPNWRPLSMRSAYIIILAVVSL
                     VLAGVQEYLSQKSGILEKEGSGLIPYNNVAEIPVSQFFAWKYLPTLVTVAYGVLWQVT
                     DYEVKRLEPYYQLSQPAGNTAEKSLALDYVTMWSYFVPFKAGKYRHWTVLVSAIGTIL
                     ATTAVPSLQSPSIKPAGNPACGPGNDMPKPGDDKPCDADYKYFLRVEPVWSRLVTSCL
                     ILVAVLAIVLLVQLRRKSGLLSDPLGVAGVAAMANRSHILAEFQGMDESLHDDIHKQL
                     QHRRYILYKSTIWQGEYTGTDQSTATERPLKPPNPQPIILRPVWLMAFIIFMIICLPF
                     VPAITYDPRLNHVIRNIPWLPVLVATLIKQLWATLEFNVKMMEPFHTLTKGNARPEQT
                     LTLDYQGTPYAVILFKSLRNRHWLVALVGLGSILSDLLTITFSSLAVKTETRHSFYSS
                     SILSMAIVVFMIFSAILIFIRRRRPFMPRQPSTIASILAFIHQSRMLEDFTGTELYNN
                     REMTEMLVSKGKRYGLGWFRGRDGRMHCAVDEEPMVSRFVWGVSYRRARAPWEEDV"
     gene            complement(<605277..>605988)
                     /locus_tag="ACHE_20205A"
                     /db_xref="GeneID:66979106"
     mRNA            complement(join(<605277..605594,605647..>605988))
                     /locus_tag="ACHE_20205A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284482.1"
                     /db_xref="GeneID:66979106"
     CDS             complement(join(605277..605594,605647..605988))
                     /locus_tag="ACHE_20205A"
                     /note="COG:S;
                     EggNog:ENOG410Q234;
                     InterPro:IPR012312;
                     PFAM:PF01814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133269.1"
                     /db_xref="GeneID:66979106"
                     /translation="MTTTSNTSIVEPHLLRNVNTHQLRAYSTQASGPTYHLRVLESIK
                     EDHREISACGEQILQSNDADEQTRAQNMFTWELARHAVAEELVLYPAMEQYLEGGRGR
                     ELAEKDRREHQTIKNQLHTFQNLKPSDPRFRPTLQSLLSDFKSHAHEEETTDVPALDS
                     KLSQEESVGLSRALDRTKMFVPSRSHPGAPSKPPFESAVGLMMAPIDHLGDLFRKWPG
                     R"
     gene            complement(<606229..>607152)
                     /locus_tag="ACHE_20206A"
                     /db_xref="GeneID:66979107"
     mRNA            complement(<606229..>607152)
                     /locus_tag="ACHE_20206A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284483.1"
                     /db_xref="GeneID:66979107"
     CDS             complement(606229..607152)
                     /locus_tag="ACHE_20206A"
                     /note="COG:S;
                     EggNog:ENOG410PJUE;
                     InterPro:IPR044053;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133270.1"
                     /db_xref="GeneID:66979107"
                     /translation="MSTTTTTTTTTTTTTTKATEDIPVPRGPVQATISFVVPWATTPL
                     DKLYNYVEQPPAGEPKHNFDEVPFQVNLTDIRGTEDTYTLDTNAFAVLKDVHTDTNYQ
                     TYFDDKEVERVYYPEVEKLLLENVPGAHKIVIFDHTIRRQGPGAARQPVNRAHVDQTA
                     AAAAERVRIHVDDKDEAEELLKGRFRIINVWRPINGTVVSAPLALADVKSIVPERDLV
                     NIQHRYPHRNGEIMGVRHSGEQRWLYVSGVEGGERLLLKCADSAEGTVLEDGGVVAGR
                     APHSAFTDPRSVEGEGGKPRESIEVRALVFG"
     gene            complement(<607507..>609145)
                     /locus_tag="ACHE_20207A"
                     /db_xref="GeneID:66979108"
     mRNA            complement(join(<607507..608592,608654..>609145))
                     /locus_tag="ACHE_20207A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284484.1"
                     /db_xref="GeneID:66979108"
     CDS             complement(join(607507..608592,608654..609145))
                     /locus_tag="ACHE_20207A"
                     /note="COG:S;
                     EggNog:ENOG410PMSZ;
                     InterPro:IPR013907;
                     PFAM:PF08598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133271.1"
                     /db_xref="GeneID:66979108"
                     /translation="MAYSPAPTSPTSGPGAMHPFPPIHPHRGAQSPSPPPTTTAPGPA
                     HTAANANANPPISKRDKRRSALQERLQDLTASFSQNRDAQFRQQLHALQCDMTLINNA
                     DPYAPGPLPDSAEEVARLVEGTVGGGVFGREMAGLSGMWYSRFVQEVNGVKEERDGEL
                     AMLVHRHENNLERFRREYAFRNHFAAEEYNNLSSTLRERLVQTITGKKGRLMREKEQL
                     DIADTNSLLLHPNQFSITNPASPGGVHGNRKTRHTRHRMDLDELGNGIGSEVLNKRKR
                     KAPEDDVGSPVRDAGSAERAKASAAQHQPPPTYSLHSLFTDKELSSHANLAHIATIHF
                     FSTSKRGDQGGVGTSNNTDADDASGTGDHTGQEDNGTPATDMVRTASQNFHATRSTRT
                     HGNSALNALAELSDKQAIRPNLPYHLLTNHQPRVNASAPPPPPLMNEEMEDDWARLER
                     LHSKPAGWVDRNLIEVLLEPGPEQVDGVPQDPHRFSMLHPDFPATMGVHWYPLRNDRD
                     RAEMLGGSTTSNKRTKT"
     gene            complement(<610041..>611832)
                     /locus_tag="ACHE_20208A"
                     /db_xref="GeneID:66979109"
     mRNA            complement(join(<610041..611086,611136..>611832))
                     /locus_tag="ACHE_20208A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284485.1"
                     /db_xref="GeneID:66979109"
     CDS             complement(join(610041..611086,611136..611832))
                     /locus_tag="ACHE_20208A"
                     /note="COG:S;
                     EggNog:ENOG410PN8R;
                     SECRETED:SignalP(1-30)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133272.1"
                     /db_xref="GeneID:66979109"
                     /translation="MHHLQCHGPFPPFSMLPESPVVSSSPSSSCASVAQQSQPQPQPQ
                     PQPQPQPQPQRQPPRRNLKRRASQGSILKKPSSVSRFLSRTSGPGSRTLSVDSQLRLS
                     ATPSTPSSSPPSPNSSPVIWKGEYPSALPPTPPSEHDYHPEWNPKPGMLLLEPQINQV
                     RGPGLDQPLDQGSNMDVNVNMNMNMENASRPPLTVDGLSSPSDQLSSAAASPGSTEMD
                     VDYHTWLENGIDAAISELPFLNGRGEAVKIVSQTLPYPRASDKSVTLPTHDSVFSAMV
                     QAVQNRMQQGQSPYINITHAVPEQFSLSNLPTSPPSTPLSAGEDYFNSTVFSNAAVVS
                     TYHDFRGPVLGMQASHWPMPVVPPHTVQLSVLERYLPPSSSQEHKDLFSSSRPSYLVD
                     RICELSPNGGSLLFIYPTKRGGSTFKSQYLGPILDPLLRQLVVVNELSADVSRSLGRL
                     ASVSQMDDFETMKSNLSRLCEDLSSQSANFSVVDARKGNAHLDRNLWTEWYIHQEKAR
                     MKEVLSLYWQNGRRLPVNKTSTSSNLFLADKEVTSAMLLGDILDGIRRRPYGEENEHQ
                     DGVELGVFVIRRSQ"
     gene            complement(<615499..>616404)
                     /locus_tag="ACHE_20209A"
                     /db_xref="GeneID:66979110"
     mRNA            complement(join(<615499..616225,616277..>616404))
                     /locus_tag="ACHE_20209A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284487.1"
                     /db_xref="GeneID:66979110"
     CDS             complement(join(615499..616225,616277..616404))
                     /locus_tag="ACHE_20209A"
                     /note="COG:S;
                     EggNog:ENOG410PX68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133273.1"
                     /db_xref="GeneID:66979110"
                     /translation="MSTGIVSPFQIPRKHLADLANNNAFTAVREHLRRQELGMDAPSF
                     CSHHRHACSHEDQESFRLHRDIIHTLLVPLFLLHTQASRIATGVLPSSRASEPERAFR
                     GEARSAYAWLHCILSEEHDWYLTERCPACIVLHVMHSEPTIRFIAVACLLSGHLQGHD
                     VPVGKRRLPSFDFWLETLETAVREDTFWGDDFWPEIEYRACSLTDGVKQLALQCLELQ
                     STAEQQEFEQLQQQVHTVKQTSCAWKQVPVAAEDQKRLKINNCFMQSRRHQRFHVRSV
                     DSRRRNMT"
     gene            <618341..>619780
                     /locus_tag="ACHE_20210S"
                     /db_xref="GeneID:66979111"
     mRNA            join(<618341..618482,618532..618743,618791..>619780)
                     /locus_tag="ACHE_20210S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284488.1"
                     /db_xref="GeneID:66979111"
     CDS             join(618341..618482,618532..618743,618791..619780)
                     /locus_tag="ACHE_20210S"
                     /note="CAZy:GH72;
                     COG:S;
                     EggNog:ENOG410PHD0;
                     InterPro:IPR017853,IPR004886;
                     PFAM:PF03198;
                     SECRETED:SignalP(1-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133274.1"
                     /db_xref="GeneID:66979111"
                     /translation="MLSSLTSWSAASLLLAGLAPTAHAAVDKINAVGSKFFYENGTQY
                     YMKGIAYQLVPDDPLIDTDQCKRDITRMSELGVNGIRVYHVDPTADHTGCMKAFADAG
                     IYLFVDLDTFDTQIEQTHPEWTERQFDRFKSVLDEFQKFDNTAGVFVGNEVITTKEGS
                     AAAPYILAATRDIKAYRDHKGYRPIPVGYSAADIAELRPMLQEYLACRKDSVDRLDFF
                     GLNAYEWCGSSGYIQSGYNMLQKNASTYPIPIFFSETGCNTHRPRTFEDQAAIFGHEM
                     GDTWSGSIVYEWIEETNDYGLISYGPPVKGAAPTNTLIQDGFTRKGTPTPVQPDFDNL
                     KKQWATLHPTGVALTEYAKSTATITPPQCPSSTAGGWSVDPSAPLPTLGQTYSGNLST
                     TSRTSGTARQTATAIVTVSATSSAAAATPTKENGGRAVGVDMSMLGLVGAVAWWL"
     gene            complement(<620355..>621946)
                     /locus_tag="ACHE_20211A"
                     /db_xref="GeneID:66979112"
     mRNA            complement(join(<620355..621743,621794..>621946))
                     /locus_tag="ACHE_20211A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284489.1"
                     /db_xref="GeneID:66979112"
     CDS             complement(join(620355..621743,621794..621946))
                     /locus_tag="ACHE_20211A"
                     /note="COG:S;
                     EggNog:ENOG410Q5PF;
                     InterPro:IPR036322,IPR015943,IPR001680,IPR019775,
                     IPR020472,IPR011045,IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133275.1"
                     /db_xref="GeneID:66979112"
                     /translation="MGTHSGTFLHDNGLVDAFLREHLLHWIEALSLIKSMSSSVSAIA
                     KLTNMVRNVSQGSKLFELIHDVHRFILFNRGVIENAPLQVYHSALIFSPSGSLTRGLF
                     SDDEPKWATAKSAIDSTWGACLQTLEGHSDEVNSVVFSRDGTRIASGSVDNTVRIWDA
                     GNGACLYTLQGHSDWVTSVVFSPDGTRIASGSFDNTVRIWDAGNGACLYTLEGHSDWV
                     TSVVFSRDGTRIASGSVDTTVQIWDAGNGACLYTLQGHSGWVESVVFSRDGTHIASGS
                     RDNTVRIWDAGNGACLYTLQGHSDSVRSVVFSPDGTRITSGSRDKTVRIWDAGNGACL
                     YTLQGHSSWVSSVVFSPDGTRIASGSVDTTVRIWDAGNGACLYTLQGHSGWVESVVFS
                     RDGTRIASGSDDKTVRIWDAGNGACLYTLKDVGSSMTSDAGTLGMIAWRGTSNTQKMW
                     ETPQHLTYCLNNNGTWITSNSQNVIWLPSEYRPRSFALTSSTMAIGCQSGRVLILDFS
                     NKASL"
     gene            complement(<622889..>624001)
                     /locus_tag="ACHE_20212A"
                     /db_xref="GeneID:66979113"
     mRNA            complement(join(<622889..623770,623828..>624001))
                     /locus_tag="ACHE_20212A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284490.1"
                     /db_xref="GeneID:66979113"
     CDS             complement(join(622889..623770,623828..624001))
                     /locus_tag="ACHE_20212A"
                     /note="COG:A;
                     EggNog:ENOG410PKD8;
                     InterPro:IPR027417,IPR031359,IPR007111;
                     PFAM:PF17100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133276.1"
                     /db_xref="GeneID:66979113"
                     /translation="MKQLVDKGLAKTEHEAKVKQEMGDPVDIVLKLKDMIGTAVKPCP
                     EAALAWTGVVFALQMMINPIKETETNRKGIQHVIERMSWYWELSSHILKERDPNGTSY
                     AGLRSGLKEQLIQLYKALLSYQMKSVCSYYQNRGFVFLKDLVQLHDWNGQLDNINKIE
                     ATFQGSVTQYDMQQRTGLDQQKLGTLGDISGHLQKLPSRQRDLQEEEKNSGCLKDLRL
                     TNPEDDMKRIEDSKDLLLHESFIWILSHPCFTEWMDDKGSQFLWIKGDPGKGKTMLLI
                     GIIKELSRRPHKSSPLSFYFCQATDAKLNNATAVLRGLTYQMLVQQPSLISHLRKEYD
                     TAGPKLFEGVNAFTSMS"
     gene            <630839..>632432
                     /locus_tag="ACHE_20213S"
                     /db_xref="GeneID:66979114"
     mRNA            join(<630839..630954,631010..>632432)
                     /locus_tag="ACHE_20213S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284491.1"
                     /db_xref="GeneID:66979114"
     CDS             join(630839..630954,631010..632432)
                     /locus_tag="ACHE_20213S"
                     /note="COG:G;
                     EggNog:ENOG410PKV4;
                     InterPro:IPR005828,IPR003663,IPR036259,IPR020846;
                     PFAM:PF00083,PF07690;
                     SECRETED:SignalP(1-24);
                     TransMembrane:10
                     (i7-25o65-87i94-115o121-140i152-170o182-203i341-362o368-
                     394i406-430o436-457i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133277.1"
                     /db_xref="GeneID:66979114"
                     /translation="MLRGRSIHLAQVLLTVAPAFITYGYNQAGVAPLASLQSWVHTFP
                     EIDTINTEGTIKSRNATRKGAVIAALQLGALVGSLSCTYFGNWLGRRKTIFMAAIIAV
                     VGQLLQTASYGVIQFSLGRVILGIGVGQLSATVPVWQAECSSAKHRGQHVVVDGICMT
                     MGFMLCNWIDFGLSKASGSIQWRVPLAISFCFPLAVIGSVFLLPESPRWLVMVGRPEK
                     ATRSLAAYKGLPVDDETVQAEIASIESSLELSTQSSGVMILELLVGNDEERLLYRFAL
                     CILTQFFQQMCGGNLISTYISTIFEENLKLGSDLSRILAASALTWKCACNFIPFFAID
                     RFGRRKVFIVSGIGMCICMTVLAITTSLDTERQAVSITSVVFIWLFNLFYPIGFSGAN
                     FLYCTEVAPMRLRVAMSAVSTGNKWLWNFIVVMISPIALDKLGYQYYIVYAVICACIP
                     VSVYFFYPETMNRNLEALNHVFRDAPSAWHVVAMARKLPEGDVVDGEGGREEKASVEQ
                     KENA"
     gene            <633428..>634571
                     /locus_tag="ACHE_20214S"
                     /db_xref="GeneID:66979115"
     mRNA            join(<633428..633679,633726..>634571)
                     /locus_tag="ACHE_20214S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284492.1"
                     /db_xref="GeneID:66979115"
     CDS             join(633428..633679,633726..634571)
                     /locus_tag="ACHE_20214S"
                     /note="COG:S;
                     EggNog:ENOG410PM4Z;
                     InterPro:IPR007400;
                     PFAM:PF04303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133278.1"
                     /db_xref="GeneID:66979115"
                     /translation="MGSSRKSKSANQIDGVGGASSTTSKVAVVERSNRPDVDVEYTFV
                     QVAPDQPRIDMTGNCGNIASGVGPFALDEGIVRAAPRQSEIDIRVFNTNTGQTIVETV
                     QVAADGTFREEGNYSIAGVEGTSSPVRVAFLTPGGSMTGRIFPSGVQQEILTVPSRTI
                     GTIHVRVSLVDAANPFVLVDAASMPLEEHPSWPDPNDARFLSLVEDVRREGAVRLGLA
                     ANTQAAGQVRGTPKIAILSRAAGDDDMDVDLQVLSFTMGKPHPSLQLTGAVCLGAATV
                     IHGTIAWELAHAREIDRPPKHGMLVGSHQIAAPVPVGIRHPAGVIHAETSLRMDRKGG
                     VHVDRVAVFRTARRLFEGSVLYRVEETEAYM"
     gene            complement(<634738..>636791)
                     /locus_tag="ACHE_20215A"
                     /db_xref="GeneID:66979116"
     mRNA            complement(join(<634738..636419,636483..636565,
                     636652..>636791))
                     /locus_tag="ACHE_20215A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284493.1"
                     /db_xref="GeneID:66979116"
     CDS             complement(join(634738..636419,636483..636565,
                     636652..636791))
                     /locus_tag="ACHE_20215A"
                     /note="COG:S;
                     EggNog:ENOG410PGDR;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133279.1"
                     /db_xref="GeneID:66979116"
                     /translation="MINFENDSGMAFLSLDMMYRGKRRQGDRFPGFTNRPAAGKAAIP
                     NRLQNQTQVADASVPVEPIRKQLMGEAVYQRQMEMLNFQQGKLDFDGVDPELGMHLLS
                     LHWNRQHHSFLITYRPAFMRDMATEGPYFSKLLLNAIYFGASKFSNRPEVRQDPTDAR
                     TAGWTFRRRVKELLGSALDRSEITTIQALLVMTSSLFALGDERSAAWLYAGTAFRMII
                     DLGMHVDATMLPNMRRLSPEDLEIRRRVFWGAFVVDKIQSLYQGRPVSLQHCDTRVSL
                     SFLDHYEELEPWQPFAYSDTQSYSGSPAYSVSTFVQLCKLSLMLNEILNKVYSERSSN
                     RSPHDLIASLNTLDGQLKDWHNALPDHLRFNTHATRVVPPPHVLSLLALYNLQVILLH
                     RPFVSEGHLHTADPSVALSSFTTCTAAAFSITQLLQAYDNTFSIQRAPYLISYATYVA
                     ATIFVRVAAQREGASRAHASLQNCLDVFEKNQETNWAVRRAHNVILHLMNRMGVRLEN
                     QPVTPTDGIGSLLEQPSGSLAIPPDSNLQGPAPVTSHENPPEIEASALDIDMIIQSFI
                     RPPSKNAEGQAAGEQGESSFMSSAVVHPGWQGTLAPTLPLAEDLHDHMPFDDMLFGFN
                     GSPQDGLFGS"
     gene            <637311..>638456
                     /locus_tag="ACHE_20216S"
                     /db_xref="GeneID:66979117"
     mRNA            join(<637311..637352,637416..637469,637544..637690,
                     637742..637914,637991..>638456)
                     /locus_tag="ACHE_20216S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284494.1"
                     /db_xref="GeneID:66979117"
     CDS             join(637311..637352,637416..637469,637544..637690,
                     637742..637914,637991..638456)
                     /locus_tag="ACHE_20216S"
                     /note="COG:C;
                     EggNog:ENOG410Q1YF;
                     InterPro:IPR018108,IPR023395,IPR002067;
                     PFAM:PF00153;
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133280.1"
                     /db_xref="GeneID:66979117"
                     /translation="MGTTIVPAKEKQSMWVSLVAGGVAGGVEAAVTYPFEYAKTRVQL
                     LQTSTVATPSNPLRLILHVAKQEGIGYLYTGCSTLILGTTAKAAVRFVSYDTIKNTLA
                     DESGALSPGRGILAGVVAGGMESVLAVTPTERIKTALIDDAKNARQFRSSMHAGQVLV
                     RTHGVSELYRGLVSTTLKQSATSAVRMGTYNILKEVVRAREIKPSVLTTFGMGALAGV
                     VTVYATQPLDSIKTRAQSAQGASFAEAVWSVVRDHGLRGFWKGSTMRLGRLLLSGGIV
                     FSVYEEMASILCALGSR"
     gene            complement(<638827..>639111)
                     /locus_tag="ACHE_20217A"
                     /db_xref="GeneID:66979118"
     mRNA            complement(<638827..>639111)
                     /locus_tag="ACHE_20217A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284495.1"
                     /db_xref="GeneID:66979118"
     CDS             complement(638827..639111)
                     /locus_tag="ACHE_20217A"
                     /note="COG:S;
                     EggNog:ENOG410PUHM;
                     InterPro:IPR023213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133281.1"
                     /db_xref="GeneID:66979118"
                     /translation="MTYGEKAEEHSNRSPGVAAYQANFIRGGLVFTMHHHHYANDVMG
                     WAGLNQLAENCYAIVHQTSFPLWKPACLDVSRLAKAEVPEELKVDGPVAW"
     gene            <639161..>639502
                     /locus_tag="ACHE_20218S"
                     /db_xref="GeneID:66979119"
     mRNA            <639161..>639502
                     /locus_tag="ACHE_20218S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284496.1"
                     /db_xref="GeneID:66979119"
     CDS             639161..639502
                     /locus_tag="ACHE_20218S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133282.1"
                     /db_xref="GeneID:66979119"
                     /translation="MGLLDLIKGRMIIVGQIQLLYHEADGAVLLLDKGMTTVSILLDG
                     PAQMVFLAQRSLQTYLQHLDDVSLVTIIQPEKDDIVLVAADAEIVEGGEFEPFLRVIF
                     PTEWMKVNMSC"
     gene            complement(<640064..>640369)
                     /locus_tag="ACHE_20219A"
                     /db_xref="GeneID:66979120"
     mRNA            complement(<640064..>640369)
                     /locus_tag="ACHE_20219A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284498.1"
                     /db_xref="GeneID:66979120"
     CDS             complement(640064..640369)
                     /locus_tag="ACHE_20219A"
                     /note="COG:G;
                     EggNog:ENOG410PMKK;
                     InterPro:IPR025733,IPR029052;
                     PFAM:PF14008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133283.1"
                     /db_xref="GeneID:66979120"
                     /translation="MDIFTEPSSHIHWYERMLPIGNGTIDTASVVNNHTYRTNAGKST
                     THIINSMAGNIDSHSEFSSGKGLSNITAVLDKTHYGFNKMTFLYETTLKWDLVRGDD"
     gene            <641866..>642102
                     /locus_tag="ACHE_20220S"
                     /db_xref="GeneID:66979121"
     mRNA            <641866..>642102
                     /locus_tag="ACHE_20220S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284499.1"
                     /db_xref="GeneID:66979121"
     CDS             641866..642102
                     /locus_tag="ACHE_20220S"
                     /note="InterPro:IPR029063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133284.1"
                     /db_xref="GeneID:66979121"
                     /translation="MSQMVKPRQQGLGTQSNKWYNKLEISVLEKLVRVNTAAHALDLT
                     TGNGLVARWLAAQGTGVLVTDVSLKKIDITSSRL"
     gene            complement(<642881..>645806)
                     /locus_tag="ACHE_20221A"
                     /db_xref="GeneID:66979122"
     mRNA            complement(join(<642881..643763,643835..644185,
                     644236..644599,644658..644815,644868..645624,
                     645695..>645806))
                     /locus_tag="ACHE_20221A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284500.1"
                     /db_xref="GeneID:66979122"
     CDS             complement(join(642881..643763,643835..644185,
                     644236..644599,644658..644815,644868..645624,
                     645695..645806))
                     /locus_tag="ACHE_20221A"
                     /note="CAZy:GT1;
                     COG:C,G;
                     EggNog:ENOG410PV20;
                     InterPro:IPR004276;
                     PFAM:PF03033;
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0030259 - lipid glycosylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133285.1"
                     /db_xref="GeneID:66979122"
                     /translation="MTSNNHVEEIFELPGDPVAISPYSSSAAIGKNGIDLKDDGRVDI
                     DLDSNLMRRFSMLHTSQFLRRPSTPPPEYSELPPQVDDATTRELGHLPKYPEPVTENG
                     KAWNVKLNIVIQVVGSRGDVQPFIALGNELMRYGHRVRLATHGIFESFVRDSGLEFYP
                     IGGDPAELMAYMVKNPGLIPTMKSLGAGEIHRKRLMIRQMLSGCWQSCIEPDMTTHEP
                     FVADAIIANPPSFAHVHCAQALSIPVHLMFTMPWSSTKAFPHPLANLRCDNADQDLKN
                     YISYDVVNWLTWQGVGDVINQWRKELDLDEVAMFEGPYLAEILRVPFTYCWSPALIPK
                     PSDWPSYIDVCGFFFRDFCQYEPPADLQAFLASGPPPIYIGFGSIVLDDPEKITAIII
                     SAVNAAGVRAIISKGWSNLGGTENDNIYSIGDCPHEWLFQQVAAVVHHGGAGTTACGL
                     RNARPTIIVPFFGDQPFWGAMVAAAGAGPAPIPYKKLSVEALSQGIQYCLTEQVATAA
                     SAIAIKMSSEAGVRAAVSSFHRNLPLERLQCDLYPGQPAVWSFAKGRRKIKISKIAAE
                     MLVTERLIDRKSLVMHAIKPIVIENRRWDPITGGASAVVGTSTALTASILGTFYKPFK
                     EYQDYHENRRDRPSSSSSHRPIQRPASRSSSGNTSSRMTNHGEELDNLGTMDTTIFET
                     SSLSHFKEPSDHHKIRLAGRMAGASAKSLASFGPTALKGMMVDFPLAIAEGMRNVPRY
                     YGEEPRDHGPVTDIKSGFAVAGKSFAWGMAEAVSDIVVQPYQGMQEDSARGAVKGIGK
                     GIANMASKSGCAMFGVLAYPSAGIAKSLQSSIHSKTRKKIDKARHSEGVWLLKDGRCK
                     EPNSVFTTFQGQFKGKKR"
     gene            <649530..>650278
                     /locus_tag="ACHE_20222S"
                     /db_xref="GeneID:66979123"
     mRNA            join(<649530..649835,649889..>650278)
                     /locus_tag="ACHE_20222S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284501.1"
                     /db_xref="GeneID:66979123"
     CDS             join(649530..649835,649889..650278)
                     /locus_tag="ACHE_20222S"
                     /note="COG:G;
                     EggNog:ENOG410PM1X;
                     InterPro:IPR012341;
                     SECRETED:SignalP(1-18);
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133286.1"
                     /db_xref="GeneID:66979123"
                     /translation="MKTCLILALLAHSIACEAFYTTSSQPTYQPETYTLAASGPVPLN
                     NATVYKLSSDGSSPAIFILDYGKNVEGYATFEVTQQSGNTSIFEMSYGETREALDVYM
                     ADGPIPLSAAMDTYRINRYNISQPTVQVNRLIQGALRYQKLNLSSAGELEVTAVGFKP
                     TVDNTPVSDLPGSFACSDPVLNRIWNAGARTVQLNEFPANSLPDSWVIADEGAFIDSL
                     SPHHLHIYHHGLA"
     gene            <650718..>650936
                     /locus_tag="ACHE_20223S"
                     /db_xref="GeneID:66979124"
     mRNA            <650718..>650936
                     /locus_tag="ACHE_20223S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284502.1"
                     /db_xref="GeneID:66979124"
     CDS             650718..650936
                     /locus_tag="ACHE_20223S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133287.1"
                     /db_xref="GeneID:66979124"
                     /translation="MHMIDGYIGTSWWCWGDLESDLKDKPFHAWQKGINFLDAPFPAD
                     PDNWALGEDPSELKFEDRSGWVEFEVVE"
     gene            complement(<658364..>659194)
                     /locus_tag="ACHE_20224A"
                     /db_xref="GeneID:66979125"
     mRNA            complement(<658364..>659194)
                     /locus_tag="ACHE_20224A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284503.1"
                     /db_xref="GeneID:66979125"
     CDS             complement(658364..659194)
                     /locus_tag="ACHE_20224A"
                     /note="COG:S;
                     EggNog:ENOG410PSJK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133288.1"
                     /db_xref="GeneID:66979125"
                     /translation="MESAVFSLFPSLPAELRIQIWRDALPDKVGQALYFYKKGCWRPR
                     HLTEADANYNPHDDELNLVFEFHHELLDDVQLVIPSFFVNREARGITLTWIHSQGIKI
                     QFYKERQCLTFARSFNPKYDTLYVPLEKWDEFIIEPYDRLEEPDLFNRAVECPGPQIT
                     RIAVPQALLQHKVNPLADFFEWYNHLDMLFIIIDTPPDLQPEDNDTGVQQQWELKSTQ
                     GATFSWNHDRGVFVGGCDDISDQALYKLIQGASDGLGEKLADNHKRSFEVHPGFAVQK
                     "
     gene            <659934..>660446
                     /locus_tag="ACHE_20225S"
                     /db_xref="GeneID:66979126"
     mRNA            join(<659934..659948,660222..>660446)
                     /locus_tag="ACHE_20225S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284504.1"
                     /db_xref="GeneID:66979126"
     CDS             join(659934..659948,660222..660446)
                     /locus_tag="ACHE_20225S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133289.1"
                     /db_xref="GeneID:66979126"
                     /translation="MYGLKGKGGAEKKAGGNIDDSKDELVLKNMKEWSHNKFKTSQHA
                     ATKIITVQLVDNVKTKNEASDAITQAQQLVNQKTK"
     gene            complement(<664003..>665277)
                     /locus_tag="ACHE_20226A"
                     /db_xref="GeneID:66979127"
     mRNA            complement(join(<664003..664400,664467..664572,
                     664634..664958,665044..665153,665245..>665277))
                     /locus_tag="ACHE_20226A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284505.1"
                     /db_xref="GeneID:66979127"
     CDS             complement(join(664003..664400,664467..664572,
                     664634..664958,665044..665153,665245..665277))
                     /locus_tag="ACHE_20226A"
                     /note="COG:T;
                     EggNog:ENOG410PXR1;
                     InterPro:IPR036457,IPR015655,IPR001932,IPR000222;
                     PFAM:PF00481,PF13672;
                     go_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IEA];
                     go_function: GO:0016791 - phosphatase activity [Evidence
                     IEA];
                     go_function: GO:0043169 - cation binding [Evidence IEA];
                     go_process: GO:0006470 - protein dephosphorylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133290.1"
                     /db_xref="GeneID:66979127"
                     /translation="MVTIQAVGAASAKGTRPYQQDTYTLLPPDQFLPESDPNLAFFAV
                     YDGHGSEIVSNHASQNLPSLLSQSLTSTSTSTSTSLTPESYENAIKQAISSEEQLLVQ
                     EFKNGEADYAFAGSTLALVLLDLKSGTLVVGDLGDSKVFLGTLGGNDGDQVEDVKCLT
                     KSHKPSSPDEKHRIENAGGMVLPDQHEIPRIGALNMSRALGDLQYKTPFTNLSVTNPE
                     TNEENPLTREQARAGVEPSEQQGDFLSSEPDITRVNLRQGKKYMLALVSDGVSDSPKV
                     DDEGFIQMLANGFNSGIRGEAVVREVINEVVEGVESDNATCVGLLLQ"
     gene            complement(<665626..>666573)
                     /locus_tag="ACHE_20227A"
                     /db_xref="GeneID:66979128"
     mRNA            complement(<665626..>666573)
                     /locus_tag="ACHE_20227A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284506.1"
                     /db_xref="GeneID:66979128"
     CDS             complement(665626..666573)
                     /locus_tag="ACHE_20227A"
                     /note="COG:S;
                     EggNog:ENOG410PQKN;
                     InterPro:IPR008427;
                     PFAM:PF05730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133291.1"
                     /db_xref="GeneID:66979128"
                     /translation="MFASTPTPKPGSSLLSSRDTPSSADDTTLVTYESVTSVLVTQLM
                     PSAEMFKTLVHDSASTLTLTSTSTICATCKTTDTATPTTLSTSTISLFSAYNPLTSSS
                     PSQPFSPSSPSCPEIVPRCINTWLDSVPKCSSNSDVSCFCPKSSFTNHVIGCIQSWAG
                     SEEEVSAGIGYFVGICAGYVSENPGIVTGVPGSVSIAPVTGTATGDVSATAVSYGTRT
                     LTVPEVSFTTDAAASASGSQVQLVPGAPATTLSSSATSTTSSTTQTPWSPTWITSTTS
                     DGSSSATPSSTHTGRASKVEVGRGLGVGVVGVVFAGLLF"
     gene            <667151..>667663
                     /locus_tag="ACHE_20228S"
                     /db_xref="GeneID:66979129"
     mRNA            join(<667151..667332,667381..>667663)
                     /locus_tag="ACHE_20228S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284507.1"
                     /db_xref="GeneID:66979129"
     CDS             join(667151..667332,667381..667663)
                     /locus_tag="ACHE_20228S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133292.1"
                     /db_xref="GeneID:66979129"
                     /translation="MTEISSPEDEDGDGGGDEVGVAEVEAAAALLLHAAQTVEVDVRV
                     CVDNVVNKDVKELSPDNVVVASSVEPGGMMPIDEDAGYEEIGPDEIETEAPADEDGPA
                     GAGTETAIEVGVAEEEAAATLLLHVVQTVEVDVRVCVDKVVNTDMKELSPEE"
     gene            complement(<667865..>670270)
                     /locus_tag="ACHE_20229A"
                     /db_xref="GeneID:66979130"
     mRNA            complement(join(<667865..667898,668021..669924,
                     669977..670156,670220..>670270))
                     /locus_tag="ACHE_20229A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284509.1"
                     /db_xref="GeneID:66979130"
     CDS             complement(join(667865..667898,668021..669924,
                     669977..670156,670220..670270))
                     /locus_tag="ACHE_20229A"
                     /note="COG:S;
                     EggNog:ENOG410PQKN;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133293.1"
                     /db_xref="GeneID:66979130"
                     /translation="MLVPFLSFAALAQASALFWDTDKSYTRPQTIKHTCTSAQSKGVE
                     FKWTDISTGDVSTYEGFTFTGFKVSTDFHGYVGKYLEGKLTTNASDLQVAMEDGAEFS
                     VSLLNFATSKETEIQVIYGMSDGTTCKNTASSGPNMTDIANQQCGGAISMGFQVPESE
                     GDGDITLAFYSIDFYCPQLTSGSNSKRGLSARDKIGAEAPLDATVFSTNEVTITSCGP
                     EKPDCPASSTAVPSTESVGAGMPSSAAAESSAPWTPGAPSTESVSVGVPSSAAPESSV
                     APSTPVTPVETSSSAFTPSEVASPPVDSTVFSTNEVTITSCGPEVPDCPASSTALPSS
                     TEAVSAGIPSSAAAESSIAPSTPVTPVHAETSSNSVFASSWSTSASPSHLDATVFSTN
                     EVTVTSCGPEVTDCPASSTSLGVGFLSSFTPPAESSVPGGWGSSVSPVETTLSSFESS
                     WVISSSAAVTSSAVIASTSTSIELGSWSWSASASASASASVETSSSIAVSSIGSVVPS
                     DSTLTETVSGFVPAGSMGASSVPVASTPVSSTPVRPTKSTVYSSAAPLTSTRPAIPSR
                     SSSIPVISSSRAVIPTPESSSAIPSVTPTEEGTTTLVTYETVTTCPITSTHYSGGSAV
                     TSVYSTLSTLTLTSTSTVCTACKSGSAAAASSVMPTPTSTSVISSVPVSVPASSLSAS
                     STPILSSWGMSSHASSDHVSTTEGTTTLVTLSGEQCGYSF"
     gene            complement(<671718..>673690)
                     /locus_tag="ACHE_20230A"
                     /db_xref="GeneID:66979131"
     mRNA            complement(join(<671718..672691,672757..>673690))
                     /locus_tag="ACHE_20230A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284510.1"
                     /db_xref="GeneID:66979131"
     CDS             complement(join(671718..672691,672757..673690))
                     /locus_tag="ACHE_20230A"
                     /note="COG:S;
                     EggNog:ENOG410PSZE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133294.1"
                     /db_xref="GeneID:66979131"
                     /translation="MHHHKSKAPPRRAGKSLSVGPLSGDRKRRASSSVSSVSSVSSVE
                     DLSDALDNSSEDDADDEEDPPAPAYHKDKGRKSAPKPAKKTINNRNKKQTTRKKKKAA
                     RISDDELYDDDNESEGSSDDVYAAVDYISDGDGEDQDMEKLEEMMILESESDSRIGNL
                     LSTADVGDDAETWAGPTNIFDDHMLLTGASFFDEDQLYSAMENFGETDLASEAVETPM
                     QVPRHVHFETHSDSSSDSDSHTEDEIPGDFLQQDSLDPQLRRMIENDNENTRKQNRRR
                     MSNDDIFGDSDYGHSNIYHVESDAVDDKSESSGYETDDGETTDEDLPPPATITHPRSI
                     LRRDSSASLAPPADEKNESTTHRRGPVMGSFVPDPNKPVALVDCTGKHLVIIPAYASS
                     RHDWLESANNSMPGTASNSPRATTMQIIDESDTDALASPNHADFSPMLASGANLMMTA
                     LGNDITPGGQVMGPPEAFYPSQDITIDSSFEDDDDEDPESALNVNDFIDFGDGSSDDE
                     MDEKPFDDELTSPAMTNPVPMVGAGSPTPTRTAESQQTNSAERFLNHLDRGIVTAFRR
                     NHNRYQALLRLPQHREFMPANSPARPASVFRHARLADQRTPTRKRRNGNTGDAVRRKL
                     MDAHRRNQLPF"
     gene            complement(<675573..>677117)
                     /locus_tag="ACHE_20231A"
                     /db_xref="GeneID:66979132"
     mRNA            complement(join(<675573..675982,676038..676689,
                     676752..>677117))
                     /locus_tag="ACHE_20231A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284511.1"
                     /db_xref="GeneID:66979132"
     CDS             complement(join(675573..675982,676038..676689,
                     676752..677117))
                     /locus_tag="ACHE_20231A"
                     /note="COG:S;
                     EggNog:ENOG410PPXY;
                     TransMembrane:2 (i302-320o326-348i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133295.1"
                     /db_xref="GeneID:66979132"
                     /translation="MQSNRETPVSTQISTNTSPTTHDPVLTSDDEAFFRQIMSRPDAA
                     GLDTGNAVTADAPGPVAQDNQNAEEFGKKLGEQQRKATDLEEQEKSGDKDRNKEQAES
                     TVEGKKKRWSLNWPWGKGKKKAEKSDDANETPDRGDSKDKDATKDQDQLQQSQQAEAA
                     TETSAPADKPADDDMAEILEQLNLAAENNRIFSASDEMQELLRKFKLIFKDLINGVPT
                     AYHDLEMLFKNGNNQLQDTYSKMPSFLQRLIEKLPEKWTDSLAPEVLAAASEKAAKNG
                     VNTENVAKAAAAADKMGLKVPSLKELVGKPAAIVGMLRSIVAFLKARFPAVIGVNVLW
                     SLALSILLFVLWYCHKRGREVRLENERLVTEEEIRKMNEQMASEERPIRATETLTTTA
                     PPGAAADMIRDGVREVERTRETVRTSTANPEATEAEVAGHGTSGTEVAGDENAAPVPT
                     RTKSRLSIFSRSGKKASKAEPYPGT"
     gene            <677262..>678162
                     /locus_tag="ACHE_20232S"
                     /db_xref="GeneID:66979133"
     mRNA            join(<677262..677691,677747..>678162)
                     /locus_tag="ACHE_20232S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284512.1"
                     /db_xref="GeneID:66979133"
     CDS             join(677262..677691,677747..678162)
                     /locus_tag="ACHE_20232S"
                     /note="COG:S;
                     EggNog:ENOG410PFQJ;
                     InterPro:IPR011009,IPR002575;
                     PFAM:PF01636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133296.1"
                     /db_xref="GeneID:66979133"
                     /translation="MAPIPTSTFFKNHRASTLPPPAEIRALNIATDKPSATSFNCPPP
                     VIIPSLGLVVKYGADVTWIEAETQIMICEKLQGRVPVPEVYGWEEDGNQGFLYMELVE
                     GYTLMERWSGLSKDEMRAICEELNQMVKLMKGLEQDDGPYIGSLNKQPLRDLFLIDRP
                     NLNGPYQGPNAIAQFQETCGLWITDDNPTPIVFTHNDFLPTNILISNGPNPKVTAIID
                     WAQAGWYPAYWEYCKARYIRVNPRYFSDAAIADWRTKYLPSIVDPVEEEGCYHPWLYF
                     ALSKC"
     gene            complement(<678671..>679235)
                     /locus_tag="ACHE_20233A"
                     /db_xref="GeneID:66979134"
     mRNA            complement(join(<678671..678772,678837..>679235))
                     /locus_tag="ACHE_20233A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284513.1"
                     /db_xref="GeneID:66979134"
     CDS             complement(join(678671..678772,678837..679235))
                     /locus_tag="ACHE_20233A"
                     /note="COG:S;
                     EggNog:ENOG410PPN3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133297.1"
                     /db_xref="GeneID:66979134"
                     /translation="MPLLPPPPSVPKERPPNTFLVTLLIYPNHWAYYIPSPAHPSLGI
                     LLHVTGDTRTGFKLAIQRSYDLSLPENQNPPTTYRIPLQWVDGWWLDEEKMLNNGAGV
                     RDCEPACAFERVVGRVEMPGLGEGLDDEGDKDWVIKVAEELVSSGVFEENVVSYLYTI
                     RMAEWL"
     gene            <682511..>683569
                     /locus_tag="ACHE_20234S"
                     /db_xref="GeneID:66979135"
     mRNA            <682511..>683569
                     /locus_tag="ACHE_20234S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284514.1"
                     /db_xref="GeneID:66979135"
     CDS             682511..683569
                     /locus_tag="ACHE_20234S"
                     /note="COG:Q;
                     EggNog:ENOG410PIXU;
                     InterPro:IPR000627,IPR015889;
                     PFAM:PF00775;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0008199 - ferric iron binding [Evidence
                     IEA];
                     go_function: GO:0016702 - oxidoreductase activity, acting
                     on single donors with incorporation of molecular oxygen,
                     incorporation of two atoms of oxygen [Evidence IEA];
                     go_process: GO:0006725 - cellular aromatic compound
                     metabolic process [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133298.1"
                     /db_xref="GeneID:66979135"
                     /translation="MQLSHLWQLALLGLAGLSAAHPGAHEESSMTPAAKKTFLYNAKR
                     SLGQCADRLERRGVKARAAARRAAISETYRKRSLLVRDTDRVVNTSHHSPLQVTSNTP
                     ETELFAQNPVCILSPEGEIGPFWVKGELVRSDIRDGEAGIPLIMDGQFVDIETCEPIQ
                     NLYWDVWSCNSTGQYSGVQSDMNGNGNDASNLDKTFLRGIQQTDSDGVAQFKSIFPGH
                     YSGRATHVHVVAHVGSHTLKNNTIAGGHVSHIGQLFFDQDLISKVEATYPYNTNTVEI
                     TQNAEDHVVQDETEDSNSDPVFEYALLGDKLQDGIFAWITMGINVSATYDTSNAATLT
                     SSGGVMNDDSSPGEAVDM"
     gene            <686865..>687686
                     /locus_tag="ACHE_20235S"
                     /db_xref="GeneID:66979136"
     mRNA            join(<686865..687081,687154..>687686)
                     /locus_tag="ACHE_20235S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284515.1"
                     /db_xref="GeneID:66979136"
     CDS             join(686865..687081,687154..687686)
                     /locus_tag="ACHE_20235S"
                     /note="COG:S;
                     EggNog:ENOG410PY0R;
                     TransMembrane:1 (o174-196i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133299.1"
                     /db_xref="GeneID:66979136"
                     /translation="MSANDTRPCYFPDRTEAKNNVPCSPDQHTHCCGMADICLTNGYC
                     LSIDHQPWVLSRGACTNQNWDSGCPERCVGDADNKGGGCSIVNLQYENEDGKSTYCCG
                     NPVSGSGTTATCPTESQFTLDDGHAVPGYALLSNLSNFYVSGSAPSSSATPSILPAPT
                     ILPDSSGDTCHDKAIGAGVGVPLGVIALAALAWGFFERKRVRAMHKQMSTVALNNAVQ
                     QPPAYGINQKNQVPAELEHTTPVPELMGREQ"
     gene            <690110..>691067
                     /locus_tag="ACHE_20236S"
                     /db_xref="GeneID:66979137"
     mRNA            join(<690110..690246,690300..690461,690512..690985,
                     691040..>691067)
                     /locus_tag="ACHE_20236S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284516.1"
                     /db_xref="GeneID:66979137"
     CDS             join(690110..690246,690300..690461,690512..690985,
                     691040..691067)
                     /locus_tag="ACHE_20236S"
                     /note="COG:S;
                     EggNog:ENOG410PKSM;
                     InterPro:IPR000210,IPR011333;
                     PFAM:PF00651;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133300.1"
                     /db_xref="GeneID:66979137"
                     /translation="MSMFRRSFTVKDEPSKTGRWIRKRHGKHSRHDKLKAQSRMDSLT
                     ERPISNPAVTFVVSSERRLFVGHEHVIARSPYFRSILRDLSMVGAYANKVVELPDEDP
                     EIFSCVLEFLYKGDYYPRLTHNELENAHDSKTFDRIASKATILHTRTRDEVLRDTVVY
                     CAAEKYGLTDLKQLALCKQGFHVGIPIPIILRSARYAYENTPDSDADLRAHYLVMVIR
                     AREMFKTSGTMEMEMEKGHAWFFDLFVAMCNHIDDLEDVCKQQTFKSS"
     gene            complement(<691759..>694397)
                     /locus_tag="ACHE_20237A"
                     /db_xref="GeneID:66979138"
     mRNA            complement(join(<691759..692108,692167..692877,
                     692928..693432,693691..693966,694026..>694397))
                     /locus_tag="ACHE_20237A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284517.1"
                     /db_xref="GeneID:66979138"
     CDS             complement(join(691759..692108,692167..692877,
                     692928..693432,693691..693966,694026..694397))
                     /locus_tag="ACHE_20237A"
                     /note="COG:Z;
                     EggNog:ENOG410PGNR;
                     InterPro:IPR036961,IPR027417,IPR027640,IPR001752;
                     PFAM:PF00225,PF16796;
                     go_function: GO:0003777 - microtubule motor activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0008017 - microtubule binding [Evidence
                     IEA];
                     go_process: GO:0007018 - microtubule-based movement
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133301.1"
                     /db_xref="GeneID:66979138"
                     /translation="MISTSKASQTSLFQVYLRLRPPISQQNNIQPDRCLIVDPPEHNI
                     EHAEDDQDAPLPATTHITLQPPADSKKRAVERFGFTQVFDESASQIDVFQDTGMDDII
                     RGVLLEGRDGLIATLGVTGSGKSHTILGSKSQRGLTQMSLDVIFKALEPTMKPPDNSI
                     NPNLLASVAASDPGEAQIFTAQTFLEAVYGDPNTERGRNSRAQTPISSSRGNTPLVDP
                     MPALIFPRRQMPQRPSMLPRVPDVSKFAPDLNPKSEYMVLVSMYEVYNDRIFDLLSPA
                     ITPGQGSSRQAVNNQKDRRRPVMFKYTERSPDRKVVASLRKIACSTYEEALAILDVGL
                     AERKVTGTGANSVSSRSHGFFCLEVKRRMRHKITGEETWVGNTLTVADLAGSERARTA
                     KTAGSTLAEAGKINESLMYLGQCLQMQSEIKDGKAALVPFRQCKLTELLFSNSFPSSN
                     SSHSRGPQKAVMIVTADPLGDYNATSQILRYSALAKDVAVARAPSPAESIFSATLHSP
                     RVSDHGWNSPDPALNGELEDALAVISRLTSENESLSVRLTQEEIARAELEMHLKASDE
                     RCLMIEQEVREECWAEMDEKMEEERKRWQSAWDDQTGRNDEHMDKKIELLSRGFQINE
                     DPEPPADEKYQFLEFENDQLRAKITALERELNCRSPTKQPTRPRTRNALKSSRNSNLL
                     GRESDIESALRHMDQLKLSENLFAPAVTAGPGGSPGKRTRKMATRKWDLAPEDEI"
     gene            <695022..>695664
                     /gene="SEC11"
                     /locus_tag="ACHE_20238S"
                     /db_xref="GeneID:66979139"
     mRNA            join(<695022..695359,695424..>695664)
                     /gene="SEC11"
                     /locus_tag="ACHE_20238S"
                     /product="signal peptidase complex catalytic subunit"
                     /transcript_id="XM_043284518.1"
                     /db_xref="GeneID:66979139"
     CDS             join(695022..695359,695424..695664)
                     /gene="SEC11"
                     /locus_tag="ACHE_20238S"
                     /note="COG:U;
                     EggNog:ENOG410PJU3;
                     InterPro:IPR036286,IPR019756,IPR001733;
                     MEROPS:MER0000602;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008233 - peptidase activity [Evidence
                     IEA];
                     go_process: GO:0006465 - signal peptide processing
                     [Evidence IEA]"
                     /codon_start=1
                     /product="signal peptidase complex catalytic subunit"
                     /protein_id="XP_043133302.1"
                     /db_xref="GeneID:66979139"
                     /translation="MLSFLSSSMSSARQSLAQVLNFALVLSTAFMMWKGLSVATASSS
                     PIVVVLSGSMEPAFQRGDLLFLWNRAPRAELGEVVVYNVRGKDIPIVHRVVRTFPEVE
                     GKGKNVKEVEDASTVPNNMLLTKGDNNVADDTELYARGQDYLNREEDIVGSVRGYIPM
                     VGYVTIMLSEHPWLKTVLLGIMGLTVMLQREQ"
     gene            <696164..>696776
                     /locus_tag="ACHE_20239S"
                     /db_xref="GeneID:66979140"
     mRNA            join(<696164..696190,696270..696386,696453..>696776)
                     /locus_tag="ACHE_20239S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284521.1"
                     /db_xref="GeneID:66979140"
     CDS             join(696164..696190,696270..696386,696453..696776)
                     /locus_tag="ACHE_20239S"
                     /note="COG:O;
                     EggNog:ENOG410PPYQ;
                     InterPro:IPR016135,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133303.1"
                     /db_xref="GeneID:66979140"
                     /translation="MGSQKRIAKELAELVESPPEGIKVELANEADLYDWKVYLNGPEN
                     SPFHNGTFLVKLKFPNEYPFKPPAVNFATKIYHPNVTNDEKGSMCLGMLRPDEWKPSS
                     RVVAVLQFARQLLAEPMPDDAVEGRIAEQYKNDWARYEEVARDWTRRYANEKA"
     gene            <699486..>701900
                     /locus_tag="ACHE_20240S"
                     /db_xref="GeneID:66979141"
     mRNA            <699486..>701900
                     /locus_tag="ACHE_20240S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284522.1"
                     /db_xref="GeneID:66979141"
     CDS             699486..701900
                     /locus_tag="ACHE_20240S"
                     /note="COG:U;
                     EggNog:ENOG410PFC7;
                     InterPro:IPR035969,IPR000195;
                     PFAM:PF00566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133304.1"
                     /db_xref="GeneID:66979141"
                     /translation="MVTENGEFRYPPRVGEFDIPSRRRVPPPPRLDPLRFHPPAPPSR
                     PATSHSQGAHSRSNSPRLPPAPFRARGPLPHGYWPPPPEELVSPCPSPQFGPDYNVYY
                     DFDPPRATHRAPTFPAVPHEPVPTWRHMDGEGDRPSRRKMPPGRAGLRISMSASRMNH
                     QKRAKGQHSRERRPTDTSHPQALGLPRATPSSSLDAYGGNDALRSSVNSAMTSRSSIE
                     QNSGTERSSVLTKSSSITDLSPDTPDGPEKDGGMSVEDAISMYLDGFSDVTEEPSSPD
                     LHAEDKSRPSSPRPSTTMTMDTFDEQSPDMNPMEGLPPVPPLPEMQPMGQNPPHQELL
                     NDQSSIHETSNEHSHETYHHEPTSPAKDPGIARQESTIVVPGIVPPPLLPGTDSRDRY
                     GFRKASNHVPIERYDAWSRSYSSFAANRKVKWAELLREHGLETKEPTRFPPKSSRVKR
                     FVRKGIPSEYRGAAWFYYAGGFELLSRNPGLYDELVQKAMISPSNDDKEHIERDLHRT
                     FPDNVHFKPEQGASSGSSNPQGTVVETQMIQSLRRVLYAYALHNPKVGYTQSLNFITG
                     MLLLFLPEEKAFWMLHIVTSLYLPGTHEISLEGANIDLWILMVLLKESMPNVYSKIAA
                     TGPGSNKARVPALTVHSRLPDITLGLTNWLMSIFIGTLPLETTLRVWDVFFYEGSKTF
                     FRVSLAIFKACEKDILAVSDPMEVFQVVQTVPKKLLDANTLLDDCFVRRHRVGQGRID
                     ELRAQRRAAVRQDKIRRSMALTQGQLQAATDEWPTQRSRTPIPGLERSIADSWRHMRR
                     HHHAVR"
     gene            <702467..>704252
                     /gene="PNS1"
                     /locus_tag="ACHE_20241S"
                     /db_xref="GeneID:66979142"
     mRNA            join(<702467..702772,702840..>704252)
                     /gene="PNS1"
                     /locus_tag="ACHE_20241S"
                     /product="putative choline transporter, neither null
                     mutation nor overexpression affects choline transport"
                     /transcript_id="XM_043284523.1"
                     /db_xref="GeneID:66979142"
     CDS             join(702467..702772,702840..704252)
                     /gene="PNS1"
                     /locus_tag="ACHE_20241S"
                     /note="COG:I;
                     EggNog:ENOG410PHF7;
                     InterPro:IPR007603;
                     PFAM:PF04515;
                     TransMembrane:11
                     (o97-118i139-162o174-195i202-220o240-272i307-324o373-
                     391i403-424o430-449i470-494o506-527i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative choline transporter, neither null
                     mutation nor overexpression affects choline transport"
                     /protein_id="XP_043133305.1"
                     /db_xref="GeneID:66979142"
                     /translation="MSGQAASYYNPSQGFEEAPQQPPQPYQQPFYNLQQQQQQQQQQQ
                     QQQQQQQQQQQYAPYPNQGVAESKPPENPPTYNQAVYGFDEAFKIEKPKLNDLWAGLL
                     LIAVFLGYVAISGLTIHRYAKYKGFNGGGIYDAGNEVSLNTNTLVLFIFVLCVAIAFS
                     WAYFMGARFFPKTFIWVTGILNIVLALATGIYYICRKQYGGGIAFLIFGIFALVCFIS
                     WIPRIPFTAFMLQTSMDVTRKYGHVFVVSAIGGIVAVAFAAWFSVTLVAIYVAYEPTS
                     SSSGRAGAVDGLSDTSTVSNPSCSNGGCSRARVIGLVVYVTFAMYWFSEWIKNTVHTT
                     IAGIYGSWYYFCGEGPGGQGGKNMPKGSTRGAFKRATTYSFGSISLGSLFIAIINMMR
                     QACSIAQRHEAAEGNIVGCVFAWILGSCISLLDWLVTLFNRYAFCHIALWGKAYIPAA
                     KDTWAMMRDRGVDALVNDCLMGPVLTMGSVGVSYICALLAYLYLQFTNPGYNADGNFT
                     AVIMAFAFVIGLQVAQILLTPVGSGIETIFAAMAWDPEVMMREHPGLYQELVKVYPRV
                     QQAIHA"
     gene            complement(<704371..>706361)
                     /locus_tag="ACHE_20242A"
                     /db_xref="GeneID:66979143"
     mRNA            complement(join(<704371..705619,705673..>706361))
                     /locus_tag="ACHE_20242A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284524.1"
                     /db_xref="GeneID:66979143"
     CDS             complement(join(704371..705619,705673..706361))
                     /locus_tag="ACHE_20242A"
                     /note="COG:S;
                     EggNog:ENOG410PU4S;
                     TransMembrane:1 (o610-634i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133306.1"
                     /db_xref="GeneID:66979143"
                     /translation="MSQFRLFPPLTPTSTTKDNLPSRGGRGRKVLVGSSSPSTSTVLE
                     DLRGSRKTDAVLRQIGENAKAIQPPKPPPKAHVTKPALKSDIFGGANGRDGERQEPER
                     LALSSSSTLADNRSPGRFSALSIPIKSIFPRYNPNLPLSEQEYYPQISDSNSRSRQKP
                     KGLVLSPEPEIDRALGPKTVPASVMEFLPGLLDSVEVHYSSAIDLQGLWEAANGQRLE
                     NQTASFKLRLTRTDPTTFTFSDPQHQHPFYTLRLTTPAELTISRTNPTKPTNSIPIMT
                     LALKDRTRREHPNDGLVSIVSSRLAAMLAVEQADEVARKQHLTPSEALDAQRKALKRA
                     EEQESCRLAWNHDLRLYTLEHPSFSKQATPDLISAAGIPLSPARPKGPGAVHITVSTP
                     SPSPTHTTKQPQSQPSTILATAPTPSNSTSTGSARLAPTPRTSMLPLTDTDDPLASLD
                     LSTRTLCISSNAVIATIPSLYAIDSVVAGILAVAVVDEGSRGVLMGMEMGTGCQNQGT
                     RQELFTTVAEREDVAMGCDLVERFESGPNTGAVNDDKQEPSNSDTKPPFWNRLRKPRP
                     QKPKQKNKQIVIEEFDLEKYGRYGPSSSREGEKLPSIARGVLRVLFWGLDLVVKMLTA
                     MVKMLAWILVNLTRCVTSERF"
     gene            complement(<706885..>708430)
                     /locus_tag="ACHE_20243A"
                     /db_xref="GeneID:66979144"
     mRNA            complement(join(<706885..708225,708281..>708430))
                     /locus_tag="ACHE_20243A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284525.1"
                     /db_xref="GeneID:66979144"
     CDS             complement(join(706885..708225,708281..708430))
                     /locus_tag="ACHE_20243A"
                     /note="COG:O;
                     EggNog:ENOG410PG2M;
                     InterPro:IPR014851,IPR003959,IPR003960,IPR027417,
                     IPR003593;
                     PFAM:PF08740,PF00004;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133307.1"
                     /db_xref="GeneID:66979144"
                     /translation="MEPNGPPNAPGLSSSGDLIQQRKDAVQAAAQSPRDGSYLSQLTN
                     NPFFTAGFGLAGLGAGLSFAQKGLRHGAALLRRRMLVDVEISIKDDSYPWFLHWMTLY
                     QQSHNSARTTAAKSSFMDSLLQRLTPGMRHLSIQTQKVEHSNGAIHTHFALVPGPGKH
                     VLRYKNAFIFVNRMREAKSVDLQTGRPWETITLTTLYSHRHVFEELFTEAHAYAAKAH
                     EGKTTIYNSWGTEWRPFGQPRRKRPLESVVLDEGVKERIVTDVKDFLDSGSWYHDRGI
                     PYRRGYLLYGPPGTGKSSFIQALAGELDYDIAILNLSERGLTDDRLNHLLTIVPNRTL
                     VLLEDVDAAFANRRQTDVDGYRGANVTFSGLLNALDGVASAEERVLFLTTNHVDRLDP
                     ALVRPGRVDMTVRLGAVTRYQVGCLWDRFYGELDTTGAYRHTFLTKLEELGLIEDENG
                     QQADRSRTTSAAALQGLFLYNKDNMEGAISMAEALTYSVHEEAMEN"
     gene            <708938..>710395
                     /locus_tag="ACHE_20244S"
                     /db_xref="GeneID:66979145"
     mRNA            join(<708938..709149,709202..709249,709318..709962,
                     710017..>710395)
                     /locus_tag="ACHE_20244S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284526.1"
                     /db_xref="GeneID:66979145"
     CDS             join(708938..709149,709202..709249,709318..709962,
                     710017..710395)
                     /locus_tag="ACHE_20244S"
                     /note="COG:S;
                     EggNog:ENOG410PICU;
                     InterPro:IPR024884,IPR036866,IPR001279;
                     PFAM:PF13483,PF12706;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0070290 -
                     N-acylphosphatidylethanolamine-specific phospholipase D
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133308.1"
                     /db_xref="GeneID:66979145"
                     /translation="MRSYQRWFFFFRKQTRSTPCSNLLLARRNMSSSTAAVLYALTVT
                     TSPTSPGPEDATKKSHHLQEGFKNPWDSWYQHDFFGILGHMVHRRISGKGNVPDTKPP
                     TVSVQKPEFLPSRETSNLRATWLGHACYYVEFPSGLRVLFDPVFEDRCSPCSFMGPKR
                     YTKMPCEIKDIPVIDAVVISHNHYDHLSYPTVKEIFERHPNCHFFAPLGNKAWFSSCG
                     INNMTELDWWDERDIILSPSQRPAPAAGVEMPDGASEAKNADIKARIGCLPCQHTSAR
                     GLFDRSKTLWSSWSIESGGRKVYFAGDTGYRAVPELPDDVDDHAPEYNFPACPAFKQI
                     GQYRGPFDLGLIPIGAYQPRYIMSPMHADPHDSVQIFKDTKCQRALGMHWGTWVLTEE
                     DVLEPPRKLREYLRKEHIAEEGVFDICDIGESREF"
     gene            <710993..>711853
                     /locus_tag="ACHE_20245S"
                     /db_xref="GeneID:66979146"
     mRNA            <710993..>711853
                     /locus_tag="ACHE_20245S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284527.1"
                     /db_xref="GeneID:66979146"
     CDS             710993..711853
                     /locus_tag="ACHE_20245S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133309.1"
                     /db_xref="GeneID:66979146"
                     /translation="MSRPPDPDPDMIEISRWSTSSSEEEEEESGEGHEAGSRGSKTSQ
                     GKNSAHDRNAGKRDDNPQNEEEVIYELDEDAMSQLPDHLQINMREIQQERMERIHCEN
                     SNVQIRKISDQKEVRADNWFRNMLSRFPSRPNMGFHANRDTVRRRHSPSLDDLEAHER
                     ARLAPGSPMPLTKDNLEYLTECTGGETNVMLAAATRRRVEKKASIKDRIYSRLSGKRR
                     REEEAALRHLKNIESQVHVGIPQCYRDLVKEEEEQNRQLSAQIAEGRHSLRGRVKESM
                     QKMSMAFKKD"
     gene            <712341..>714239
                     /gene="CCT3"
                     /locus_tag="ACHE_20246S"
                     /db_xref="GeneID:66979147"
     mRNA            join(<712341..712365,712427..712493,712555..712763,
                     712819..713409,713461..714098,714150..>714239)
                     /gene="CCT3"
                     /locus_tag="ACHE_20246S"
                     /product="T-complex protein 1 subunit gamma"
                     /transcript_id="XM_043284528.1"
                     /db_xref="GeneID:66979147"
     CDS             join(712341..712365,712427..712493,712555..712763,
                     712819..713409,713461..714098,714150..714239)
                     /gene="CCT3"
                     /locus_tag="ACHE_20246S"
                     /note="COG:O;
                     EggNog:ENOG410PGNN;
                     InterPro:IPR002423,IPR027410,IPR027413,IPR017998,
                     IPR002194,IPR027409,IPR012719;
                     PFAM:PF00118;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0051082 - unfolded protein binding
                     [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="T-complex protein 1 subunit gamma"
                     /protein_id="XP_043133310.1"
                     /db_xref="GeneID:66979147"
                     /translation="MQAPVVVMNTNAGDRQVGRKAQLSNIAAAKTVADIIRSCLGPKA
                     MLKMLLDPMGGIVLTNDGHAILREIEVSHPAAKSMIELSRTQDEEVGDGTTTVIILAG
                     EMLAQALPQLERNIHPVVIISAFKRALADALAIVEEVSTPVDIDNDDEMYKLIQSSIG
                     TKFVSRWSKLMCDLALKAVRTVSFDAGGGKQEVDIKRYARIEKIPGGQIEDSEVIDGV
                     MVNKDITHPKMRRRIENPRIVLLDCPLEYKKGESQTNIELTKEDDWNRILQIEEEQVK
                     HMCDAVLALKPDVVITEKGVSDLAQHFFARANVTALRRVRKTDNNRIARATGATIVNR
                     VDDLQESDVGTQCGLFEIEKIGDEYFTFMRKCQTPKACTILLRGPSKDILNEVERNLQ
                     DAMSVARNVIFHPRLSPGGGALEMAVSVKLGQLAKSIEGVQQWPYKAVADAMEVIPRT
                     LAQNAGASPIRVLTRMRAKHVEGQVNWGLDGDTGNLVDMQEYGVWEPEAVKMQSIKTA
                     VESACLLLRVDDICSGKSAQQAGVGVGGGDD"
     gene            complement(<714367..>714972)
                     /locus_tag="ACHE_20247A"
                     /db_xref="GeneID:66979148"
     mRNA            complement(<714367..>714972)
                     /locus_tag="ACHE_20247A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284529.1"
                     /db_xref="GeneID:66979148"
     CDS             complement(714367..714972)
                     /locus_tag="ACHE_20247A"
                     /note="COG:S;
                     EggNog:ENOG410PQ3T;
                     InterPro:IPR009548;
                     PFAM:PF06658;
                     go_function: GO:0003725 - double-stranded RNA binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133311.1"
                     /db_xref="GeneID:66979148"
                     /translation="MSEPGPESIPTSADRRSNRPLKRRALNTPHSEQASQISSLFRDP
                     SKELKLPEASRQKTASNLPPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMQ
                     SEVDREKGDEEWEKEREETRRRDEEKTEKNRKRREKRNATKKKSNGKKGGGAGAGANG
                     NGNGDNGGERMAVDDTGVDAHAGAHGAGVVEETPGVIIHED"
     gene            <715695..>717094
                     /locus_tag="ACHE_20248S"
                     /db_xref="GeneID:66979149"
     mRNA            join(<715695..716016,716177..716312,716373..716553,
                     716615..716680,716741..>717094)
                     /locus_tag="ACHE_20248S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284530.1"
                     /db_xref="GeneID:66979149"
     CDS             join(715695..716016,716177..716312,716373..716553,
                     716615..716680,716741..717094)
                     /locus_tag="ACHE_20248S"
                     /note="COG:S;
                     EggNog:ENOG410PSUB;
                     InterPro:IPR036957,IPR001510;
                     PFAM:PF00645;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133312.1"
                     /db_xref="GeneID:66979149"
                     /translation="MNTHTLTRYHRKAHRHQHCGIDFQRSAWVSISLSTSPHLSNSCL
                     PSLQPLLSIPSSQKIEVQLIPSVIEEVSCDFQLHISFVPHCVSRREAELRCRVIRPRM
                     GSYRLEEASTGRAGCQNKECKDSKTKIAKGELRFGTWVDTERIQAFMWRHWGCVTPKL
                     IGNLNETIDEEGGGGDEKDYTAIDGYEDLPDELQEKVRGALEQGHVDDEDWKGDVEMN
                     RPGKTGFRVRKKAGATAKKDDEEKEPPKTKKRGKAQDDEHEEGTEKPAKKTKKDARGT
                     KKAAKEEPESENAEEGSENEEEKPARKSRSRATKTTSANRKKQDDAAEEDKDEQMADA
                     EVPAEEKPKRGGRKKRAT"
     gene            complement(<717524..>723809)
                     /gene="HIR3"
                     /locus_tag="ACHE_20249A"
                     /db_xref="GeneID:66979150"
     mRNA            complement(join(<717524..719008,719061..719216,
                     719268..>723809))
                     /gene="HIR3"
                     /locus_tag="ACHE_20249A"
                     /product="histone transcription regulator 3"
                     /transcript_id="XM_043284532.1"
                     /db_xref="GeneID:66979150"
     CDS             complement(join(717524..719008,719061..719216,
                     719268..723809))
                     /gene="HIR3"
                     /locus_tag="ACHE_20249A"
                     /note="COG:K;
                     EggNog:ENOG410PHS4;
                     InterPro:IPR033053;
                     go_process: GO:0006336 - DNA replication-independent
                     nucleosome assembly [Evidence IEA]"
                     /codon_start=1
                     /product="histone transcription regulator 3"
                     /protein_id="XP_043133313.1"
                     /db_xref="GeneID:66979150"
                     /translation="MSSWVALNIEPDEAVEEEVDDTKEIQIEEALKLYQNALKLHSQG
                     SQFYPQTAEAYDALFNSDIFKYPESFSDYKRIALQDSEPEPQPNDLLEYLATTDSADD
                     IGESDINDSTSSTLLQTIYLSYKNHGQFLLDSLQSFLQGVSESPDAARESATERLERS
                     RAALTSFAEALERDDTDLNLWRQSARLSSALQSYRLSRYCLESVLADDENRLEVRTEQ
                     LGLEETIAEERLRNTLQSLNDRLAVAQVPVKRPKKALIKFLQRQADPYPYLPTLPENL
                     EDADSSKNPLPLKATRHVLKPSSATWDAVGKEILQALLDEEKHTLNIGPGASVDVQLP
                     TTSPEPQDTTPKEMQHADESPKMEDEQVQSIEQQDIAMGDNQPSTSNAQENEPNDIPA
                     EPTEDQMISADQQPAKPSTEPQDDQAAQHPEDSIQEQPAADEPDSKSANGYRKRSSAS
                     AVNDEQAENLRAKSRRTRARESNIDPSQADEIAFDQSKYYEDRLEMYVYADQWLFETT
                     DSFLSKAGAENLGDLDYMRKRMSLVGDANGPVDSAGNFESLLSQDLGSIINNWDDKKA
                     RAFSESDNFSNLHDIQSMSKSGLAIFLEHSKKSTRKSGINEVLSGGEKLPECLKPINE
                     GWSRLGEVAFDWLKGLLMPEYGEYSDGVSKEENFPATESTYISLQWPETLKDTVVQIL
                     QREDEYIYNRLSGQIANLERQVLDLSPDASFAYDLKHRSELEMIQAIFELHLDVYAQI
                     NNPNSEVDQETRLLQWDRLCRWSMLAQNSLSYFVDHSISGQSGNEIILRHLWATTFHS
                     NMAPDVQREHILLCLQDLKQILDRLGNPDITLVNNAVMPELSSEAIDREVSKLKSMGF
                     FLKIFSPESEDPVDIIETIEPLLEPSSIECQNGVSESESDDNDNPASDFHEMGSFLDR
                     GDATLRLFLWRRLQEAYKTIDYPPKVISCYLRGIETIVKELCSSAYAEELIEHRQHTL
                     LRWLKSLDSILSKLVTQALQEQDKAFDCIDMDHLRSSMSALVRLLKLLHSFTLYEDSV
                     RVGQILAPEFRSSLAKSLEGFRDRLREMEVRCWILQYILFKEVIAQNKELFDAPDADR
                     IEYLRTVHYALGLRKMCRRSGKEFLRLMKSELHDVKINEDLDLEICQVFYDLHGYRLI
                     NHDLITDHGCPTERIDRATAIMMIDFVLRQAMKVNIKDFAKSDLKSTIDKMQQAIGSA
                     KSSPPLAYNKRIFSSYLKSAINPIELYRAARGVEDLPLIPVTTESATIAQKGWYFLLG
                     YSALTKFRSQKRLAPTGTGELDDAIGFFRQDIENRSGRWETWYRLAQTYDSKLEEDIT
                     WSAEKINNNRNELATLQRNAIHCYAMALATASRTAEPTPETRNTLSELYTDFAIRMYS
                     SSREPLSMGPFSLSDYARHYSNEENQQMYKGEPFREMKPYSVWNFTSYLLKRAIVDKP
                     KNWVNHYMLAKCLWKMYRSDDSVRGNFKRVSLDDVLDSLLDAIDTLPQRKDSRSEPIF
                     EPHYKLVSIIHKLVHGDVLIPAEGSKTLLATPWARKVKAPEDKAGWQSYILEVLRNLK
                     HADKSNWHHRMAMRAARIVYDDQEDASAAAVAAKNELTQQIFTKTMAIQVWRPENERP
                     GRHFVYTTRYVYFFVHLLDQLDDRAGLDQLLRRVRKRQGDFINHPKLWEDICLTYGRV
                     IRRAGKINEGHEEGIFKPIGWEEFVANTGRLENLPELVAPESASLLELLRDSIELKKL
                     NNNLMKVSLLEDLIADLYSRLYELNLPHVIEQASEENKEKMKVDHLLMTMDGAADAHP
                     TGPGGPTVHPPGTTATAISAPGQAQPTTTTSTEAPASVPRGRTKGIARRDIQKRAEAI
                     VASKLTTRPPTKLTTTTGPSTTTTETETQNANETGATTTASTKAPKSEPGTKDKKPGS
                     TRESGDESELSETDEEKMTKLDAERQHSRVFPNLKPSSPQEPGSEMSVPDGDAEGDGG
                     ETANEGEGEGEGDTTVEESFISAAPGDETEVIDEEEGEGDEGVEEGGDVADGEDGDDE
                     GEDDNENEGEGETEILKDTEDGAEGEGGQEQFQATGDEPEAMET"
     gene            <724227..>726636
                     /locus_tag="ACHE_20250S"
                     /db_xref="GeneID:66979151"
     mRNA            join(<724227..724249,724327..724462,724565..724692,
                     724745..725025,725076..725983,726038..726412,
                     726469..>726636)
                     /locus_tag="ACHE_20250S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284533.1"
                     /db_xref="GeneID:66979151"
     CDS             join(724227..724249,724327..724462,724565..724692,
                     724745..725025,725076..725983,726038..726412,
                     726469..726636)
                     /locus_tag="ACHE_20250S"
                     /note="BUSCO:EOG0926142Y;
                     COG:S;
                     EggNog:ENOG410PFA8;
                     InterPro:IPR015374,IPR011990;
                     PFAM:PF09295;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133314.1"
                     /db_xref="GeneID:66979151"
                     /translation="MVAPAVPEIYEEDDIYAAVDARTETLQNLRELGPPDLVYLVKQP
                     KASGSRQTEQTGVYHHVTGIDASSSASLAAYVNTLTFSPLDKTHKVVSGIYCCYNAFS
                     HLDMRVEVKIPGSLESYCIDERGDKRVATDALWLETFLCGVLRAYAYADDGGGDAIRR
                     IVGVRRFNPVTNTEMEHKFLDAAERLFFMGRQLSSDPETQVPNTVSNHLTTGLLKYIQ
                     TTGRYTSGINLFEKLRTRDVEVSSLLSRVLLMADEEVRAVRLMYDALQDVPMDYSLLD
                     CQASFCQKKGEGEMALECAKRAVTAAPSEFSTWAQLAEVYVNLEQWDLALLTLNSCPM
                     FTYQDRDTPRMPQPSRIMLPILAESILDEIDEGQPRQGDPHDYVHPSLRKLHAAAYQG
                     TFLKAYNLLTKIAAAIGWDQLLKTRSEVFVMEEEYRVERQHSTSKPPGSVKSNSGDVE
                     MNGNGGHAENSANEENGEHEGNQIERPEHTMASEVVKSGNEDHDPSHSSYTQFKNKRL
                     CERWLDNLFMVLYEDLRIYTIWRTEMAQYRQQSMEYKKSATEWEILGELAERLHHFEE
                     GIEAYQHCLAIRFSPKAMRGALKLHEAKNNTRGMLNSLIRLIAWQYRWYSEFSPELLY
                     LIRKLIEDEGAVKVRSIVQATNLPQPVLDLTHQYCQLCATFRSSGSDF"
     gene            complement(<727016..>727738)
                     /locus_tag="ACHE_20251A"
                     /db_xref="GeneID:66979152"
     mRNA            complement(join(<727016..727272,727357..727520,
                     727653..>727738))
                     /locus_tag="ACHE_20251A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284534.1"
                     /db_xref="GeneID:66979152"
     CDS             complement(join(727016..727272,727357..727520,
                     727653..727738))
                     /locus_tag="ACHE_20251A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133315.1"
                     /db_xref="GeneID:66979152"
                     /translation="MVTRKRKQEAVEEEELQALPSDESEEEEEYQSSDEEGSGGEEES
                     EEEPSEAESEEYVEEGDGESEEKEGKGKGKDRAKPKEEKGPTPKKRKTSPPAAKKQKG
                     DEDTGEKEAPTGEEEEEAEDEGEEKPEETAENSGPAASAAKAKGDKVPKESDLPEAEP
                     EGEGEEKE"
     gene            complement(<728624..>730887)
                     /locus_tag="ACHE_20252A"
                     /db_xref="GeneID:66979153"
     mRNA            complement(join(<728624..730445,730517..730649,
                     730761..>730887))
                     /locus_tag="ACHE_20252A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284535.1"
                     /db_xref="GeneID:66979153"
     CDS             complement(join(728624..730445,730517..730649,
                     730761..730887))
                     /locus_tag="ACHE_20252A"
                     /note="COG:S;
                     EggNog:ENOG410PICM;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133316.1"
                     /db_xref="GeneID:66979153"
                     /translation="MASTPRKRSSYDAGFESAQKDDKHASNLPDGRPLPRISKARACA
                     ECKRHKIRCEIKPGASSCSKCLRSGIKCVVNDFSQKFVDDDGVWKSQAAASLQQLQAA
                     VSHILRQNGLPELSAYPAGDSRNNPSPVASINGHPPSLHDDAQSNTSHNGPEPVMDVT
                     REPSQEPDLQDPELVPAPMRSLYEVTKLRNFRNNPVEKPKVTMLEEDFISRGLISVHE
                     AEELFAYFSRTMNQLLWGGIILVHRDLTSVRRASTLLSAAVLTVAALHIPNRTDTLNR
                     CYGEYVSLVSNMSLSRAHTLDDIRALCVGAFWLSELSWKLSGHAVRIATELGLHQSYQ
                     KFIRGHTDQYERAQLWYLLYVCDHHFSIAYGRPPVMHEDNAIKNYETFLQSPMVVPGD
                     IRLIAQLALFMILTEAYRTFGSDTEQALTEEDFGQLRVFNVAVDQWRLLWQPRSCRYS
                     QFYGGTPCELTSSLADSPYVRTYPSKGVVLHYHFAKFQLNSLSLRALSPSNTPVFSMD
                     RKESANIAISSAMACLNMVLEEPDIRDAIVGVPIFTHTMVTFSAVFLLKVAVNWNSAY
                     LSLDGRQVRNLVERVIELLNCVSAGEKHLTRHIARGLGKMLERFDSWEMAWQAGRIPN
                     GHGSRHSVPVSTCGIVTSGTPVEVPGGANAMAQGFPPPDLIYDMVGTYGFGLDENLLD
                     PSMASFEFLAQ"
     gene            complement(<732540..>733280)
                     /locus_tag="ACHE_20253A"
                     /db_xref="GeneID:66979154"
     mRNA            complement(<732540..>733280)
                     /locus_tag="ACHE_20253A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284536.1"
                     /db_xref="GeneID:66979154"
     CDS             complement(732540..733280)
                     /locus_tag="ACHE_20253A"
                     /note="COG:E;
                     EggNog:ENOG410PIV7;
                     InterPro:IPR009770;
                     PFAM:PF07063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133317.1"
                     /db_xref="GeneID:66979154"
                     /translation="MYREEVPLYGDLVKIVHNINAVTLEDAISKTSAADTVALRASAE
                     WLTLERHGANRLGIPYELQIVKRIFAVLGMYPIGYYDLSASGLPIHATCFRPKHTASL
                     DWNPFRVFTTLFRPELLVSKDAREQALALLEQRRIFTDTLLDLLNTAGEQDAQLDHEQ
                     AEAFVPEALLSFSWRSVAAAAFDQYRLLREEHPILADIACLQSAHINHLRSLNQTPDP
                     FPILQCRGHFGVICQMIQGMPIAFLGYH"
     gene            complement(<734176..>736411)
                     /locus_tag="ACHE_20254A"
                     /db_xref="GeneID:66979155"
     mRNA            complement(join(<734176..734932,734989..735216,
                     735270..735802,735856..736065,736115..>736411))
                     /locus_tag="ACHE_20254A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284537.1"
                     /db_xref="GeneID:66979155"
     CDS             complement(join(734176..734932,734989..735216,
                     735270..735802,735856..736065,736115..736411))
                     /locus_tag="ACHE_20254A"
                     /note="COG:S;
                     EggNog:ENOG410PJJS;
                     InterPro:IPR021709;
                     PFAM:PF11696;
                     TransMembrane:2 (i164-193o361-384i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133318.1"
                     /db_xref="GeneID:66979155"
                     /translation="MVSNPLSSVVKSDDGEGRHMGHNLVHHINATSRIENQGPTNSHA
                     ISQAVSDEEGLVQKAGASQEVSDIGWEHGPGEIGEQIVPGLANDDLWMLLRRFDKQLY
                     YVKALPDTPMQRLDLVRAEDENFSPDKLRATLERFYTTVALRLISAAKHIARLRSWRE
                     YERTLGFCIVYFAAWLLDLLAPTFFIVLITLVVHPPSRTLLFPPAPIALVDTATGGTK
                     KPKAGHLGSDDSATGAPERYKGEAAEKEASNILASVAGLTVESAAGKHEQEMPEVEPE
                     NAPQDAKIDKTPNPAEIATKAADARTAVHGEKPEESHDKTRQPIKETVVNLANQSMRV
                     LSDITDTCERFENALSPTPPFPMVTPYLRFVGVLMFALFTSFIISSYAFVKISTFLSG
                     FVFFGDPVVQRAVKFLDRRYSNWKRLLELRNTLLQGIPTNAQLTLTLLRIGETNLAPL
                     PPPPGSRAKNPSYGNNTSAPTSESENSRPGSPSPQHIAEPHKQKQGILSYIVSFFRGT
                     TATSIKSKLAVDRARAVAGSRHAKARVGILRSKGKRALPSGPVEFDARYKGKRGAAII
                     DSSKDPPLLYFTTESALHFDNMEIESRQDGTVLFSLPVSDIREMRKTGGLGWKGKLVV
                     GWAVGSKEVVDGLLLIGREPGQRYQLTAMTTRNQLFDRLIAIDGQVWQSY"
     gene            <736958..>738878
                     /gene="MUS81"
                     /locus_tag="ACHE_20255S"
                     /db_xref="GeneID:66979156"
     mRNA            join(<736958..737052,737109..737278,737330..737721,
                     737769..>738878)
                     /gene="MUS81"
                     /locus_tag="ACHE_20255S"
                     /product="crossover junction endonuclease Mus81"
                     /transcript_id="XM_043284538.1"
                     /db_xref="GeneID:66979156"
     CDS             join(736958..737052,737109..737278,737330..737721,
                     737769..738878)
                     /gene="MUS81"
                     /locus_tag="ACHE_20255S"
                     /note="COG:L;
                     EggNog:ENOG410PIJ7;
                     InterPro:IPR027421,IPR011335,IPR006166,IPR036388;
                     PFAM:PF02732;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0004518 - nuclease activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="crossover junction endonuclease Mus81"
                     /protein_id="XP_043133319.1"
                     /db_xref="GeneID:66979156"
                     /translation="MSEETCANPLLLGWIKEWLDQARERNSKGFTVYKKAYESMKACP
                     LVFQHPSEAQQLNGLGPKLCDRLTDKLKEYCAQNGLPEPEPPHKKSKRPSGEGLPEDQ
                     PAKKLRKKKAYVPALRSGPYALLLGLGTLNENASQSMTKAQLIEAAQPYCDSSFTVPP
                     DPTKFYTAWNSMKTLVQKDLVYEHGRPLRKYALTEEGWEVAKRVQKTLPGTGQSTLPF
                     GGTDEQASANPRLQRTPSIFTDNDNDIQASTSQRPGAVPETLDEDQEDLNPYTLGTGA
                     ADGSNITPIPLAPKSFTIQLILDTREVRSSKDRDYISNELTKRGVTPEVRALELGDAM
                     WVARVHDQSILSRHGEENANDEIMLDWIVERKRLDDLVGSIKDGRFHEQKFRLRRSGI
                     RNVIYLIEEFTVTQDSAMASKYHEMVASAIATTQVVNGYFVKKTRNLDDTIRYLTRMT
                     FLLQKMYDDSTNTLSFLPTSQISSSQAYLSALERLRPQSPAMTYGVTFSTFSALSSKS
                     DVLALRDVFLKMLMCIRGVTGDKALEIQRRWRTPRELVEAFQALDPRDREDMVAERMK
                     GMVGRKKIMKALSKKIAEVWGS"
     gene            complement(<739123..>742911)
                     /locus_tag="ACHE_20256A"
                     /db_xref="GeneID:66979157"
     mRNA            complement(<739123..>742911)
                     /locus_tag="ACHE_20256A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284539.1"
                     /db_xref="GeneID:66979157"
     CDS             complement(739123..742911)
                     /locus_tag="ACHE_20256A"
                     /note="COG:P;
                     EggNog:ENOG410Q1HB;
                     InterPro:IPR018303,IPR023298,IPR023299,IPR008250,
                     IPR036412,IPR001757,IPR017969,IPR006121,IPR027256,
                     IPR036163,IPR023214;
                     PFAM:PF00403,PF00702,PF00122;
                     TransMembrane:10
                     (i485-510o534-553i583-606o618-636i780-803o823-851i1115-
                     1138o1144-1167i1179-1201o1227-1249i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0019829 - ATPase-coupled cation
                     transmembrane transporter activity [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA];
                     go_process: GO:0030001 - metal ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133320.1"
                     /db_xref="GeneID:66979157"
                     /translation="MEDKNNGVLGAFGPHFPVHEPRCLRSTFFVSNVHCSSCVAYIND
                     ILSDIPAVRGVEVNILTHEVHVRHGVEVGASRLATALIQAAFEVHYVTTYDDIEGSVV
                     SEIDTTLLLPRDSILFSSVRASYPKLPLKNKQHIANCDACRKENQDRLSWSPRPEKNG
                     LFRRESSCISPLAASNRNSFCPDYKREGSDVESLVPGASPVAMEPVQPLDPASLSAPQ
                     HMDEEFNARISIGGMSCASCVNTVTNEVKQLEFIKDVVVNLLTNSAMLVYTGPKSNID
                     KVIDQIEDIGFEASLDEVNAVIQSSRAPNAFVAEIAITGMTCGSCVGTVTGAIEELPF
                     VTHVSVNLLSHSGVVEFEGEDKANSIVEKVEDIGFDASLTSVHPLAAQKDDNDESKPR
                     TVSIHVDGMFCHHCPERVLGSLDRLTDVVIEEPLSIRNPILKLTYTPSPSSFTVRELL
                     STIDSAHDAFKASVHHPPSVEDRSRAIQLHERRRLLCRLLFVFTVTIPTFLIGVVFMS
                     LVSSNNPTRMYLEQPIWAGSASRMEWSLFIMTTPVMFYGTDIFHVRAMKEIHALWRPG
                     SRVPFLRRFCRFGSMNLLISAGTTVAYLASLAVLIVDAAVGTNKSSQTHSSTYFDTVV
                     FLTLFILAGRFMEAYSKAKTGDAVASLGKLRPPEALLVERSVTPDDEKTEVIRHINVD
                     LLDIGDIVSIPHGASPPADGTVANTTGTYQFDESSLTGESKPVKKAAGDQVYTGSVNV
                     GQPVQIQVSAIGGSSMLDQIISVVREGQSRRAPLERVADLLTSHFVPIITLIAILTFL
                     IWLSLGLSGALPDDYLDVSRGGWTFWSLEFAIAVFVVACPCGLALAAPTALFVGGGLA
                     ARHGILVKGGGEAFQEASRLDAIVFDKTGTLTEGGSLKVSEHEVLSNTNDSAEMQVAW
                     TLAKKLEESSNHPIARAIMEFCNGKPAVFVQSSEIQELSGKGMKGVFTVSTLETKDPI
                     QYEAAIGNERLLHELASPVTDTYYISTLLSKYQSAGKSTAILSIRKTKPNSFEKTPFI
                     PVLVFAVSDLIRPEAAQVISDLQKRRVNVYMCTGDNHTTATAVADMVGIPRSNVMANV
                     LPAGKADFVRQIQESSPSDNQKKTRSLVAFIGDGVNDSPALAAADVSIALSTGSDVAL
                     SSASFILLNSSLTTILHLVLLSRRVFNRVKMNFGWALVYNLCLIPIAAGVFYPIVSGH
                     RDVMGSNGEVIGMVDTHWRLSPVWAALAMALSSVSVVCSSLALGVEDRVRRFLGKSDI
                     "
     gene            <744293..>746542
                     /gene="BRF1"
                     /locus_tag="ACHE_20257S"
                     /db_xref="GeneID:66979158"
     mRNA            <744293..>746542
                     /gene="BRF1"
                     /locus_tag="ACHE_20257S"
                     /product="transcription factor TFIIIB subunit brf1"
                     /transcript_id="XM_043284540.1"
                     /db_xref="GeneID:66979158"
     CDS             744293..746542
                     /gene="BRF1"
                     /locus_tag="ACHE_20257S"
                     /note="BUSCO:EOG092613QA;
                     COG:K;
                     EggNog:ENOG410PFE5;
                     InterPro:IPR013150,IPR036915,IPR011665,IPR000812,
                     IPR029529,IPR013763;
                     PFAM:PF07741,PF00382;
                     go_component: GO:0000126 - transcription factor TFIIIB
                     complex [Evidence IEA];
                     go_function: GO:0000995 - RNA polymerase III general
                     transcription initiation factor activity [Evidence IEA];
                     go_function: GO:0017025 - TBP-class protein binding
                     [Evidence IEA];
                     go_process: GO:0006352 - DNA-templated transcription,
                     initiation [Evidence IEA];
                     go_process: GO:0006383 - transcription by RNA polymerase
                     III [Evidence IEA];
                     go_process: GO:0070897 - transcription preinitiation
                     complex assembly [Evidence IEA]"
                     /codon_start=1
                     /product="transcription factor TFIIIB subunit brf1"
                     /protein_id="XP_043133321.1"
                     /db_xref="GeneID:66979158"
                     /translation="MSARPGMRAPMPSRAGSRAPVGRLASLKPTNPTPIRRPQPIARP
                     QPTKPTTHPKTSTCPNPGCPAPHIVEDDGQKVCSGCGTVISDANIVSEVTFGETSSGA
                     AMVQGTFVGEDQSHVRSYGPGFQRGGNMESREITEQNGNRYINQLSRALIIPESAAKA
                     AGQVFKLAVGLNFIQGRRTKTVAAVCLYIACRRQDGNTTMLIDFADVLMINVFKLGRT
                     YKALLEELRIGGNVFLMNPIDPESLIYRFAKQLEFGSATMQVASEAIRIVQRMNRDWM
                     TTGRRPAGVCGAALILAARMNNFRRTVREVVYVVKVTEITISQRLNEFSSTESGELTV
                     DQFRSVQLENAHDPPSFTRAREGRKPGRRIKRKAPETAAEIEDDEYEEPPERRVDADG
                     FAIPSLPIDPALRNAATGRRQSASSAVSDVSEAGEESLTSKPGQTKGSKPKSVPFQPS
                     AEQVASENALENEMTAFLAKGSSMVETASHPAQGQDTNRRFISDSTEIDASEFESDPE
                     VANCLLAPLEVEIKERIWVHENKDYLRTQQAKALKRALIEADSGPGVHKPRKRRRGRM
                     GDVTYLEGEGEDGDGRSTRASTPAEATRRMLERRGFSKKINYRLLDSLYGEEGTETKP
                     DGASRSQSVVSGRNVSVEPEPAPPRTGVFTPSATAKPTASPAPRPGPAPARATAPQAS
                     KQPNEEVLGPASGPNNNEEVVGEAPGNEDDYDEEDDEEEDGDDGVDAAFAGNYGDYYD
                     DNSDGYDSD"
     gene            <751886..>752257
                     /locus_tag="ACHE_20258S"
                     /db_xref="GeneID:66979159"
     mRNA            <751886..>752257
                     /locus_tag="ACHE_20258S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284541.1"
                     /db_xref="GeneID:66979159"
     CDS             751886..752257
                     /locus_tag="ACHE_20258S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133322.1"
                     /db_xref="GeneID:66979159"
                     /translation="MIKEHLSSGDAAILDQIWRPVPPLNEVEPISDNEEGGHEGDDLS
                     DDLDGSDDDHLEELTLTQITTQRKQARCKQPRNKTSEPQDDGDDGLLLPEMATEESTQ
                     VRSGRIQKKPKLPDGFEIDKL"
     gene            complement(<753731..>754132)
                     /locus_tag="ACHE_20259A"
                     /db_xref="GeneID:66979160"
     mRNA            complement(<753731..>754132)
                     /locus_tag="ACHE_20259A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284543.1"
                     /db_xref="GeneID:66979160"
     CDS             complement(753731..754132)
                     /locus_tag="ACHE_20259A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133323.1"
                     /db_xref="GeneID:66979160"
                     /translation="MSLNLVGYESSDGDGHQELSSSMSIAPSELHNQTPPVNETFPTR
                     EVAMKFFNQRNKLYRDMEMDGVVRPTAAEEHSQGRLLGEPRATRALLQFLASTSVALP
                     RAHLQRTAERARRDDEWGLEALEKAIRTGEG"
     gene            complement(<754861..>755907)
                     /locus_tag="ACHE_20260A"
                     /db_xref="GeneID:66979161"
     mRNA            complement(<754861..>755907)
                     /locus_tag="ACHE_20260A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284544.1"
                     /db_xref="GeneID:66979161"
     CDS             complement(754861..755907)
                     /locus_tag="ACHE_20260A"
                     /note="COG:S;
                     EggNog:ENOG410PP2V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133324.1"
                     /db_xref="GeneID:66979161"
                     /translation="MSPMISDGPAMVLSPPQDHAFGQFPSALPFAANTTLPNPVPSKP
                     SRKRSRDDAGFEEAMNAAAFEPPAPVPAPKPVEEPIYGEGMVLLNPRTGMAVSAESQT
                     GTWYEEKVEQSAAAAPPVFSRFQTGMSSGVQGRKSQRLDPTAPGLDDIALSSMQKRLQ
                     NTTDDSRSSPSHQEPLVDDATRLLGISWQRINVSDDDDMAPAVRGWKKYINNQYSNYL
                     QNCQILMKSRALNAFLVAAQPVAPAFGTVTNSPAYFLFSDDLDQARLVGSTWEACVQN
                     LQSSPILFEGAETLQAKDKRSDNGSMQAPLGTNTMEAGVPLLQSLSAQPQPAGNAGVG
                     GLNGGVGTGMEIDS"
     gene            complement(<757446..>758823)
                     /locus_tag="ACHE_20261A"
                     /db_xref="GeneID:66979162"
     mRNA            complement(join(<757446..758222,758273..758496,
                     758564..758631,758690..>758823))
                     /locus_tag="ACHE_20261A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284545.1"
                     /db_xref="GeneID:66979162"
     CDS             complement(join(757446..758222,758273..758496,
                     758564..758631,758690..758823))
                     /locus_tag="ACHE_20261A"
                     /note="COG:E,G;
                     EggNog:ENOG410PGHJ;
                     InterPro:IPR004853;
                     PFAM:PF03151;
                     TransMembrane:10
                     (o38-57i69-88o108-133i145-163o169-200i221-243o258-279i286-
                     306o312-330i359-381o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133325.1"
                     /db_xref="GeneID:66979162"
                     /translation="MSAEGEKARQSGEISRPEPTLPTVNPAVDKPEPPSPTFHPAVYV
                     TVWITLSSSVILFNKHILDYAQFRFPIILTTWHLAFATFMTQLLARTTTLLDGRKTVK
                     MTGRVYLRAIVPIGLFFSLSLICGNVTYLYLSVAFIQMLKATTPVAVLFATWGMGMAP
                     VNLKVLMNVALIVLGVVIASFGEIKFVFIGFMFQIGGIIFEATRLVMVQRLLSSAEYK
                     MDPLVSLYYFAPVCAVMNGITALFLEVPNLTMGHIYNVGVWTLLANAVVAFLLNVSVV
                     FLIGKTSSLVMTLCGVLKDILLVAASMMIWQTPVTGTQFFGYSIALIGLVYYKLGGDK
                     IREYTGQAGRAWAEYGATHPAQRKFVIIGAVALIFFLFMGTMGPSYAPESVDRVKGML
                     GGASAGNA"
     gene            <761715..>763612
                     /locus_tag="ACHE_20262S"
                     /db_xref="GeneID:66979163"
     mRNA            join(<761715..761797,761933..762002,762063..762143,
                     762200..762550,762602..>763612)
                     /locus_tag="ACHE_20262S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284546.1"
                     /db_xref="GeneID:66979163"
     CDS             join(761715..761797,761933..762002,762063..762143,
                     762200..762550,762602..763612)
                     /locus_tag="ACHE_20262S"
                     /note="COG:H;
                     EggNog:ENOG410PHSQ;
                     InterPro:IPR002937,IPR036188;
                     PFAM:PF01593,PF13450;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133326.1"
                     /db_xref="GeneID:66979163"
                     /translation="MLSLARKTLNRVPSFQDILQGRMTHPDVSVDVLVIGAGPTGLGA
                     AKRLNQINGPSWLIVDSNETPGGLASTDVTPEGFLYDVGGHVIFSHYKYFDDCINEAL
                     PNDDDWYSHQRISYVRCEGQWVPYPFQNNISMLSKEQQVKCIDGMIDAALEHRVANTK
                     PQNFDEWIIRMMGTGVADVFMRPYNYKVWAVPTTKMQCAWLGERVAAPNVKAVTTNVI
                     LNKTAGNWGPNATFRFPARGGTGGIWIAVANTIPKENTRFGEKGRVVKVNANNKTVQM
                     ADGTTIGYERLVSTMSVDFLAGAMADQELISHTKELFYSSTHVIGVGIRGSRPERIGD
                     KCWLYFPEDNCPFYRATIFSNYSPHNQPEASKKLPTIQLADGSKPQNTEAQEGPYWSI
                     MLEVSESSMKPVNHDTLLAESIQGLVNTEMLRPGDEIVSTYHRRFDHGYPTPSLEREG
                     ALTKILPKLQEKGIWSRGRFGSWRYEVGNQDHSFMLGVEAVDNIVNGAVELTLNYPDF
                     VNGRQNNERRLVDGAQIFAKNKQ"
     gene            complement(<765786..>767743)
                     /locus_tag="ACHE_20263A"
                     /db_xref="GeneID:66979164"
     mRNA            complement(join(<765786..766220,766280..766453,
                     766523..766878,767224..>767743))
                     /locus_tag="ACHE_20263A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284547.1"
                     /db_xref="GeneID:66979164"
     CDS             complement(join(765786..766220,766280..766453,
                     766523..766878,767224..767743))
                     /locus_tag="ACHE_20263A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133327.1"
                     /db_xref="GeneID:66979164"
                     /translation="MTMIRLRPTRIVPNRDDIHYHIEQIFDRLYERLRAFEPECYDDD
                     FGDDLGSLIDADISSFRSSPAADEDYDSEASSAFDLDYEYKRYPSSQLEDYGIDDGIP
                     LSDSRVIEHPHPRQYPRSEISNTTDEGSYGNGSYETAIDSGVGMQEDGMGLDLPSSRM
                     NYGELTRAPHSPEENQSPQPSDKETTSKLDRDLDSKLVSFNEAKTRLVQLAPSIHQAF
                     PNPRVNKMPGSIQDERNMSQTDIHMSDAPEHDITESGSNNTSCVSSTVSQNRGKRTRT
                     SAGSRMSAVSSDTKSKRHSSQVPSEGETSSSISNRGAHTTGAASIQTGRTVSQWTELS
                     RPVTRRTSWHPVNAPQGQRGRRQPANKGRTNSIGQGTTRTAKTAQTDTSSLRPTSTQG
                     SAPLLSDNVQRPATSPHATPATQARPSTAQPTLTATAPAPAGINMPPQTALSPEKWKH
                     MMEASQVYREHVNHMITEMEKDDDNANGFGLGELRRRPLGDMLD"
     gene            <768934..>771529
                     /gene="PKH3"
                     /locus_tag="ACHE_20264S"
                     /db_xref="GeneID:66979165"
     mRNA            join(<768934..771120,771179..>771529)
                     /gene="PKH3"
                     /locus_tag="ACHE_20264S"
                     /product="pkb-activating kinase-like protein"
                     /transcript_id="XM_043284548.1"
                     /db_xref="GeneID:66979165"
     CDS             join(768934..771120,771179..771529)
                     /gene="PKH3"
                     /locus_tag="ACHE_20264S"
                     /note="COG:T;
                     EggNog:ENOG410PGTT;
                     InterPro:IPR017441,IPR008271,IPR039046,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="pkb-activating kinase-like protein"
                     /protein_id="XP_043133328.1"
                     /db_xref="GeneID:66979165"
                     /translation="MDGDLSLSQSLGGLRIANPDDSSLNSSEEPAVSAPEVAASIAPD
                     EKTDDPEPPTSFVPELPPSSQSSIPPSIAEESSRYAPDAASLRSYSRRTENRTSIYSI
                     SDPQSQPPQQPTQSQYAPYHPQQHSQSPTSSRPLSAFYSNGSSPALVAREGSYRIRTD
                     SAASSASESQARVDSRGGSSALHAGVPARDNTHSDRSYRPAPHNGPMVMRQPSRAHAR
                     PAAATPLSGTPYGMENGPSPSSEEWQHRGAAVAVRQEIDPNGKPVARYIKKGVRDFSF
                     GHTLGEGSYSTVVLATDRQTLKEYAIKILDKRHIIKEKKVKYVNIEKDTLNRLTEHPG
                     IVRLYYTFQDERSLYFVLDLCKGGELLGVLKRMTSFDEECTRFYGGQILDTIDYMHKR
                     GVIHRDLKPENVLLDHQMYVKITDFGTAKILKGQRRPDPNSSGMPPLDSNEIPEEERA
                     SSFVGTAEYVSPELLTDKNACKASDLWAFGCIIFQLLAGRPPFKAGNEYQTFQKIVAL
                     DYEFPPGFPAVARDLVERLLVLDPARRLPIEHIKNHPFFEGTVWGPELWKRKAPRLKA
                     YVPPPREPIKLNGGGEGDSFPPNITAAPSTTTNASSRVVPRLVTELPPPSQLDVEWSP
                     VLTKTNERILKMGNQVVLSSPASHSPVSKNGGESETTKKFSRFFAGSTTKKRQRLVMV
                     TSCARIIMAASGGDEKKAKMEISLLANGTQYRTTTDSKGLSSWVVDTRDKRFSFEDPK
                     PSSSNLGVTALSAQEWLDALDRAKEMALTQHNNGAYSGDETFRDLSSGMSSHSNTLDR
                     SSEIHAEAAPPPGRATLIKNQATDSESVKGRKRFSRRHSKNGLAAVF"
     gene            complement(<772695..>774620)
                     /locus_tag="ACHE_20265A"
                     /db_xref="GeneID:66979166"
     mRNA            complement(join(<772695..774058,774119..>774620))
                     /locus_tag="ACHE_20265A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284549.1"
                     /db_xref="GeneID:66979166"
     CDS             complement(join(772695..774058,774119..774620))
                     /locus_tag="ACHE_20265A"
                     /note="COG:S;
                     EggNog:ENOG410PQHU;
                     InterPro:IPR036864,IPR021858,IPR001138;
                     PFAM:PF00172,PF11951;
                     TransMembrane:1 (o561-582i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133329.1"
                     /db_xref="GeneID:66979166"
                     /translation="MVARGCYTCRRRRIICDNAQPTCQKCRDAGKECLGYQKPLVWVK
                     GGVASRGKMMGRSFEEVTKKSPRRVGESHELSVPAPTENTNPPSTVEVLNQSVPNTSN
                     QIAVPNGSDILPLGSSGAAQQRGKNNCQVSASRNTSTTDGTHILPGLVDPILKDINGL
                     ARFYIYHFNKKTAGDLVLYSNTQNPYRDLISLVGESPLLANALSATGALHYALLADGD
                     FSPMPWSTGEPTANGTLLTPKEVEREVTSSMSRRPSSKVYEHFLGLKQRALRQLSQDI
                     CDPVKRNDDKTAAAIMVLALMDAIESGDEAWKYHLEGAKNLLNSRQHGFDASRSQEIL
                     GWLDTLTVDGCLIIELMGSTLARPGVLSKPFYSPSMGPTALRRLEKTSWVGCPAYLLE
                     VIFFVHARFCHADTTTHEQQDQEQQPTMLFSSSFLPSNSKPLQSPQALLKHIQAFDPI
                     AWAIDLQSYLYLPDLTMRIALATTYKAAVYLYTSRVLSRPRTGSSFPPTNTDEWFGLP
                     HDHTAVAHILIDQLAVIPPQDPHFKCLIWPTFIAGAECRDPSHRPFILDRLSALYYAI
                     ATVNVRNAAWVLSLMWRKQDLRREQASASDGDDYDNDDFDWIQELDESRIDWLFI"
     gene            <776403..>778111
                     /locus_tag="ACHE_20266S"
                     /db_xref="GeneID:66979167"
     mRNA            join(<776403..776912,776960..>778111)
                     /locus_tag="ACHE_20266S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284550.1"
                     /db_xref="GeneID:66979167"
     CDS             join(776403..776912,776960..778111)
                     /locus_tag="ACHE_20266S"
                     /note="COG:S;
                     EggNog:ENOG410PIVX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133330.1"
                     /db_xref="GeneID:66979167"
                     /translation="MTNRRSSASVSEMVSQAHVLDRPVPPRHATSSVVSRHSRRRSGH
                     SHHGGTSRQPQNDFPIFTHTGDVEIVIRAGGQEKRYLLHRLILAQCSGFFAASTSEEW
                     SRQPVSGPPKPDDSAMSRMTEDDTLSTGSTLAQSDVGGISRPIEKRRWRFELDWQNKA
                     EDEEPILVQKPPSFSAAFANAVQPPPAVTKPSGSQAGFFRSMANLTGMQSTTNLPHNT
                     TDEPPHPLIRDYDNLFRLFYNHFPTLNSVNIATAYAECKCLLGLADMYDALPVTGPRV
                     DHHLLGFGTRLFKQIAKYPPSYLKLGYMARSRVVFSEALIHVVGQWPTGLSHLRNGYP
                     SLPDSVLDIIEDKVEDLEDMKARVDSKLFRLTLTTSRGERVNPNNAYLDWLAVSLFRQ
                     WLVESTTPPPAPILKNSPTPHQTHHRHTESSASSSHRPSSARPPSASHSSVSPSPAKV
                     YRLIGSSSSQAYLVHDELKRFLKLHPTPSSDSLYTRDVLKRFERKMDEIKRLAREIVK
                     PLMRNFLELDLKGIASGTASAEQGSRTVELPYLTCTKVEDADIPW"
     gene            complement(<778636..>780210)
                     /gene="DIA4"
                     /locus_tag="ACHE_20267A"
                     /db_xref="GeneID:66979168"
     mRNA            complement(<778636..>780210)
                     /gene="DIA4"
                     /locus_tag="ACHE_20267A"
                     /product="serine--tRNA ligase, mitochondrial"
                     /transcript_id="XM_043284551.1"
                     /db_xref="GeneID:66979168"
     CDS             complement(778636..780210)
                     /gene="DIA4"
                     /locus_tag="ACHE_20267A"
                     /note="COG:J;
                     EggNog:ENOG410PHEH;
                     InterPro:IPR006195,IPR015866,IPR042103,IPR010978,
                     IPR002317,IPR002314;
                     PFAM:PF02403,PF00587;
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0004828 - serine-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA];
                     go_process: GO:0006434 - seryl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="serine--tRNA ligase, mitochondrial"
                     /protein_id="XP_043133331.1"
                     /db_xref="GeneID:66979168"
                     /translation="MASLMASSTASKAPYVCLNCRVSRRFTRFTPSIRRNFTSSLRRL
                     SDVVRPATAPKPTPDVKHIRQNAEIYAKNCLDRNYVTHSEYPLRIQQLSEESRQLDHD
                     LQAPRSRIKQLEKMIAKVAREQQENMGQEDLTALRSEAQRLKDESHAMNTRKTSCADE
                     IQRLALALPNLSSSETPVGRDPKLIGYINFDPQFPPEWATRSSPDPSRSHVVIGTSLG
                     LIDFTSSATTTGWGWYFLTNEGALLEHALVQYSLTVARRHGWKIVSPPSLVYSYIAEA
                     CGFQPRDQHNEQQIWTVEQSEKDKNSKPPRSLTGTAEIPLAAMYAGRDIEASQLPVKL
                     VGSSRCYRAEAGSRGVDTKGLYRVHEFTKVELLGWADNNNPTQPEIDHPSTTLFNDLL
                     TIQTEILTSLNLPCRILEMPTTDLGASASRKRDIEALFPSRLRNTSDLEPAWGEVTSA
                     SICTDYQSRRLGTRVRGGSAKESRFPHTVNGTAMAVPRVLAAILENGWDEKRGVVVVP
                     EVLRGYMGGLEVIGNQ"
     gene            complement(<780414..>780989)
                     /locus_tag="ACHE_20268A"
                     /db_xref="GeneID:66979169"
     mRNA            complement(join(<780414..780908,780969..>780989))
                     /locus_tag="ACHE_20268A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284552.1"
                     /db_xref="GeneID:66979169"
     CDS             complement(join(780414..780908,780969..780989))
                     /locus_tag="ACHE_20268A"
                     /note="COG:S;
                     EggNog:ENOG410PN16;
                     InterPro:IPR006593;
                     PFAM:PF03188;
                     SECRETED:SignalP(1-20);
                     TransMembrane:3 (n13-24c29/30o39-61i73-96o144-164i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133332.1"
                     /db_xref="GeneID:66979169"
                     /translation="MLFTGHPLLNTIALLLQVQGTLILQPTSTARQKLIGTRFHYIIQ
                     GLSLLAFIAAFLVIEINKGDHERFTSPHGVLGLITYIVIILQASVGVVQYFLSVQVLG
                     SVDTGKKIYKYHRASGYALLMLELGTVTAATQTTFNLNALHIPLWGIVVTSVLVVAGI
                     GARIKKHKLGL"
     gene            complement(<781776..>782285)
                     /locus_tag="ACHE_20269A"
                     /db_xref="GeneID:66979170"
     mRNA            complement(<781776..>782285)
                     /locus_tag="ACHE_20269A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284554.1"
                     /db_xref="GeneID:66979170"
     CDS             complement(781776..782285)
                     /locus_tag="ACHE_20269A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133333.1"
                     /db_xref="GeneID:66979170"
                     /translation="MVVHQCIPVNEREAIIEAVRRQECYIYTGLKIFIERYEDVVKQL
                     EQLEQLDQEDIERAREIQRQAIATYLTPPGQAQSPFPNCSYQGTDTDDFDENDYLLPE
                     GLDPAYIWKFYSDSEDGDDDEYESDSEGEECVNDHLQERMCVRRDCHQFGFCREHELS
                     AVCVCNGGQ"
     gene            <783064..>783552
                     /locus_tag="ACHE_20270S"
                     /db_xref="GeneID:66979171"
     mRNA            <783064..>783552
                     /locus_tag="ACHE_20270S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284555.1"
                     /db_xref="GeneID:66979171"
     CDS             783064..783552
                     /locus_tag="ACHE_20270S"
                     /note="COG:S;
                     EggNog:ENOG410Q1TX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133334.1"
                     /db_xref="GeneID:66979171"
                     /translation="MGRTEIEIGAILSTLAIIYWRYTDPSTGISNKPHGLDWICVERS
                     IYRLLVLRGTIKLGDKFYENPWHLYLNEYAPAGMRRSISLGQGQSHIFQSSTLMASTT
                     SVPTSTVSSGDQGRGRQPANCDGQQQQPQRRVCFLDTPSPARGRAPRRLPLSPAPNAR
                     FH"
     gene            <786845..>787290
                     /locus_tag="ACHE_20271S"
                     /db_xref="GeneID:66979172"
     mRNA            join(<786845..787141,787246..>787290)
                     /locus_tag="ACHE_20271S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284556.1"
                     /db_xref="GeneID:66979172"
     CDS             join(786845..787141,787246..787290)
                     /locus_tag="ACHE_20271S"
                     /note="COG:S;
                     EggNog:ENOG410Q2S0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133335.1"
                     /db_xref="GeneID:66979172"
                     /translation="MPSMQIYEHGSFPEARGLIYDESEMALFRAKLSYQSTIDARMAS
                     KDPNLAAIAETQARILKRWEMLKHMDKEATDNGTLDPTIKTQMAQHAWRYKQLEEIQQ
                     PAKHTIMAHGV"
     gene            <788165..>789316
                     /gene="DAL2"
                     /locus_tag="ACHE_20272S"
                     /db_xref="GeneID:66979173"
     mRNA            <788165..>789316
                     /gene="DAL2"
                     /locus_tag="ACHE_20272S"
                     /product="allantoicase"
                     /transcript_id="XM_043284557.1"
                     /db_xref="GeneID:66979173"
     CDS             788165..789316
                     /gene="DAL2"
                     /locus_tag="ACHE_20272S"
                     /note="COG:F;
                     EggNog:ENOG410PFHD;
                     InterPro:IPR008979,IPR005164,IPR015908;
                     PFAM:PF03561;
                     go_function: GO:0004037 - allantoicase activity [Evidence
                     IEA];
                     go_process: GO:0000256 - allantoin catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="allantoicase"
                     /protein_id="XP_043133336.1"
                     /db_xref="GeneID:66979173"
                     /translation="MESNAFPPSAAEPTTTATDFIPSNEIDTTFAHTTNLASAALNTK
                     VLSRSDDYFASATNLLTPTPPINRPGVFVHTGAWYDGWETRRHNPEPYDWVVIKLGVA
                     SAVIKGIEVDTGFFVGNFGEKAEVQATNAEGGGGVDDEEIAEAGYGKWETILPAKACG
                     PSQRRAWRVNEPFASKPYTHVRLLMYPDGGFGRLRLYGHAIPPALPAQVIASTDRAVL
                     PVEELSSALVGGLALGASDQHFTPCSNLLLPGRGENMGDGWETARSRAPGHVDWAIVK
                     LGLPGSVARIVVDTKDFRGNFPRTVRVHGLVGKKDKEGQVPAHDDPEWIELLKGERAC
                     KADTEHVFEGDDLAAEGEDTRVFSHVKLTLVPDGGVKRLRILGRRGVID"
     gene            complement(<789770..>796846)
                     /locus_tag="ACHE_20273A"
                     /db_xref="GeneID:66979174"
     mRNA            complement(join(<789770..793883,793932..>796846))
                     /locus_tag="ACHE_20273A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284558.1"
                     /db_xref="GeneID:66979174"
     CDS             complement(join(789770..793883,793932..796846))
                     /locus_tag="ACHE_20273A"
                     /note="COG:T;
                     EggNog:ENOG410QDVW;
                     InterPro:IPR027417,IPR001789,IPR003594,IPR003661,
                     IPR036890,IPR041664,IPR036097,IPR011006,IPR003018,
                     IPR000719,IPR004358,IPR011009,IPR029016,IPR005467;
                     PFAM:PF00072,PF00512,PF13185,PF13191,PF02518, PF01590;
                     TransMembrane:2 (o1414-1435i1447-1466o);
                     go_function: GO:0000155 - phosphorelay sensor kinase
                     activity [Evidence IEA];
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016772 - transferase activity,
                     transferring phosphorus-containing groups [Evidence IEA];
                     go_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133337.1"
                     /db_xref="GeneID:66979174"
                     /translation="MEDHILGEDLPLPPARLFERLSELPGYTWDQSSEPFHSTYSHWH
                     VFGHRLSPESDASTPAATSSGPSSLARHSPRAEPRPAFRHHWRNSLSESSSEISLSRL
                     DQEPAWIPVIARVSSHIVRLEREFHMIRSIVQTSDPDCNHTIRPLDLIRLPPDPGDVG
                     PLLVATFESPGPNMLRELVAFGPAWFAVGVKSDSNDSTPGEQVSLATFLDFAIGACDC
                     LELLHYGLKTVHGEIRGDAFHFNRDTASVKLTNTGNGARSFDNILSEGWSSLSRELGV
                     KNKLQFIAPEQTGRMPTEPDSRTDIYALGVLFWTMLVGKPAFTGEDPVEVVQNVLGKR
                     MPPVSAKRMDIPDAVSAVIQKMTQKTVTDRYHTISSVKRDLAQISQLLGDGNSEALKD
                     FQIAQRDVSSFFTLPSRMFGRRQEYDKIIGVVEKVHRRQQSALARAAAQNSSGLGSGS
                     SISDSRVDSFEITSASSDSGSFHLAAPKPNSNGGPNPLGRVSTHESFHSTESSLSTPK
                     PGSKAKSPVDSTRSSWETTDRDSQPSTSTNTPSHGDNSLGIHNRHKTTHKLRRSARCE
                     VITISGAAGIGKTDILNRVQPAIRKLGYIGIARLDRARRIPFEPFAKILASLLRQIFS
                     ERDVTTDYHNSVRTALRPMWSTLHQVLELPEQLMSPGGKGNDISPKLSAAQYILKDAS
                     TKGEPSKRVMLPRLDRGQSSVEFFLSNAALKNMRLMETFLEILKTLSQFKLICVCVDD
                     LHYADDETLELIMNVMKAKIPCVLILTSRPAELESDAIKSLFEAENPNITRLALSPLG
                     EQEIMELVAATMHQEPNTMLTPLAAVIQEKSLGNPFYVRLMLETCYIKTCIWYSWKNS
                     VWEFDLDRIFTEFVAPTYGEGLGLGFMKRRLLEIPSSAQLILAWSALLGSPFSFSLVQ
                     KLLTSEFLYSSDDDDGQDLTCPDNANLIRQSEADIVVGLQYLVQANLVIPGRTDDEFR
                     FANDRLAQAAASLTEGRNTEKMHFIISQAMKKYYHDGRSRYAMARHVALASRIIGSRV
                     VQRLDYRKILWDAAQTAAQSGARPTALWYFRHCMALLQDSPWDDNLTDVYYDETLRLH
                     IATAEMSWSQGQNTDALALLDMVFLYGKTAVCKSRAWIVKAKIYAQMGNHLQSMDSLL
                     TCLEELGVHIREPTTYEECDAAYNNLKAVVEKASLEAIVRKPVSKDINMITIGAVMAE
                     AMAVTYWDDALTFYRTAIEMMNLHIFRGGFVQISIGCSHLAMISFSRFRDLDLATRLS
                     DLALMHLDRCPEPWTQSRGSIVHNLYVSHLRVPMASTLPALEDSLEVSFSMGDPYITL
                     ISLSSMAMTRLFLGHDMTQLEAFCNESPEDIPEWLNDTRGGASLVAVRQVARALQGKT
                     ANQCPETIMEDENHNTALFMTYLDANASNADRPRDIYWGLAMIPLFVYGHHTKAIELG
                     IQMMETMPRLWSARVAYVVYFYLALSLLTLHNDYPARGYLDGNLKVVLQYKAEVDFAR
                     SACDANYGMWSLILEALIYEVRNDHTSAIQTFEAAIDHCQIHGWPLEEALALELHGEF
                     LIRRGAKRAARSVMQDAIAAWAAISAAGKAAQLSEKHEWLLKTATSSRSIDVGCQTVD
                     SLEIEHTAVGQDHMVMTQNMEDDRKHRWIEQNEVTTGERSLDSISAFGIDIIDLSSIL
                     ESSQVMSSELQIDKLFTKMIEIVLESCNGSDFAVIATDFDDNGFAVAAAGDLERGQKS
                     FVDGLPFSEVDDKMAQQISHYVMRTKERVLVHNVLEDERFSNVSEAYQTRFPFGRSVI
                     ALPIVQAEHLLGVIHIEGKPNSFTQRNVMVLHLLCNQIGISLSNALLFREVRKVSATN
                     ASMVEAQKRALAQAREAEQKAKAAEAEANHNVKLKEDAARAKSIFLANISHDLRTPMN
                     GVIGLSELLKGTHLDKEQDEYVESIRVCADTLLTLINDILDFSKLEAGKMKISTVPLN
                     IKETISEVVRALRYTHRDRGLETIEDLEKVPSELVVLGDPVRLHQIFMNLLSNSYKFT
                     PKGSVAVRAKVSREGKGRVRLECSVTDTGIGIPDEQKSRLFRPFSQADSSTARSYGGS
                     GLGLSICKAIIEDVLGGAIWLDSAPGQGTTVTFHLSFNKAPKETFAKTTYSQKNNHVE
                     KKAPAKPIARDLSMVPREHIRVCIAEDNPINQKIAVKFVVGLNLQCEAYSDGRQAVEA
                     LRTRSQEGNPFHVVLMDVQMPTLDGYNATREIRRDPDPNVNEVLVIAMTASAIEGDRE
                     KCIEAGMNNYLPKPVRSTILSDMLDKYLAPVPTYTKTRLAIRDKNRASVSAAVTGSSS
                     DVGVPSPNSFTSLGSENVVLSPDEEKQLEKSPSEAD"
     gene            <801916..>807913
                     /locus_tag="ACHE_20274S"
                     /db_xref="GeneID:66979175"
     mRNA            join(<801916..807393,807444..807557,807617..>807913)
                     /locus_tag="ACHE_20274S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284559.1"
                     /db_xref="GeneID:66979175"
     CDS             join(801916..807393,807444..807557,807617..807913)
                     /locus_tag="ACHE_20274S"
                     /note="COG:T;
                     EggNog:ENOG410PFP0;
                     InterPro:IPR001610,IPR000014,IPR001789,IPR035965,
                     IPR003594,IPR003661,IPR036890,IPR036097,IPR011006,
                     IPR000700,IPR013656,IPR004358,IPR005467;
                     PFAM:PF00072,PF00512,PF02518,PF08448;
                     go_function: GO:0000155 - phosphorelay sensor kinase
                     activity [Evidence IEA];
                     go_function: GO:0016772 - transferase activity,
                     transferring phosphorus-containing groups [Evidence IEA];
                     go_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133338.1"
                     /db_xref="GeneID:66979175"
                     /translation="MMGEVRSMRTPPLPSPAEAPSPVAASQSYPHPPHEPRGPTASVS
                     TPSSFLPIDNDDGGSAMLDDTLRIANTHAASLQHQQTPDVSCISPNNIPSENKSSDSG
                     KGSQEDHGRSLQTLRELRRQMEELLAYQQMQQQSQDQDATAAAAAPPSREVFASPALP
                     PPAPPSATRDDPLPCSSSPHESSKKRRISNDESPQLPASSSSDAMPSAATYSDSTSSA
                     GTIRPPDSSNNPMLAGQTPSYPFPRMYPSPSTAAARSAQESSPMLNHSHFKLTLPAEK
                     LKFNKGPSSQPSDERPPPVMKTPTPHSVFLPPQHKPVMEDPIYPSPTLYDITLQLNAD
                     PGLEAWWSNVVNILQTSYGAERASLAVPGDATDLENVPWGQKAVFDQSLYEDPDSIHH
                     LYSETTRAGPSGADSQNSGTMANNTTTNNVNTANNTMESHSRSGSASALKRPSLLSRH
                     SFAGFGKDRKHATDSDPSQLLHKMKAENAQSTIATNAMDVDFGLSRSIPTDNRDKANV
                     TTPQAQSLDDTLITTPQHGYRQAVFPIPRPLEVESDPLIKRTGVVKLFGRTKPVVLTR
                     EYSKGSTNVCSEQHGGTARSPADDKVQVTPTAEPIRPGVPQTPSRPGGSTLQAPALVP
                     GLPPSMEVSDEYEQVPPSPWSQSPAPSPAPRAQAEQNPFFVSYSVDESAFAKNPPPHD
                     YSNLEPLQAIGVDLAKSVVHIPLLHAGSSKQPSSSTLRFPVAVISILSPIIPYPSNLR
                     QSLAYLMPHLTTSFCLAQQYSQLERQFVSRLETPRYGHLLGLGGTFSDESSELELVAG
                     LSGHVNYRVAEDGTISAHASLSSPDEKSNSTKLSPPIPGGPGGTPGFELGTLGAATAN
                     NTDQNDVSGASTKLSGDAADSYFNVPQQQHKSFREALMYQQRHRLSKTKHVTVPDPAS
                     PGKSLVKASTEEDSSLQDPNAVAPSSQQGSQAAVSPTQPSNSRHPSANSLYAQLQREI
                     PRPFSDTVAQLMLNSVPLHLFLAKPQSGEVIWTNSKFDAYRRSQPQEQKMRDPWQNIH
                     SSEREHVSQEWANALRTGSQFTERVRVKRFNDEAAYRWFIFRANPLLSSTGEVLYWIG
                     SFLDIHEQHIAELKAAQEREKFATDAKYRAFSNSIPQVVFEAAEYRGLIFANEQWHLY
                     TGQKLEEALNFGFAKHIHSDDLEKCGLLSHHLIGKTDSKDPASSELPKGKNAPPERHF
                     GHGFTPALDELVKRGVASVQQDENGRVFYSTEIRLRSKGGDFRWHLVRLVRVETSSFG
                     NGEASWYGTCTDINDRKNLERELNKAMQQLNNQMESKTKFFSNMSHEIRTPLNGILGT
                     IPFILDTQLDTDQRRMLDTIQNSSTNLRELVDNILDVSRVEAGKMSLVNSWFHVRSVI
                     EDVIDTVASRAIDKSLEINYLMDVDVPPTVIGDRFRIRQVLINLVGNAVKFTSQGEIH
                     ICCSIHHDSSALAKDTELLLNFDVVDTGKGFSARDAERLMQRFSQLGQNGSQQHAGSG
                     LGLFLSKQLVEMHGGKLTPSSKEGQGAKFSFYVKVDAPPPTTPEEQSKARQQKESDTQ
                     TKPSQESAKGPEAPASEIPASHPSTSTESSAQPVPPIPSENPSVATPDASVAKTDAPK
                     QTGPDQPAPAPVTESGPRASKAAPAAEPKPSPQQANPCSILILCPLENTRKAIQQHIQ
                     QVVPHEVPFTIKAYPDIDDWRDMVNEGTGSSMTHLVLNLPNVDDVMDVIQYVSECEPT
                     AAPTLVLISDLYQKRQVNPKIKELSASGRKIYTVPKPVKPSAFSAIFDPDNRRDLSKD
                     RNQDMAREINNNFKTMSKMVKEVIGNKGYRVLLVEDDETNRMVMLKYLDKIKVMAETA
                     SNGQECTEMVFSKEPGYYSLIICDIQMPVKNGYDTCREVRGWELKNHYPQIPIMALSA
                     NAMTDQIKDAARAGFNDYVTKPIKHNELGKMMMGLLDPNRPLLLLRDRLREDNDNDDS
                     HREE"
     gene            complement(<810127..>810624)
                     /locus_tag="ACHE_20275A"
                     /db_xref="GeneID:66979176"
     mRNA            complement(<810127..>810624)
                     /locus_tag="ACHE_20275A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284560.1"
                     /db_xref="GeneID:66979176"
     CDS             complement(810127..810624)
                     /locus_tag="ACHE_20275A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133339.1"
                     /db_xref="GeneID:66979176"
                     /translation="MGTGTINAIATAHETAYESSRDELLCNKSLFALLREYMRLKIPE
                     MACSALTHGCAVLPSPLLQSKNTRKFDRRNEQRYKRFRRHWMETKWTNAAHGIFLYPH
                     PGCSCREHKTTEYQLRGKRALGPGKDMTRDCNAMPKTWGQNLIRSFLLSTNDKEPYHG
                     ARSTD"
     gene            <812256..>813140
                     /locus_tag="ACHE_20276S"
                     /db_xref="GeneID:66979177"
     mRNA            join(<812256..812557,812679..812831,813053..>813140)
                     /locus_tag="ACHE_20276S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284561.1"
                     /db_xref="GeneID:66979177"
     CDS             join(812256..812557,812679..812831,813053..813140)
                     /locus_tag="ACHE_20276S"
                     /note="COG:S;
                     EggNog:ENOG410PQND;
                     InterPro:IPR019371;
                     PFAM:PF10241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133340.1"
                     /db_xref="GeneID:66979177"
                     /translation="MAATQRYQPPTLPINVPSKAPAPAGLYPIGRVAGSPPDVENTSM
                     TAGSRTSGGFGYSSGSDYESSNGSYSGVDVVDVLNDRMQETFDPTPLDKGLVKQAQTS
                     GHLNAKQRELMELQALAQRRLKGARSNFSEGIKVARETKRDLEWTQKRVNALKTKAEA
                     AHPEEYRRASKKYAFQDDDY"
     gene            complement(<814421..>817201)
                     /locus_tag="ACHE_20277A"
                     /db_xref="GeneID:66979178"
     mRNA            complement(<814421..>817201)
                     /locus_tag="ACHE_20277A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284562.1"
                     /db_xref="GeneID:66979178"
     CDS             complement(814421..817201)
                     /locus_tag="ACHE_20277A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133341.1"
                     /db_xref="GeneID:66979178"
                     /translation="MTQTNPNVQPLPSPLPSPGTMSEREFRALEEWVPAETLKTRASG
                     YLRAQAQSQPQRHGQGQGLGRGQSRGQGTVNNTNAHGNLSSHANANFNYDNVPTGLRR
                     AAQTTNKRRGRGKGRNRTSSIFEEWKAQASVDVGHKGDGDDGQKMVSDSTGAGATTVS
                     GSATVTAASKPTSATVGPSATGTKGRSYRGRARNDSLVRQEPSTTEDGQKVASAKQGT
                     VSGRESAVVSGSHPGASVAEAQHATSTANASSTEMANGSSPSEDSMSRQRSERQKNPI
                     VSTNPASDSRPIDSIINFSEGQHNTTKGESSKVVIEDSTAVHVGPSADSSGATDTTAS
                     AGQGTITTKSERSKCRSPSGKGGKDSHAHRESGPSSTKAEASKASKDSTTAPAEPSVN
                     SSKAPASSVANDKFATISGSRSRRGGKKGSHRRGKSGSAPTESELKNISSSSAAPADS
                     SLIGSIADGAAKQPVTADVSQPQTGKGKKSRHGRKKSASVSTRDSGKIVDNKESKGPS
                     AKHSSAPVALTAGQNKTAVSYRAPKADAKSSQARGVSVSNSTGELKDKDSSAKSKELA
                     ARSSSEKTASVAVASGGKTNHIGSHLRSAMGEESFRTRQASVYAFVEEWKESTAVYEG
                     SPAKTPGVPVISTTGSLEGQSVIVGPLTQHETSEEDFHDCQASVDSAEESKEAVSFKA
                     AATSSEESLVKSSSIPVTSIAGPSKIQPADASSHQQSEAATERPCACQEAGHASTGSE
                     PKKTKSSNGGTSAEMLASHLSASVGSSASQPENKPTVTAGSGEAKNDALQGKKGKDIP
                     RSSESASAGEPKAPIRQKEAQQPIIFYPAQAPENKPSQPIPKGPEADTNRRASTTVNT
                     KLDKRAVSRQHEQEGYTAPNGECLNKNQLARYAEGMKSPHKDTVYFQPSFIEDPWAGM
                     KPVLIPCSPRYW"
     gene            complement(<817616..>820175)
                     /gene="SEC18"
                     /locus_tag="ACHE_20278A"
                     /db_xref="GeneID:66979179"
     mRNA            complement(join(<817616..819794,819856..819981,
                     820045..>820175))
                     /gene="SEC18"
                     /locus_tag="ACHE_20278A"
                     /product="transport between ER and Golgi ATPase protein"
                     /transcript_id="XM_043284563.1"
                     /db_xref="GeneID:66979179"
     CDS             complement(join(817616..819794,819856..819981,
                     820045..820175))
                     /gene="SEC18"
                     /locus_tag="ACHE_20278A"
                     /note="BUSCO:EOG09260NC6;
                     COG:O;
                     EggNog:ENOG410PIAG;
                     InterPro:IPR039812,IPR041569,IPR003959,IPR003338,
                     IPR029067,IPR027417,IPR003593,IPR003960,IPR009010,
                     IPR004201;
                     PFAM:PF17862,PF00004,PF07724,PF02933;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0035494 - SNARE complex disassembly
                     [Evidence IEA]"
                     /codon_start=1
                     /product="transport between ER and Golgi ATPase protein"
                     /protein_id="XP_043133342.1"
                     /db_xref="GeneID:66979179"
                     /translation="MFNRTNYSNPFSSSRSGGPPSREGYSVPGQGPPPSYGQPMPGAG
                     GRPGQMPMPSRPPVGAKPPAGGGNWVLRPAKSPDNNYTFGNLVAVSPSDFPPTRDGLD
                     LLLLVNGLFVFSARPYPNFPPGNISMSDPQRTWAGVAFTDSVNVQIYDPFSQGGQAYL
                     GSTDIEVGFAGKKRVETPYDQDDLGNAVAKNFENQIFAPGQKILMDHRSIPLLLTVKT
                     VQRVDLSSEKADLSGGAVETDPTARGILTRHTQFNFFKDARTGINMKPSARRPASNSI
                     IQPDFKFENMGIGGLDAEFSTIFRRAFASRIFPPGLVDKLGIQHVKGMLLYGPPGTGK
                     TLIARQIGKMLNAREPKIINGPEVLNKFVGQSEENIRKLFADAEKEYKEKGEESGLHI
                     IIFDELDAVCKQRGSGGGGGTGVGDSVVNQLLSKLDGVDQLNNILLIGMTNRMDMIDE
                     ALLRPGRLEVHMEISLPDEHGRGQILKIHTQKMRDNSVMDQDVDLEELALMTKNFSGA
                     EIAGLVKSASSFAFSRHVKVGTMASIGDDVVNMKVNRSDFHHALDEVKPAFGVSEEEL
                     SSRIQYGIIHYSPIINEILREGDLFVKQVGQSTPLFSVLLHGPTASGKTALAARIAID
                     SGFPFIKLISPEDMVGYNEMAKVHHISKVFEDAYKSRTSVVVVDNIERIIDWVPIGPR
                     FSNTVLQTLMVFLRKQPSKDRRLLVLATTTQRAVLKNLDVYNSFNADIMVPNVNTYNE
                     LRYIMEQSEAFDAQEIAQALEEIGGIIDDGKIGVGVKKVLLGIETAKQDVDKVGRFVR
                     VINRAIEEERIFE"
     gene            <820651..>821793
                     /locus_tag="ACHE_20279S"
                     /db_xref="GeneID:66979180"
     mRNA            join(<820651..820658,820713..>821793)
                     /locus_tag="ACHE_20279S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284565.1"
                     /db_xref="GeneID:66979180"
     CDS             join(820651..820658,820713..821793)
                     /locus_tag="ACHE_20279S"
                     /note="COG:S;
                     EggNog:ENOG410PPME;
                     InterPro:IPR039875,IPR019339;
                     PFAM:PF10197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133343.1"
                     /db_xref="GeneID:66979180"
                     /translation="MPLHLLGKKSWNVYNPENVARVRRDEAQAKAREEEEERRMQEVD
                     AEHRIQILRGERPSTPPLPPASPPSAAQHEKRSRRDGETGRYNKKRRRLAGEDDTDRE
                     IRLAREDAQLADGKRAELTRSETSDAPLEDGAGHINLFPSETARAPVEKNAEAEAEAT
                     EKKRRYEDQYTMRFSNAAGFSQSVGRTPWYSVSGREAAAPEFMSGKDVWGNEDPMRKQ
                     RDMVRMDANDPLVAMRKGVKQLKTVEQERKRWNDERSRELEALKAEDREGSCRHRRGQ
                     SPSRGSISENSLEGFKLDASSDRQRDDKGRERNSHRHHHRNRHQRNRSRDRSRRHHSH
                     SHSRSRSHRHHRDHHESRHDNRRSSRRP"
     gene            complement(<821937..>823869)
                     /locus_tag="ACHE_20280A"
                     /db_xref="GeneID:66979181"
     mRNA            complement(join(<821937..822684,822740..822977,
                     823047..823454,823629..>823869))
                     /locus_tag="ACHE_20280A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284566.1"
                     /db_xref="GeneID:66979181"
     CDS             complement(join(821937..822684,822740..822977,
                     823047..823454,823629..823869))
                     /locus_tag="ACHE_20280A"
                     /note="COG:K,O,T;
                     EggNog:ENOG410PFG1;
                     InterPro:IPR036236,IPR029063,IPR041698,IPR025799;
                     PFAM:PF13649,PF08241,PF13847;
                     go_function: GO:0016274 - protein-arginine
                     N-methyltransferase activity [Evidence IEA];
                     go_process: GO:0018216 - peptidyl-arginine methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133344.1"
                     /db_xref="GeneID:66979181"
                     /translation="MSTFPTSECPPKDEDTRSTTSAEDSDVTDEEGWEDLEPDQEEFE
                     PIVGLFSDKIYPDVNAMLQESKDKHDFDLRKIQKEFDLDFIGLIKLVNYIRSEVKAGN
                     TAPDVSSTDKFDDEAYMKPVLEDDALLYSLGDIAEEDEPEASGGNDAERRVVELQEDL
                     ERLQTQFTEYRLAVQRSMEEQLTQEDNKLSSAGPSMRNKNKIEEADSDYFVSYQYNGI
                     HESMLKDTVRTDSYRDFIYDNKRLFQDKVVLDVGCGTGILSMFCAKAGAKKVIAVDNS
                     DIIDRAKEIVYENGFGDVITCIRGKIEEVTLPVQQVDIIVSEWMGYCLLFEAMFDSVI
                     YARDRYLAPDGLMVPSDATLRIAPFADSDFIASHISFWHSVYGFNMKSMLTGIYDEAN
                     VRSIQPSALPGDSSVFLKLPLHTITVEELSFLKEFQVTLKEDIDTLDGWSIWFDIFFM
                     PSRNATVPDDAVPSEMQKKGYVAFTTGPYGTETHWQQGVLLIDHGRKGGVPLKKGQTI
                     SGKVGYQKKEPNARTLNITVDWDAQEGGKGSQKWSL"
     gene            <824427..>825840
                     /locus_tag="ACHE_20281S"
                     /db_xref="GeneID:66979182"
     mRNA            join(<824427..824528,824589..824649,824717..825192,
                     825257..825529,825610..>825840)
                     /locus_tag="ACHE_20281S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284567.1"
                     /db_xref="GeneID:66979182"
     CDS             join(824427..824528,824589..824649,824717..825192,
                     825257..825529,825610..825840)
                     /locus_tag="ACHE_20281S"
                     /note="BUSCO:EOG092633QB;
                     COG:D;
                     EggNog:ENOG410PHCR;
                     InterPro:IPR016024,IPR011989,IPR013878;
                     PFAM:PF08569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133345.1"
                     /db_xref="GeneID:66979182"
                     /translation="MAFLFNRGRRQPLEVVRSIKDLLEKLRETPNTPKIEEELARQLS
                     QMKLMIQGTQEIDTSPEQVQALVGAMVHEDLLHELAHNIHILPFEARKDTQTIFSHVL
                     RFRPAHAAHGDPPVISYIVHHRPEIIVELCRGYNHSQSAMPCGTILREALKFDVIAAI
                     ILYDQSTGDEPAIRLTNVRPGNPQNGDGVFWQFFGWIDRGSFEVSADAFTTFRETLTR
                     HKSVVTGYLAANFDLFFSRFNNILIQSESYVTKRQSIKLLGELLLDRANYNVMMAYVE
                     SGENLKLCMKLLRDDRKMVQYEGFHVFKVFVANPNKSVAVQRILINNRDRLLKFLPKF
                     LEDRTDDDQFTDEKSFLVRQIELLPKEPIEPAQSAYDGVRTTTAVA"
     gene            <827061..>829763
                     /locus_tag="ACHE_20282S"
                     /db_xref="GeneID:66979183"
     mRNA            <827061..>829763
                     /locus_tag="ACHE_20282S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284568.1"
                     /db_xref="GeneID:66979183"
     CDS             827061..829763
                     /locus_tag="ACHE_20282S"
                     /note="COG:S;
                     EggNog:ENOG410PKY2;
                     InterPro:IPR035969,IPR000195;
                     PFAM:PF00566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133346.1"
                     /db_xref="GeneID:66979183"
                     /translation="MDERPTSFPADVMPSTTTTATTASTGSTLHAIPYEDSTTRSDSL
                     STPGASSVDSESRSRSISTTGSSSAGGATGPGGAGDQPRASPTSSHGNKFPETGLAGK
                     DSRTIRSEGDNSGLSLRSIPSIIVNDAASLRPSSRPGSRPGSRPGSRWSERKWGGLRT
                     RRSAELDRPTCSVCPPSPPPPVPQMDPQFSGISLDIPTGSLDGLGPQSMKFSKRGSLI
                     KHPSQQKSGEAQSQSQPELQPQPQQQQQPPPKQPEQSQYEGQQGAKEPQQEPPQDDSQ
                     SEQKLVEQPEEPKQPESQEQQDKQLEATPISPASSADDQSDVQQPQFHGAQPRFLKPS
                     ASLRVRRQISIPSRAISADEDMLSRRVRLMYEKGEENVSDSEVADSMAMENGVLWEEA
                     AETPASDAPSDAGTKRLSTVKPERKSMLKKETNELAGGIEYWQNIGAGDVDRYGFIRH
                     PQTSSGDTTDQPNPIQRVATSLLLSSETPRRKHSIRPPSALASNRSFTGRSPTRKFSE
                     PSIRPSSSQSTYSSPMRRSTSRFRHAANHLPHNRDRRFTDEAADMLTLPVNAVDSANG
                     LDSAAARAMKRKEWEREDKWAKMARPSKKNKDGGGMKFEFDTQSSKLIERTWKGIPDR
                     WRSTAWYSFLEASARKRSDSPSETELVEAYHEFQYVSSPDDVQIDIDVPRTITSHIMF
                     RRRYRGGQRLLFRVLHAMSLYFPDTGYVQGMAALAATLLAYYDEEHTFIMLVRLWQLR
                     GLERLYEHGFAGLMEALGDFEREWLEGGEVAAKLNENGIPPTAYGTRWYLTLFNYSIP
                     FPAQLRVWDVFMLLGDADPTPSHSVLPLKGSKQLQTSGFGKGLDVLHATSAALIDGMR
                     EIILESDFENSMKVLTSWVPIKDIELFMRVAKAEWKVHHRKKFS"
     gene            complement(<835752..>837113)
                     /locus_tag="ACHE_20283A"
                     /db_xref="GeneID:66979184"
     mRNA            complement(<835752..>837113)
                     /locus_tag="ACHE_20283A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284569.1"
                     /db_xref="GeneID:66979184"
     CDS             complement(835752..837113)
                     /locus_tag="ACHE_20283A"
                     /note="COG:S;
                     EggNog:ENOG410PPPB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133347.1"
                     /db_xref="GeneID:66979184"
                     /translation="MLLTLKPPTPARMAQNGIKGPSHEYSVIRQSIPSFRDSSVPFRQ
                     PSVPPSPNTHTNTTTNTTPSSANMDPSSRRSLPPPPSRTLPPPQLTAAHTPPQLPPPP
                     PSSQWHCGDKDPSMHLWLQARAEEDRRKQEEEKARQETLRLEQRVVEHSMLRDALQAG
                     VPPHMIPLIFAGISGGGLPQAAIDLAQQYVSHSVAQAQCQGPGPAVASMPPPPAPPAP
                     PPPQHHPHHHYHQSSGSDMPSSTFPRPPAPFTHRHSHSGSIDLRHSHPVPPNALYNPQ
                     PSVPTPGEILPSQPPNISRGSSPVRQSLGQSPFPPSGPPSSSSLPQPSIPPSNSTQQY
                     TQTSSASTPQSAANNEYQYRPRQSTSIYFHHWVPPGQQPPSGKSQESTPGGKASQEPS
                     AGKPSEREKEPTPASSGAHSRSVSEDHSSPSRKRKARGTHQPAPVPSSRSRQSSIARD
                     SVQ"
     gene            complement(<838151..>840979)
                     /locus_tag="ACHE_20284A"
                     /db_xref="GeneID:66979185"
     mRNA            complement(join(<838151..839674,839732..840133,
                     840199..840632,840691..>840979))
                     /locus_tag="ACHE_20284A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284570.1"
                     /db_xref="GeneID:66979185"
     CDS             complement(join(838151..839674,839732..840133,
                     840199..840632,840691..840979))
                     /locus_tag="ACHE_20284A"
                     /note="COG:F;
                     EggNog:ENOG410PI9B;
                     InterPro:IPR002110,IPR037986,IPR036770,IPR020683,
                     IPR002710;
                     PFAM:PF01843,PF12796,PF00023,PF13857;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133348.1"
                     /db_xref="GeneID:66979185"
                     /translation="MCPPSCITPTTTGVDTATAYPLPTMDNETRAASSSLDFGRDENN
                     LNTDDDNNDDLGVPNKRHTLTTTLPDDLPKSLDDRRSVPVFPQETEIYDAWMGQSQFL
                     TTPVAAKPLTFNLALDDHSHDDEHNLQAQYGRGMLDVDKDVEDTARLEDSDARLMEML
                     AAQAAHREVDSLGADEDSIADDEKLKDSEKKDILQRGLNMAASNGDVERVRKLLNGKA
                     REFVDVNMPDEEGTVPLIYASCFGHQDVVSELLDAGAHVDQQDRNQWSALMWAMTNRH
                     KTIAKILLDHGASPDIKSSSGGTAFDFAQPGSEISEYLNENGYHFGSAVDDDFYDSGF
                     GHSRFEEEIAEIGMKRRMMMEESAINLEVDLSSLGLDEKLDSADDADLEEDQQEFVWD
                     KCLHDQMFVFQDNELEWILDIIITNMTPQRSPSQKPVPANLLFLSARYAHYHASEELL
                     EQLLVSATEKINDVVERHQWDMTILAFWMSNATLLLHYLKKDTGLMEATVDFQQHLAE
                     LINEIFILIIRDAERRMNKVLEPAMLDHETIPGLEDVHFQNEWKLFRGKSKAKPPEPA
                     EKRFRPPSPRRRAQISPRNITSLLSSTLFVLDLYDVHSVITTQILSQLLYWVSAEIFN
                     RIMTTKRYLARTKAMQIRMNISALEDWARANNRQPEHYENGSTTCTGESTMDAARRHL
                     APVIQLLQWLQCFSSLGDDFESLVTTLLQLQQLTPAQLLHTVKSYRPEVGEKGLTKPA
                     MRFLIDLQRDYDLLFREQEKIQENKAKAAEGAATQSAPTTTDGQSRPQTPPPKDTPQG
                     HGSPAARSMASPGSIRSGTAARFDDRSTTELFLDPSMTLPFSLPTSTDMLISYGAGWG
                     GTNRERARKYIPTVPPEVLSRFDREA"
     gene            complement(<841793..>846849)
                     /gene="LTE1"
                     /locus_tag="ACHE_20285A"
                     /db_xref="GeneID:66979186"
     mRNA            complement(join(<841793..846362,846464..>846849))
                     /gene="LTE1"
                     /locus_tag="ACHE_20285A"
                     /product="guanine nucleotide exchange factor lte1"
                     /transcript_id="XM_043284571.1"
                     /db_xref="GeneID:66979186"
     CDS             complement(join(841793..846362,846464..846849))
                     /gene="LTE1"
                     /locus_tag="ACHE_20285A"
                     /note="COG:T;
                     EggNog:ENOG410QDPV;
                     InterPro:IPR000651,IPR036964,IPR023578,IPR008937,
                     IPR001895;
                     PFAM:PF00617,PF00618;
                     go_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IEA];
                     go_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor lte1"
                     /protein_id="XP_043133349.1"
                     /db_xref="GeneID:66979186"
                     /translation="MEERQVRDPPTDTHASSSAQPAGFRSSVKPFGSATESTFATSNL
                     RRANTVAQGGGNISKNNLESSAVDKEKPAEVSQLRTRDSHELLQKPLSLKRSLTQRGP
                     RDALVNGRGGSHFTVGSVGQNGKIFLRPIRNLSIKEPRAQQQQPLSSSTDPSQSERLH
                     PNTAHSHGQGANDPRWSNSQLSELQPDVTREENVVDDGESVTTESARSEYRQQNRQRP
                     HSFSTISEHQSTSSIRPRGEYQRIVIDRSDDRRRSDIAEEPSAFPTLEVSIPHYRLGI
                     PQFNKTESPALQSSRGSTQGYFRTSPLLGENLNSHPLSNVLSDSVIPERPSFVSSILS
                     DTGVELGPDPTATEVPIFYEMKEPIEPSVFETLVSDMDDESVVRYIPGTKELSAATPA
                     RIVAQISSESFMDYELVSDFFLTYRSYLSPSHLLRLLLARLQWAINRWQDDGRIIRIR
                     TFAALRHWILNYFTDDFAEDYELRVYFCDIINLLYNDVKSRENGGTSDLKILIDLKRC
                     WHGKCAMIWDAPELSSAYYHQDSPVVPGGLIETIDGDQGERAQHFVQPGLPLSIGDDS
                     VNVDAGQEPTLAQHYRTHSGATNQSIPVTVQSDDHCLAASCSFPPKSHRRPSNPPPKT
                     APHPVPLSPAKYAHVPPPPKSSTAASTKRRPFYTHAHKRSGSFSDSVRDDRAPLPLLK
                     LDQWGISSQEILDPASLIRGTLYPPAESYMTMMAPLSPPLPLGSVPGLERQSTADGTS
                     KPTTSGSGVKTIIGSIRRAINGAKHGNQNISRHTRGYSGSPFRGKTSTLPNNVAFGSD
                     YYRDRKTTARSKKPTRIDTLCDEVLRQYRQVIADREETKQDPPQQEASMPRLQVPPSR
                     IGSQVRSQSGLTMGSESIVIVDDTGLDIPMVSGANGEPIVDFERSPGFLNAGNGTATP
                     KTDSLRVPSTRGDDKYSLRIFYDDSAPAGSSHQPSKTFYNNSDSSASRRSISIGHALP
                     FRKRTSPSLRLRKYASFQSIISRRRPATSANGEPVPLVADLNVLQDEPETPTGPILRR
                     RPGGDLRKMQNGKNRLSYLRSRSTISVAESELTASTRDVQSRRQTSLIPPNPRYSLIQ
                     TNSSQDVRRSFEAAIAKFAQIPDDDDGGVESTLLKLEGKWDGPETPRADGEGSSSAPH
                     HRNMPVVLRQNCNDDGFQRRPTFLGDPLTYSQVRERMRPVRPYSDSVAESEESFSSIP
                     LLERGLSDESMKKPPALSRVATNPAATPRASRTDTSDWDSSRPSTHVINKTESISRIP
                     RGSTVPVPRPLAPRDRTRLSELSLDVIDRREILDGRPSTDSARLSRSSYRIPPHPLAQ
                     PPSPPMTIQNPRSITSCATPLNPVIVQAQPLTPDPSPSRRNAQPDPSRFIDMQQDVLS
                     RSENGQQQPSPVAAPDVDHVPFILACESQLLAQQLTLVEMAALSEIDWRDLVEMRWSS
                     GSPTTLSWVQFLTSEDHRGIDLVVGRFNLMVKWVLSEIVLTQDIHERVQTISKFIHVA
                     VHAKRMCNYATMLQIAIALSSINCARLEKTWSLVSPEDKRLLKDMEALIQPVRNFHDL
                     RVEMETANLQEGCIPFVGLYIHDLNYNSQKPAQVTTQAGEPLINFERHRTTARIVKNL
                     LRLIDASTKYAFEPVQGVIERCLWIASLDEEGIQTRSRDLD"
     gene            complement(<848136..>850752)
                     /locus_tag="ACHE_20286A"
                     /db_xref="GeneID:66979187"
     mRNA            complement(join(<848136..848213,848271..849821,
                     849875..850383,850441..850676,850739..>850752))
                     /locus_tag="ACHE_20286A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284572.1"
                     /db_xref="GeneID:66979187"
     CDS             complement(join(848136..848213,848271..849821,
                     849875..850383,850441..850676,850739..850752))
                     /locus_tag="ACHE_20286A"
                     /note="COG:E;
                     EggNog:ENOG410PFH5;
                     InterPro:IPR008753,IPR018497,IPR024079,IPR000718,
                     IPR042089;
                     MEROPS:MER0011141;
                     PFAM:PF01431,PF05649;
                     TransMembrane:1 (i63-83o);
                     go_function: GO:0004222 - metalloendopeptidase activity
                     [Evidence IEA];
                     go_function: GO:0008237 - metallopeptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133350.1"
                     /db_xref="GeneID:66979187"
                     /translation="MSNSKSSDEFEAAHLIEEGSHTVDEEHPHPHGSARVGQFTVDDF
                     FRHPIRAIPDKHRKRLSTLLRLSGVLLLVFGGYFFWNYFEIERSCESSSRPDAPMLCE
                     SPECVHAASEILYNLDPNVANVDPCTDFDQYVCGGWRARHDMRPDQGSIFAGTAMAEN
                     AQMRLRHILEAPDAPSSEDKENFGKLKAAYQACLDESTINKRGSKPLEHVLAQLEDIY
                     SMKGVSNRDVQKNLTDAVLQLIKFDVEALVVPSVSPDDRDPDSVAIFVVPVDEIGLPA
                     REYYNNTDTVAEYTKVAEKVLGSFVSSKDSIKDVMTFEAKLANATPDTQTREDITKSY
                     NPRTIKETESLLPEISLSDIISALAPSGYKNDRLIVGSPSYIESLSSILSETSRETVQ
                     LFFKWKIIQSFADSIEDPKIRPLREFNNKLSGKDPQATEERWRKCINVLDGGLPWSLS
                     RFYILDSFSRASKELGDQVISDIKERFVFTLDQTSWMSPEVKKLGIQKVGNIVQKIGY
                     PTKSPDVMDPSDVEEYYRDLKLSDETFFENQLAIAEFLIQRLWSKLGKPTDRNEWDMS
                     APTVNAYYNPPGNEIAFPAGIMQSPVFYGPSAPLYLTYGAFGAVSGHELSHGKCDHYF
                     RPKMRSLTDPLSAFDSSGRHYDETGNYTDWWDEKTVAGFEERAQCFVDQYSEFTVTGP
                     DSKPLHVNGRLTLGENIADAGGLAAAFHAWKKRDESKPDPLLPGLSTFSKEQLFFVSY
                     ANWWCSKTTREAAQSAIYNDPHAPKPARIIGTMANSREFKEAFQCASHDPVCKLW"
     gene            <854642..>855936
                     /locus_tag="ACHE_20287S"
                     /db_xref="GeneID:66979188"
     mRNA            join(<854642..854771,854825..855009,855063..855226,
                     855283..855541,855595..>855936)
                     /locus_tag="ACHE_20287S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284573.1"
                     /db_xref="GeneID:66979188"
     CDS             join(854642..854771,854825..855009,855063..855226,
                     855283..855541,855595..855936)
                     /locus_tag="ACHE_20287S"
                     /note="COG:D,T;
                     EggNog:ENOG410PG0J;
                     InterPro:IPR002975,IPR027417,IPR011025,IPR001019;
                     PFAM:PF00503,PF00025;
                     go_component: GO:0005834 - heterotrimeric G-protein
                     complex [Evidence IEA];
                     go_function: GO:0001664 - G protein-coupled receptor
                     binding [Evidence IEA];
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA];
                     go_function: GO:0019001 - guanyl nucleotide binding
                     [Evidence IEA];
                     go_function: GO:0031683 - G-protein beta/gamma-subunit
                     complex binding [Evidence IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0007186 - G protein-coupled receptor
                     signaling pathway [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133351.1"
                     /db_xref="GeneID:66979188"
                     /translation="MGCMSSKTADPVEKEAVQRNARIERVLKGDKKTMDRTIKILLLG
                     AGESGKSTIIKQMRIIHSGGFPDDERHQTRAVIYANLIIAFKVLLDIMDAEHISFEHD
                     STKPLAQLVDNTDPDVGSEEAFSDMAIRDAMKSMWDDAGVQKAVARGHEFALHDNLHY
                     YFDSIDRLFTPGWLPDNQDMLQARLRSTGITETLFELGQMNFRMMDVGGQRSERKKWI
                     HCFEGVQCLLFMVALSGYDQCLVEDQSANQMHEAMMLFESLANGEWFKRKPIILFLNK
                     IDLFKGKLEMSPVAKHFPDFTGSNSDFDAAARYFADRFRGINRIPDREIYIHYTNATD
                     TTLLKATMDSVQDMIIQKNLHTLIL"
     gene            <856856..>858014
                     /locus_tag="ACHE_20288S"
                     /db_xref="GeneID:66979189"
     mRNA            join(<856856..857270,857332..>858014)
                     /locus_tag="ACHE_20288S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284574.1"
                     /db_xref="GeneID:66979189"
     CDS             join(856856..857270,857332..858014)
                     /locus_tag="ACHE_20288S"
                     /note="COG:S;
                     EggNog:ENOG410PRE8;
                     InterPro:IPR013177;
                     PFAM:PF08213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133352.1"
                     /db_xref="GeneID:66979189"
                     /translation="MLSSSLRRAAWTPIVPISGIARTAAGAAGAAAGASAAASTTSNN
                     MTTNNSNGGLMPQYVRQRRYSSSSSKPSDGFDASGPSSGQTPAKGVNGGTGESKREGR
                     RSRRAGKEQRSAQQQQHDAAFSKLPSVPSTQYQQPHDVHVASFFSIHRPISVSTTVPP
                     SSNQEAFDAIFSSKKSAKAEQEDVMLTLSSAVQSMENTAAEHDDLGRHLEVDVQPYDS
                     MNMSDIKLSVDELAKRLRAFHPPPPPMPFDEAKEVANARQLESSQENSYSTVLTIHES
                     TDATGRKTYEAHTTPFVRTQDMDAPGATEHEEFIDVPQSKGTTYIERLRNNRTMHAIS
                     TKRRRKAKMKKHKYKKLLRNTRTLRRKLDKA"
     gene            complement(<858858..>859779)
                     /gene="VMA3"
                     /locus_tag="ACHE_20289A"
                     /db_xref="GeneID:66979190"
     mRNA            complement(join(<858858..858922,858978..859081,
                     859138..859294,859353..859482,859640..859652,
                     859763..>859779))
                     /gene="VMA3"
                     /locus_tag="ACHE_20289A"
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /transcript_id="XM_043284576.1"
                     /db_xref="GeneID:66979190"
     CDS             complement(join(858858..858922,858978..859081,
                     859138..859294,859353..859482,859640..859652,
                     859763..859779))
                     /gene="VMA3"
                     /locus_tag="ACHE_20289A"
                     /note="COG:C;
                     EggNog:ENOG410PMYT;
                     InterPro:IPR011555,IPR035921,IPR000245,IPR002379;
                     PFAM:PF00137;
                     TransMembrane:4 (o12-34i55-76o88-113i125-151o);
                     go_component: GO:0033177 - proton-transporting two-sector
                     ATPase complex, proton-transporting domain [Evidence IEA];
                     go_component: GO:0033179 - proton-transporting V-type
                     ATPase, V0 domain [Evidence IEA];
                     go_function: GO:0015078 - proton transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:1902600 - proton transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /protein_id="XP_043133353.1"
                     /db_xref="GeneID:66979190"
                     /translation="MATELCPVYAPFFGALGCSSAIIFTCFGAAYGTAKAGVGVCGMA
                     VLRPDLIVKNIVPIVMAGIIGIYGLVVSVLIANDLGQKIPLYTGFIQLGAGLAVGLAG
                     MAAGFAIGIVGDAGVRGTAQQPRLYVGMILILIFAEVLGLYGLIVALLMNSRSRIDAT
                     C"
     gene            complement(<860137..>861822)
                     /locus_tag="ACHE_20290A"
                     /db_xref="GeneID:66979191"
     mRNA            complement(join(<860137..861549,861613..>861822))
                     /locus_tag="ACHE_20290A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284577.1"
                     /db_xref="GeneID:66979191"
     CDS             complement(join(860137..861549,861613..861822))
                     /locus_tag="ACHE_20290A"
                     /note="COG:S;
                     EggNog:ENOG410PS4R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133354.1"
                     /db_xref="GeneID:66979191"
                     /translation="MSMIPGCVPISMPARLTFQSKPLRLSFRKTSWLCPRSPLPAQRW
                     YTAQATSTREARSFAYTWLTKTPDEIVPDDVLATIPPIPASVAESGHIPILLVTPSFA
                     PWIDPASPFLEQCVNKFLSNTPNVRSLNPLHAIAAIIDKLPDVRGQPGDALISSNGQA
                     QSDSEGVSLLFVKAENVQGKAAESRRIRSSGTEEPALLFSVNTNAPDRPAHEVGLRLA
                     NTIFINGNENTLFGMRWSYNATSSRFALDQYLDFSNCVITSPANSVHNAFRFPLYPVS
                     RRRKVISGMGNILRQVAKSADDDQSNVPMPASSELERELPRYIEEHGIIDQRVSVWAL
                     VETPDMNVPIETSFLQDRLSHSLRAGGKLHHVMSGGGGWGKKQGLLSLDPEISFLEAT
                     IREELLTIDQLFEPRAESADPILGLPPFLSKGFGDDLSTLSQTAKPGDYVQFFVAVQP
                     SDVHDKRPDIAKPQEGSISCQFGIVTGIPEVQTIDGQQKDLVVLPNYFGALSEKAITY
                     QQPILDVQANEQVFESGTKLNVPGCRVELTLA"
     gene            <862956..>863280
                     /gene="PMP3"
                     /locus_tag="ACHE_20291S"
                     /db_xref="GeneID:66979192"
     mRNA            join(<862956..862972,863100..>863280)
                     /gene="PMP3"
                     /locus_tag="ACHE_20291S"
                     /product="plasma membrane proteolipid Pmp3"
                     /transcript_id="XM_043284578.1"
                     /db_xref="GeneID:66979192"
     CDS             join(862956..862972,863100..863280)
                     /gene="PMP3"
                     /locus_tag="ACHE_20291S"
                     /note="COG:S;
                     EggNog:ENOG410PRTI;
                     InterPro:IPR000612;
                     PFAM:PF01679;
                     TransMembrane:1 (o32-55i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="plasma membrane proteolipid Pmp3"
                     /protein_id="XP_043133355.1"
                     /db_xref="GeneID:66979192"
                     /translation="MPFTASDICKIIFAIILPPLGVFLEKGCGADFLINICLTILGWI
                     PGIIHAMYVLFPLRKSLLQHR"
     gene            <865231..>867165
                     /locus_tag="ACHE_20292S"
                     /db_xref="GeneID:66979193"
     mRNA            <865231..>867165
                     /locus_tag="ACHE_20292S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284579.1"
                     /db_xref="GeneID:66979193"
     CDS             865231..867165
                     /locus_tag="ACHE_20292S"
                     /note="COG:S;
                     EggNog:ENOG410PPSQ;
                     TransMembrane:1 (o144-167i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133356.1"
                     /db_xref="GeneID:66979193"
                     /translation="MKTDNGYTLGEGILQCILSYCSDDVVAESGNDVYKICDGVKGAV
                     SKTHASIIATLVPGVTSSAVSGDTTTPTISASGTTASGFETSVTSPVLTTFQSPVSTT
                     GLEGVASATSGATESQSQSPSTTPEANGDEDQDSNSLSAGGVVGVSLASGLSGSFLIG
                     IAIFFWWRKMRRKRKEADDAHYFEIGGRMTEPPDFDTPRPRLPTPGPNSYRPRPPPKS
                     PDQIPTTETSRLMSPFLPGPRPANSNSNPAVVVTDVDDDYHHDGGGGLGEDPDRTAHA
                     FPPFVFDEVDTPRNVPATQRTRSDQLLPEKPELLPEPLNWDRPRPSRANSDAITMFEE
                     DVPRPKDHPFNGYPNFSGPLGPRPMNSKRPIAGLPANPRAMMYGFGSQDHLPPKRTQD
                     SLLKPTYLQPEARPSSFIAATPGRCSQSSMSDDDYDDYYSNWQDYDTNQPRPPARIAN
                     RRSYPSPSTESWSNTGFDFRSLESPRIFRHSGIFKPLTPVREESRTPARSLSNPSPQD
                     RIGYSTGSPQQRFYHPSPQTPNLDPTCEVVSRPRIVRQHDIKRVEIRRGKSREVNTPV
                     MSSPYSPDDYWNEPSRNSLTQVTTAGSSAMTTPTSLSVGTSMPPVEKTITRKPAKRQS
                     LLERNLTPSREGADLILRVE"
     gene            <868109..>868324
                     /locus_tag="ACHE_20293S"
                     /db_xref="GeneID:66979194"
     mRNA            <868109..>868324
                     /locus_tag="ACHE_20293S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284580.1"
                     /db_xref="GeneID:66979194"
     CDS             868109..868324
                     /locus_tag="ACHE_20293S"
                     /note="COG:G;
                     EggNog:ENOG410PHS3;
                     InterPro:IPR036412,IPR006357,IPR023214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133357.1"
                     /db_xref="GeneID:66979194"
                     /translation="MVGHMAQQYVENHENADRVSLVSDRPATVSDNFAFAFDIDGVLL
                     RGGQAIPEAIDALRYINGDNPYSIKVL"
     gene            <870236..>871066
                     /locus_tag="ACHE_20294S"
                     /db_xref="GeneID:66979195"
     mRNA            <870236..>871066
                     /locus_tag="ACHE_20294S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284581.1"
                     /db_xref="GeneID:66979195"
     CDS             870236..871066
                     /locus_tag="ACHE_20294S"
                     /note="COG:G;
                     EggNog:ENOG410PHS3;
                     InterPro:IPR036412,IPR006353,IPR023214;
                     PFAM:PF13242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133358.1"
                     /db_xref="GeneID:66979195"
                     /translation="MREMADKYHTVLVVGGEGEKCRVVAEGYGFKDVITPGDIIKTKD
                     DTTPFRRLTDDEYKNSRFRDLKNTRIEAVFVFADSRDWAGDQQIILDCLMSVNGHLGT
                     RSETGNEGPPVFFSHTDVVWATSHEHCRLGMGALRASLEAVYKAITGRELSTIAFGKP
                     QLGTYHFAMRLLQQWRKDTHDINKPPRTVYFVGDTPESDVRGTNEFNDVSEAEWVSLL
                     VKTGVFQDGATPKYQPGHTCENVLEAVKYAVEREQARSKGEIDDVDSGIDSESACLRN
                     "
     gene            complement(<875816..>877212)
                     /locus_tag="ACHE_20295A"
                     /db_xref="GeneID:66979196"
     mRNA            complement(join(<875816..877085,877160..>877212))
                     /locus_tag="ACHE_20295A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284582.1"
                     /db_xref="GeneID:66979196"
     CDS             complement(join(875816..877085,877160..877212))
                     /locus_tag="ACHE_20295A"
                     /note="COG:L;
                     EggNog:ENOG410PI0C;
                     InterPro:IPR007751,IPR029058;
                     PFAM:PF05057;
                     TransMembrane:1 (o268-289i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133359.1"
                     /db_xref="GeneID:66979196"
                     /translation="MASTNASSADHLCVLVHGLWGNPMHLDYVAASLRERYGDRLHIL
                     AAERNAGNFTYDGIELGGERLAHEVEDTLEALAGQGHTIKKLSVVGYSLGGLVARYAL
                     GLLHARGWLDKLEPVNFTTFVTPHVGVRTPLKGIQNHIWNVLGARTVSMSGRQLFMID
                     SFRETGKPLLSILADPESIFIKALARFKHRSVYANIVNDRSAVFYTTGISKFDPFPDV
                     ETTNFNYAKGYEPVVVDSNVYTLPLEVKEPNPLDSHAWRKMMRIIANLPFWFFLLFFV
                     PVGSFIFLLNAVVQTVRSRQRIRLHEQGKTGVFFGSYRVPLLVQDVQNAVEDVFENVN
                     SSQDPEYLSPTNERDIELPKDERALPPSSSQAPEIVYNGLRYPVLALTSAQFAIIDSL
                     NAVGFRRYPVYIHKHRHSHAAIIVRMPKKGFEEGRVVIKHWLDNEFVV"
     gene            complement(<878686..>880103)
                     /locus_tag="ACHE_20296A"
                     /db_xref="GeneID:66979197"
     mRNA            complement(join(<878686..879531,879589..879661,
                     879709..879856,879914..>880103))
                     /locus_tag="ACHE_20296A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284583.1"
                     /db_xref="GeneID:66979197"
     CDS             complement(join(878686..879531,879589..879661,
                     879709..879856,879914..880103))
                     /locus_tag="ACHE_20296A"
                     /note="COG:S;
                     EggNog:ENOG410PHFU;
                     InterPro:IPR036291,IPR005097;
                     PFAM:PF03435;
                     TransMembrane:1 (o282-304i);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133360.1"
                     /db_xref="GeneID:66979197"
                     /translation="MSTEREYDVILLGATGYTGKLTAQYIFKSLPLDLKWAIAGRNKQ
                     KLQEVAESLGPLHLSRQAVDTLVVSLNEKELDSLAKRTRLVISTVGPFQLYGSDTFAA
                     CARNSTHYLDCTGEAPWLKDMIEQYDIIAKTNGSIMIPCCGFDCVPSDLLTWVAASYN
                     RRHFGAQTGRVDLCIHSVQGGISGGTLASVLQAFELHSLRHLYHVHAPFSLSPKRPTP
                     KVSPKRTSLWTKLFGLLWIKQLGWMAYQPQAAVDRTIVHRSWGLLEPTTASYGHDFDW
                     HTWFKIWGPVLAILWHFSGLLLAPWILLRPVRKLLPKLWYEPGSGAGEGTITNNWFEY
                     RGVAETNTSVQPKSRALVRMRYDSDPYIFTAVALGEAARIVLWQQDTWAHKFGGGVLT
                     PATLGDHYVSQLRAAGVVIEARNAVP"
     gene            complement(<881853..>882975)
                     /locus_tag="ACHE_20297A"
                     /db_xref="GeneID:66979198"
     mRNA            complement(join(<881853..882484,882541..882819,
                     882900..>882975))
                     /locus_tag="ACHE_20297A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284584.1"
                     /db_xref="GeneID:66979198"
     CDS             complement(join(881853..882484,882541..882819,
                     882900..882975))
                     /locus_tag="ACHE_20297A"
                     /note="COG:Q;
                     EggNog:ENOG410PM4N;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106;
                     TransMembrane:1 (o20-37i);
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133361.1"
                     /db_xref="GeneID:66979198"
                     /translation="MVSLQAVRTHNTSLKDLGSGLVAVFVGGTSGIGLYTAREFVRRT
                     LSPTIYLVGRNETRAGDIIAGLKLLNEGAQIYFIKADASLLMEVDSACDVIQRQVSHV
                     NVLFLSCGIFTLNRREETTEGLDRRFSLHYYTRMRFIHNLIPQLTCAGRNEHGLSRVV
                     SVLGAGHETKLHLDDLDLRERYGVEACDVHATTMTSLMVKEFALRYPSTTFIHTYPGI
                     VKSGIAREAGPVVSRVIRAAMFLGRLWMVSKQESGERHLFAATSRQFSPGTKAAVGGI
                     TGGAYLLNWDVSEAGNRGLLDDYYTHGVSDQVWMHTQETFRKALGNKGRLRQ"
     gene            <883797..>885398
                     /locus_tag="ACHE_20298S"
                     /db_xref="GeneID:66979199"
     mRNA            join(<883797..883896,884026..884367,884443..884462,
                     884529..884765,884929..885282,885339..>885398)
                     /locus_tag="ACHE_20298S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284585.1"
                     /db_xref="GeneID:66979199"
     CDS             join(883797..883896,884026..884367,884443..884462,
                     884529..884765,884929..885282,885339..885398)
                     /locus_tag="ACHE_20298S"
                     /note="COG:C;
                     EggNog:ENOG410PN40;
                     InterPro:IPR001155,IPR013785;
                     PFAM:PF00724;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133362.1"
                     /db_xref="GeneID:66979199"
                     /translation="MAEGLADKGHLPGTRISRVYGEWAKGGWGALLTDERQSLELWKK
                     YADTCQQHGTPAIAQICHPGRQSPRGAGERGLFGKAIAPSEVPLHIGNGLAPTIVRNI
                     VFGMPKAMSHADIDHVIAQFVNCARVLAQCGFGGIEIHAAHGYLLSQFLSSRSNIRQD
                     DYGGDAERRARIVLEIIHQIRKAVPAAFCVGIKLNSADHNASSFEDTMTQIQLFSDAG
                     VDFLEISGGTYEDPTMMGRGLRGGTSNTKSQNPESGEAFFLDFATQARKRFPNLILLL
                     TGGFRTRKGIEAALKDGVCDLVGIGRPAVLRPDFPRFIMDDIYSDQEARVVFPKVPIP
                     FLARLLQIRMLGGGAETQYFRGQIHRIAAGLVAYAP"
     gene            complement(<892264..>893313)
                     /locus_tag="ACHE_20299A"
                     /db_xref="GeneID:66979200"
     mRNA            complement(<892264..>893313)
                     /locus_tag="ACHE_20299A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284587.1"
                     /db_xref="GeneID:66979200"
     CDS             complement(892264..893313)
                     /locus_tag="ACHE_20299A"
                     /note="InterPro:IPR036875;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133363.1"
                     /db_xref="GeneID:66979200"
                     /translation="MPRGRPRTIAEETTLSSQDTITPEQIDTDLQAIHNRIAKLEELR
                     VARENLARLEAEVINPSEIGSVVNRDHPGNHPPESHTEELKIKNISTFTLNFNLQRRQ
                     DWLLDLRYTFRGAPRKYRTDGKKILAALNFLDHTCRHRWYRHVEEKSIEERQNIEDSW
                     AYFEEWTLSLIRNTTTLQADIMDQIERTCQLPNQDPREFHAYLDTLEQHFPRQAEKER
                     ALSFFAKLQGNLKKYIREHHIKLPEGREEMVSLATHYWNLLKPSRKRNWTESTTTSGQ
                     EQDDPKRRRYKYSAPYLKTKWKQPTGPDGKPYHCYICDATDHLASRCPKKTKIQSVLN
                     NQNIQSEMGNGEESK"
     gene            complement(<897328..>898009)
                     /locus_tag="ACHE_20300A"
                     /db_xref="GeneID:66979201"
     mRNA            complement(join(<897328..897901,897957..>898009))
                     /locus_tag="ACHE_20300A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284588.1"
                     /db_xref="GeneID:66979201"
     CDS             complement(join(897328..897901,897957..898009))
                     /locus_tag="ACHE_20300A"
                     /note="COG:S;
                     EggNog:ENOG410PVJT;
                     InterPro:IPR023375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133364.1"
                     /db_xref="GeneID:66979201"
                     /translation="MSSTAGRSSAASSKASAPCSQCPTAQVEFGGQKVDVPKGGYYDR
                     YRMNPNLDEVARDPAVGPDIDFFWKIPKKLVNSRVGQVYAPNFYYRTRSIQLLFLAPL
                     DRLQSKLPSPLEPIAAFPGYGLVALTFYSYLVCDNDPYNEVSIAVIVRQPGKDSYSTT
                     QLLSSIWNRTFYGYVLALPVNTEIARVRGVLLLLLFNQVYCPYRALEL"
     gene            <900688..>900921
                     /locus_tag="ACHE_20301S"
                     /db_xref="GeneID:66979202"
     mRNA            <900688..>900921
                     /locus_tag="ACHE_20301S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284589.1"
                     /db_xref="GeneID:66979202"
     CDS             900688..900921
                     /locus_tag="ACHE_20301S"
                     /note="TransMembrane:1 (o6-33i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133365.1"
                     /db_xref="GeneID:66979202"
                     /translation="MAVPDWLQYASIVLGILAYTSLSAGAALHALLVPRAAALRKDHH
                     VPQLLQTQSRMRQRKETEDEARIMELEQCRPKI"
     gene            <902306..>903793
                     /gene="REX3"
                     /locus_tag="ACHE_20302S"
                     /db_xref="GeneID:66979203"
     mRNA            <902306..>903793
                     /gene="REX3"
                     /locus_tag="ACHE_20302S"
                     /product="RNA exonuclease 3"
                     /transcript_id="XM_043284590.1"
                     /db_xref="GeneID:66979203"
     CDS             902306..903793
                     /gene="REX3"
                     /locus_tag="ACHE_20302S"
                     /note="COG:L;
                     EggNog:ENOG410PG7T;
                     InterPro:IPR012337,IPR036397,IPR013520,IPR034922;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="RNA exonuclease 3"
                     /protein_id="XP_043133366.1"
                     /db_xref="GeneID:66979203"
                     /translation="MLTKAPASHGVRLSILTKLHSAMSTLNAKLAEDQENGNKYLVLS
                     PNELVTMALDEEEKAAKDNPSVYSNIIKLRIVRLSKMSKEDWANEVKDHLNARYYKFE
                     PIQEPPKPRVFTTGLSAKEEVAIVGKLVTPLEGLEGFGYVTRAPSKEEIESARKGVEG
                     SKGWEQCARCAGRFQVWPGRRPDGSLTSGGQCTHHPGKPLYPPKSQTQHITGPKEAYY
                     SCCNESLGASSGCTKGDTHVFKVSETKRLASILQFEKTPWQPDKRARPPVCFDCEMGY
                     TTLGMELIRLTAVSWPDGKPLLDILVRPMGEVLDLNSRFSGVFPGHYANAIPYDPSTQ
                     TPEFNETENQPLQVVDSPAAARSLLFTHLQPTTPIIGHAIDNDLNACRIIHPTVIDTV
                     ILYPAPRGGLPNRMSLKTLCRKFLEREIQTGGERGHDSKEDAVATGELVRVKVGETWK
                     VLKSKGWRIDVAGGKLVPPERMGEGDAAKERSLGVGAGVKRKGLS"
     gene            complement(<904115..>904704)
                     /gene="RPL22"
                     /locus_tag="ACHE_20303A"
                     /db_xref="GeneID:66979204"
     mRNA            complement(join(<904115..904241,904297..904493,
                     904549..904584,904687..>904704))
                     /gene="RPL22"
                     /locus_tag="ACHE_20303A"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_043284591.1"
                     /db_xref="GeneID:66979204"
     CDS             complement(join(904115..904241,904297..904493,
                     904549..904584,904687..904704))
                     /gene="RPL22"
                     /locus_tag="ACHE_20303A"
                     /note="COG:J;
                     EggNog:ENOG410PQSK;
                     InterPro:IPR002671,IPR038526;
                     PFAM:PF01776;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_043133367.1"
                     /db_xref="GeneID:66979204"
                     /translation="MAPVATARGRKAQKVTQKYVINASQPASDKIFDVSAFEKFLHDR
                     IKVEGRVGNLGDKVVISQTGDGKVEVVAHIPFSGRYLKYLTKKFLKKQQLRDWLRVVS
                     TSKGVYELRFYNVVNDEAEEDEE"
     gene            <905645..>906755
                     /locus_tag="ACHE_20304S"
                     /db_xref="GeneID:66979205"
     mRNA            join(<905645..905710,905786..905822,905884..905937,
                     905992..906125,906179..906284,906343..906428,
                     906479..906628,906681..>906755)
                     /locus_tag="ACHE_20304S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284592.1"
                     /db_xref="GeneID:66979205"
     CDS             join(905645..905710,905786..905822,905884..905937,
                     905992..906125,906179..906284,906343..906428,
                     906479..906628,906681..906755)
                     /locus_tag="ACHE_20304S"
                     /note="COG:S;
                     EggNog:ENOG410PJDZ;
                     InterPro:IPR033956,IPR002848,IPR016069,IPR016068,
                     IPR036081;
                     PFAM:PF01997;
                     go_function: GO:0003697 - single-stranded DNA binding
                     [Evidence IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     go_process: GO:0016070 - RNA metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133368.1"
                     /db_xref="GeneID:66979205"
                     /translation="MIDHRIFEDLQTKIDEETHVRDELQEIVQTLARRGRSTQAIISR
                     AHSTPSDQLKPVLDTATKEIIAQKAEVTRLKAVADQHPFYKYNGLWTRELQNLVTAIE
                     LCAWLGGFEEYKSADSSEFLTIEEVGKFLDVPVNLKEEDAFHLTIEEYLLSLIAMAEE
                     LARLAVNSVTLGDYTRPVQIGRFIKDLFAGFQLLNLKNDVLRKRGDGMKYSVKKVEDV
                     VYDLSLRNLIPKGSAAA"
     gene            complement(<906857..>907608)
                     /locus_tag="ACHE_20305A"
                     /db_xref="GeneID:66979206"
     mRNA            complement(join(<906857..907371,907437..>907608))
                     /locus_tag="ACHE_20305A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284593.1"
                     /db_xref="GeneID:66979206"
     CDS             complement(join(906857..907371,907437..907608))
                     /locus_tag="ACHE_20305A"
                     /note="COG:O;
                     EggNog:ENOG410PN5P;
                     InterPro:IPR029759,IPR000889,IPR036249,IPR029760;
                     PFAM:PF00255;
                     go_function: GO:0004602 - glutathione peroxidase activity
                     [Evidence IEA];
                     go_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133369.1"
                     /db_xref="GeneID:66979206"
                     /translation="MRPASLATSSTFRFIAVPKTPLLSTSYTSPLRRAQIQPPNTRTM
                     SSATTFYDFEPVDKTGKPFPLSSLKGKVILVVNTASKCGFTPQFASLETLYKSLTEKY
                     PDTFTILGFPCNQFGSQDPGSNDDIQSFCQVNYGVSFPVLGKLDVNGEQAAPVYNWMK
                     EEMPGIMGLRRVKWNFEKFLISADGKVVGRWASTTKPEALEGRIVEEIEKARKEGTLA
                     GASGEQAKLS"
     gene            complement(<908318..>908923)
                     /locus_tag="ACHE_20306A"
                     /db_xref="GeneID:66979207"
     mRNA            complement(join(<908318..908642,908727..>908923))
                     /locus_tag="ACHE_20306A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284594.1"
                     /db_xref="GeneID:66979207"
     CDS             complement(join(908318..908642,908727..908923))
                     /locus_tag="ACHE_20306A"
                     /note="COG:S;
                     EggNog:ENOG410PRWM;
                     InterPro:IPR015419;
                     PFAM:PF09341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133370.1"
                     /db_xref="GeneID:66979207"
                     /translation="MLRHTSPYPEPPRLPLTTANEPSNKHFHLDPSKQNKHHITSATL
                     YTLPTLEKTTMAANATEFPYSLTITLPLPSSHLSSSALRTLEVDTELSPFVQRDLELV
                     APSASTPAPEAGKMEIEEGEKSVLKTTYRATTNRMLRVAVNGFMESLGVVLGVMQELD
                     VDVLEMDGVKEDE"
     gene            complement(<909633..>910534)
                     /locus_tag="ACHE_20307A"
                     /db_xref="GeneID:66979208"
     mRNA            complement(join(<909633..910291,910357..>910534))
                     /locus_tag="ACHE_20307A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284595.1"
                     /db_xref="GeneID:66979208"
     CDS             complement(join(909633..910291,910357..910534))
                     /locus_tag="ACHE_20307A"
                     /note="SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133371.1"
                     /db_xref="GeneID:66979208"
                     /translation="MKFTGIAAMLAVVTAVTGAAIPNVNGALAEVHQVTGDVKGLLSN
                     VLGTKDEAQVNKLVSQLENVQKALEGLTGSEQKRDLLNVGVGADVDVLKRDDVLGDLT
                     KTLGLKRDEGLLGDLPLVGDLKRDEGLLGDLPLVGDLKRDDAISSLAEQITPQVTQVV
                     QGLNVQQITGLLNILNVNGLLTNVESVLSNLLGGGLLKGLTGNLLGGILKRDDAISSL
                     ASQLLPKLTQGGILPQDLSVEQLTGLLNILNVNNLLTGVESLVQNLLGGGLLKGLTGD
                     LL"
     gene            <913816..>915796
                     /gene="CDC14"
                     /locus_tag="ACHE_20308S"
                     /db_xref="GeneID:66979209"
     mRNA            join(<913816..913864,913963..914494,914551..>915796)
                     /gene="CDC14"
                     /locus_tag="ACHE_20308S"
                     /product="cell division control protein 14"
                     /transcript_id="XM_043284596.1"
                     /db_xref="GeneID:66979209"
     CDS             join(913816..913864,913963..914494,914551..915796)
                     /gene="CDC14"
                     /locus_tag="ACHE_20308S"
                     /note="BUSCO:EOG09262E7I;
                     COG:V;
                     EggNog:ENOG410PHH0;
                     InterPro:IPR029021,IPR026070,IPR003595,IPR020422,
                     IPR029260,IPR016130,IPR000387,IPR000340;
                     PFAM:PF14671,PF00782;
                     go_function: GO:0004721 - phosphoprotein phosphatase
                     activity [Evidence IEA];
                     go_function: GO:0004725 - protein tyrosine phosphatase
                     activity [Evidence IEA];
                     go_function: GO:0008138 - protein
                     tyrosine/serine/threonine phosphatase activity [Evidence
                     IEA];
                     go_function: GO:0016791 - phosphatase activity [Evidence
                     IEA];
                     go_process: GO:0006470 - protein dephosphorylation
                     [Evidence IEA];
                     go_process: GO:0007096 - regulation of exit from mitosis
                     [Evidence IEA];
                     go_process: GO:0016311 - dephosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="cell division control protein 14"
                     /protein_id="XP_043133372.1"
                     /db_xref="GeneID:66979209"
                     /translation="MAGNTTGCGQIIEYIQDRLYLASYDSTPDSRTPFPFPLEQTKSP
                     SKRRAQPSTPSSKRRSPVYFTVEDSLFYNAFHADFGPYHIGHLYRFAVHFHEILGDPA
                     NSDRAVVFYSKTDSKSRANAACLVACYMVLIQSWPPHLALAPIAQADPPYMPFRDAGY
                     SQADFILTIQDVVYGVWKAKEQSLCGLREFNLEEYEKYERVDMGDFNWVTPHFIAFAS
                     PQHHPITPIPPTSKEYAALPSTVSEVLASKLPLSFKNVLAHFASRDVGLVVRLNSELY
                     SPSYFTALGITHIDMIFEDGTCPPLPLVRKFIKMAHEMIAKKKGIAVHCKAGLGRTGC
                     LIGAYLIYRYGFTATEIIAFMRFMRPGMVVGPQQHWLHLNQNAFREWWYEDSMKEKLA
                     QMAAPVTPGRQSTKQRVHHVPVATPPSKRAALGEIDHNEVGSHQAEENLPAPTPGQPR
                     KSHRKDSRHHPYARTASGGIAMDKDARRTGEHSSHRNQRLSNDSSESEEEIQLRRLAK
                     RSSKSPVASPSHRSVSYSATITLADDIHEDQENWGETAYGAPKTPKTPKTPVGTKTTS
                     APISVSKVRSSPRRVTDSKSESRGVRKPSGRIGSAGSPVRVK"
     gene            complement(<917727..>919882)
                     /locus_tag="ACHE_20309A"
                     /db_xref="GeneID:66979210"
     mRNA            complement(join(<917727..919598,919658..>919882))
                     /locus_tag="ACHE_20309A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284598.1"
                     /db_xref="GeneID:66979210"
     CDS             complement(join(917727..919598,919658..919882))
                     /locus_tag="ACHE_20309A"
                     /note="COG:S;
                     EggNog:ENOG410Q1ZU;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133373.1"
                     /db_xref="GeneID:66979210"
                     /translation="MNYILTSTTTTERSAPTITTTATTTSIMSQPIVPVDTTANKPPR
                     KRNVITRGRTGCLTCRKRRLKCDENKPGCNNCRRIKAVCEGYNQKITFKDQTNLTVEK
                     VKKAARKKAQASNTAKEDTSSDDTSTFSAEEVPSTAKVTQQQASFPPAQFVDCFVGLT
                     SPETVLNDSFDSQDGLVFQDSLLATPPMSTLDDLLSSPAMISSNTGYMTPTSPASIDF
                     LASPTQVVSNATLSLAGAFEFPEDYTYFQYSAGGSFSSISKILPLAELFQSEPMSSHV
                     YDAAIALAALTLSNSKSQPANARSIRRHAFHHSVKAIQSMQNDLTQTGKLGTSTSSNV
                     LRADAALSLFATTMLAANFELQRNSVLHWYSQMRGAALCLSATYTELMKKNTGMLLIR
                     AFSRMALLLRLYNEEYSVTTPAFMPEHLSNWLNKLLRESSNLHDRILLFVEEVTALEI
                     QKRQHPALETAWAVKSADLLHRLEQWRADLPPSEIPVDDHTGAFLTISSSTTANSSTL
                     IRIPALYFPNSPDPCIAAVNYASYLCTRMRARTRYLHNPHHPPNFLDRILPPETEQTA
                     LTICRIAASKSPSHFADSFTYSYGMLPSVVGAYRWSSNHGLRAWAKNWLMGFRTIREG
                     IWDVSRTLRLIKMMDEQGNGQGRGNGQAFVAIRAIDEPVDPSPEAEEGDREGPFRVVL
                     STRGVEGARSNVIMVN"
     gene            complement(<922510..>925545)
                     /locus_tag="ACHE_20310A"
                     /db_xref="GeneID:66979211"
     mRNA            complement(join(<922510..923396,923456..924127,
                     924184..924357,924407..925089,925148..>925545))
                     /locus_tag="ACHE_20310A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284599.1"
                     /db_xref="GeneID:66979211"
     CDS             complement(join(922510..923396,923456..924127,
                     924184..924357,924407..925089,925148..925545))
                     /locus_tag="ACHE_20310A"
                     /note="COG:Q;
                     EggNog:ENOG410PU7J;
                     InterPro:IPR017871,IPR027417,IPR003593,IPR011527,
                     IPR003439,IPR036640;
                     PFAM:PF00005,PF00664;
                     TransMembrane:8
                     (i12-32o38-60i368-391o411-436i448-464o499-529i597-617o629-
                     651i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_function: GO:0042626 - ATPase-coupled transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133374.1"
                     /db_xref="GeneID:66979211"
                     /translation="MQVIVASESVSSALTFLALLFCLLLYTIVGKMPLEPGVVFTVVV
                     VFNIVNSMFSLSVLGAGQYAQATVSLDRLGKFLDQPEKVACSRYEEANTCETASQDTF
                     ITVQPEPCKAPIQADLEFIAPGLNVVTGDVGSGKSLLLQSLLFDREKVHKTQFEPIAY
                     APQNPWLFRGTIRDNILFGTSFNQERYRSVIKCCALEPDLATFKDHDLKDVGEGGSRL
                     SGGQRQRVALARAVYSNAETVLLDDVLLGLDPKTFEWIVNNCILGPQMRNRTVILVSN
                     NDKLLRRAGMIVYMRNGTVSRTARPKMSEIAVIDDGGVVHFSPVSAVGVVSESDCSEG
                     NNKPCEDNNEKSNDFDNLRGRIGFKYISKYIRSFGCRTFIATMALFTISAQAMDIVLP
                     TWLSVWSRAYSGGSSTHPGFFIGIFTGLGVARILLLTISLILLYSGAWRASRDKHMEM
                     LVVVFGATYAWIWRTPAGQAINRFSSDMASLDDTLFKTLRPVLETYLSIAFRILTVSS
                     LVPLFLLPSIVLTGLALYIGYRYRFASTAVKHMYAGSLTPLHHSISETASGLMTVHAY
                     RAEKVLQDRFNAAVDHHVRAWNGVSDLQRWLAVRMDLCVGLISFSVAVLAVTQRHANA
                     STVGLSLTLTTGLCTSLLYLVYLSSLLEVEMTSYYRIENYIKDLPQELGPCDGSNVTE
                     PEEWPTQGVVHIRNLTAGYSWDENEVLKDVNFSALARERVAIVGRTGSGKSSLALSLL
                     RLATKLRGSITIDGVEIDSLDVEKLRQRISLIPQDPTLFDGTIRFNLDPSSRLPDEHL
                     QTILDDVAGAPNKWRLDDPVEGNGKNFSHGERQLIALARAMVSRNRIVILDEGTASLD
                     KDSEARIHIVLRERFRDCTVIAITHQLHNIVDFDRVLVLDQGRVAEQGNPRDLLSAAG
                     KGWFQSLYMQQHGPHPRPHPRTD"
     gene            <928047..>929413
                     /locus_tag="ACHE_20311S"
                     /db_xref="GeneID:66979212"
     mRNA            join(<928047..928053,928105..928370,928417..928774,
                     928826..929283,929345..>929413)
                     /locus_tag="ACHE_20311S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284600.1"
                     /db_xref="GeneID:66979212"
     CDS             join(928047..928053,928105..928370,928417..928774,
                     928826..929283,929345..929413)
                     /locus_tag="ACHE_20311S"
                     /note="COG:E,O;
                     EggNog:ENOG410Q1J2;
                     InterPro:IPR001563,IPR029058;
                     MEROPS:MER0003541;
                     PFAM:PF00450;
                     go_function: GO:0004185 - serine-type carboxypeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133375.1"
                     /db_xref="GeneID:66979212"
                     /translation="MVGMLLELGPCHINNGGQGTHRNPYSWTRNSSMIFVDQPVGTGL
                     SYTDPGVNIPTTSSIAAEDMYIFLQIFLKIFPERRRVPFHIAGESFAGHYIPTLSAEI
                     IRQNNLHSDRLVIPLNTTLIGNGYISPLDTTYGYYETLCTTKPGVAEPVFNQTRCQII
                     ADTLPRCLYVYEACYRYPDKDLCKATDQVCGTIKELFHNESHAGGRDPFDITRTCEVE
                     HLCYAATLDIQKYINKPTTWRALQVPQEIGGFSIESMRVASAFASGNDLYSPVMDEVR
                     FTLDSGVDVLIYNGNLDLACNTAGNLRWANSLRWNGQADFASKDLKPWYSVNNRGMRK
                     AGSYKEVFAQTGSTERRFAFVTVDHSGHMVPLDQPEVALDLYTKWLFKEPF"
     gene            <930038..>932718
                     /locus_tag="ACHE_20312S"
                     /db_xref="GeneID:66979213"
     mRNA            join(<930038..930186,930237..930385,930436..931227,
                     931274..931515,931563..931901,931956..932087,
                     932143..932328,932386..>932718)
                     /locus_tag="ACHE_20312S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284601.1"
                     /db_xref="GeneID:66979213"
     CDS             join(930038..930186,930237..930385,930436..931227,
                     931274..931515,931563..931901,931956..932087,
                     932143..932328,932386..932718)
                     /locus_tag="ACHE_20312S"
                     /note="COG:P;
                     EggNog:ENOG410PUEH;
                     InterPro:IPR004813,IPR004648;
                     PFAM:PF03169;
                     TransMembrane:16
                     (o73-93i100-122o148-172i184-203o209-228i248-278o284-
                     303i315-337o397-417i454-475o481-500i507-525o531-548i634-
                     652o681-698i710-735o);
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133376.1"
                     /db_xref="GeneID:66979213"
                     /translation="MAEKHGADILVMQEPTLSLRDEGIDLSGRSKELPESRSDTGDES
                     IGEDDLHSPYPDVQASVSDTDEDLPVNTFRAWLLGVVGTIVLTALNQFFQLHNPPLFL
                     SAYIAIFATLPCGKLMAATLPTKVWDVFGFEFTLNPGPFNQKEHSIVAIMASLVTAFD
                     NGSLASDVYVAFDKFLNIPISAGYRFMFLLSTQALSFGIAGLFHRFLVEPAFCVWPAT
                     LPICSLLYTFHEKRTQKQEINGWKISRMGFFSIIVVCGAAYQFVPGFLFAGLTTFAWI
                     TWIVPKNVTVNQVFGATSGMDLLPLTLDWNQITGYLGSPLLVPSWALVNVFCGSVFFL
                     WIVSPALHWSNVWQGLYMPFSSSGNFDNTGKLYNTTRVMNPDYSLNEAAYYDYSPVYL
                     ATTSALSYGLGFAAVASIIVHTILYHRQAVWQGLLATFGLFSQPQKPDIHAKHMQKYK
                     QVPMWWYLTIFLSIFGISIAFLYVYNTSLPWYGLILAIAVNVILLVPTGIMKAICNIQ
                     LSTAVISAFIAGYIWPGQMMNNVVFKIFTLVSSAQGLGYIQDMKIGHYMKIPPRVTFA
                     AQCTGILVSWLTQTAVNLWAMGNIEGICTPNASNNFTCPLAQGYATNAVFWGLIGPKR
                     LFSEGSMYRPMLWFFLIGAILPIIFFFLDRYFPKLRLRKIHLPAVFASTASIPPATAA
                     NYMAWGLVGLLFNGYIKRKYYAWWMRYNYILSAGLDAALAIGSFLIFFCLIYPGVNVE
                     WFGNSIATQTADGAGTPLRRVSEGETFGVKTWK"
     gene            complement(<933011..>933820)
                     /locus_tag="ACHE_20313A"
                     /db_xref="GeneID:66979214"
     mRNA            complement(<933011..>933820)
                     /locus_tag="ACHE_20313A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284602.1"
                     /db_xref="GeneID:66979214"
     CDS             complement(933011..933820)
                     /locus_tag="ACHE_20313A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133377.1"
                     /db_xref="GeneID:66979214"
                     /translation="MFRFLFRNPKAAEDWHAHLRRNPNRQKMLKCLLSDISFSDKRTI
                     LNVFLQACVENRQKWKLPQDPKKLAYKKQSKLLWLESKLDEAGHIKMAQFIRFALYNE
                     EDNESDMDWCSRIIRADVKARWLVQREAYLIEEVQALHKSLSLLPLNADEAVCAAAAT
                     QAEFKLKMYEKELRLLDNAYGPTRNTSGSLKPVSLYQQLDEPMKRAGRTSQIGIYPNG
                     CAATVLAVGGAVDGVAGAVKRREAIRTGNGSMVIVRVPVGAVCVQRDLGKW"
     gene            <934054..>934864
                     /locus_tag="ACHE_20314S"
                     /db_xref="GeneID:66979215"
     mRNA            join(<934054..934423,934476..>934864)
                     /locus_tag="ACHE_20314S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284603.1"
                     /db_xref="GeneID:66979215"
     CDS             join(934054..934423,934476..934864)
                     /locus_tag="ACHE_20314S"
                     /note="COG:S;
                     EggNog:ENOG410PZS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133378.1"
                     /db_xref="GeneID:66979215"
                     /translation="MTPRELTPEEWRGRLHQNPKPPELLEPLHSLDAKDKNIAEFLEI
                     SQDKTNNESTDKDNEAKEIADLEYLARALANTGDGVYAQEIRLLLFKRQLVAEIEQNL
                     LWAQNIIEADIKGRYRVEGKFYKLGEFGFEVKDKEEKETQLAVYKAELQLLNDEYWQD
                     NEHVWRLEANTTLGPMRRAYKACRRKPDWHLSEWLRRDCAGRGGCYGRKCRCCEKARE
                     TRGKGILGTALVHAGAVLRVKGALLRGRRQWKRI"
     gene            complement(<935268..>935919)
                     /locus_tag="ACHE_20315A"
                     /db_xref="GeneID:66979216"
     mRNA            complement(join(<935268..935451,935501..935716,
                     935789..>935919))
                     /locus_tag="ACHE_20315A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284604.1"
                     /db_xref="GeneID:66979216"
     CDS             complement(join(935268..935451,935501..935716,
                     935789..935919))
                     /locus_tag="ACHE_20315A"
                     /note="COG:O;
                     EggNog:ENOG410PG37;
                     InterPro:IPR001841,IPR013083;
                     PFAM:PF17123,PF13923,PF00097,PF13445,PF13639;
                     TransMembrane:1 (o25-49i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133379.1"
                     /db_xref="GeneID:66979216"
                     /translation="MSSSSPTPQTDHNKNNNAGLNKQHLIIALAVGLSVVTLIIMCLL
                     LSIFVNNRHSNSDNSEHRRFRPSRSKKPKKSPSERRLRKLDAESPICTLEEWWSRAKI
                     PPLPSDDECDQFTCAICLDSVLRSHEIRDLKCLHVFHRECLDKWYLQDQFHCPLCHRA
                     YFKQQFQPTNEFVWMV"
     gene            <937605..>939415
                     /locus_tag="ACHE_20316S"
                     /db_xref="GeneID:66979217"
     mRNA            join(<937605..937786,937845..937956,938009..>939415)
                     /locus_tag="ACHE_20316S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284605.1"
                     /db_xref="GeneID:66979217"
     CDS             join(937605..937786,937845..937956,938009..939415)
                     /locus_tag="ACHE_20316S"
                     /note="COG:K;
                     EggNog:ENOG410PN62;
                     InterPro:IPR017970,IPR001356,IPR009057;
                     PFAM:PF00046;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133380.1"
                     /db_xref="GeneID:66979217"
                     /translation="MSEPNATVTTCSSPPSVPPSDATAAALNYAFLVHSQKTLTQNLP
                     PRVDNKLLARQKRRRTSPEDHAILEAEYQRNSKPDKTARADIVNRVSLGEKEVQIWFQ
                     NRRQNDRRKSKPLQPHELLAPRAIADHLRNDDNVSAERSTVEQGDLDNAPSSDVLQSS
                     FESDPVSGAEDKDEQERSIQSSQTSLDSETSEAPQQLNEEAAAAEPEPEPVENPEIPA
                     DASQLNITKRKRSVTDLRGDASESQPAEKDASKDFKSPPSLRISLSFDGEAMVRKEGE
                     MTPSPPKGRNALRISMSSDGKAVIRTDDEPSPSKNRISMFSTRKSRFAGLRRSNSAIL
                     PATPRVASSEKERMFGRSRDPRNWESVFDTDARSALSTPGSAQSAPHSTPGLLRSQGQ
                     RSLTRSLSSRQNAFANNSPSHPDTPVPLQTGDKRRKLSRTVSSLGRLESNRANALGQV
                     SGNSLKMPKLFGNSKKNNEDFEFHNGDSDKENWIPGTRISNVRRRTMSSNMQRPALKD
                     TNSKSRRSRLSQAHQQRKAAPEVDPEVSAFMTNGSSASQEEDLDCIQGLLSLSQGAWR
                     "
     gene            <940065..>941733
                     /locus_tag="ACHE_20317S"
                     /db_xref="GeneID:66979218"
     mRNA            join(<940065..940190,940250..940287,940346..940734,
                     940787..>941733)
                     /locus_tag="ACHE_20317S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284606.1"
                     /db_xref="GeneID:66979218"
     CDS             join(940065..940190,940250..940287,940346..940734,
                     940787..941733)
                     /locus_tag="ACHE_20317S"
                     /note="COG:Q;
                     EggNog:ENOG410QEHX;
                     InterPro:IPR002937,IPR036188;
                     PFAM:PF00070,PF01593,PF13450;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133381.1"
                     /db_xref="GeneID:66979218"
                     /translation="MGKTPRVAIIGAGVSGLRCADILGQNGAQVTIFEARDRVGGRVA
                     QSKVGDHLVDLGPNWIHGGQDNPISVIAESTKTELEDFDEYQIVFSKDGKPLDDKLAA
                     KVSDFVWTTIGEAFEYSNTYKDSIPSGRSLFDFFQERVEKKGFNEEEKEACLESCRLW
                     GSYVGDPVERQSLKFFCLEECIDSSNCFVSSTYQKILEFVSKAALKYANVRFKQPVVG
                     IEAEPRGNKADHQVILSTADGQKYEFDEVVVTCPLGWLKRNKSAFAPDLPPRLIRAIN
                     NISYGRLEKVYVTFPQAFWHTERADHKPPNFAMFLDPKYSNHPKDIIWNQECVSLATL
                     GPQAHSTLLFYIHGPCASHVVSNISNLSPSSPEYYDYLNDFLHPFYSRLHGYSAASPD
                     CKPLAFLATQWQTDPYAGNGSYSNFQVGLEQGDKDIEVLRDGAGIGEERGVWFAGEHT
                     APFVALGTTTGAYWSGERVAGRVCQIYGLDGIGIGTERDDSLPSQIPIT"
     gene            <942126..>942920
                     /locus_tag="ACHE_20318S"
                     /db_xref="GeneID:66979219"
     mRNA            <942126..>942920
                     /locus_tag="ACHE_20318S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284607.1"
                     /db_xref="GeneID:66979219"
     CDS             942126..942920
                     /locus_tag="ACHE_20318S"
                     /note="COG:S;
                     EggNog:ENOG410PZXY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133382.1"
                     /db_xref="GeneID:66979219"
                     /translation="MDNSTQNQPFFPIPRDQVPWLLFRVEHRLSSSYGTLSAQARIAR
                     IVTPPSPDDFDRHLLNSKDFLTPFLSYFSNFRRALSLYRAFRLEGRHEVTITALWARD
                     MANIYNAESIAQSLGFRDGDGANPRRMLRDHIGEFLIHGGIVDTCRILTVFRGMNAPQ
                     TPTPTPVTPGPITIREVDVVFECDAYQAVATLPEGFLPSSLQDNALRALDEEIYRRTG
                     VLNDFWRDMVVSAVMGRPVNWAGRFMGAEQMGFLFGDTGQRKGEGI"
     gene            complement(<944384..>945037)
                     /locus_tag="ACHE_20319A"
                     /db_xref="GeneID:66979220"
     mRNA            complement(join(<944384..944941,944999..>945037))
                     /locus_tag="ACHE_20319A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284609.1"
                     /db_xref="GeneID:66979220"
     CDS             complement(join(944384..944941,944999..945037))
                     /locus_tag="ACHE_20319A"
                     /note="COG:Z;
                     EggNog:ENOG410PMJ4;
                     InterPro:IPR001451,IPR011004;
                     PFAM:PF00132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133383.1"
                     /db_xref="GeneID:66979220"
                     /translation="MPPKAFKGDYIETDTGNKISRRAQIHGTQRIILGGKTVIQTDAV
                     IRGDLYRSSSSHASTDDPASAAPSPSVAITVGRYSYISKQAILRPPSRLHRGVHSYYP
                     LKIGDHVFVGERAVVEAASVGNHVHIGKEAVIGGMAILKDFAVVLDGTVVPAGMVVPS
                     WCVVGGRPARIVGEVGEGYGVEGADGGLARERYRLVGR"
     gene            <945658..>945990
                     /locus_tag="ACHE_20320S"
                     /db_xref="GeneID:66979221"
     mRNA            <945658..>945990
                     /locus_tag="ACHE_20320S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284610.1"
                     /db_xref="GeneID:66979221"
     CDS             945658..945990
                     /locus_tag="ACHE_20320S"
                     /note="COG:M;
                     EggNog:ENOG410PJJV;
                     InterPro:IPR020683,IPR036770;
                     PFAM:PF13637,PF12796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133384.1"
                     /db_xref="GeneID:66979221"
                     /translation="MDGEAEIVKELLLRGADPSLPLYEDLEPPLLKAILRGHNAVVDV
                     LLADPRADHDVRFNDRIDIQGTQTALQEAAKKGNAHVVRCPLEKGACARPNVETTMHS
                     AVITAARR"
     gene            complement(<946641..>950232)
                     /locus_tag="ACHE_20321A"
                     /db_xref="GeneID:66979222"
     mRNA            complement(join(<946641..948827,948878..949109,
                     949160..949364,949417..949756,949816..>950232))
                     /locus_tag="ACHE_20321A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284611.1"
                     /db_xref="GeneID:66979222"
     CDS             complement(join(946641..948827,948878..949109,
                     949160..949364,949417..949756,949816..950232))
                     /locus_tag="ACHE_20321A"
                     /note="COG:Q;
                     EggNog:ENOG410PGWA;
                     InterPro:IPR010255,IPR034812,IPR036396,IPR037120,
                     IPR019791;
                     go_function: GO:0004601 - peroxidase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133385.1"
                     /db_xref="GeneID:66979222"
                     /translation="MLRRFSTNFKKSKGDKEERREAKENGQVNGKRHSLVAPIRKSNS
                     SPPSTEEEETPQGATRNGVQSSFEKFSQVIHASQTPLPRQTGDATFLEQDTTQGLFGD
                     IKALGFRDVNTLKDLIKSKASGELVDDKTMLMERIIQLVSGLPAGSKNRVELTNLFLD
                     ELWNSLPHPPLSYMGDDYQYRSADGSNNNPTLPWLGAANTAYSRSIPPLTVQPSGLPD
                     AGLVFDSLMAREKFNPHPNKVSSLFFDWASLVIHDIFQTDYRNPNINKTSAYLDLAIL
                     YGDVQEEQDLIRTHKDGKLKPDAFSEPRLQAFPAACCVLLVMLNRFHNYVVEQLALIN
                     ENGRFTKPSPKLPEEEAKKAWAKYDNDLFQTGRLITCGLFINITLYDYLRTIVNLNRS
                     NTTWCLDPRSHMEKEGSTPQGMGNQCSVEFNLAYRWHSAISANDEKYTEQIYRELMGK
                     PAEEVSIPELLIGLGKYEANLDRDPAKRTFAHLERQEDGTFRDDDLVNILSDAVEDVA
                     SSFGARNVPKALRAIEILGINQARRWNVGSLNEFRKFFGLKAYESFEEINSDPDVANS
                     LRHLYEHPDFVELYPGIVSEEAKEPMIPGVGIAPTYTISRAVLSDAVALVRGDRFYTV
                     DQNPRNLTNWGYSESRYDLSVNQGCVFYKLCLRAFPNHFKPDSIYAHYPMTIPSENRN
                     IMKNLGRESHYSYDRPTYTPPKVNLSSYTNVKRVVEQPTDFRALWGEVPAFVFGKTGY
                     EQLLAGDSSFGTQQKEAISQALSSEEWNKQVKTFYEDITLQLLREKSGRLAGRNQIDI
                     TRDLGNLAHTHFAANVFSLPLKTADNPKGIFTEHELYMALAAIFTSIYFDVDPAKSFP
                     LRHASHAVVQQLGQAVESSLKGSSGFLGGFLGGSRKATNALAEFGAKIIKQLLDSGVG
                     ASEVTWAQIIPAAVGMVPNQGQAFTRIIDYFLSADGAQHLPEINRLANENTPGSEEKL
                     RRYVLEAIRINGAFGAYREAQTSAILNDNGREISINPGDKVFVGFSGANHDAEAFPEP
                     NQVRLDRPLEAYIPFGVGPHASLGKDTSLIALTTMLRVVGGLPNLRRAPGPQGQLKKV
                     QAEEGYTAYMREDNSGYFPFPMTFKVHFDGEIPGPKHR"
     gene            <953801..>955697
                     /locus_tag="ACHE_20322S"
                     /db_xref="GeneID:66979223"
     mRNA            join(<953801..953920,953979..>955697)
                     /locus_tag="ACHE_20322S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284612.1"
                     /db_xref="GeneID:66979223"
     CDS             join(953801..953920,953979..955697)
                     /locus_tag="ACHE_20322S"
                     /note="COG:S;
                     EggNog:ENOG410PJGE;
                     InterPro:IPR018712;
                     PFAM:PF09994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133386.1"
                     /db_xref="GeneID:66979223"
                     /translation="METAPLGPAPIPKQFVLCFDGTGNKFAGDESDSNVLKIFRMLDR
                     SKSHQFHYYQPGIGTYVTSKSFSHTGRFQRIKSAYLKAKDSAVGSSFAEHVMGGYKFL
                     MRYYSPGDEIYFIGFSRGSYIARFLSEMLDCIGLLEAGNEELTRFAWKTFAKWQQRRG
                     DTEEDRKEKEKLFLFMKAFRETFSRPVTRIKFMGLFDTVNSVPSFESAWMQRSKFPYT
                     ARSSARVIRHAVGIDERRAKFRQDLISGAKPQAKKSKSRHAWGNLQHHLHLEKSHEDL
                     PAIVVNDGTNGASQATPDQRNHNGSTSMRRSSYNSHAASSPNNNADHRYRAPATYLKP
                     RPNLAIPTVASAEDLASVKSGQSGLSLQIPIEDDQEQDIQEVWFPGCHADIGGGWKLE
                     KDEKWPLSHPPLVWMVQEAWRAGLQLDPRKVKQFECMEEFDGEFSPIRENGWNEDTEN
                     GDAGVKLAGPCGDEKERSPSSRDFHAALHLGSTKGWIHDCLSFGNGLPAASVIIWRLM
                     EYLPFRRMDLQPDGSWKPIRWPLPCGEVRDIPLDAQVHVSVIRRMEANPDYRPGNLIV
                     GGGGRGVRKAPEEYGMGDWVVKDHEGDPVRQVYVRKSVSKCQENHQ"
     gene            <956852..>957871
                     /locus_tag="ACHE_20323S"
                     /db_xref="GeneID:66979224"
     mRNA            <956852..>957871
                     /locus_tag="ACHE_20323S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284613.1"
                     /db_xref="GeneID:66979224"
     CDS             956852..957871
                     /locus_tag="ACHE_20323S"
                     /note="COG:S;
                     EggNog:ENOG410PRRF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133387.1"
                     /db_xref="GeneID:66979224"
                     /translation="MSSERFMSPPSPVESVDSFDSGPAATTANRDTATESTGKTKRSD
                     DVMVTLSLPPQPAMTPRSRSPLARSHFRSRSLAEVPNMPPMTRAYSSPGLDSRGRYIF
                     VNGRGAPISNPLENGKRHPFLQVATGDALESRMAPLKISEPIAEHAELDTAMNPSSQT
                     DAESAHAVSPAISTHHTFPRMGRRRPSSPLHFHPGNASSPGPFPVYSSSPVMLGSKYN
                     EAFPSYSSSSASSMPSTPTSLRSRSPSISSLETIPDIPDAEAAASEADQVAALKAAAD
                     RIDDGEASGAGNRRRGTSDAMGPAGSLMGMRGGYGVRADKRKRWSVCGAERRQDLDLE
                     TIWED"
     gene            complement(<958521..>959955)
                     /locus_tag="ACHE_20324A"
                     /db_xref="GeneID:66979225"
     mRNA            complement(join(<958521..959537,959614..>959955))
                     /locus_tag="ACHE_20324A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284614.1"
                     /db_xref="GeneID:66979225"
     CDS             complement(join(958521..959537,959614..959955))
                     /locus_tag="ACHE_20324A"
                     /note="BUSCO:EOG09263SFX;
                     COG:D;
                     EggNog:ENOG410PMZ9;
                     InterPro:IPR036915,IPR031658,IPR043198,IPR006671,
                     IPR013763;
                     PFAM:PF00134,PF16899;
                     go_function: GO:0016538 - cyclin-dependent protein
                     serine/threonine kinase regulator activity [Evidence IEA];
                     go_process: GO:0006357 - regulation of transcription by
                     RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133388.1"
                     /db_xref="GeneID:66979225"
                     /translation="MIEDDIYRTSSQFRIWSFTEDSLKQLRATTNTIASERVRAALRR
                     AREARQSAAPSAVGTPTANQSGSEADGKGAEERIIECLTPEEEQELVRYYCEKTVELG
                     ETYKPPMPTIVRATAIQYLRRFYLTNSPMTYHPKSIMACALFLATKTDNYYMSLRQFA
                     AGIPGDTTQEDVIAPEFLIMQSLRFTFDVRHPFRGLEGGIMELQAISQGLGQPSPLQP
                     QQTPEDLRRGLSSIPPAPNASSSQSLNDRLARAHHTTREILKSAAQMTDTYFLYTPSQ
                     IWLSAFFLADKPLAEFYLDTKIGGPPATDPDSPLSTLRTKLLTILTNCSNLLSAYKPL
                     STDPEQMKTLRRIAKKLYHCQNPEKANIAGQKRIPAAATSSGAATAAGTPAAGGGSGE
                     SGASESEMERLAKKRKLEGGGSSGTKADDMFGGELVTQRNKQQNKQQNKQQGPTSHPE
                     AG"
     gene            complement(<960316..>961158)
                     /locus_tag="ACHE_20325A"
                     /db_xref="GeneID:66979226"
     mRNA            complement(join(<960316..960490,960552..960835,
                     960898..>961158))
                     /locus_tag="ACHE_20325A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284615.1"
                     /db_xref="GeneID:66979226"
     CDS             complement(join(960316..960490,960552..960835,
                     960898..961158))
                     /locus_tag="ACHE_20325A"
                     /note="COG:O;
                     EggNog:ENOG410PI5J;
                     InterPro:IPR000608,IPR009060,IPR016135,IPR023313,
                     IPR015368;
                     PFAM:PF09288,PF00179;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133389.1"
                     /db_xref="GeneID:66979226"
                     /translation="MASHRSRRITKELADIHADSQSQIGAEPVGGDEDITHLRGSFPG
                     PPGTPYEGGTYYIDIRIPLEYPFKPPVMKFETKIWHPNVSSQTGAICLDTLSSAWSPV
                     LTVKSSLLSLQSLLNTPEPKDPQDAEVAKMLLHNPKEFERVAQQWAVMYAGAPQNNAA
                     EGSAGESLRGQEQGQQKDDLAKYDGYNKDLIDRFCSMGFDVERVVGAFKYVGIDRSDG
                     EDYELGEEEMGDITARLLGES"
     gene            <961790..>963371
                     /gene="RPT2"
                     /locus_tag="ACHE_20326S"
                     /db_xref="GeneID:66979227"
     mRNA            join(<961790..961792,961863..961928,961998..963066,
                     963118..>963371)
                     /gene="RPT2"
                     /locus_tag="ACHE_20326S"
                     /product="ATPase of 26S proteasome regulatory subunit 4"
                     /transcript_id="XM_043284616.1"
                     /db_xref="GeneID:66979227"
     CDS             join(961790..961792,961863..961928,961998..963066,
                     963118..963371)
                     /gene="RPT2"
                     /locus_tag="ACHE_20326S"
                     /note="COG:O;
                     EggNog:ENOG410PICC;
                     InterPro:IPR041569,IPR003960,IPR003959,IPR027417,
                     IPR003593,IPR032501,IPR005937;
                     PFAM:PF16450,PF00004,PF17862,PF07728,PF07724;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0030163 - protein catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ATPase of 26S proteasome regulatory subunit 4"
                     /protein_id="XP_043133390.1"
                     /db_xref="GeneID:66979227"
                     /translation="MGNQQSNIGGGPGGDGRDEKDKKKDKPRYEPPPPPTTRIGRKKR
                     KAAGPSTAAKLPDIYPTSRCKLRYLRMQRVHDHLLLEEEYVENMERMRKAKAQATQGP
                     VSQGDLDIMDRNADERSRVDDMRGSPMGVGNLEELIDDDHAIVSSATGPEYYVSIMSF
                     VDKDLLEPGASILLHHKTVSVVGVLTEESDPLVSVMKLDKAPTESYADIGGLESQVQE
                     VRESVELPLLHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSE
                     LIQKYLGDGPRLVRQIFSVAAEHSPSIVFIDEIDAIGTKRYDSSSGGEREIQRTMLEL
                     LNQLDGFDDRGDVKVVMATNKIETLDPALIRPGRIDRKILFENPDQNTKKKIFTLHTS
                     KMSLGDDVDLDEFINQKDDLSGADIRAICTEAGLMALRERRMRVQMDDFRAAKERIMK
                     TKQDGGPIEGLYL"
     gene            <963627..>965420
                     /locus_tag="ACHE_20327S"
                     /db_xref="GeneID:66979228"
     mRNA            <963627..>965420
                     /locus_tag="ACHE_20327S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284617.1"
                     /db_xref="GeneID:66979228"
     CDS             963627..965420
                     /locus_tag="ACHE_20327S"
                     /note="COG:O;
                     EggNog:ENOG410PK80;
                     InterPro:IPR036322,IPR015943,IPR019775,IPR001680,
                     IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133391.1"
                     /db_xref="GeneID:66979228"
                     /translation="MTMDGFDEETFKQFFPTSFGKQTRTTNINAQIDRTKRSEVSVKP
                     DGDDTKKELTDSAGADTRGEFETRPEEQEARDDDDDDSDDNDSDEDDEDEFPISHELL
                     IKTHERAVTTMTVDPSGSRLITGSNDCSIKLHDFASMTPTTIRAFKSVDPSVKKQSAA
                     QETHAVHYAAFNPITPSHVMVVPATPQPRILDRDGETLVEFVKGDMYLRDLHNTKGHI
                     SEVTSGAWNPTDYNLCVTAGTDSTVRIWDANVGRSQKEVIVHKSRVAGSAGRSKMTAV
                     AWGSPKQGGSNILVAAALDGSLLMWGGNGPFNRPSGEIRDAHTRDTWTSGLDVSSDGR
                     LVISKGGDDTIKLWDTRKFKQPVTTAHHPSSSTRYPTSNIIFSPTSANVLTGSETGHL
                     HILNPATLKPELVTPVTPGSPLITVLWHEKLNQILTGSANAETHVLYNPKTSTKGAAM
                     VMSKAPKRRHVDDDPNLTMDLSQGLSGENVVVGSNGIPHYSSSTWSARHPTIGLTASG
                     RPKDPRRPHLPLQTPFAKSQPDERHIRENIPLSSMRDEDPREALLKYAEKAEKDPIFT
                     KAWKETQPKTIYREVSDDEEEQQPDKKKARR"
     gene            <966642..>967854
                     /locus_tag="ACHE_20328S"
                     /db_xref="GeneID:66979229"
     mRNA            join(<966642..966833,966954..967010,967166..967212,
                     967264..967362,967411..967518,967578..967657,
                     967769..>967854)
                     /locus_tag="ACHE_20328S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284618.1"
                     /db_xref="GeneID:66979229"
     CDS             join(966642..966833,966954..967010,967166..967212,
                     967264..967362,967411..967518,967578..967657,
                     967769..967854)
                     /locus_tag="ACHE_20328S"
                     /note="COG:P;
                     EggNog:ENOG410PKTG;
                     InterPro:IPR011008,IPR006314;
                     go_function: GO:0004601 - peroxidase activity [Evidence
                     IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133392.1"
                     /db_xref="GeneID:66979229"
                     /translation="MPPSSSLSWRKWPTKSSHPASSAQDMRTETFFYNSARRQGKITG
                     PPVLQIAGVNTTFSYGGLAKLGKEGLQGLAFRDGQFHSMVEIIHGEDLKTRGNEHFGF
                     KDGIAQPQLEGLNDPRANTRKKSFRSTPPGVIITGRGRGHNEPDWAKDGSYMASRKLR
                     HFFLEFKDFLQRETSRLGYAPEQLGTRLVGRWESGAEKDDFHFTKNDQSECPFAAHIR
                     KARP"
     gene            <967909..>968336
                     /locus_tag="ACHE_20329S"
                     /db_xref="GeneID:66979230"
     mRNA            join(<967909..968048,968108..>968336)
                     /locus_tag="ACHE_20329S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284620.1"
                     /db_xref="GeneID:66979230"
     CDS             join(967909..968048,968108..968336)
                     /locus_tag="ACHE_20329S"
                     /note="COG:P;
                     EggNog:ENOG410PKTG;
                     InterPro:IPR011008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133393.1"
                     /db_xref="GeneID:66979230"
                     /translation="MRRGIPYGAEATDEELAQKKTIMDRGLLFACYQISLRAGFEFIT
                     NGMFNNDYFPPRTPVQPGADSIMTNSVKNATNEDKKLFMNIVDSKQQAKKIEFDPFVE
                     SHGGAYLFMPSLDLLREMAH"
     gene            <969290..>971729
                     /locus_tag="ACHE_20330S"
                     /db_xref="GeneID:66979231"
     mRNA            join(<969290..970226,970285..>971729)
                     /locus_tag="ACHE_20330S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284621.1"
                     /db_xref="GeneID:66979231"
     CDS             join(969290..970226,970285..971729)
                     /locus_tag="ACHE_20330S"
                     /note="COG:S;
                     EggNog:ENOG410PJBB;
                     InterPro:IPR008521;
                     PFAM:PF05653;
                     TransMembrane:9
                     (n8-17c22/23o46-68i182-203o209-229i238-256o276-295i302-
                     318o330-349i370-389o401-419i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0015095 - magnesium ion transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0015693 - magnesium ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133394.1"
                     /db_xref="GeneID:66979231"
                     /translation="MGHTQEPLAAGLLAGFVSTIVPSSVPSNQTLSDGHGSGGAGRMH
                     EWSSLIGIITALAGNVLISLALNIQRYAHIRIDKEWMRDRIQRESNWKRSHPGRDAAG
                     ANGTAEEYHDEPRGRHHEPTFEPYRDESPDLQHAREGSSRARNQQGEQSASHGGLQES
                     IFSDQTIQPEDKTHRKSYLRSPYWWVGIVLMVLGETGNFMAYGFAPASIVSPLGVVAL
                     ISNCVIAPFMLKEQFRKRDLLGVFVSIAGAVVVVISAKSSEEKIGPHDIWVMITQWEF
                     ELYLGLTAGLIVALMWTSAKHGSQTILIDVGLVALFGGYTALSTKGVSSLLSYTLWHV
                     ITFPITYLLVFVLVFSALMQIRYINRALQRFDSTQVIPTQFVLFTLSVIIGSAILYRD
                     FESFGAQRAGKFVGGCLMTFLGVYFITSGRVRADDESTYSADDEEQAIGLLAGERYHD
                     NVDVSPPGPESRIHKSLQRVPEAHDEEPSSPRGSLLSQGIDGFEDDHPTPRGILSAAP
                     SLEDSLTTGSLRAPSPEPPHSLITNPWADSQERLVDSPASEPQIRPVTPPEQTPDQTM
                     GSTVLLRFPPAPGAESNAPQNDDSEAPEADPAQPAAPETPPARRMRNSISMRFSPGPL
                     LPALSGGFSAVVAESLRRGESSPVKERKGRRRTDRRKQLSTTVLDGALRRAGESREAE
                     YDSDGAVDENQDSPFNVSTGRLNSTGGIPTGPSTPAPPRGINRGHQDNNEDVSSLNRL
                     RSLSDSWSGGPTWLGGLLRRGSKQHQQPPINESAIYGDESEQQSTASGNTHQQ"
     gene            complement(<972327..>974324)
                     /locus_tag="ACHE_20331A"
                     /db_xref="GeneID:66979232"
     mRNA            complement(join(<972327..973940,974008..974133,
                     974193..>974324))
                     /locus_tag="ACHE_20331A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284622.1"
                     /db_xref="GeneID:66979232"
     CDS             complement(join(972327..973940,974008..974133,
                     974193..974324))
                     /locus_tag="ACHE_20331A"
                     /note="COG:S;
                     EggNog:ENOG410PKE0;
                     SECRETED:SignalP(1-36)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133395.1"
                     /db_xref="GeneID:66979232"
                     /translation="MASQLGFTISFLVFSLFKHSCIPSLICDLNISLAVAMETAPLTL
                     AHTHARNAVLETRKANPVAASEEHDLAAGEFSTAANTSSDREALRTLQLLERHHKKLA
                     EILRFQHENPSSASAAETTSSPATTPGLNAQQPVAQQPPRLSGNKRLSTREASSSIAS
                     NLASARGIPSHPRRASPASPTLSSQQAGAKMTDSPPRARTGESKLRGTQYYPTKDRTG
                     RVSAPKQPWSPPSISPTDITSQQVVPVDAVDSPRQKRITEEPFQRFYSTFEGLISKIS
                     APLAFAGLPLGTDANQAESTKGKSSAETRLDRQQAISDRPSTSTEPDVSKIFSKAALR
                     AVRDGTNGAPNTTAESFYVVPTTGGTVSYAGILSRAEKEARRNSFEEVDEDFVDARET
                     PSPEMRHSMTGAKSRVARGADKLTSLQNPKTLEELQMENQALKHLSDTLSKRLHMWEV
                     NAQSSSMALQQSIRAMHHLPSPEHHPLPAPSGGSAATSPIAPLTAGPSTTDHEQRIKE
                     LEELVRTSEKELGQAGRENEKLRNVLGRYRERWEKLKEGAKTRRETQAQAAQQSRDEN
                     AAAAPTTSTPAAAVAPVDDDKTTHLGAQEDHETSSRPNENADDSAEQEHQSKDVSED"
     gene            <975037..>978905
                     /locus_tag="ACHE_20332S"
                     /db_xref="GeneID:66979233"
     mRNA            join(<975037..975452,975548..976722,976783..>978905)
                     /locus_tag="ACHE_20332S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284623.1"
                     /db_xref="GeneID:66979233"
     CDS             join(975037..975452,975548..976722,976783..978905)
                     /locus_tag="ACHE_20332S"
                     /note="COG:S;
                     EggNog:ENOG410QDV2;
                     InterPro:IPR031968,IPR011993,IPR040147,IPR004182;
                     PFAM:PF02893,PF16016;
                     TransMembrane:1 (o1091-1110i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133396.1"
                     /db_xref="GeneID:66979233"
                     /translation="MENPPTAKELPPAPLLSEPLNISKISRTRTTPVDLDTMDSSGRS
                     NGRSSIDSTSERPKSQSGEAADTARAGPSGFSKLLRRKKNKKNQKQTDEQSTDNDRDI
                     PGSRDGDYAASLFANDNNPLPENEAGTLLADDSELDRSLQNSSSNNGINTTSSPLIQT
                     TSIDATDTEGVQADVESAVSGPSATASDSNPDADPSKSATQNPSTLEIPESRTGGKRR
                     GTSPGRRFKNAFSSSAQDKKDTEGGRERSSSTSSKRSMTLFGGNGRRGSLSAKRAQTS
                     HGIVAEPPPPLPPIRTDLTEDKPSELSERPRTPPHTALPVPAPHTTVTPPTPSEHRLE
                     FPKLIDSPEVTSSPESITPGEGIVVSPSGNMISHRRVRSASSAHRPSKLSNSISVSPT
                     IEEVKSSSRNPSAAQQAGFFSSMFSAAQNAASTLSSSLNNQPRNPSQLDSTTNASQTN
                     SGAEDAKGDSNNSNGEEKRSLAIETLGSGDLDFSHLEVNVPPGGSVSTPDGIVITKPD
                     LPPEKRKNMAVYQRDEEAAMLEVPPTDEPLELGSTTSLPKDFGGDQPPPSGDILDADL
                     GTRSRRSPSLRGRLIGRHRGSSAATTSSTVGALAGAGAVALAAPGATPSVPRSTGFAV
                     AGKKRNRDFHQLFRSVPEDDYLIEDYSCALQREIILAGRIYVSEGHICFSSNILGWVT
                     TLVISFDEVVAIEKESTAMVFPNAIAIQTLHARHTFRSLLSRESTYDLMVNIWKINHP
                     ALKSSINGTRVSHGTGDKTEKAGESDVESDEDNEEDEIYDEDEDGDTVDSFVEAASVN
                     GSEPTNPRKALSRQASGNIPKASANGPDAGDNGNSASGDTDFPGPATHAPTEYTDPNG
                     QYDKVVKDEVIPAPLGKVYSLVFGPASGAFVPKFLVDNQKSGELQFSSEKQGLTNDSR
                     NREYSYIKPLNGSIGPKQTKCISTEYLDFLDLEKAVLVTLTTQTPDVPSGNVFSVKTK
                     YLFTWAAGNQTRFLMTCTIEWTGKSWLKGPIEKGAIDGQSGFGGDLIQAIKGAIAPRA
                     RPGTAKPGKGKGKRKKGDAAGQEPAPAIAATDATASKADSWGILEPLQGVLEPVMEIM
                     KPLVSGNVAIAIIGILLFLLFFRTPFRSTVPSSHDIGCPGYTLPQRLAAYEEMWRREE
                     SELWSWLEDRVGLEGALFPMVRPSVSPLRQKAQQLRAERELSAKMSDDKMTDREMDAA
                     IRTTRERLDALEDILNKRKAHSIVEEVQSRHEL"
     gene            complement(<979904..>982035)
                     /locus_tag="ACHE_20333A"
                     /db_xref="GeneID:66979234"
     mRNA            complement(join(<979904..980658,980706..980780,
                     980831..981226,981279..>982035))
                     /locus_tag="ACHE_20333A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284624.1"
                     /db_xref="GeneID:66979234"
     CDS             complement(join(979904..980658,980706..980780,
                     980831..981226,981279..982035))
                     /locus_tag="ACHE_20333A"
                     /note="COG:S;
                     EggNog:ENOG410PI25;
                     InterPro:IPR021369;
                     PFAM:PF11204;
                     TransMembrane:5
                     (o386-412i419-436o448-464i542-567o573-597i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133397.1"
                     /db_xref="GeneID:66979234"
                     /translation="MDRIEPVGGPDDRPNGAPFPAFDNNSLTPTAHTPRPRALSRSRR
                     PSIRLSRLSSVSSLGSSGDDPNQNPQNSNRRTAADDSATAFLTRNRSPGPGREHTQIE
                     EEDESWQGSRRRSSSEPRPGRWSSPSPVALSRIATPMLPLAEVRTNQSRGPRSPSERQ
                     DNNLESNPENPQNDNHEDSEKLAVRPPPVVRPRADSRLRRTSQAALNRFSRNRASTVN
                     GPVPKVIDWNHYRDEDYDRSHEYDPDIVNVLDVIDPEVSALSTLTNVQNSLFVPDLFG
                     FVNREPTYTLSPPHHEAVTEEEGTTTDDAGDNLQELRPDMKNLRHLSSISSVLDAGET
                     RFAVLPDETNLDGWTKEDIEELNDHVRHMLHSRRNKFKRAMKGFGQYVSKPLGFLVTL
                     YATLITLFGLAWVLFLIGWINVGGKQLYVINIIDNILVALFAIMGDGLVPFRAIDTYH
                     MIFIARYTFLTWKIRKQRALPSLKNKNDLPVRREIDIDVEWGDTPKDEAYEFSVLDRI
                     QQARLIHHQKKFAKSHTFYKPHETVTHYAFPLRLLIAIVVVLDCHSMLQIALGTCTWS
                     IDYHVRPFALTTVILCCSIACNISGGVMIMIGDRMTRKKDVVERMFRQKLTSEAMKIM
                     QKRRRKEEKRNASLSHTSSGPSNSVLAPQVSPYEGT"
     gene            <983561..>984934
                     /locus_tag="ACHE_20334S"
                     /db_xref="GeneID:66979235"
     mRNA            join(<983561..983772,984012..984303,984357..984566,
                     984617..>984934)
                     /locus_tag="ACHE_20334S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284625.1"
                     /db_xref="GeneID:66979235"
     CDS             join(983561..983772,984012..984303,984357..984566,
                     984617..984934)
                     /locus_tag="ACHE_20334S"
                     /note="COG:S;
                     EggNog:ENOG410QDT7;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133398.1"
                     /db_xref="GeneID:66979235"
                     /translation="MSTAVENVADKVASNTTNEAPNGTAPAQEQQPQPTDAAAASADE
                     GRRLYIGNLAYATTEGELKEFFKNYKIESTSIPVNPRTNRPVGYAFVDLATAHEASAA
                     IQELSGQEILQRKVSVQLARKPEPAEAKEGAASGGEGEGRKRTGGRGRGRGRGRGRGG
                     RVGRGGRSDQAQKTEAPTNVPAQADPLTDNQANNAATTEQGKPRGRVQQKQRGPPEDG
                     IPSKTKVMVANLPYDLTEDKLKELFSAYQPVSAKIALRPIPRFMIKKLQARNERRKGR
                     GFGFVTLSSEEQQEKAVKEMNGKEIEGREIAVKVAIDSPGKEDDAPEAEKSEEVVPAA
                     GQENAPAAA"
     gene            <985722..>987197
                     /gene="GCS1_2"
                     /locus_tag="ACHE_20335S"
                     /db_xref="GeneID:66979236"
     mRNA            join(<985722..985763,985836..985904,985988..986710,
                     986790..>987197)
                     /gene="GCS1_2"
                     /locus_tag="ACHE_20335S"
                     /product="Zn finger-containing GTPase-activating protein
                     for ADP-ribosylation facto"
                     /transcript_id="XM_043284626.1"
                     /db_xref="GeneID:66979236"
     CDS             join(985722..985763,985836..985904,985988..986710,
                     986790..987197)
                     /gene="GCS1_2"
                     /locus_tag="ACHE_20335S"
                     /note="COG:T;
                     EggNog:ENOG410PG8M;
                     InterPro:IPR001164,IPR037278,IPR038508;
                     PFAM:PF01412;
                     go_function: GO:0005096 - GTPase activator activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Zn finger-containing GTPase-activating protein
                     for ADP-ribosylation facto"
                     /protein_id="XP_043133399.1"
                     /db_xref="GeneID:66979236"
                     /translation="MSRMWEVDPETRAKLLQISKTNGNDRCCDCNAPSPQWASPKFGI
                     FICLNCAGTHRGLGVHISFVRSITMDAFKTGEIHRMEQGGNEPWKSFFDNHAITQSEG
                     RTFEDSTIKERYEGEVGEEWKERLAAKVEGREYVPGQREVKKKETPAASQGPSSISNT
                     GPRGSSPALSEGGGVGGGKKERNEAYFAKLGTANATRSESLPPSQGGKFTGFGGGLPP
                     SSPAGSRSSFMGGAGGAPALDDFQKDPMGTLTKGFGWFTSAVGKSAKTVHDSYIQPTA
                     KQLAESDFAAQARLQAVHLGQNIQVGARGAADQFNRFVEGQDEHTASLARRRGEPERK
                     DFWDDFAALGAEGQGQHRRSASRPNAIGTAAMKPGATGAGTGTGATGSTGAAGSGSGS
                     GATGTAKGQGQQHEEGWDEDW"
     gene            complement(<987929..>989845)
                     /locus_tag="ACHE_20336A"
                     /db_xref="GeneID:66979237"
     mRNA            complement(<987929..>989845)
                     /locus_tag="ACHE_20336A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284627.1"
                     /db_xref="GeneID:66979237"
     CDS             complement(987929..989845)
                     /locus_tag="ACHE_20336A"
                     /note="CAZy:GH2;
                     COG:G;
                     EggNog:ENOG410PKJX;
                     InterPro:IPR006103,IPR006102,IPR006101,IPR006104,
                     IPR036156,IPR008979,IPR017853,IPR013783,IPR023230,
                     IPR023232;
                     PFAM:PF00703,PF02836,PF02837;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133400.1"
                     /db_xref="GeneID:66979237"
                     /translation="MKLLSALSLLSLIPHALSVPTGNSHHLRSSVQDGQPHLLNLKPQ
                     RTTSRDLVSLDGLWNFALASDDNSTAQPWTGPLPKGLECPVPASYNDIFVSHEIHDHV
                     GWVYYQRSVIVPRGWSGEQYLVRAEAATHHGRIYVNDCLVAEHVGGYTPFEADITDLV
                     AAGEEFRLTIAVNNELTYQTIPPGKVQVLENTGRKVQDYQHDFFNYAGLARSVWLYSV
                     PKQHIQDITVVTDVDGETGLINYAIKVSGNATTGSNIKISVLDEEGKRISEASGPKGT
                     VRIDSVKLWQPGAAYLYQFRADLVDSSGKVLDTYSVATGVRTIKVSGAQFLINDKPFY
                     FTGFGKHEDTAVRGKGHDQAYMIHDFQLLNWIGANSFRTSHYPYAEEVMDFADRHGIV
                     VIDETPAVGLAFSLDAGLDGGDAPATFTPDGINNKTREAHAQAIRELIARDKNHASVV
                     MWSIANEPASNEDGAREYFEPLAKLTRSLDSTRPITYANLGSATYKVDTISDLFDVLC
                     LNRYFGWYSETGQIDEAEAELEKELYGWQEKFPEKPIVMTEYGADTIAGLHSVLDVPW
                     SEEFQVTMLDMYHRVFDKMESVVGEHVWNFADFQTALGITRVDGNKKGVFTRDRKPKT
                     AAHRLRERWTKMFA"
     gene            complement(<990527..>993331)
                     /gene="MEF2"
                     /locus_tag="ACHE_20337A"
                     /db_xref="GeneID:66979238"
     mRNA            complement(<990527..>993331)
                     /gene="MEF2"
                     /locus_tag="ACHE_20337A"
                     /product="ribosome-releasing factor 2, mitochondrial"
                     /transcript_id="XM_043284628.1"
                     /db_xref="GeneID:66979238"
     CDS             complement(990527..993331)
                     /gene="MEF2"
                     /locus_tag="ACHE_20337A"
                     /note="COG:J;
                     EggNog:ENOG410PGST;
                     InterPro:IPR000640,IPR027417,IPR035647,IPR005225,
                     IPR041095,IPR035649,IPR031157,IPR000795,IPR004161,
                     IPR009022,IPR030851,IPR020568,IPR009000;
                     PFAM:PF14492,PF00009,PF00679,PF03144;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA];
                     go_process: GO:0032790 - ribosome disassembly [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ribosome-releasing factor 2, mitochondrial"
                     /protein_id="XP_043133401.1"
                     /db_xref="GeneID:66979238"
                     /translation="MVATPLLRISPQAMALKPGSIAARRLGTLKSLPVSNRKLFSTSS
                     AKWAEALERTRNIGIIAHIDAGKTTTTERMLYYSGFTRRIGDVDEGSTVTDFLPAERA
                     RGITIQSAAITFHWPPGSPGDKNTVTLQESQPRSAVPHTINLIDTPGHADFTFEVMRS
                     LRILDGAVCILDGVAGVEAQTEQVWHQASTYRIPRLVYVNKLDRDGAAFGRTVKEVGS
                     RLGGWPAVCQIPWFEGGDGRFVGVADVVNIHGLRWSEGDGKSVKMLDLQQLDQEESQL
                     AAELRRARAALVELLSEHDDELVEKFFECDEDHLAVPPQDILNSLRRCLIENKSSRVI
                     PVFAGASFRNIGVQPLLDSVINLLPSPLETADPEVSIGNVKGGLRRLLSGDLLVEQNE
                     KQAASGGKKQKSKKNLQAESQSSIERLQGCGLAFKVVNDAKRGVLVYVRVYSGSLDRN
                     STLFNTNLNISERVPRLLKMYANDAVEVDSIPAGHIGVVVGLKHARTGDTLVSYAGHK
                     STPPEPLNTLQLRPIGVPPPVFFAGVEPHSLSEEKKLEESLALLLREDPSLHVTVDED
                     SGQTLLSGMGELHLEIARDRLLNDLKAKASMGRIEIGYREAPLGASTPVTRIFDKEIA
                     GRKGKAGCTAVVEPWDPYMDSTNSEGNDILSIITHENNQIIITTPNLQVETNKKGIEE
                     SPLLPAGLDIPTFRAALQNGVFAALARGPQFTFPMHSTRVTLTFNATEHLYGTDTTAS
                     AVSSAARLSTTAALRTLLPPPSSPQSAPGTSPTPGTALMEPLMNVIISVDEASLGAVV
                     HDISSSRGGQIISLDEDLTLPTTDLASSPTSSYSPPQQPPEDLPPIDTSKVYAPRDPF
                     ETTSIGGGSLGNTDPVSGSANRPRTIAAKVPLKEMVGYLKHLRSLTAGRGTFVMSVDR
                     FERMSAPRQKAVLIELRGGL"
     gene            <993756..>995671
                     /gene="VPS17"
                     /locus_tag="ACHE_20338S"
                     /db_xref="GeneID:66979239"
     mRNA            join(<993756..994250,994303..994756,994812..>995671)
                     /gene="VPS17"
                     /locus_tag="ACHE_20338S"
                     /product="vacuolar protein sorting-associated protein 17"
                     /transcript_id="XM_043284629.1"
                     /db_xref="GeneID:66979239"
     CDS             join(993756..994250,994303..994756,994812..995671)
                     /gene="VPS17"
                     /locus_tag="ACHE_20338S"
                     /note="BUSCO:EOG09261IEH;
                     COG:U;
                     EggNog:ENOG410PGQ6;
                     InterPro:IPR027267,IPR014461,IPR037907,IPR001683,
                     IPR036871,IPR015404;
                     PFAM:PF09325,PF00787;
                     go_component: GO:0030904 - retromer complex [Evidence
                     IEA];
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA];
                     go_process: GO:0015031 - protein transport [Evidence IEA];
                     go_process: GO:0042147 - retrograde transport, endosome to
                     Golgi [Evidence IEA]"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 17"
                     /protein_id="XP_043133402.1"
                     /db_xref="GeneID:66979239"
                     /translation="MDYSAISDHPTGSSPWASPAPERTTFSESNDSDIPPSALPPQQQ
                     SPYDADRDLSQAAGAGPWSASREEDPDADLSERLQSAQLGDPDYAVEQPPYATQQPPL
                     PPQQPQYAPQYAPQQQVQPAAQPHFAPAGQENKRPAPLYKIQARITGLERTGKKDPIL
                     RFDVHTNIPKFRTTQYRDVRRTHAEFVRLAEHLMSANPEALVPAVPPPLTPAGAGTEE
                     DEVRVKAGMQRWLNIVMSNEILTQDDEVVLFVESDFGYSPVVRMKQPATGMRRKVLKQ
                     FAPPPDDTPELQSARPAVKMFYLGAMDASHKVDRVVKGRRGLGLAETDFGIKLGQMHV
                     QETHPGLANAYKKLGKVISNVGDYHAVQATAEATTLGDPLNYHSSDAFVVKETLTNRH
                     ILLRDLLQAQQTARSKRAAADRLRVSSSVRPDKVDEALSALEEAESHEAYLSKRTHRV
                     TSNLVQEKRRWFDQTSNDVISHLREYTLRQIEAERRTLATLESVRPDIRAIDSSGGLS
                     RLGREAHPTARRPNLGSSQGPKGDAWSGVPRRGDSLGRSLSGSYMAPNLENDEETEAG
                     PGRVRSSSGVGSIAEEDDDDRLDARNAASRLAASTF"
     gene            <996095..>997219
                     /locus_tag="ACHE_20339S"
                     /db_xref="GeneID:66979240"
     mRNA            join(<996095..996114,996162..996367,996420..>997219)
                     /locus_tag="ACHE_20339S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284632.1"
                     /db_xref="GeneID:66979240"
     CDS             join(996095..996114,996162..996367,996420..997219)
                     /locus_tag="ACHE_20339S"
                     /note="COG:S;
                     EggNog:ENOG410PHFD;
                     InterPro:IPR036291,IPR016040,IPR001509;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133403.1"
                     /db_xref="GeneID:66979240"
                     /translation="MAPKVFLTGTTGYIGGDGFYSVHQAHPDWQLSVLIRNKDKAAKL
                     ASEYPQVRIVQGDLDSADIIEEEVKNADIVYHFADCDHVASAEAIAKGASHHTPQNPV
                     WWIHTSGTGILTVEDFRTNTWGIERSKEYNDWDGVSELLNLPDDALHRNVDKIVIEAS
                     KNNPESIKTAIVCPPTIYGPGRGPGNQKSVQAYWLAAAVLQRKKGLLVGQGTNIWHQV
                     HVQDLSKVYLSLGEAAAAGGAPATWNDGGYYFAENGSFVWGDIQREVAKVAHEKGLIS
                     SPDVEPIPDAQVTELNQFGLYAWGSTSRGHAIRARKLLGWTPEKPKLIELIPHIVDVE
                     AKGLGLR"
     gene            <997980..>998471
                     /locus_tag="ACHE_20340S"
                     /db_xref="GeneID:66979241"
     mRNA            <997980..>998471
                     /locus_tag="ACHE_20340S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284633.1"
                     /db_xref="GeneID:66979241"
     CDS             997980..998471
                     /locus_tag="ACHE_20340S"
                     /note="COG:S;
                     EggNog:ENOG410PVF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133404.1"
                     /db_xref="GeneID:66979241"
                     /translation="MDPQEYYGKVEEWFKQGHFSRDALLHTLSSRTKNFGILEDDEEQ
                     RLHETFDSLCADNNGSRYLSQPAFVSFLQRLGFLPSSMNEAGAVLYRSLINISQAPFD
                     EHSARQLTLNDLLRSLVLTDYDRSRRVYEESEDSRTRTPADTRRIIFQSLATARNDKK
                     ALS"
     gene            <1000803..>1006450
                     /locus_tag="ACHE_20341S"
                     /db_xref="GeneID:66979242"
     mRNA            join(<1000803..1004029,1004095..>1006450)
                     /locus_tag="ACHE_20341S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284634.1"
                     /db_xref="GeneID:66979242"
     CDS             join(1000803..1004029,1004095..1006450)
                     /locus_tag="ACHE_20341S"
                     /note="COG:K;
                     EggNog:ENOG410QDF8;
                     InterPro:IPR021726,IPR032302,IPR040007,IPR021418;
                     PFAM:PF11732,PF11262,PF16134;
                     go_component: GO:0000347 - THO complex [Evidence IEA];
                     go_process: GO:0006397 - mRNA processing [Evidence IEA];
                     go_process: GO:0006406 - mRNA export from nucleus
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133405.1"
                     /db_xref="GeneID:66979242"
                     /translation="MDELKEEKLKEKAERERAARPGGGVNALMMAGALADDTVPMPRI
                     RESEARATPSKEQEADKAAAKAEENELPEPSDQKVLLLKSLLAIGALPEALLILSKFP
                     WLMDVYTELPEFIHRILHHSLSKVYASLRPLPSVDGLRDQQQIPSLDQSSVPKGQVRL
                     NQAPPRRVLRWAQLDVEDEHDGTDYRFYWDDWADNVPICQSVDDVFALCSSFLNLSGH
                     KIGQDAALLSKLARIGRDSLSKDGSQENRARWQDLCKRLLVPAISLTKANPGVVNEVF
                     DLISFFSREVRYNMYAEWYFGQTSRLPDIKSAFDQARAETKDTLKRLSKTNIRPMARA
                     LAKIAYANPGIVINVAISQIESYENLIEVVVECARYFTYLGYDILTWSLINSLGQKGR
                     SRVQEGGLLTSRWLNALATFAGRTFKRYSVMDPTPVLQYVVEQLRHNNSTDLIVLEQM
                     ISSMAGIITDSSFNESQIQAMAGGDTLQSQTILQLLDKRHESKTTSKRLMKSLTVSKL
                     AGQLLVAIAQERWTCIFQDESSSELKLSGNIFDEIHRILTQYLDLLRSNMSVEEFDSF
                     VPDLPTLIKGFGVQPELAFWIQRPSIGKKIAEVERAAQEDEAAAKTRESEEASSATKA
                     EDGQEMAVDGEPTAKAEEATAEGAMDVDKPQPQSLNESDGTLAPEQTAANDNGNSEPP
                     ASNAVIQDLEGQIQSVLPVETYGIVGLRFYVIFWQLSLYDVHVPQKAYEDEIDRQKRK
                     VVTINNDRSDISMAGTQRKEREKKQLTQLQERILEENKTHLKAYGQTRIRLQKEKDRW
                     FAGMRGNYDTLNVSLLEQCFVPRLLLSPIEAFYCFKMLKFLHTSGTPNFRTVGLLDQL
                     FREQRVTALIFQCTSKEADNLGHFLNETLRDLGRWHADKAVYEKEAFGTKKDLTGFAT
                     SVGSDGKPTMFLDYEDFRRLLYKWHRILASALKICLNGGEYMHIRNAISVLKAIVQQF
                     PAVNWIGRDILKSVNNLSQNDERDDVKTPAASLIGDLNRREKKWMLPQAFNEIKGPIP
                     AQQQQQKTEQALSDKATAEKAGASGTVTPTPLNAAAPSFKPPGGQEAEGAPKPEPSKQ
                     EVEDGEIEDAKMTDVAMKGTEGAKQEPSGKPETTPQQAEQPVTGGPEVAPTDKPAEPA
                     AKQPRASSASAVSQPEPQALERQADIPKRPEIERSSSSASNIRGLPNRPIRHGDGRLP
                     PRPERQRHPGRYDGEHDPHSHGLLERDLPTRLPPDEPFRGPAYRDGRLPREPEWLDRS
                     GRLRPAPDGFDGRSDGARLPLEAPNGPRPGPQTHPDRAGLIHERPDRDRRGPPPRGLS
                     PPRSSDLPGRLERFPGDDRRFANYPPGSRLDDLPTGPRSERPGREIHDPRETPSGPDM
                     SHGRLRQPEPAEIPSGPRSRNRGGRGASGPQPPPPPPAGGNERQPPMGPKQQPPGAPA
                     SPAGDRLDNSGIHPDRLKALQQQGNEYGGGRSQQPPSPGIAPPSGPRSSFAPPSGPAP
                     MPRGAQPSGSGGGGGGGGDRGRGDKRFAGINNMLQQSAGPADRSGPGTSIRGRGANRS
                     AAAMNAPSPQSTPSGGTPDDGSRTVSSSSQQGRPDLLADRITSASRGDEGHSRRSLGG
                     RGDLIDEPGSESRRSSQRYSERDRDRDRERERDRERDRDRERDRGDRERGERSDRDRE
                     RERDRERERERERERRAGDEEGTRSSSRREERERAREYERERSRRSDAGAAASRDDAR
                     YEPPREVLRRGGGNRDRRERRERDEGAAGDLASHEHEGRLRPPSSMGVPPPPPPPPPP
                     LPGSAEDERRWGGGGRERDRERNRDRARDRDYGGGSSGGGGGHRKRGRGGDDGHGEGG
                     GRGGMRMGNENKRPRRGM"
     gene            <1007338..>1009934
                     /locus_tag="ACHE_20342S"
                     /db_xref="GeneID:66979243"
     mRNA            join(<1007338..1007407,1007467..>1009934)
                     /locus_tag="ACHE_20342S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284635.1"
                     /db_xref="GeneID:66979243"
     CDS             join(1007338..1007407,1007467..1009934)
                     /locus_tag="ACHE_20342S"
                     /note="CAZy:GH3;
                     COG:G;
                     EggNog:ENOG410PFI5;
                     InterPro:IPR017853,IPR019800,IPR036962,IPR037524,
                     IPR008979,IPR002772,IPR036881,IPR026891,IPR013783,
                     IPR001764,IPR011658;
                     PFAM:PF00933,PF01915,PF14310,PF07691;
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133406.1"
                     /db_xref="GeneID:66979243"
                     /translation="MVRLDVEQTISELTLGEKIALTAGVDFWHTAAVHRLNIPSLRLS
                     DGPNGVRGTRFFNGIPAACFPCATALGASWDTKLLNDVGRLMADEAIAKGCHVVLGPT
                     INIQRSPLGGRGFESFSEDGILSGTLAGYYSKGMQEKGVGATLKHFVCNDQEHERLAV
                     DSIVTQRALREIYLLPFQVALRICQSACIMTAYNKVNGTHVSENKKIIGDILRKEWGW
                     DGLVMSDWFGTYSTSEAINAGLDLEMPGKTRWRGDVLAHAVSSNKVAEFVLDERVRNV
                     LNLINYLDPLGITEGAPEKGLNREQDHALLRRAAAESVVLLKNQDSILPLKKDKPILV
                     IGPNAKIAAYCGGGSASLLPYYTVTPFQGVSAKSQASVEFSQGVYSHKDLPLLGPLLK
                     TVDGKQGFAFRVFNEPPTEANREVVDELHLVASTGFLMDYVNPKIKSMTFYVDMEGYF
                     TPEEDGFYDFGVTVVGTGKLLVDDEVVVDNTKNQQRGSAFFGNGTIEEKGAKHLQAGR
                     TYKVVLQFGTAPTSDLDNRGIVAFGPGGFRFGAARRVNQEDLISHAVEQACRAEQVVL
                     FAGLTMEWETEGYDRDHMDLPPGSDELITRVLAANPNTVIVNQSGTPVTMPWAHNAKA
                     ILQAWFGGNECGNGIADVLYGDVNPSAKLPLTFPVRLQDNPSYVNFRSERGRVLYGED
                     VYVGYRFYEKIERDPLFSFGYGLSYTTFTRSNLSINTVPENPTLPHQPEGTITEPITA
                     TLTVTNTGPVAGSEVAQLWIRPPPTSSVNRPVRELKGFNKVFLQPGKSKEVQIVVDKK
                     VATSWWDEQRGAWASEKGIYRVEVTGTGEGVLQGEFEVEKTRYWVGL"
     gene            complement(<1011900..>1013225)
                     /locus_tag="ACHE_20343A"
                     /db_xref="GeneID:66979244"
     mRNA            complement(join(<1011900..1013105,1013157..>1013225))
                     /locus_tag="ACHE_20343A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284636.1"
                     /db_xref="GeneID:66979244"
     CDS             complement(join(1011900..1013105,1013157..1013225))
                     /locus_tag="ACHE_20343A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133407.1"
                     /db_xref="GeneID:66979244"
                     /translation="MEFKASLRDRLRRTRSSLISFSQPITLFSVKPNTNSNAKRPSSD
                     ITEPPCIPRDVERELRYACHRLQRRIERGIPSYDNYGVPEISGERRQTMTVPQINTAP
                     RAQSLPATLRSPRNRYYSGLEFEVQQSEQKKDDISELYDRTAHIARAESTYTARSDFN
                     TSRIPSSATHDAAHADGEQPHSSGETLVGANDSRLSHDQRYSMDIANGPYPQVPLDLI
                     RDLDSMPHIVPSLSRPPGPATMPARLVRKKRVENLQEESESQSQTNTDTETETETVTS
                     DKATGPRPKYRYSWLPQTATATARPVSAMELGLGVSPPVIIDSKGQRQVMSPEAEQQR
                     QKDLQQAVREKMNTGTIRPRPVSDIHTQPCANCSNTTKSAGITNVNETGEQLSRRRSI
                     LQKFSFFSFVKLKNGMPRTREAVGFSRIVDVV"
     gene            complement(<1015067..>1016658)
                     /gene="MET2"
                     /locus_tag="ACHE_20344A"
                     /db_xref="GeneID:66979245"
     mRNA            complement(join(<1015067..1016111,1016168..>1016658))
                     /gene="MET2"
                     /locus_tag="ACHE_20344A"
                     /product="homoserine O-acetyltransferase"
                     /transcript_id="XM_043284637.1"
                     /db_xref="GeneID:66979245"
     CDS             complement(join(1015067..1016111,1016168..1016658))
                     /gene="MET2"
                     /locus_tag="ACHE_20344A"
                     /note="COG:E;
                     EggNog:ENOG410PF9D;
                     InterPro:IPR000073,IPR008220,IPR029058;
                     MEROPS:MER0044357;
                     PFAM:PF00561;
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase"
                     /protein_id="XP_043133408.1"
                     /db_xref="GeneID:66979245"
                     /translation="MAERNAHTGQFRQYSPISSMNPRDADGQLLNPVERIDSQPENPY
                     SHLITDQTTVIVPSFTLESGVTLHNVPIAYTARGELSPNRDNVLVICHALSGSADVAD
                     WWGPLLGGPGQAFDVSRFYVVCLNSLGSPYGSASAVTYKDGDPEKGIYGPEFPLTTVR
                     DDVRIHKMVLDDMGVKQIAAVIGGSMGGMLALEYAYFGKDYVRAVVPIATSARHSAWC
                     ISWGEAQRQSIYSDPKYDDGYYSFDDPPVTGLGAARMSALLTYRSRNSFESRFGRNVP
                     DPSKQQNIKDTQKLPTPPNEHWAVHNDGHKGGQSRSSPTPQLQAESPAVEYMDPQFSG
                     TKTFSAPVKPSVEGRKRPPTYFSAQSYLRYQGEKFVKRFDPNCYIAITRKLDTHDVSR
                     YRASPTSEDPVKEALSQIEQPALVLGIESDGLFTFEEQKEIAAGIPDSRLKRIESPEG
                     HDAFLLQFEQVNHYILEFFREVMPEIMSKQTTEGGTIVDGVNKLTKSSTFGEAEVEDI
                     TAW"
     gene            complement(<1018117..>1018837)
                     /locus_tag="ACHE_20345A"
                     /db_xref="GeneID:66979246"
     mRNA            complement(join(<1018117..1018503,1018748..>1018837))
                     /locus_tag="ACHE_20345A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284638.1"
                     /db_xref="GeneID:66979246"
     CDS             complement(join(1018117..1018503,1018748..1018837))
                     /locus_tag="ACHE_20345A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133409.1"
                     /db_xref="GeneID:66979246"
                     /translation="MSDQKWWIWLIPVDLLFDQVPEHVKASEVKQATTMTENIFDTYN
                     VTLSDCDVLVGYQNLHSWIQQSVRKFEGGGPQYVAVDGVTISVLEQIDKNRSRLPNMR
                     LYHDASSNRLLIKFVKTDHNVAASQFLAELMEGCQAERCQAVGITRKDFYSLLGSI"
     gene            complement(<1021600..>1023950)
                     /locus_tag="ACHE_20346A"
                     /db_xref="GeneID:66979247"
     mRNA            complement(join(<1021600..1023728,1023896..>1023950))
                     /locus_tag="ACHE_20346A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284639.1"
                     /db_xref="GeneID:66979247"
     CDS             complement(join(1021600..1023728,1023896..1023950))
                     /locus_tag="ACHE_20346A"
                     /note="COG:S;
                     EggNog:ENOG410PPK6;
                     InterPro:IPR021589;
                     PFAM:PF11500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133410.1"
                     /db_xref="GeneID:66979247"
                     /translation="MLGWMTGQNQNEQFAYSADNSKVLDPPETPAPVFALRAFKSALF
                     GTPAPEEEDRDRVSRTKEQQPASRTREQVDSRKDHSTGSLKNDNIPTLKPDTAPTGNT
                     MASPTKSILVTPGTISNRRKTVSFGDGVVDNERKQESPSKTPSLTTPTNLSTSPSSQW
                     ASGSSDGKPRSKLTQALLDSREKRSSKDFQLTQTSKPSENRSGGITSKMAPPSAGNDD
                     NDETLNMNEPRSQSGKYWKTEFDKYRTKTDWEIKRLVQYRSVAKAYARKKDEEAVRLA
                     GKLKQEEEKVAEMERHVSQLASTMVTEGDKHDKEKLIQDLTKQTALALQYKHRVTMLR
                     KALEQHGVVSNEMEDIKEQPDGNDKTSEELRKTQQALEQANAKIKSMQNQRSDLSKLH
                     DLSESSEQKASDLEKENTTLKHTLARFKSEMTKYEGRRKEKEAKLKQREAKLELRIRE
                     YRERLRTVTQRHRESQESLKESFEEERYSLLEQIERLKLTLGTLDRLPDFESGRLTLS
                     PRKDYTGVNVYDFGQRSPQRGHENDETEEFGDPPSPSPRSKERRYRQLQSATDDPLDL
                     RRAAQAMGIDIDGDDNSPSIYAEEEEGSQRQSRRFNHVPDDEGDVVIPPSSPPDLSSI
                     KPSYNRKSSTRLDHGLDDQRTMSRGRYLADLEEEKQARAQQRRRRSPTKYGLEALSGN
                     TKQQRLGLSESQRDAMPIDRKIAAQARLKRKEASRKAKEEAIGAF"
     gene            <1024379..>1029443
                     /locus_tag="ACHE_20347S"
                     /db_xref="GeneID:66979248"
     mRNA            join(<1024379..1024597,1024660..1027038,1027095..1028097,
                     1028147..1028580,1028633..1029077,1029133..>1029443)
                     /locus_tag="ACHE_20347S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284640.1"
                     /db_xref="GeneID:66979248"
     CDS             join(1024379..1024597,1024660..1027038,1027095..1028097,
                     1028147..1028580,1028633..1029077,1029133..1029443)
                     /locus_tag="ACHE_20347S"
                     /note="COG:J;
                     EggNog:ENOG410PHNI;
                     InterPro:IPR036621,IPR017441,IPR008271,IPR016135,
                     IPR016255,IPR024435,IPR041715,IPR006575,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF13393,PF12745,PF05773,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004694 - eukaryotic translation
                     initiation factor 2alpha kinase activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0000077 - DNA damage checkpoint [Evidence
                     IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA];
                     go_process: GO:0010998 - regulation of translational
                     initiation by eIF2 alpha phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133411.1"
                     /db_xref="GeneID:66979248"
                     /translation="MPHKQKKASNHALRIGSPRAEKKQQQHQSVPNTPPPIVAPTNYR
                     EIHQNEVEALRSIYGDDFEEVENRRSAWHQSSDVCFRLHLRASSNPEVRIQLLVELPA
                     TYPKTYPNLSLENLAEFREGAQSRILDIVENKPKLLVGTEMIYELGVSIQDVLEDVAQ
                     AKEQDKDLPSLEEERMKQEAAAMHQAELERQEEIRKQEAATAEEERALQQLIENKIRE
                     RSRARLSRRKSRTAGMDSNGFTDDIEHVPGAIAFDPPLVMNDSDEQLLKFRAVFGKTL
                     LKSIHGKETFTVRPVVSENRPHAPLLVLKEYSLEKGLGTLAFRERMRTSEDKLESIKK
                     LRHPNLIDFVGFKINSPDIYDGSHDNAWKVYALVEYANKGSLVEFLDLVGTVPVEMLR
                     SWMLQLLEGLEFYHRSGFVHGEIHSGRVMLFRSPTGGTTVKLQPSIEGALPSPAGGRS
                     RSMATSKSPFWTPPELTQEDVPLSMKTDVWDLGIVLLQMGFGKDVMLRYTSANALMGA
                     LDLSSPLQDLLEEFFRPDPKKRPTAFQLQPSEFFRVDTPLIMQTSTANSMSLPRRPRM
                     DSFGGISALSRYNQDFDEAGRLGKGGFGQVVKARNKLDGRFYAVKKISQKSAAALKDT
                     LSEIMLLSRLNHPYVVRYYTAWLEEDFDLGDEDAVSSTDGDPFVSRDPGSVGFSTGGL
                     DFISSSGYSGIQFGLDSDDEDAGSVSEQDRKETLDGYDDSESESGTEPSRMKTSSQGR
                     PVFTTLYIQMEYCEKHTLRDLIRNGLYDDVDRSWRLFRQILDGLSHIHGHGIIHRDLK
                     PDNIFIDVANNPRIGDFGLATSGQFMTAVRSSATADLGGNLTRSLGTTYYVAPEMKSG
                     FTGNYNEKVDMYSLGVIFFEMCHPLATGMERDQTLREIREKNHTLPATFQHSDKVVQG
                     KIIESLLNHTPNERPSAEELLHNGNIPLQVEEETFRRAIVHLLSDPNSPDYKKILSAI
                     FSQSPKRFEDIAWDMDSRVSPAANELLVQGLVKDKLISIFRRHGAVESARQMLFPRSQ
                     HYNHGAVRLLGSSGNLLQLPFDLTLPNARAIPRQDPSLEKTFAFGTVYRETPHGGEPR
                     THKEVDFDIVSHNTLDLALKEAEVIKVLDEIIEEFPPLRSAQMCFMVNHSDLLQLIME
                     FCRITPSQIPLVKEIISKLNVGKWSMQKIRSELRSPAVGVASTSLDNLARFDFRDSPK
                     QAHKKLRAIMEGTPFAERLTPIFARLNLIVNYLQEFDVKRKVYVNPLSSLNDKFFRGS
                     ILFQCVFDNKRRDVFAAGGRYDRLVQEFSPKASSRIQTHAVGFNLSWDRLSSSMLGHL
                     KEPTKPSLKHSEAEAGAGTFWKTRRCDVLVASFDATVLRTVGIKVVQDLWSSDISAEL
                     AVDASSLEELLSKYRDHNHSWIVIAKQDSKERGFKVRSLAPREEYDLRASELVPWLRN
                     EIRARNLREGTTDHSKQHRLPSQPDVSFPGNERTNDIRILVSQHRSKKSNRRNIVDSA
                     LQRSREVVEQALNGPIAAIDTRDDVLESIRDTRLSDPDSWRTVIQNAPPSERKYLSQV
                     HELLCDLANESIMGDGTESYTNAFIYNYRTGSCLYYDLGRMSER"
     gene            complement(<1029644..>1030876)
                     /gene="CWC2"
                     /locus_tag="ACHE_20348A"
                     /db_xref="GeneID:66979249"
     mRNA            complement(<1029644..>1030876)
                     /gene="CWC2"
                     /locus_tag="ACHE_20348A"
                     /product="pre-mRNA-splicing factor"
                     /transcript_id="XM_043284641.1"
                     /db_xref="GeneID:66979249"
     CDS             complement(1029644..1030876)
                     /gene="CWC2"
                     /locus_tag="ACHE_20348A"
                     /note="COG:A;
                     EggNog:ENOG410PG3V;
                     InterPro:IPR000504,IPR032297,IPR034181,IPR012677,
                     IPR039171,IPR039173,IPR035979,IPR000571,IPR036855;
                     PFAM:PF16131,PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0017070 - U6 snRNA binding [Evidence IEA];
                     go_function: GO:0036002 - pre-mRNA binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0000387 - spliceosomal snRNP assembly
                     [Evidence IEA];
                     go_process: GO:0045292 - mRNA cis splicing, via
                     spliceosome [Evidence IEA]"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor"
                     /protein_id="XP_043133412.1"
                     /db_xref="GeneID:66979249"
                     /translation="MADTEVVDPPQTTIPSPPPSGTEPTPNDGNALTTQPTETAITTT
                     TEADGTQKKKKIIRRKRRPARPQVDPATIKSEPPPQTGTVFNIWYNKWSGGDREDKYL
                     SKQAASSRCNVAKDSGYTRADKVAGSYFCLFFARGLCPKGHECEYLHRLPTLHDLFNP
                     NVDCFGRDKFSDYRDDMGGVGSFMRQNRTLYVGRIHVTDDIEEVVARHFAEWGQVERT
                     RVLTNRGVAFVTYTNEANAQFAKEAMAHQSLDHSEILNVRWATVDPNPLAQKREARRL
                     EEQAAEAVRRALPAEFVAEIEGRDPEARKRKKIEGSFGLDGYEPPDEVWYTRTKELED
                     AGTAPQLEAPEQHLMIESAPPAAAAPFQQEQQQSGGIFSNSTVAALQGLAGGNVTTQK
                     AAPSSGPLVAYGSDDESD"
     gene            <1031199..>1032628
                     /gene="RBG2"
                     /locus_tag="ACHE_20349S"
                     /db_xref="GeneID:66979250"
     mRNA            join(<1031199..1031227,1031290..1031318,1031375..1031389,
                     1031448..1031472,1031521..1031839,1031893..1032002,
                     1032052..>1032628)
                     /gene="RBG2"
                     /locus_tag="ACHE_20349S"
                     /product="ribosome-interacting GTPase 2"
                     /transcript_id="XM_043284643.1"
                     /db_xref="GeneID:66979250"
     CDS             join(1031199..1031227,1031290..1031318,1031375..1031389,
                     1031448..1031472,1031521..1031839,1031893..1032002,
                     1032052..1032628)
                     /gene="RBG2"
                     /locus_tag="ACHE_20349S"
                     /note="COG:T;
                     EggNog:ENOG410PG8U;
                     InterPro:IPR027417,IPR005225,IPR012675,IPR031662,
                     IPR006074,IPR006073,IPR031167,IPR012676,IPR004095;
                     PFAM:PF02421,PF02824,PF01926,PF16897;
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="ribosome-interacting GTPase 2"
                     /protein_id="XP_043133413.1"
                     /db_xref="GeneID:66979250"
                     /translation="MVNITEKIKEIEDEMRRTQKNKATEYHLGLLKGKLARLRAQLLE
                     PTGGSGGGGSGFDVSKSGDARVALVGFPSVGKSTFLSKITKTKSEAAAYSFTTLTAIP
                     GVLEYGGAEIQILDLPGIIEGAAEGKGRGRQVISAAKTSDLILMVLDATKRAEQRALL
                     EAELDAVGIRLNRDPPNIYLKQKNAGGMKITFQTPPKSLDEKMIYNVLRDYKILNCEV
                     LVRDENATIDDFIDVIMKDHRKYIRCLYVYNKIDGVSLDFLNELAHEPHTAVMSCELD
                     LGVQDVVDRIWKELRLIRLYTKRKGEEPDFSEALIVRHNSSIEDVCDQIHRTLKETFK
                     YALVWGASARHIPQRVGLGHVVADEDVVSIVAK"
     gene            complement(<1032863..>1034221)
                     /gene="CPA1"
                     /locus_tag="ACHE_20350A"
                     /db_xref="GeneID:66979251"
     mRNA            complement(<1032863..>1034221)
                     /gene="CPA1"
                     /locus_tag="ACHE_20350A"
                     /product="multifunctional pyrimidine synthesis protein
                     CAD"
                     /transcript_id="XM_043284644.1"
                     /db_xref="GeneID:66979251"
     CDS             complement(1032863..1034221)
                     /gene="CPA1"
                     /locus_tag="ACHE_20350A"
                     /note="BUSCO:EOG09262914;
                     COG:F;
                     EggNog:ENOG410QEEE;
                     InterPro:IPR035686,IPR036480,IPR029062,IPR017926,
                     IPR002474,IPR006274;
                     MEROPS:MER0060647;
                     PFAM:PF00988,PF00117;
                     go_function: GO:0004088 - carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing) activity [Evidence IEA];
                     go_process: GO:0006207 - 'de novo' pyrimidine nucleobase
                     biosynthetic process [Evidence IEA];
                     go_process: GO:0006541 - glutamine metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="multifunctional pyrimidine synthesis protein
                     CAD"
                     /protein_id="XP_043133414.1"
                     /db_xref="GeneID:66979251"
                     /translation="MFARIFKAMPARAPAFPSVNAGIQSRFMATVRQKPTSERATFTI
                     RDGPIFHGKSFGARSNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPS
                     FQKDNHGLLKYFESPNLQAAGVVVADVAERYSHWTAVESLGEWCAREGVPAISGVDTR
                     EIVTYLREQGSSLARITVGEEYDADQDEAFTDPEQIHLVRQVSTKAPFHVSAADPQCH
                     VAVIDCGVKENILRSLVSRGASVTVFPYDFPIHKVAHHFDGVFISNGPGDPTHCQDTI
                     YHLGRLMESSQVPIFGICLGHQLLALATGARTVKLKYGNRAHNIPALDMSTGRCHITS
                     QNHGYAVDPTTLPSDWKPYFTNLNDSSNEGMIHKSRPIFSTQFHPEAKGGPLDSSYLF
                     DIYLDSVLSYKNNQAQFHPQRDSRPNPLLVDILAKERVGVQPTIGMQNVAAASAAAAG
                     SA"
     gene            <1035392..>1036254
                     /locus_tag="ACHE_20351S"
                     /db_xref="GeneID:66979252"
     mRNA            join(<1035392..1035956,1036013..>1036254)
                     /locus_tag="ACHE_20351S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284645.1"
                     /db_xref="GeneID:66979252"
     CDS             join(1035392..1035956,1036013..1036254)
                     /locus_tag="ACHE_20351S"
                     /note="COG:S;
                     EggNog:ENOG410Q28Z;
                     InterPro:IPR032710;
                     SECRETED:SignalP(1-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133415.1"
                     /db_xref="GeneID:66979252"
                     /translation="MVAIRYLLQALVASILDTTALSRAIKPHHHGQLSEIQHPLGQYP
                     QDKPGCDGSGIIAPGNGDCNGDGLIDNPNPRHRDREGFHFENPSTDCAYVTQMHIWDS
                     FKDLEKDMNKLFTLIHKDVNFTVVGHHPIAGHYNDLMHFYVNALRRVSVLFMDHADKF
                     EIHPQAIHGGCNERWSVQEVQFKGIMNSGDPFDIVNVWVTRWHKGQMVEIRTYIDAAR
                     IMEALHKNEIWWNGTTFRDNVNYMPGPAGMPDIKALEDLMHYPDGSPYED"
     gene            <1036535..>1038439
                     /locus_tag="ACHE_20353S"
                     /db_xref="GeneID:66979254"
     mRNA            <1036535..>1038439
                     /locus_tag="ACHE_20353S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284646.1"
                     /db_xref="GeneID:66979254"
     CDS             1036535..1038439
                     /locus_tag="ACHE_20353S"
                     /note="COG:K;
                     EggNog:ENOG410PVFB;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o395-412i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133416.1"
                     /db_xref="GeneID:66979254"
                     /translation="MSDSAIRKRSRVACTSCQSRKRKCSGGQPCTICAQFGTECHYDY
                     FSRKKKDVKPNPYATVFHTAPTAPTAATSTTNSSDLTSTADEKRSRSPVEPDHIHPTS
                     LEVNSGAAFVRRLGLKLETAHAPRLHLFAWNVGARTPSAESMVSSSAGSTIVDIISQD
                     EMRSFIAVWFEKIDPCYGFIDRDYLLRQVSRRWLPPSSESALGPGPYDAVLCGLAAMG
                     MLFSRRKGSVAEARVADCGRQILEKHVTSDSPSAAIITGWVLRVSYLRMTASPHAAWM
                     ASCTTMHLVEAAGMHLENPSDNGFLRPDDESYCSRELRRRLFCMARHLNVWVSFELGR
                     SRVVLHGANSLAPARRVDVNTTQFYTEIFELLPVSESLDPVRSSDSTDLEAALSDVLD
                     GEYVPYILILVQCNLVLCIYRRLRALNHSISAKLLDRVVALAAKALHATRELTASVCP
                     WQYIAIVPFQVVCTLLAMDNRKSLALLGDAMHTLGEVAAAYDTDVMREAYSTAYLLIL
                     LHQRRKEEDTRVIGNVLQVNSVASLLTPHNASSAPARIHQQAVAVPDDATVNSNNAIP
                     PDTASTSTAADSNHAGHAHAHAYGVSPPTHSEFSWLGDLMIDMPSLQNFDLDQFLTTD
                     VPWPLPEMGI"
     gene            complement(<1038505..>1040306)
                     /gene="PBN1"
                     /locus_tag="ACHE_20352A"
                     /db_xref="GeneID:66979253"
     mRNA            complement(join(<1038505..1039304,1039359..1039782,
                     1039835..1039901,1039961..1040100,1040157..>1040306))
                     /gene="PBN1"
                     /locus_tag="ACHE_20352A"
                     /product="protease B nonderepressible form"
                     /transcript_id="XM_043284647.1"
                     /db_xref="GeneID:66979253"
     CDS             complement(join(1038505..1039304,1039359..1039782,
                     1039835..1039901,1039961..1040100,1040157..1040306))
                     /gene="PBN1"
                     /locus_tag="ACHE_20352A"
                     /note="COG:O;
                     EggNog:ENOG410PHSH;
                     InterPro:IPR042322,IPR013233;
                     PFAM:PF08320;
                     TransMembrane:1 (i487-504o);
                     go_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA];
                     go_function: GO:0000030 - mannosyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="protease B nonderepressible form"
                     /protein_id="XP_043133417.1"
                     /db_xref="GeneID:66979253"
                     /translation="MRRRITFIQPPNAPFSPDQAVLTPDALTITNLDAVREERLTVSY
                     DELPDDVRAVLDQYQAVHIRWATEDPYTAAAPFASRISPGLHVFVSGKKRTEGEDVLC
                     PLLKRVFWEEVECLSTEKSFIEPPILSKRFSSTADSYYWSLLPFSSPLVRYIEDNICA
                     KASDKASDNCLKLARSLYADSIDISYDSISHALTVSAVSSRTHGGQGWTERITKPDEN
                     SNDGREGIDQVEVGLLTTEKAADEEDIKMGGLLSVVGRDEKMKPTMFSFPSRHHALPD
                     DATYLTSFPHPRGLHPTMTLSLSPSALKAPSAPADATCALHTYLTLPSSIFGDKYQLS
                     TTDPLFLKSHNLAALRAVFGETDLEAPDWGVDRWGSNWLLELATPENPEEVTGEWNVT
                     IPLHLRYLPPSKSGYRTIQVPWPVVFWACTAEGGTKMGINPFDRVNLGWEGLFGSRTM
                     FYQVHPGDNDDARLVEKITVPVLQLDEKQGLFRSKTIELSTVVVIVLGFVWVLWKLGV
                     VVSSSSSSGKKGKQGKTE"
     gene            complement(<1040643..>1041868)
                     /locus_tag="ACHE_20354A"
                     /db_xref="GeneID:66979255"
     mRNA            complement(join(<1040643..1040942,1040996..1041666,
                     1041721..>1041868))
                     /locus_tag="ACHE_20354A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284648.1"
                     /db_xref="GeneID:66979255"
     CDS             complement(join(1040643..1040942,1040996..1041666,
                     1041721..1041868))
                     /locus_tag="ACHE_20354A"
                     /note="BUSCO:EOG092641A6;
                     COG:O;
                     EggNog:ENOG410PKB4;
                     InterPro:IPR008971,IPR002939,IPR001623,IPR036869,
                     IPR018253;
                     PFAM:PF00226,PF01556;
                     go_function: GO:0051082 - unfolded protein binding
                     [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133418.1"
                     /db_xref="GeneID:66979255"
                     /translation="MVAETKLYDALSIKPDASQDDIKKAYRKAALKYHPDKNKDDAGA
                     ADKFKEVSQAYEVLSDPEKRKVYDQFGLEYLLRGGPAPSPGGGAGASPFEGGMPGGFG
                     FGGGMPGGGARSFHFSSGPGGGSGFRFSSADDIFRNFAKASGGGMGGMDDDDIFSMLG
                     GGFGGGGGAGRGFRSGTSGRGPGFQQSRRAPTPEPTVVEKELPLTLEELFRGTTKKVT
                     TKSKAFDPSGKRTVQDVTLEANIKAGLRTGSKIKYKGVGDQEEGGRQDVHLIVTEKEH
                     PNFKRHNDHLVTTVEISLKEALTGWERIVRTIDGKSIRVSKPGPTQPGHEERFPGLGM
                     TISKKPTERGDLVVRVNVRFPTSLTPSQKDVLRDVLPS"
     gene            complement(<1043112..>1045051)
                     /locus_tag="ACHE_20355A"
                     /db_xref="GeneID:66979256"
     mRNA            complement(join(<1043112..1044839,1044896..>1045051))
                     /locus_tag="ACHE_20355A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284649.1"
                     /db_xref="GeneID:66979256"
     CDS             complement(join(1043112..1044839,1044896..1045051))
                     /locus_tag="ACHE_20355A"
                     /note="COG:O;
                     EggNog:ENOG410PIFS;
                     InterPro:IPR018202,IPR001563,IPR029058;
                     MEROPS:MER0016549;
                     PFAM:PF00450;
                     SECRETED:SignalP(1-21);
                     go_function: GO:0004185 - serine-type carboxypeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133419.1"
                     /db_xref="GeneID:66979256"
                     /translation="MPSLHSLAITAVAGLASVAAAGQDRSYFPPSPEGLTVVESKHQE
                     GVKISYREPGICETTPNVKSYAGYIHLPPGALADVNVQQKYPINTFFWFFESRKDPKN
                     APLSIWMNGGPGSSSMIGLLQENGPCRVNKDSNSTVLNPWSWNNEVNMLYIDQPNQVG
                     FSYDVPTNGTWDQVSGNWDVSPFPHGVVPEQNNTFYVGTFPSQKNYTTANSTENSAKA
                     LWHFAQTWFTEFPEYKPHDDRVSIWTESYGGRYGPSFAAFFQVQNEKIVKNKADYHYI
                     HMDTLGILNGCVDLLTQAPHYPQMAYNNTYGIEAINKTQYENAMRAWSRPGGCKDGIL
                     KCRRLAAEGDPKMTGRNATVNKFCSKASDFCSNEVEGPYINTSGRGYYDISHFDPDPF
                     PPPYHNGFLSQHWVQGALGVPVNFTESVNSVYSAFGATGDYARSDVHGYLDDIAYLLD
                     TGVKVALVYGDRDYACPWNGGEAVSLRVDHAEAHQFRSAGYAPLHTNASYVGGLVRQH
                     GNFSFSRVFEAGHEVPAYQPQTAYEIFHRAMFNRDISTGKVPTANNDTYSTQGPSSSW
                     SVKNEVPDSPAPTCYILSLASSCTKEQAKAVLNGSALVRDYIVVEGAEAEHEHASKRF
                     ELV"
     gene            complement(<1045868..>1046314)
                     /locus_tag="ACHE_20356A"
                     /db_xref="GeneID:66979257"
     mRNA            complement(<1045868..>1046314)
                     /locus_tag="ACHE_20356A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284650.1"
                     /db_xref="GeneID:66979257"
     CDS             complement(1045868..1046314)
                     /locus_tag="ACHE_20356A"
                     /note="COG:C;
                     EggNog:ENOG410PINF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133420.1"
                     /db_xref="GeneID:66979257"
                     /translation="MGRRTEASASIEGLQIQYLIQPQPITNGTNLLGLVPGERDVVMA
                     VLTAAYKDSADDDAVMKQIKPIVDKQESVLQQEGSLLRFEYLNCAYKSEDSIGCYGQE
                     NKKRLQDVGKSTTRMACFRSVFQEDSSYFEQMRRGKSVMAELAENW"
     gene            complement(<1049595..>1051830)
                     /locus_tag="ACHE_20357A"
                     /db_xref="GeneID:66979258"
     mRNA            complement(join(<1049595..1050247,1050295..1051137,
                     1051184..1051525,1051583..1051696,1051764..>1051830))
                     /locus_tag="ACHE_20357A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284651.1"
                     /db_xref="GeneID:66979258"
     CDS             complement(join(1049595..1050247,1050295..1051137,
                     1051184..1051525,1051583..1051696,1051764..1051830))
                     /locus_tag="ACHE_20357A"
                     /note="COG:L;
                     EggNog:ENOG410PKWZ;
                     InterPro:IPR036616,IPR036420,IPR001357,IPR012317,
                     IPR008893,IPR004102,IPR036930;
                     PFAM:PF05406,PF00644,PF00533,PF02877;
                     go_function: GO:0003950 - NAD+ ADP-ribosyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0006471 - protein ADP-ribosylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133421.1"
                     /db_xref="GeneID:66979258"
                     /translation="MAPRTFKKAIVAVSGTFPGYKQADLKALVEGQGATFSSSVSQDC
                     THLVTTEKDVEKGSAKNRTACGISTCEVVNLDWLLESVEAKKPLPVKSYLFTNDLSSP
                     APLANGDAKADKKENKEVKKEKGGAKKRTHEDAMGANGAVNGDEEESKKTKHSQKASS
                     KKLVVPLDEGCTLGGYSVYIDDSGLIWDATLNQTNAGHNNNKFYRIQLLVSRSSDYRT
                     WTRWGRVGESGQSTVLGNGAFDQAMVEFEKKFKDKTGLTWENRLDTPRNKKYTFLERN
                     YEDSDDEEDDEDQVVKREEREETPVESALPESIQNLMTFIFNQQHFLSAMEALSYDVK
                     KMPLGKLSKRTLHEGYRILKDLSDLLANPGLANARYGTTVPAAAEELSNRYFTTIPHV
                     FGRNRPPVLFHDKLIKKEVELLEALTDMGVTNAIMKESKDVERERVHQLDLQFNSLGM
                     EEMTPVEPNTTEFIELEQYLNHSRGATHNLSYKVINIFRIERPGETDRFSKSYGAIKN
                     SNRRLLWHGSRSTNFGGILSQGLRIAPPEAPVNGYMFGKGVYFADMSSKSANYCCPYN
                     SGNMGLLMLCDVELGDPMYEQDYANCNAAEDSKKEGKLATLGRGSSIPAGWKDAKCVH
                     ENLKGVTMPDVSVGSMNEQNRCSLYYNEYIVYDVAQIRQRYLFHVKMR"
     gene            complement(<1052503..>1054317)
                     /locus_tag="ACHE_20358A"
                     /db_xref="GeneID:66979259"
     mRNA            complement(<1052503..>1054317)
                     /locus_tag="ACHE_20358A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284652.1"
                     /db_xref="GeneID:66979259"
     CDS             complement(1052503..1054317)
                     /locus_tag="ACHE_20358A"
                     /note="COG:S;
                     EggNog:ENOG410PHQA;
                     InterPro:IPR007461;
                     PFAM:PF04366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133422.1"
                     /db_xref="GeneID:66979259"
                     /translation="MPRTSSWWEKTKGTSKKGFDKTWSTLDKLGDPVNRLSYRLGAEA
                     FWPMSLDKECDKAARILRSFCKDGFYAEDETPDTTFDGKIDKPKGKQRVIQRIPTQVI
                     QRAQGLAIFTTMRSGLWMSGSGGAGVLLGRIPETGEWSPPSGIMLHTAGVGFLAGVDI
                     YDCVVVINTPEALEAFKTFRCTLGGEISASAGPVGVGGILESEVHKRQTPIYNYMKSR
                     GFYAGVQVDGTVIIERTDENERFYGERLSVTEILAGKVRHPPWEINGLIKTIQAAQGD
                     ITDESVLPEGETPGDAVLQPGGMFGVPAIDDPDPFGVKALEEQGLFIREAGTKNRPSQ
                     DVFEFKPNPNSPVYSTFAAATRGSLESSPRNSWRASVQSYASVDRGVQTDDLPTAPTS
                     ASRASSRSRFSPVDKDAIIPEHRQLTISTDRDIDRASVIEDDLEVHEVSSATVSKRGS
                     TMEDYFNQPPLASPTGSRRHSPTFTRARLVTIPKRIPPPLPPRHPQRSTSSSTPVSPV
                     SPIADDNRSVASAGLLNGFSELPLHYMSSNSSSISQTLQEKDEFHSISSESSDRESDN
                     QSHESNTTNDFHEEPHAITHDSKIEMSSYNNVVHAQTT"
     gene            complement(<1063560..>1064364)
                     /locus_tag="ACHE_20359A"
                     /db_xref="GeneID:66979260"
     mRNA            complement(join(<1063560..1063642,1063695..>1064364))
                     /locus_tag="ACHE_20359A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284654.1"
                     /db_xref="GeneID:66979260"
     CDS             complement(join(1063560..1063642,1063695..1064364))
                     /locus_tag="ACHE_20359A"
                     /note="BUSCO:EOG09263WWI;
                     COG:C;
                     EggNog:ENOG410PFI6;
                     InterPro:IPR033948,IPR014730,IPR012255,IPR014729;
                     PFAM:PF01012;
                     go_function: GO:0009055 - electron transfer activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133423.1"
                     /db_xref="GeneID:66979260"
                     /translation="MLIKENVQIKPRINKAQTGVETAGVKHSLNPFDELSIEEAVRLR
                     ERKGPLSVDNILALSAGGPKCADTLRTAMAMGADRAFHIDVAEGNDGPEPLTVAKMLK
                     GVVEKENINLVLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDVKDGEGTVEVVHE
                     VDGGTETLKAKLPMVITTDLRLNEPRYASLPNIMKAKKKPLEKKTLADFGVEDQRRLK
                     TLKVTEPPPRQGGGKVEDVGGLVSKLKELGAL"
     gene            complement(<1067136..>1068004)
                     /locus_tag="ACHE_20360A"
                     /db_xref="GeneID:66979261"
     mRNA            complement(join(<1067136..1067515,1067595..1067841,
                     1067897..>1068004))
                     /locus_tag="ACHE_20360A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284655.1"
                     /db_xref="GeneID:66979261"
     CDS             complement(join(1067136..1067515,1067595..1067841,
                     1067897..1068004))
                     /locus_tag="ACHE_20360A"
                     /note="COG:F;
                     EggNog:ENOG410PS6D;
                     InterPro:IPR024661;
                     PFAM:PF11705;
                     go_process: GO:0006383 - transcription by RNA polymerase
                     III [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133424.1"
                     /db_xref="GeneID:66979261"
                     /translation="MSRFGAKKGRKLPGAEFSWETDAGGEPDTAPTPLYPKYNVTRAM
                     LLSPREQLQVDYYRDLRERFHEGPYYSVLDAASSSAKRGSAARANFDPFHGMPSYSGK
                     YQKKKRTLPKLQGRPYIMKFFPRELWQTIQPSFKPETSMDGYVPQVARTGAKRGFEDD
                     EEEEEDMKRRKAGEDDEEGGEGEGDILDPDEEQEEEIVDDDFEDDDDDMGGDYNAEQY
                     FDGGDDEYGDDGFGDGGGGGGEEDTF"
     gene            complement(<1068445..>1070388)
                     /locus_tag="ACHE_20361A"
                     /db_xref="GeneID:66979262"
     mRNA            complement(<1068445..>1070388)
                     /locus_tag="ACHE_20361A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284656.1"
                     /db_xref="GeneID:66979262"
     CDS             complement(1068445..1070388)
                     /locus_tag="ACHE_20361A"
                     /note="COG:S;
                     EggNog:ENOG410PJ1M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133425.1"
                     /db_xref="GeneID:66979262"
                     /translation="MVVPSSFPAVKAHLDQVLSDPSIGLDTTLLDKLKIEFTENVDPT
                     VPATLLTQIPQLLPVLQEDPTPLTVLGTRATAYFSFADLRSVEPPVNFVAGFKAPSPP
                     INLLALSLLEKAGQVPSDAAMVAGDSELVASLVELWLSTSSTEVAQAALDTIWALLEI
                     DNENSRENGADVKVGGQGLVWRRMFTDKDVYGTLFSICSLNDDRPGSLPKRDKTVAQG
                     RLMGLLVRAGRLRWDIISTSQVPEVESKYQSNSLLHFAACQMVDKSDVLMHMTLLNFF
                     RDLLEIDAPGLVARSYVQSASTFSSPALDFLITHNVHPTVLECYLDESKLDPVDFSFL
                     HGPIMTYVAQYTELYPNHFLQNQQSLLDRVLERVTESLRISSTQWAHGRIPSGQLNVL
                     SSLPRVLLVEASKQGLNPVLALPTNPPSKEALNALARILHGPQRSSTPNSTELNSSGQ
                     TPTDWQKEAAAARYLYFVYLNDHPNLWKDIVASADILAMKDVCLASMSFMQAIVTANW
                     QTLTDQVIAPVPGMGSRFQLPSEQSLGSVSPSKQGSLPTSGSWAVLTPPALLTLLPYL
                     FKPPRSYAEFVGGGAGDAENAVWKIATAKYDVLVTLHDRMKELDNKTPEFEDIMRTLQ
                     QRVRDGPLGPITRTVQNVGTIGL"
     gene            <1070622..>1071934
                     /locus_tag="ACHE_20362S"
                     /db_xref="GeneID:66979263"
     mRNA            join(<1070622..1070892,1070954..1071418,1071486..>1071934)
                     /locus_tag="ACHE_20362S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284657.1"
                     /db_xref="GeneID:66979263"
     CDS             join(1070622..1070892,1070954..1071418,1071486..1071934)
                     /locus_tag="ACHE_20362S"
                     /note="COG:O,T;
                     EggNog:ENOG410PH1R;
                     InterPro:IPR024969,IPR037518,IPR033859,IPR000555;
                     MEROPS:MER0030137;
                     PFAM:PF13012,PF01398;
                     go_component: GO:0008180 - COP9 signalosome [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008237 - metallopeptidase activity
                     [Evidence IEA];
                     go_function: GO:0070122 - isopeptidase activity [Evidence
                     IEA];
                     go_process: GO:0000338 - protein deneddylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133426.1"
                     /db_xref="GeneID:66979263"
                     /translation="MADQAKSLVSQKSSDSGLHIQLHPLILLSISDHITRHAARQQRG
                     PIIGALLGQQDGREITLEHTFECLVAPGENGEVQLPHDWFVERVKQFKDVHKVPALDL
                     VGWWSTAPPSGPNTSHLPIHRQILQNYNESAVFLTFHPSQIQIGASNGSKLPLTVYES
                     VYEGDNAAEGDKAMQVDNEEQSLNIRFRELPYSIETGEAEMIGVDTVARSARNAASDT
                     SAAPQQEMQTKGKKEQKDAMLSPEEEELVASLNTRLNAVRTLESRVSLIKSYISALST
                     TEETPDQNQKASKPSSELLSHPHLRNINSLLSNLSLLTPPEQSAFSAESLAQTNDVLL
                     VSLLGQLGQSVKDMRELGRKAAIVNNVRQSMGMASRKGGKAARLESEFLSGREGPAGM
                     FA"
     gene            complement(<1072410..>1074358)
                     /locus_tag="ACHE_20363A"
                     /db_xref="GeneID:66979264"
     mRNA            complement(join(<1072410..1073303,1073355..1073504,
                     1073553..1073678,1073731..1074028,1074099..1074249,
                     1074316..>1074358))
                     /locus_tag="ACHE_20363A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284658.1"
                     /db_xref="GeneID:66979264"
     CDS             complement(join(1072410..1073303,1073355..1073504,
                     1073553..1073678,1073731..1074028,1074099..1074249,
                     1074316..1074358))
                     /locus_tag="ACHE_20363A"
                     /note="COG:T;
                     EggNog:ENOG410PM3Y;
                     InterPro:IPR005178;
                     PFAM:PF03619;
                     TransMembrane:7
                     (o30-54i66-86o92-117i162-185o205-227i239-263o283-304i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133427.1"
                     /db_xref="GeneID:66979264"
                     /translation="MGWPVCNSTTEEQSINEVPLWDGGITFHQMALIVGGAFAIVAGI
                     VSFYIIMGHATHYSKPLEQRHIIRILLMVPIYSLVAWLSIYFHKQAVYYSVIGDCYEA
                     FTISAFFALMCHYLAPDLHSQKNYFRGIKPKQWVWPLNWMQKCCGGEHGIWRVPRSGL
                     TWFNVIWVGIFQYCVLRVLMTIVAVVTQHFNLYCESSLSPAFSHIWVLVIESAAVTIA
                     MYCLIQFYVQIKDDIKQHRPFLKILSIKLVIFLCFWQSTLISFLYSAGVIKDSEKIEA
                     TDWKVGLPNLLITIEMAIFSVLHLWAFAWKEYSLDHAQVHDDEVTDFYGNGKVSYQGG
                     PWGMKALLDALNPLDLLKAIGRSFRWLFVGRKKRTLDPSYQVPSEQIGLDQADNVPTT
                     IVTAYEGAGPFMAGGRGNSPPGEEGEDLLSHAQPNPTLNRLSSGLSPSPYEDPHSSRF
                     YSTSQDRLSDSSMLDPMAPAHQPYSPYEHDSFNNPYMVPSDSELDAHRHYRHPSSNSS
                     GQESGVTTRLYHPNDNLHQHDPIPMPDAYQPPPLHDDYERGRSRY"
     gene            complement(<1075054..>1076982)
                     /locus_tag="ACHE_20364A"
                     /db_xref="GeneID:66979265"
     mRNA            complement(<1075054..>1076982)
                     /locus_tag="ACHE_20364A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284659.1"
                     /db_xref="GeneID:66979265"
     CDS             complement(1075054..1076982)
                     /locus_tag="ACHE_20364A"
                     /note="COG:S;
                     EggNog:ENOG410PP6Z;
                     InterPro:IPR035979,IPR003034,IPR032552,IPR036361,
                     IPR034257;
                     PFAM:PF16294,PF02037;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133428.1"
                     /db_xref="GeneID:66979265"
                     /translation="MTDYSKWKVTDLKAELKRRGIAQTGLRVKQQFIDKLLEAEAGDQ
                     AGESTEGASAGPETTNAQGTAEQQPAEAEQPAEQPTPDVPQDVKPEEQKTEEPKLEQA
                     QEPLAQNGDVEKRDEPKPAEPTAEKTPRDEAEVDQPMTDTVEQEQQEEKPQEEEQTDA
                     GKETEKPPEDAPTLQAQPDEAPAQPVEQAPGDAVAQEAPSEQREPTGTEPAAPTDKDA
                     PSAKAPEADNELPPALPTEEVAEDRLKRKRRSQSPIATPEALASKKAKAQDETPRVVL
                     PEDREGLATEQQLGKEQVQQEEAREEHGAPAPTPEEPRPRKEAPPKQDARFKGLFAGA
                     EREQVRPASPPADTEMRDAEVEPALHVATAALYIGGLMRPLQPGMLRNHLVNLASAPG
                     SSPSEDVIVDFHLDHIKTHCFVSFANVSAASRVRSALHGNIWPNERNRKNLFVDFIPE
                     QKLQQWIDMEEESRGRGGPQPRWEVRYDRTEDGVEAVLEEIDPKSAAGNPPPRSRQES
                     MTDGLRVPPSGPRAERERFPSGPSRAPPPAEPRPSRPGQGFKPLDELFKSTTVKPKLY
                     YLPVSRETADRRLDRFDDLLRKGDYPRRGGDETRRISFEDGDLFVDNGPEFAGGGRNN
                     RRRRGRGHGGGFRDSWRG"
     gene            <1077804..>1079310
                     /locus_tag="ACHE_20365S"
                     /db_xref="GeneID:66979266"
     mRNA            join(<1077804..1078361,1078415..1078991,1079063..>1079310)
                     /locus_tag="ACHE_20365S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284660.1"
                     /db_xref="GeneID:66979266"
     CDS             join(1077804..1078361,1078415..1078991,1079063..1079310)
                     /locus_tag="ACHE_20365S"
                     /note="COG:E;
                     EggNog:ENOG410PJ6Z;
                     InterPro:IPR006076,IPR036188;
                     PFAM:PF01266;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133429.1"
                     /db_xref="GeneID:66979266"
                     /translation="MGSTDSLPAGLPVGNPTTPFWRTELHPLDDLRATPELPQQSDIV
                     IIGAGYAGVSIAYHLLKQQDQKGQPHPSITILEARQICSGATGRNGGHIRPDLYGHIP
                     TYIERHGTEAGVELANFELSHVKALKDVIVKEEIDCDLNITRNMNVYLNEAHGEKAKR
                     TYEALASQAHSFVEDIHYTPQKHAEGISGVKGAKACMSYTAGTLWPYKFVLGLLSKIV
                     DYSALNVQANTPVTSVSSESDSSHLVNTPRGSIHASKVIYATNAYTPGLLPEYSSHIV
                     PVRGICCHITIPEGKNAPFLPYSYILNTENGDGCSYLITRPDGSIITGGAQYTFKEAK
                     EQWYGVVDDSTLIEPAKDYYNDYMQRTFQGWEDSGAYVKEIWTGIMGYSYDSNPHVGE
                     IPDKPGQYICAGFNGHGMPVIFLTAKGLAEIIQTGKSFEEAKLPRIFKSTMKRLQAAQ
                     EASDGGDVLA"
     gene            complement(<1082184..>1083563)
                     /locus_tag="ACHE_20366A"
                     /db_xref="GeneID:66979267"
     mRNA            complement(<1082184..>1083563)
                     /locus_tag="ACHE_20366A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284661.1"
                     /db_xref="GeneID:66979267"
     CDS             complement(1082184..1083563)
                     /locus_tag="ACHE_20366A"
                     /note="COG:Q;
                     EggNog:ENOG410PMAP;
                     InterPro:IPR001128,IPR002403,IPR036396;
                     PFAM:PF00067;
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133430.1"
                     /db_xref="GeneID:66979267"
                     /translation="MSLIIAGPIAIITAFFLWHYCYQLFFSPLARIQGPLIYALTGWR
                     LAYEDYKGDRSRTLHKLHSKYGPVIRVGPDEVSFNSTSALRVIYGAGSRFERTGFYRM
                     FDVAGRPNLFSFASGKAHGDRKRILAHAYAKSRMLKGDTAALIEKKVRIYQELIEREG
                     PTSNIFNSLHYFSLDVITEFLYGRFGRTACLQGVKADRALTRAMGNPERRKLTWFSVH
                     FLRFTEWLYTRDGALGCLARQFYPMQAPTTYMGIRNHALKACQSFSAVTNDEKNMEGS
                     SALIARLWQHHRSRKEGGMDDLDIASECADHLMAGIETTSDTLMFAVWSLSRPEHRHF
                     QKEVIEEVCALSENGINADGIPRVEASDKLPYVNAVIKETLRLFAPLPGSEPRSLPTN
                     TTIDGYAIPPRTVVSMSPYILHRNPEIFPEPSRFNPDRWLDESQDQAEMKKLFWAFSS
                     GGRMCIGIQ"
     gene            <1085853..>1087795
                     /locus_tag="ACHE_20367S"
                     /db_xref="GeneID:66979268"
     mRNA            join(<1085853..1087618,1087666..>1087795)
                     /locus_tag="ACHE_20367S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284662.1"
                     /db_xref="GeneID:66979268"
     CDS             join(1085853..1087618,1087666..1087795)
                     /locus_tag="ACHE_20367S"
                     /note="CAZy:GH32;
                     COG:G;
                     EggNog:ENOG410PJC2;
                     InterPro:IPR001362,IPR013148,IPR013189,IPR013320,
                     IPR023296;
                     PFAM:PF00251,PF08244;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133431.1"
                     /db_xref="GeneID:66979268"
                     /translation="MKRTTAAELLAVSWAGVAAALDYNAPPGNLSNLPNSTLFETWRP
                     KIHVLPPTGQIGDPCAHYSDPETGLFHVGYLHNSSGIAAVQTNDLVHYYDVNKNGNYS
                     ITSGGANDPVAVFDGSVIPSGINGKPTLIYTSVSSLPIHWTLPYTRGSESQSLAVTSD
                     GGNFTKLDIPPVIPEPPAGLDVTAFRDPFVFQNSELDRTLNSAKGTWYVTVSGGVHNV
                     GPGIFLYRSKSSNFEQWEYLGEWFNAPSNSTWGNGDWAKVYGFNWETANVFGLDRQGY
                     NYNGESFMTFGVEGSYIPIQKAVSSLHAQLWAAGNVSTVNGDVTFNPSMVGVLDWGLS
                     AYAAAGKVLPSTSKASSSSGAPDRFISYVWLTGDLFEAVKDFPKAQQGWQSTLLLPRE
                     LNVHTIPNVVNNGLIHDTASWRVASNFSAGNCVELETLGVNIARETYNAMTAAPSFSE
                     PNRKLSKTGVVPFDRSPNSKFFVLNAQISFPQSARNSGLKSGFQILSSELESTTIYYQ
                     FSNESIVIDRYSTSAASQTTPGINADPESGRLRLFDINESCRSNGKGKNEHMETLDLT
                     IVVDNSVLEVYANSRFALSTWARSWYANSTEIRFFHDGEGEASFSKIQVSDGLYDAYP
                     DRSQYTV"
     gene            <1089132..>1089999
                     /locus_tag="ACHE_20368S"
                     /db_xref="GeneID:66979269"
     mRNA            join(<1089132..1089307,1089359..1089415,1089712..1089792,
                     1089837..>1089999)
                     /locus_tag="ACHE_20368S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284663.1"
                     /db_xref="GeneID:66979269"
     CDS             join(1089132..1089307,1089359..1089415,1089712..1089792,
                     1089837..1089999)
                     /locus_tag="ACHE_20368S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133432.1"
                     /db_xref="GeneID:66979269"
                     /translation="MSTWALDLTGFVRNINDRDIQIEEQLTETTVNEFAQRHVLSLVR
                     CLDANEPIVLEVCYDLNAKDFGIEDPDDREIPIYQAYATGGGTLYEQHPNFLRYDIEN
                     DKLLNYLVDFMFFNVLGPGEDYIITEDYIYVLSFNIWPEDLHETSELWMERSAEMW"
     gene            <1091867..>1093391
                     /locus_tag="ACHE_20369S"
                     /db_xref="GeneID:66979270"
     mRNA            join(<1091867..1092982,1093038..>1093391)
                     /locus_tag="ACHE_20369S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284665.1"
                     /db_xref="GeneID:66979270"
     CDS             join(1091867..1092982,1093038..1093391)
                     /locus_tag="ACHE_20369S"
                     /note="COG:Q;
                     EggNog:ENOG410PW54;
                     InterPro:IPR001128,IPR017972,IPR002401,IPR036396;
                     PFAM:PF00067;
                     TransMembrane:1 (o6-26i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133433.1"
                     /db_xref="GeneID:66979270"
                     /translation="MINVFILLAAFYSVYFLWGAIWNLYYHPLHRIPGPKLWIAFPIF
                     RHISLVRGQLEADIKTFHGKYGKVVRFSTDEVSFITAQAWREIYNDFPKAELSTNVPL
                     GINNANDTNHRRYRKALAHSFSTKALTTQEPVLIEYTEKLINKMKGFAESQRPADMVK
                     WYNSTTFDLIGDLAFGVSFGNLDTDGYHFWVSNVFQAVRGIVMGTIKDAYPVLFKLFS
                     FAFGLNRFSEARARQLEYSSSTMQKRLAREEPRDLVDFMDGFLQSKDNITVEEMEANA
                     NLLIIAGSDTTATLLSGTTYYLLRTLRALEKATQEVRSAFKSESEINFLNTTARLPYM
                     VACLNEGMRMYPPVPSVLQRVAVSSKPIEISGYYISNGTKVGVHQFAANTSPINFYEP
                     DNFIPERWLPETKKDTSSPFYNDDRDVCQVFSYGPRDCIGKNLAYAEMRVILARMLWN
                     FDMEICEESNNWNKQRTFTLWEKSPLMVRLRLREGIEKH"
     gene            complement(<1098413..>1100070)
                     /locus_tag="ACHE_20370A"
                     /db_xref="GeneID:66979271"
     mRNA            complement(join(<1098413..1099503,1099557..1099672,
                     1099732..1099862,1099920..1099990,1100049..>1100070))
                     /locus_tag="ACHE_20370A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284666.1"
                     /db_xref="GeneID:66979271"
     CDS             complement(join(1098413..1099503,1099557..1099672,
                     1099732..1099862,1099920..1099990,1100049..1100070))
                     /locus_tag="ACHE_20370A"
                     /note="COG:T;
                     EggNog:ENOG410PGEW;
                     InterPro:IPR036075,IPR002791,IPR039763;
                     PFAM:PF01937;
                     go_function: GO:0051998 - protein carboxyl
                     O-methyltransferase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133434.1"
                     /db_xref="GeneID:66979271"
                     /translation="MEFDPKTPQFHTSDSSSFGYVSAHERWPVILTGAIDDLHRTVGD
                     VTDEEKRKEGKAIIENLAKLKYELQHDRQLTQIPDDGQEPTAAEYNKELEQRGNLSWC
                     NGPWLYLECYMYRRLSTYFAQSKHWKGYDVFARQKMSTFKSSRPAVLELAARYKELAL
                     EAEKGEGKDGRTIEQIEQARRVLFSEMCEICLWGNATDLSLLTTLTYEDLQKLQGSQA
                     RKAAEKNILVNDMDAAFDVLQKAQKEKEDQERRVDIVLDNSGFELFVDLILAGYLLSA
                     GIATKVVLHPKSIPWFVSDVTPRDFPDLLNALKDAQNFYTAPDDSGREHQPLSEKELD
                     EVNFLYNQWSQLHQEGKLVIRPDPFWTGAGSYWRMPHTAPELFEDLKNSELVLLKGDL
                     NYRKLTNDAAWDPTTPFTTAIGPLGPKSGLRVLAFRTCKADVVVGLPAGVDEELRQIP
                     GGGGDKKREWAWTGKWAVVSFCDGKA"
     gene            1100463..1100534
                     /locus_tag="ACHE_t20007S"
                     /db_xref="GeneID:66987341"
     tRNA            1100463..1100534
                     /locus_tag="ACHE_t20007S"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:66987341"
     gene            complement(<1100805..>1102511)
                     /gene="PPT1"
                     /locus_tag="ACHE_20371A"
                     /db_xref="GeneID:66979272"
     mRNA            complement(join(<1100805..1100840,1100894..1101624,
                     1101674..1102109,1102208..1102288,1102362..>1102511))
                     /gene="PPT1"
                     /locus_tag="ACHE_20371A"
                     /product="palmitoyl-protein thioesterase 1"
                     /transcript_id="XM_043284667.1"
                     /db_xref="GeneID:66979272"
     CDS             complement(join(1100805..1100840,1100894..1101624,
                     1101674..1102109,1102208..1102288,1102362..1102511))
                     /gene="PPT1"
                     /locus_tag="ACHE_20371A"
                     /note="BUSCO:EOG09261M78;
                     COG:T;
                     EggNog:ENOG410PGEW;
                     InterPro:IPR011990,IPR019734,IPR006186,IPR013026,
                     IPR004843,IPR041753,IPR029052,IPR013235,IPR011236;
                     PFAM:PF08321,PF00149;
                     go_function: GO:0004721 - phosphoprotein phosphatase
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_process: GO:0006470 - protein dephosphorylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="palmitoyl-protein thioesterase 1"
                     /protein_id="XP_043133435.1"
                     /db_xref="GeneID:66979272"
                     /translation="MSSDIEAANALKVQGNKAFAQHEWPTAVDFYTKAIEKYDKEPSF
                     FSNRAQAHIKLEAHGFAIVDATKALELDPGYIKAYWRRALANTAILNHREALKDFKAV
                     VKREPNNRDAKLKLADCEKLVRRMEFEKAIEVGDPPSAFEDLDIDSMAVDDGYDGARL
                     EKEMTQEFIDDMIERFKNGKKIHRKYVFQIIKAVRDLVYAEPTMVEIGVEEGNKLTVC
                     GDTHGQFFDLLEIFRRNGYPSEKHAYLFNGDFVDRGSWSTEIALLLYAYKMLRPNGIF
                     LNRGNHETDDMNKVYGFEGECKAKYNERVFKVFSESFSALPLATLIGSKYLVLHGGLF
                     SDDNTSLDDIRKLNRHNQRQPGQQGLMMEMLWTDPQTAPGRGPSKRGVGLQFGPDITK
                     RFCEKNGLEAIIRSHEVRMEGYEVEHDGRCITVFSAPKYCDTTENKGAYINLGPELKL
                     DYQVFEAVPHPPIKPMAYAQNSLLSMM"
     gene            <1102906..>1103472
                     /gene="SPT4"
                     /locus_tag="ACHE_20372S"
                     /db_xref="GeneID:66979273"
     mRNA            join(<1102906..1102983,1103054..1103251,1103327..1103379,
                     1103439..>1103472)
                     /gene="SPT4"
                     /locus_tag="ACHE_20372S"
                     /product="transcription elongation factor spt4"
                     /transcript_id="XM_043284668.1"
                     /db_xref="GeneID:66979273"
     CDS             join(1102906..1102983,1103054..1103251,1103327..1103379,
                     1103439..1103472)
                     /gene="SPT4"
                     /locus_tag="ACHE_20372S"
                     /note="BUSCO:EOG09265BBJ;
                     COG:K;
                     EggNog:ENOG410PQ6M;
                     InterPro:IPR009287,IPR022800,IPR038510,IPR029040;
                     PFAM:PF06093;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA];
                     go_process: GO:0032786 - positive regulation of
                     DNA-templated transcription, elongation [Evidence IEA]"
                     /codon_start=1
                     /product="transcription elongation factor spt4"
                     /protein_id="XP_043133436.1"
                     /db_xref="GeneID:66979273"
                     /translation="MTYYVPPGQQRTLRACMVCSLVQLHNKFMREGCPNCDNVLGLRG
                     NNDAIQECTSQVFEGLITLNDPNTSWVARWQRLDSYVPGTYAVKVTGSLPDDVIANLE
                     DAGVKYIPRDGSTGEEEP"
     gene            complement(<1103957..>1105552)
                     /gene="UGA1_1"
                     /locus_tag="ACHE_20373A"
                     /db_xref="GeneID:66979274"
     mRNA            complement(join(<1103957..1105166,1105216..1105251,
                     1105311..>1105552))
                     /gene="UGA1_1"
                     /locus_tag="ACHE_20373A"
                     /product="4-aminobutyrate transaminase"
                     /transcript_id="XM_043284669.1"
                     /db_xref="GeneID:66979274"
     CDS             complement(join(1103957..1105166,1105216..1105251,
                     1105311..1105552))
                     /gene="UGA1_1"
                     /locus_tag="ACHE_20373A"
                     /note="COG:E;
                     EggNog:ENOG410PHBB;
                     InterPro:IPR004631,IPR005814,IPR015424,IPR015421,
                     IPR015422;
                     PFAM:PF00202;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003867 - 4-aminobutyrate transaminase
                     activity [Evidence IEA];
                     go_function: GO:0008483 - transaminase activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009448 - gamma-aminobutyric acid metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="4-aminobutyrate transaminase"
                     /protein_id="XP_043133437.1"
                     /db_xref="GeneID:66979274"
                     /translation="MSALRPGLKLRSFARLPAARTISTTPLRAAQPYFSNEPSGPTVS
                     TAIPGPNNKKAAAELNEVFDVRSLNMLTDYTKSIGNYISDLDGNTLLDVYAQIASIPV
                     GYNNPHLEKVATSPEMITSLINRPALGNFPSAEWANILKTGVLKVAPKGLNQVYTAMA
                     GSDANEIAYKAAFMYRRQLERGGPEADFSEQELESTMVNQQPGSPQLSILSFKSAFHG
                     RLFGSLSTTRSKAIHKLDIPAFDWPQATFPSLKYPLEEHAQENAQEEQRCLQEVERLI
                     KEYHNPVAAVMVEPIQSEGGDNHASPAFFQGLRDITKRTNVLFIVDEVQTGVGATGKF
                     WAHDHWNLDTPPDMVTFSKKAQTAGYYYGNPALRPNKPYRQFNTWMGDPSRALIFRGI
                     IEEIERLGLVENTAATGAYLYAGLERLSKQYPQHFQNLRGKGQGTFIAWDSPKRDEIL
                     AKAKNVGVNIGGSGQSAVRLRPMLIFQNHHADILLERLEQVIKML"
     gene            1106181..1106252
                     /locus_tag="ACHE_t20008S"
                     /db_xref="GeneID:66987342"
     tRNA            1106181..1106252
                     /locus_tag="ACHE_t20008S"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:66987342"
     gene            complement(<1106927..>1107931)
                     /gene="RAD10"
                     /locus_tag="ACHE_20374A"
                     /db_xref="GeneID:66979275"
     mRNA            complement(<1106927..>1107931)
                     /gene="RAD10"
                     /locus_tag="ACHE_20374A"
                     /product="ssDNA endonuclease and repair protein rad10"
                     /transcript_id="XM_043284670.1"
                     /db_xref="GeneID:66979275"
     CDS             complement(1106927..1107931)
                     /gene="RAD10"
                     /locus_tag="ACHE_20374A"
                     /note="BUSCO:EOG09264DOU;
                     COG:L;
                     EggNog:ENOG410PP98;
                     InterPro:IPR004579,IPR010994,IPR011335;
                     PFAM:PF03834;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003684 - damaged DNA binding [Evidence
                     IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="ssDNA endonuclease and repair protein rad10"
                     /protein_id="XP_043133438.1"
                     /db_xref="GeneID:66979275"
                     /translation="MADEFGDEAHLNALLQAEQSAPPKPRNTLSSSTAPRQPTPKVQQ
                     PKPQALPPKHAPSAILVSKRQKGNPILSYIKILPWEYADIPADYVLGNTTCALFLSLK
                     YHRLHPEYIYSRIRGIAGKYRLRILLIIVDIPNHEDNLKELSKTSIINNLTLMLCWSA
                     TEAAHYLELFKASENAQPTAIRTQQAQSYKDSLTDFVTMPRSINKSDAASLISTFGSL
                     QNAINAQPEQISAVPGWGERKVRQWCNAVREDFRIETAKGTKAPERDAGAMRALEDRT
                     VTRDEEEVMRAVNAGEMRADMPGEAENARDARPRDAGEDEGVSEGITAALAKLREGGS
                     "
     gene            <1108132..>1110363
                     /gene="NOP4"
                     /locus_tag="ACHE_20375S"
                     /db_xref="GeneID:66979276"
     mRNA            <1108132..>1110363
                     /gene="NOP4"
                     /locus_tag="ACHE_20375S"
                     /product="RNA recognition motif-containing protein"
                     /transcript_id="XM_043284671.1"
                     /db_xref="GeneID:66979276"
     CDS             1108132..1110363
                     /gene="NOP4"
                     /locus_tag="ACHE_20375S"
                     /note="BUSCO:EOG09260XQV;
                     COG:A;
                     EggNog:ENOG410PI4R;
                     InterPro:IPR012677,IPR000504,IPR003954,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="RNA recognition motif-containing protein"
                     /protein_id="XP_043133439.1"
                     /db_xref="GeneID:66979276"
                     /translation="MEPQTNQEPATDGRVSRQPRQTLFVRSLPASATTDSLAEYFSQS
                     YVIKHALVVLDPQTQQPKGFGFVTFADLEDAQRALEEFNGTVFDGKKIQVDYAQPRHR
                     EVDENIGKSVPAAAAVEFKKKREEERAAQQPPRLIVRNLPWSIKEPEDLAVHFRSFGK
                     VKQAYLPKKGNTLAGFGFVVLRGKKNAEKALEAVNGKEVDGRTLAVDWAVEKNVWENL
                     QKQEEGKQDEEEKQDDGEKSGDADMAEAEEGSGDEDVSEGDEDEDEEEDDEDDEEDKF
                     DEFDEDEDDDEEEEEEEEDKEDERNASTIFIRNLPFTCTDETLYEHFTQFGNVRYARI
                     VVDPETDRPRGTGFVCFWRPGDALTCIREGPKPQDTITADKDKSKKTSAIKHSVLQSE
                     TSDPTGRYTLDGRVLQVAQAVSRNQASKLEEEGVSRRLVRDTDKRRLFLLSEGTIPTN
                     SPLYKKLSPSEIKMREDSFKQRQSFIKKNPTLHLSLTRLSVRNIPRQVTSKDLKALAR
                     QAVVGFAEEVKKNLRQPLSPEELHRASDEMKEADKLRKQKGKGIVKQATIVFEGRDGS
                     KIGENTGAGRSRGYGFIEYYTHRHALMGLRWLNGHPIDAPNSDAEVKDKKKRVIVEFA
                     IENAQVVKRRTEQEAKSRSYAQAAAQRRKEEGEEKSQKPNGKFNGKPNGKPNGKPNGK
                     FSGNKERPSPNANMAGQKRKRSESRGSDKREGEDSEEANKIAKRNRVIAKKRMQRKGR
                     KGK"
     gene            complement(<1110518..>1111022)
                     /locus_tag="ACHE_20376A"
                     /db_xref="GeneID:66979277"
     mRNA            complement(join(<1110518..1110696,1110764..1110859,
                     1110914..>1111022))
                     /locus_tag="ACHE_20376A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284672.1"
                     /db_xref="GeneID:66979277"
     CDS             complement(join(1110518..1110696,1110764..1110859,
                     1110914..1111022))
                     /locus_tag="ACHE_20376A"
                     /note="COG:S;
                     EggNog:ENOG410PQG9;
                     InterPro:IPR036400,IPR001199;
                     PFAM:PF00173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133440.1"
                     /db_xref="GeneID:66979277"
                     /translation="MVEHEEEPKRFSPKVPVELAPPKYDPIDAEELAKCDGSDPNRPT
                     LVAIKGIVFDVSRNQAYSPSGQYRVFAGKDPSRALASSSLKPEDCRPDWYDLDDKEKT
                     VLDEWFTFFSKRYNIVGKVKDATNY"
     gene            <1113186..>1115417
                     /locus_tag="ACHE_20377S"
                     /db_xref="GeneID:66979278"
     mRNA            join(<1113186..1113408,1113462..1113558,1113730..1113758,
                     1113888..1114110,1114171..1114435,1114482..1115329,
                     1115378..>1115417)
                     /locus_tag="ACHE_20377S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284673.1"
                     /db_xref="GeneID:66979278"
     CDS             join(1113186..1113408,1113462..1113558,1113730..1113758,
                     1113888..1114110,1114171..1114435,1114482..1115329,
                     1115378..1115417)
                     /locus_tag="ACHE_20377S"
                     /note="COG:E;
                     EggNog:ENOG410QDKR;
                     InterPro:IPR004840,IPR004841;
                     PFAM:PF13520,PF00324;
                     TransMembrane:12
                     (i71-88o100-127i148-173o179-201i213-233o260-280i301-
                     322o354-377i398-420o432-457i478-500o506-526i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0006865 - amino acid transport [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133441.1"
                     /db_xref="GeneID:66979278"
                     /translation="MSSNPDIVIGPVSTAIEHGESDKTTSLKTHLKNRIGKEKDTVVE
                     DGEESINSEPHKPVCDHTHRKLKPRHVELIGIGGTIGTVLYVQIGQTLLEGGPASLFL
                     AFTIWCSVILCLTVSIAEMVTFLPLSSPTIRLAGRFVDEAFGVAAGYNFFVSQVAQIP
                     FEIVACNLIITYWSDAVPVGAIVAIVLVLYIILNVFAVQWYGESEFWLSLGKVLLSVG
                     LIIFTFIVMLGGNPLNDRFGFRYWQNPGSFAEHYKKGDLGRWLGFLYCVIKASFTIAG
                     PDYVSMAAGEAINPRTVLPKAYNGVFYRLTVFFVLGTLCVGVLVPYNDSTMAAAFDQD
                     KPGAAASPYVIAMDRLHIPILPHIVNAMVLGASFSAGNSYVYCASRSLYGLALDGKAP
                     RFFTKCTRTGVPIYCVSVVLLIALLAFLQVSNSASVVINWFVNLVTASQLINFSVCTF
                     TYIRFFKALKTQGFSRETLPYTSRFQPYLAYISLVCTTTMAFVGGYEVFLPGKWDVAS
                     FFFSYTMIGVFPILYVGWKLVHRTKFRRPEEVDLVSGVEEIDDYTRNYVEVKPTNIFT
                     KTSRVLFG"
     gene            complement(<1115505..>1116029)
                     /locus_tag="ACHE_20378A"
                     /db_xref="GeneID:66979279"
     mRNA            complement(<1115505..>1116029)
                     /locus_tag="ACHE_20378A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284674.1"
                     /db_xref="GeneID:66979279"
     CDS             complement(1115505..1116029)
                     /locus_tag="ACHE_20378A"
                     /note="COG:S;
                     EggNog:ENOG410PTSW"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133442.1"
                     /db_xref="GeneID:66979279"
                     /translation="MRMSSTFSRTLLPLTLSLNLNPSIAARAATHLSAHSRTLAFSPP
                     IFHLQCPTSLHSYSTMSEKSNAKTQPQQQTQGQEQLQEQQQQQQQPYLALPESSSSGT
                     NQLDLSQPSSTVTLDHLGPMVVNTDGTLSRIANWEGMTEIERKTTLRVLGKRNKQRLE
                     ALKAAGVGVDGQAS"
     gene            complement(<1116266..>1117228)
                     /locus_tag="ACHE_20379A"
                     /db_xref="GeneID:66979280"
     mRNA            complement(<1116266..>1117228)
                     /locus_tag="ACHE_20379A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284676.1"
                     /db_xref="GeneID:66979280"
     CDS             complement(1116266..1117228)
                     /locus_tag="ACHE_20379A"
                     /note="COG:B,T;
                     EggNog:ENOG410PPT5;
                     InterPro:IPR041667,IPR003347;
                     PFAM:PF13621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133443.1"
                     /db_xref="GeneID:66979280"
                     /translation="MKLQKWLLTCHNPRVAPVRAFMAFNHRRSTSSATPSTHRYRPLE
                     PLQNGRIDRFREQYFVPELPAILPRQFFRDIPAVERWFHPATQNDDTPRLRLNTEYLE
                     QHGSSAFVPLELTQPSTSGPTNSELSFRQFHAPLSLFLQWMQTAETNPQQSTRLYLAQ
                     CQLSDLPQILRGDFPVPDLVARAGRGDVYDANVWIGHPPTYTPLHRDPNPNLFVQMAG
                     EKVVRLVSPDEGLGLFATVRRQLGKSGNREAAAIRGEEMMQGPERALLEKVVWGDADT
                     WSSEKEGYEARLGPRDGLFIPKGWWHSIKGVGEGVTASVSLLSH"
     gene            <1117687..>1119657
                     /locus_tag="ACHE_20380S"
                     /db_xref="GeneID:66979281"
     mRNA            join(<1117687..1117904,1117952..1119337,1119390..>1119657)
                     /locus_tag="ACHE_20380S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284677.1"
                     /db_xref="GeneID:66979281"
     CDS             join(1117687..1117904,1117952..1119337,1119390..1119657)
                     /locus_tag="ACHE_20380S"
                     /note="COG:P;
                     EggNog:ENOG410PFFN;
                     InterPro:IPR020946,IPR036188;
                     PFAM:PF13450;
                     TransMembrane:1 (i569-588o);
                     go_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133444.1"
                     /db_xref="GeneID:66979281"
                     /translation="MPSPAKIHKRHAYGKDAHTYIPVVIIGAGESGIAMGCRLKEALG
                     FDQFRLFDRQAGIGGSWWINRYPGVACDVPALLYSFSFSPKQDWSTLHPTGPELAQYF
                     ADVCEKYGLVDKIQLNTEVDEIKWLEDVEEWEVTLTSLVPGTGDLAKSERDAMVAREG
                     PHSVYVQTEKVRAKVVVSGAGGLVEPKQWPQGIPGIESFEGQVIHTAKWDSNVDLQGK
                     DVVVIGSGCSAAQVVPSLAEYQPKSVTQVMRTPPWIQPDLFSDKGLELWERWTPFLFS
                     YVPGLSYTLRGVMFAMFEMDFLGWFKNNRYAEWKRRSTEQKFLAYMRSATPSKYHEIL
                     TPNYDLGCKRRVVRGEWFKSLNNPNYELTTMRLTSVQSRSVTLGPGKHYPPDSAETDE
                     VRQVPADVIILGNGFETNNWLHPLRVVGRDGKNLNEVWDERGGAQAYLGLAMDRFPNF
                     FFIFGPNTATGHTSVIFASENAVNYSLNFIKPILNGDVSSYEVTEEAERAWANKVQKG
                     LQGTVFQAGNCTSWYKTESGWNSSTYPFTQIDYYLRCTFPVWRHWTAKYTSKGKWAHR
                     IRAAFNNLTLTAALSGIVWFSLHPGDFRRWAGLIPTARGSIVSAVREGLMRASQMLG"
     gene            <1119875..>1122423
                     /locus_tag="ACHE_20381S"
                     /db_xref="GeneID:66979282"
     mRNA            join(<1119875..1120032,1120107..1120183,1120240..1120285,
                     1120335..1121097,1121154..1121405,1121461..>1122423)
                     /locus_tag="ACHE_20381S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284678.1"
                     /db_xref="GeneID:66979282"
     CDS             join(1119875..1120032,1120107..1120183,1120240..1120285,
                     1120335..1121097,1121154..1121405,1121461..1122423)
                     /locus_tag="ACHE_20381S"
                     /note="COG:K;
                     EggNog:ENOG410PKDD;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     TransMembrane:1 (o573-591i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133445.1"
                     /db_xref="GeneID:66979282"
                     /translation="MASESPQMDTTASQTGASQTAVGQDETGAKRKAEQSNGTSTRTK
                     RNRYISIACNECKRRKIKCNGQVPCQRCGHLNLECRYAPNCCNNNFKDSEEFRTMKDQ
                     ITNLQDQVNSLFVNLSDLRTQQRTSLDPPSLDALSRDGSQVFTPLQHGSARPRVRHPR
                     FQGPTSSAFNFDVARSSLQEMGIAAPAEDGMVDDLTTAHATPAVSPPLHPPPPSQLVP
                     APNIVHPTKDPIWSIKREEALRLCRVYEEEIGIMYPLVDIGKITQQVNLLYTFMEAAM
                     RTGFAQRGLPGSDGLQDDNTNILKMILATTLVVEGSGQSDLGQRLYLSMKPVVDSKLW
                     EPLDIRTIQLYGLVATYHFHTDDDAMAYRVIGLAARMCLELGLHRRDALKKTFPNEDQ
                     WPDVSKIFWSIYSLDRRWSLGTGLPFVIQDEDIDPNLPEPDSSLPYLKCMVSYNRIGS
                     KIWYSGLGSEGSTDLRRDEIGYLDYQILQWYKNVPDALKFYPFDSPNHGESASRGLRR
                     LRVLLYLRMNQLRILIYRPVLHSPASIAEDHSHAQTVIDVAKDTVRVLTRLNQTSDIY
                     RTQQICFNYFLVAALAVLFLAVCHAPNEFNRQVRDEFYMALDLLSGFSTKSYVSKRLW
                     KTIKGLRTIGEKLGVLARPFASDANDPHSTAAVAMAGLAGHPIEDLSVYGSMNGVHEL
                     GNSPLNGLQMSHELTNLFEAVGGFGNFMGPSGTGAMNGFGHNGEIPNTGEGLSGVLGD
                     EGEFARVIRDLF"
     gene            <1123186..>1124241
                     /gene="CKB1"
                     /locus_tag="ACHE_20382S"
                     /db_xref="GeneID:66979283"
     mRNA            <1123186..>1124241
                     /gene="CKB1"
                     /locus_tag="ACHE_20382S"
                     /product="casein kinase 2 regulatory subunit"
                     /transcript_id="XM_043284679.1"
                     /db_xref="GeneID:66979283"
     CDS             1123186..1124241
                     /gene="CKB1"
                     /locus_tag="ACHE_20382S"
                     /note="COG:D,K,T;
                     EggNog:ENOG410PIHQ;
                     InterPro:IPR000704,IPR016149,IPR035991;
                     PFAM:PF01214;
                     go_component: GO:0005956 - protein kinase CK2 complex
                     [Evidence IEA];
                     go_function: GO:0019887 - protein kinase regulator
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="casein kinase 2 regulatory subunit"
                     /protein_id="XP_043133446.1"
                     /db_xref="GeneID:66979283"
                     /translation="MSSSEGAPESWISSFCSLMGHEFFAEVSEDFIEDDFNLTGLQSQ
                     VPMYKEALEMILDVEPEEDEEEDEEEEDEEEEEDEILGDEKPPGYRGGQRRHARVASD
                     LSVIESSAELLYGLIHQRYITSRPGIQQMLEKYEMQHFGVCPRANCNGCKVLPVGRSD
                     TPGQETVKLFCPSCQDLYTPPNSRFHSVDGAFFGTTFGCLFFMTFPDLDIGPRLDDPI
                     TPALQQRYPGLTASAASRESDDQQFEINGVRTANFCPGLGLGKIYESRIYGFRVSERS
                     RVGPRMKWLRMKPTDIRELDEMAFVESLRRRNEQVAEEEGEEVDSDTEMQAAPASNTI
                     EGRKKAPIRRRRKVLGE"
     gene            complement(<1126423..>1127491)
                     /locus_tag="ACHE_20383A"
                     /db_xref="GeneID:66979284"
     mRNA            complement(join(<1126423..1126566,1126646..1127268,
                     1127323..>1127491))
                     /locus_tag="ACHE_20383A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284680.1"
                     /db_xref="GeneID:66979284"
     CDS             complement(join(1126423..1126566,1126646..1127268,
                     1127323..1127491))
                     /locus_tag="ACHE_20383A"
                     /note="COG:S;
                     EggNog:ENOG410PRE1;
                     InterPro:IPR004827;
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133447.1"
                     /db_xref="GeneID:66979284"
                     /translation="MPTMHRSSNYYSSRRSSNHGTSSAFSPNANPNEDWTKISDLAER
                     RRIQNRIAQRNYRKKLKRRLEDLEKRAASSSASPEQSHAEPALPKSGRSRTVRNRSKS
                     SISSINNSIDNDHLSISNNGSNRGSSPLIPTVTRTLYGDASYSDDQRGGMFSLQCTRQ
                     LSASPPPVFSYSSYSHLNPYGSPAYGQSPPLYHSPSFQSSNTPSFHGLPSFSGDYVEY
                     PSTGHIKRSYADDEIMSPFSQSYASMAGIDLGSNTLQLPSGSSNIPMSPPPPLAQSHV
                     DDRSTSTSSTPAEMSLACPLTPESDPCSPRSFPLF"
     gene            complement(<1129706..>1131152)
                     /gene="BAT2"
                     /locus_tag="ACHE_20384A"
                     /db_xref="GeneID:66979285"
     mRNA            complement(join(<1129706..1129718,1129797..1130495,
                     1130549..1130846,1130924..>1131152))
                     /gene="BAT2"
                     /locus_tag="ACHE_20384A"
                     /product="branched-chain-amino-acid transaminase bat2"
                     /transcript_id="XM_043284681.1"
                     /db_xref="GeneID:66979285"
     CDS             complement(join(1129706..1129718,1129797..1130495,
                     1130549..1130846,1130924..1131152))
                     /gene="BAT2"
                     /locus_tag="ACHE_20384A"
                     /note="COG:E;
                     EggNog:ENOG410PIW1;
                     InterPro:IPR036038,IPR018300,IPR001544,IPR043131,
                     IPR043132,IPR033939,IPR005786;
                     PFAM:PF01063;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004084 - branched-chain-amino-acid
                     transaminase activity [Evidence IEA];
                     go_process: GO:0009081 - branched-chain amino acid
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="branched-chain-amino-acid transaminase bat2"
                     /protein_id="XP_043133448.1"
                     /db_xref="GeneID:66979285"
                     /translation="MKSLHRLACRKASNGFPVSRALPLQTTAATRLWQRSYSAAASQL
                     AALDASKLSVTKTSTPKEIISPKDLVFGKTFTDHMLSIEWNAGSGWDTPRIVPYQNLS
                     LDPSACVLHYAFECFEGMKAYKDSNGKIRLFRPDKNMERLNKSSSRIALPTVDGGALT
                     KLIGELVKLDSRFIPNSRGYSLYLRPTMIGTQNTLGVGPPGSALLFVIASPVGPYYAT
                     GFKAISLEATDYAVRAWPGGVGDKKLGANYAPCVVPQLNAASRGFQQNLWLFGEEEYV
                     TEVGTMNLFMALKDKETGQKELVTAPLDGTILEGVTRDSVLGLARERLTPKGWKVSER
                     KIKMSELAEASSEGRLLEVFGSGTAAIVSPVRSISYRGQLVDCGLNAEEEAGEIALNM
                     KNWIEGIQYGDEAHPWSYVL"
     gene            <1131821..>1134587
                     /locus_tag="ACHE_20385S"
                     /db_xref="GeneID:66979286"
     mRNA            join(<1131821..1133237,1133296..>1134587)
                     /locus_tag="ACHE_20385S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284682.1"
                     /db_xref="GeneID:66979286"
     CDS             join(1131821..1133237,1133296..1134587)
                     /locus_tag="ACHE_20385S"
                     /note="BUSCO:EOG09261YGB;
                     COG:T;
                     EggNog:ENOG410PH91;
                     InterPro:IPR000719,IPR011009,IPR016024;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133449.1"
                     /db_xref="GeneID:66979286"
                     /translation="MFSSFKSNISSNYQISPHPVVISGPWRVHDGKKKSTGTAASVFI
                     FDKKFLEPRAGAFGKSSSSSTKKLQEEVIERLKREASSLARLRHPSVLQVLEPVEETR
                     NGGLMFATEHVTASLGGLLRQKDEQERVGSRTSRYMVERPDGSRGRRELEIDELEIQK
                     GLLQVAKGLEFLHESAGLVHGNLNPEAIFINAKSDWKISGLGFAGPPDSTETRSSLPP
                     LALSEVLYHDPRLPASVQLNLDYTSPDFAMDSNVSSAADLFSLGLIIVAIYNSPHVSP
                     IESHSNLSTYKKLLSSPSSTPSQTNNFLASGAIPRDLASNLLPKLITRRPAQRLNARE
                     FQQSQYFDNILVSTIRFLESLPAKNPSEKSQFMRGLQRVLPDFPVSVLERKILGALLE
                     ELKDRDLLQLILQNVFAILQRIPSARRIFPERVIPRLKEIFPTGSGKGQERDSKRDAG
                     LMVVLENMKVISENCSGMEFKNEILPLIRLGMDSPTHSLADVAIKCLPIVLPVLDFST
                     VKNEVFPPIATTFSRTSSLAIKVRCLDAFTVLCGGSADTESEPEDDLSGVAPTKQSKP
                     IKSSILDKYTIQEKLVPSLKVIKTKEPAVMMAALNVFRQVGIVGDTDFLALEVLPILW
                     SFSLGPLLDLRQFEQFMTQIKNISAKIEREQKKKLQELSSGDTSGFRNGTKSPSVVAT
                     LDQGDMNDNFERLVLGKGATPSDADIDAWDTMDSGPTPQTSAPAAPPSFSWSTSNAPG
                     PVSRGSTPAQSNPNFRSVTPDYNISSFPSLEPAPRQVSPMAQGFPALRPSPSGSWSSS
                     TSQRNVQGNTAGPSLAALASMKSASSTASTSISFGQSNYSAFSIPPPPASGSIPPQPS
                     AFGGVSNAAKPPPLGANVMQNPLSNTNTFEPVNTEKQGLDKYESLI"
     gene            <1134918..>1137363
                     /locus_tag="ACHE_20386S"
                     /db_xref="GeneID:66979287"
     mRNA            join(<1134918..1135246,1135312..1136191,1136248..>1137363)
                     /locus_tag="ACHE_20386S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284683.1"
                     /db_xref="GeneID:66979287"
     CDS             join(1134918..1135246,1135312..1136191,1136248..1137363)
                     /locus_tag="ACHE_20386S"
                     /note="COG:S;
                     EggNog:ENOG410PG5W;
                     InterPro:IPR005317,IPR039461;
                     MEROPS:MER0004247;
                     PFAM:PF03571;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0008239 - dipeptidyl-peptidase activity
                     [Evidence IEA];
                     go_function: GO:0070006 - metalloaminopeptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133450.1"
                     /db_xref="GeneID:66979287"
                     /translation="MRLSRGLATRCWPSEHRFLHRPSVSILPLNRHHSPHSYHRPLPA
                     LFPVLPSRSNISTQTSLRTLVTMMDENIKQHYLADSPPTVVRLEVKQHFDKLQDPKLR
                     KYAHYISRAAFEGTRVTLRQVSPESEPIYDLIISLYRACNGDWTSLAQKTNVSTEDLR
                     FFLEYAVQFLGNCGNYKGFGDSKFIPRLPPSSLKALASATPETKAAFEKASKTGGGIY
                     ETKEQSLMHLGYPGAGHMTTYYPESPNISQDEITAIGDLMEQKGLPLENTRLKKTASG
                     DFELLIASGVSSPPPRDRDLGEVETFDLDGKLKGKKVNLVFGDHKEEMAKIAHSIKQA
                     SLHAANDTQKKMLDAYALSFGAGSIEAFKESQRIWVKDQKPALETNIGFVETYRDPHG
                     VRGEWEGFVALVNLERTRAFGKLVDNAESMIPKLPWGVDFEKDKFLSPDFTSLEVLSF
                     QSSGIPAGINLPNYDDIRQNLGFKNVSLGNVLSAKAPNEPVPFIAEKDLDVYRRCRDP
                     AFEVQVGIHELLGHGTGKLLQETAPGEYNFDISNPPVSPVDGKPISTWYKPGQTWSSV
                     FGAIASSYEECRAECVAMALGCDFGILKIFGFGDGKEDLSNEAGDVLFAAYLQMARAG
                     LVALEFWDPKTEKWGQAHMQARYSIMRTFLDAGDDFVKLVYNKEDLSDLEIHLDRSKI
                     LTHGRPAVEKYLQKLHVYKSTADVQAGKKLYDDITSVNEWWGTKVRDVVLKNKVPRKV
                     FVQGNTVLNGDEVTLKEYEPTLEGMIQSYVERDI"
     gene            <1138587..>1139833
                     /locus_tag="ACHE_20387S"
                     /db_xref="GeneID:66979288"
     mRNA            join(<1138587..1138665,1138789..1138825,1138880..1139015,
                     1139081..1139433,1139494..1139758,1139813..>1139833)
                     /locus_tag="ACHE_20387S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284684.1"
                     /db_xref="GeneID:66979288"
     CDS             join(1138587..1138665,1138789..1138825,1138880..1139015,
                     1139081..1139433,1139494..1139758,1139813..1139833)
                     /locus_tag="ACHE_20387S"
                     /note="COG:S;
                     EggNog:ENOG410PNDS;
                     InterPro:IPR011333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133451.1"
                     /db_xref="GeneID:66979288"
                     /translation="MAAAGGASSIITQVQQAGGPPINTLGDIGGNENITLELRGTRFT
                     LSRDELLTLPEFVLLSLFPNGLLPDGHMGTFHEGDIYPVDYDPASLQYMLDFFRSVAQ
                     SIPSSSPSESTSPDVDVPSDSMLGSARDALQDRAGIIVLREDLDFYVIPPRADIDHTE
                     MIEVKRAAAQTLLKQDGIFSGLKKSDEVGSTEQHLIEMLTAGGFNRDDHWGHRAPEPH
                     KAVICSLALAKLRTDIRGDLSNNSTIGMAQKLLLFWRKPARRCWWEGIELDEVEGVEG
                     KVKVWIRRVWTLEMSVIGLR"
     gene            <1140677..>1142541
                     /gene="SFH1"
                     /locus_tag="ACHE_20388S"
                     /db_xref="GeneID:66979289"
     mRNA            join(<1140677..1141014,1141093..1142238,1142301..1142385,
                     1142443..>1142541)
                     /gene="SFH1"
                     /locus_tag="ACHE_20388S"
                     /product="chromatin structure remodeling complex protein
                     Sfh1"
                     /transcript_id="XM_043284685.1"
                     /db_xref="GeneID:66979289"
     CDS             join(1140677..1141014,1141093..1142238,1142301..1142385,
                     1142443..1142541)
                     /gene="SFH1"
                     /locus_tag="ACHE_20388S"
                     /note="COG:B,K;
                     EggNog:ENOG410PISS;
                     InterPro:IPR006939;
                     PFAM:PF04855;
                     go_component: GO:0000228 - nuclear chromosome [Evidence
                     IEA];
                     go_process: GO:0006338 - chromatin remodeling [Evidence
                     IEA]"
                     /codon_start=1
                     /product="chromatin structure remodeling complex protein
                     Sfh1"
                     /protein_id="XP_043133452.1"
                     /db_xref="GeneID:66979289"
                     /translation="MSPLRGYITSYPPRVRHYGNALLTPVIPQSQVGPTPRTTKRGTT
                     AINYAEDGFDDDFEEEEGRRPTGLRSLRREESMTEKLPISDKLGKEVHAPVEVQGVFR
                     DWMIKRMLRPACADQLQIQAQLPLTLIPIRIDLEVPSHQPLEPFPLPRGIVDPAINPT
                     LPGYRRPDPLPAFRIKDTFLWNLHEALATPEEFAVGFVRDLDLPSPQAMTLAISNQIR
                     QQLEEYAGVALHPLFQSTQIQPPAPQIGQSRDVSTTPAPTNLPATPEVTVTKEPLVND
                     SILNPDDAYRCMINLNINLQNKLYTDKFEWSLLHPPGMAEDFAKVTCADLGLNGEWVG
                     AIAHGIYEAVLKLKKEVCESGGLISGYGNEIDNQAANGAEAGWRYDPEGLGDEWEPKV
                     ETLSKEEIERREGDRERQIRRLRRETARFSSTAGITPDALRQGSGYFDVDGETPLGRG
                     ERNKRKKRFRSLSPSGRGGTPGGRGTPDTGSGAGYGGGGGTLSDWERQNWRCSNCMVW
                     GTAVWAVRDGPAGSRTLCHNCGLLYERDKVVPEWSKDLHRHDIPVGR"
     gene            complement(<1145893..>1146637)
                     /locus_tag="ACHE_20389A"
                     /db_xref="GeneID:66979290"
     mRNA            complement(join(<1145893..1145955,1146032..>1146637))
                     /locus_tag="ACHE_20389A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284687.1"
                     /db_xref="GeneID:66979290"
     CDS             complement(join(1145893..1145955,1146032..1146637))
                     /locus_tag="ACHE_20389A"
                     /note="COG:S;
                     EggNog:ENOG410PYDT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133453.1"
                     /db_xref="GeneID:66979290"
                     /translation="MLPPLDSFLQQHLKLREITANMQNQQPLVSPPPPYTTTRQYNLV
                     SEDIYPDNEIDTNTDDEDIWDNTIPTPTTINIDASISIKGDNNTIIITSGSSSVPGPS
                     MTSSPPSTSTLQAAQKHRQNRVTEMATSIIEALKESRTSGKGPIEVNISTGMKVEGSR
                     NVISAGAGGGACRILPRAKRDGSSHDGDEAGLSLKRKRRAQSEPVENMPKMKKECSPS
                     LRAK"
     gene            complement(<1147636..>1148882)
                     /locus_tag="ACHE_20390A"
                     /db_xref="GeneID:66979291"
     mRNA            complement(join(<1147636..1147791,1147891..1148706,
                     1148769..>1148882))
                     /locus_tag="ACHE_20390A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284688.1"
                     /db_xref="GeneID:66979291"
     CDS             complement(join(1147636..1147791,1147891..1148706,
                     1148769..1148882))
                     /locus_tag="ACHE_20390A"
                     /note="COG:S;
                     EggNog:ENOG410PQX7;
                     InterPro:IPR024111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133454.1"
                     /db_xref="GeneID:66979291"
                     /translation="MSDALCGPSNALQNFQKHASVDRTLQQDRLISRQPQSQGFRSQN
                     TNEGSLDPEFAAFESNLAGPSAPQLHHAGPFAAPGPYHPMPGHMETPNWASDFQRLQI
                     SGPSHPIHQQPGPSMAAQQGWQNEFMAQQRPHQPQQQQAPGPQHHQPYGYGFRPSFAQ
                     NYSLSSAQMDSAQMDTFQPQETVESQQPQANAFDESAFEAAFEQAKATMELEETNTAQ
                     THAEIVNESAQFDPTVQPETHEEIRIGSDTIAPKEDTQGRPNDADELARTAGQLLNSV
                     SHETNEKFQQSNFLALMRRIRDREVQIEGDEFRETAQSLHPGGKYYPQDNKQQQTPRP
                     ASRNGNAHIISNGTSEFDQAGSLNILS"
     gene            <1149361..>1150686
                     /gene="SEC13"
                     /locus_tag="ACHE_20391S"
                     /db_xref="GeneID:66979292"
     mRNA            join(<1149361..1149363,1149451..1149495,1149594..1149709,
                     1149773..1149803,1149888..1150297,1150362..>1150686)
                     /gene="SEC13"
                     /locus_tag="ACHE_20391S"
                     /product="GTPase-activating protein S13"
                     /transcript_id="XM_043284689.1"
                     /db_xref="GeneID:66979292"
     CDS             join(1149361..1149363,1149451..1149495,1149594..1149709,
                     1149773..1149803,1149888..1150297,1150362..1150686)
                     /gene="SEC13"
                     /locus_tag="ACHE_20391S"
                     /note="COG:U;
                     EggNog:ENOG410PGDS;
                     InterPro:IPR036322,IPR015943,IPR001680,IPR037363,
                     IPR020472,IPR037596,IPR017986;
                     PFAM:PF00400;
                     go_component: GO:0030127 - COPII vesicle coat [Evidence
                     IEA];
                     go_function: GO:0005198 - structural molecule activity
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA];
                     go_process: GO:0090114 - COPII-coated vesicle budding
                     [Evidence IEA];
                     go_process: GO:1904263 - positive regulation of TORC1
                     signaling [Evidence IEA]"
                     /codon_start=1
                     /product="GTPase-activating protein S13"
                     /protein_id="XP_043133455.1"
                     /db_xref="GeneID:66979292"
                     /translation="MAAAQVISNSGHDDMIHDAGLDYYGRRLATCSSDKTIKIFEIEG
                     ETHRLIETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQHQNTTSPVGSSAW
                     TKVFDFSLHTASVNMVSWAPHESGCLLACASSDGHVSVLEFRDNSWTHQIFHAHGMGV
                     NSISWAPAASAGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNHETKTYNPTQTLEGHT
                     DWVRDVAWSPSILSKSYIASASQDKTVRIWTSDASNPGQWTSQQLEFDSVLWRVSWSP
                     SGNILAVSGGDNKVSLWKENLKGQWEKVKDIEE"
     gene            <1151370..>1152332
                     /locus_tag="ACHE_20392S"
                     /db_xref="GeneID:66979293"
     mRNA            join(<1151370..1151415,1151476..1151937,1151992..>1152332)
                     /locus_tag="ACHE_20392S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284690.1"
                     /db_xref="GeneID:66979293"
     CDS             join(1151370..1151415,1151476..1151937,1151992..1152332)
                     /locus_tag="ACHE_20392S"
                     /note="COG:Q;
                     EggNog:ENOG410PNZX;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133456.1"
                     /db_xref="GeneID:66979293"
                     /translation="MSKAADTKIAVITGGTSGIGYAVAVALSQRPDWQVYILGSNEER
                     GRKAVEGQSNIYFHKANVSQYQELALAFHEIHGKNGRLDFVFANAGATESCNILQAEG
                     ADANTPPPEPDLTVVDVNVKGVLYTSYLATHYFRLSPHKGKDASLVITGSCGSLYPFK
                     VSPTYCGTKHNVVGFTRSIALRCKEEGIRVNALCPGIVRTGFVSDEFWDTYFKPEQFC
                     PMELMVKVTLLLVDGSEIVDSNGTKVSAGEMYGQTLETSGSNFYLREHLEFCDDTAKD
                     VMVGAN"
     gene            complement(<1153523..>1155258)
                     /locus_tag="ACHE_20393A"
                     /db_xref="GeneID:66979294"
     mRNA            complement(join(<1153523..1154648,1154712..1155008,
                     1155068..>1155258))
                     /locus_tag="ACHE_20393A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284691.1"
                     /db_xref="GeneID:66979294"
     CDS             complement(join(1153523..1154648,1154712..1155008,
                     1155068..1155258))
                     /locus_tag="ACHE_20393A"
                     /note="COG:F,P;
                     EggNog:ENOG410PG6B;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:12
                     (i45-63o91-111i118-136o142-165i177-199o205-227i324-
                     343o349-369i376-398o424-449i461-483o495-513i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133457.1"
                     /db_xref="GeneID:66979294"
                     /translation="MSDHQSGPNAPLLASQAETDRDYDDHDLDHEQQPIDLEPGYSGG
                     WFIWALTFSAGISGLLFGYDTGVISSTLVSVGSDLSNRELTTVDKSLITSSTSLFALI
                     ASPLAGILADKLGRKRVILVVDGFFTLGAVLQAITSQVWWMIVGRSIVGLAVGSASLV
                     TPLYISELAPSHARGRLVTILSLFITGGQVVAYIVGWLFSSVSGGWRWIVGLGAAPAI
                     LQFIILFSLPETPRWLVQVGRGTEAMNVLTRIYQAHPGNNALANRVMRGIQQEVAEEE
                     EELSTNKPTDNNMQWAHDVSQRAHELFRVGGNRRALTIAAMLQGLQQLCGFNSLMYFS
                     ATIFSMLSFSSPTLTSLSVAMTNFVFTLFAFAFIDRIGRRRILLYSIPVMIVSLIVCA
                     LSFSSFKISPMSSGPGPAARGEANDPSETSSFLPIAILLCLTIYTASYAFGLGNVPWQ
                     QSELFPLNVRSLGSALATATNWGSNFIVGLTFLPMMEWLSPGWTFAAYAIVCAVGWVG
                     VWAIYPEMSGLSLEEVKDLLADGWGVDRT"
     gene            <1155892..>1156949
                     /locus_tag="ACHE_20394S"
                     /db_xref="GeneID:66979295"
     mRNA            join(<1155892..1156429,1156486..1156552,1156619..>1156949)
                     /locus_tag="ACHE_20394S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284692.1"
                     /db_xref="GeneID:66979295"
     CDS             join(1155892..1156429,1156486..1156552,1156619..1156949)
                     /locus_tag="ACHE_20394S"
                     /note="COG:I;
                     EggNog:ENOG410PG6G;
                     InterPro:IPR006694;
                     PFAM:PF04116;
                     TransMembrane:3 (o54-81i102-119o139-159i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0008610 - lipid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133458.1"
                     /db_xref="GeneID:66979295"
                     /translation="MDVALELLDPLILDKAYAWALPYPGVSNSSDPILSAGDEAPTSL
                     WSRDNIYRQIISILVLTQIGATSLYLIFSALSYYFVFDRRLEYHPRFLKNQVRQEIKS
                     SLSAVPFINILTLPFFLAEVRGKSLLYRNVSDYGWSWMLISSILYMAFNDIGIYWIHR
                     LEHHPSVYKYIHKPHHKWIVPTPWAALAFHPLDGYVQSLPYHVFVFICPMQRHLYMAL
                     FGAVQIWTILIHDGDMITGHWTEKFINSPAHHTLHHMYFTVNYGQYFTWADNYFGSHR
                     APEPALDPLHDALKVMRVKGLVDEQGNLIKKPKGE"
     gene            <1157467..>1157721
                     /locus_tag="ACHE_20395S"
                     /db_xref="GeneID:66979296"
     mRNA            <1157467..>1157721
                     /locus_tag="ACHE_20395S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284693.1"
                     /db_xref="GeneID:66979296"
     CDS             1157467..1157721
                     /locus_tag="ACHE_20395S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133459.1"
                     /db_xref="GeneID:66979296"
                     /translation="MQGTTLIQLYACLQQALCPLDVSVEPHCYTKRRKHMTPSTVVKI
                     DSFGKEFQQRLVMMTESTDERSAAGPQIIIHIPAVVQGYL"
     gene            complement(<1159495..>1162079)
                     /locus_tag="ACHE_20396A"
                     /db_xref="GeneID:66979297"
     mRNA            complement(join(<1159495..1159846,1159905..1160373,
                     1160432..1160692,1160748..1161051,1161102..1161182,
                     1161243..1161965,1162017..>1162079))
                     /locus_tag="ACHE_20396A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284694.1"
                     /db_xref="GeneID:66979297"
     CDS             complement(join(1159495..1159846,1159905..1160373,
                     1160432..1160692,1160748..1161051,1161102..1161182,
                     1161243..1161965,1162017..1162079))
                     /locus_tag="ACHE_20396A"
                     /note="BUSCO:EOG09260OM6;
                     COG:E,J;
                     EggNog:ENOG410PFJH;
                     InterPro:IPR017871,IPR027417,IPR003593,IPR003439,
                     IPR032781;
                     PFAM:PF12848,PF00005;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133460.1"
                     /db_xref="GeneID:66979297"
                     /translation="MEAELQTQIPGLDRVISEYSVGYLTHASNAYVEDANAPSPLAEA
                     ADSVTELLVSASGDFSDQNAEAIRNLVEKFITGLSARDGVDPERRQMPFTAKKLDQAI
                     NVGSQRNMSSTLGLTGGNVDLESVGRKVESRVDRKKLEKAERKIRAKQEKKQMKTVQY
                     ESSRLLTQPDEAMSYEEFFMAVNPLQLGADNQSKSKDIRVDGIDVAVGGHRILTDASL
                     TLAYGHRYGLVGQNGIGKSTLLRGLSRREVAVPHHISILHVEQEITGDDTPALQAVLD
                     ADVWRKHLLQEQEKISKELAAIEAERSSMADTSQDAAKLDHEREGLDITLTDIHNKLS
                     EMESDKAESRAASILAGLGFSPERQQYATKTFSGGWRMRLALARALFCEPDLLLLDEP
                     SNMLDVPSITFLSNYLQGYPSTVLVVSHDRAFLNEVATDIVHQHSERLDYYKGANFES
                     FYATKEERRKNAKREYERQMAERAHLQAFIDKFRYNAAKSSEAQSRIKKLEKMPILEA
                     PEAEYSVHFKFPEVEKLSPPIVQMSEVAFGYTPDKPLLKNVDLDVQLDSRIGIVGPNG
                     AGKTTVLKLLTGQLQPTKGLISQNSRLRVGFFAQHHVDALDLTTSAVSFMAKTYPGKT
                     DEEYRRHLGAFGITGMTGLQRMELLSGGQKSRVAFACLSLTNPHILILDEPSNHLDIE
                     GMDALSQALQNFEGGVVMVSHDVTMLQNVCRSLWVCDKGTVQQFDGNVEAYKKMISAQ
                     ANEAGVAIAH"
     gene            complement(<1163452..>1163916)
                     /locus_tag="ACHE_20397A"
                     /db_xref="GeneID:66979298"
     mRNA            complement(<1163452..>1163916)
                     /locus_tag="ACHE_20397A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284695.1"
                     /db_xref="GeneID:66979298"
     CDS             complement(1163452..1163916)
                     /locus_tag="ACHE_20397A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133461.1"
                     /db_xref="GeneID:66979298"
                     /translation="MIDPLVRVVNLPGRSNFGKILVQRSQTTLISRFQGTHTIINHSS
                     FHYVQVLREKGNVVIVGPRQWVILISLARIHNNAEDTMDGSRLRHAMHMYDVRPNNTH
                     TTRARVRVSVVSIKLQRDAKMIVRVSVRLSKVPRNKGPLTSGCIEYSIIPTS"
     gene            <1165991..>1169442
                     /locus_tag="ACHE_20398S"
                     /db_xref="GeneID:66979299"
     mRNA            join(<1165991..1166008,1166212..>1169442)
                     /locus_tag="ACHE_20398S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284696.1"
                     /db_xref="GeneID:66979299"
     CDS             join(1165991..1166008,1166212..1169442)
                     /locus_tag="ACHE_20398S"
                     /note="COG:S;
                     EggNog:ENOG410PPFS;
                     SECRETED:SignalP(1-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133462.1"
                     /db_xref="GeneID:66979299"
                     /translation="MEHVSTLCALSTIGVAATGLAIGRVDQTSSPSTKFGRFRRKTLS
                     LTDPPVAKTNAIDSPVSDVYLEASTLSGTTPAESPARPGPRDAEKSAALNGLQSTEEN
                     PTPRRKLPLFAGVRQHCRSQTLSSPTAPVAKKEPQTAHVRRSSSWLKRLSIVPSQIDS
                     RVTSPSPLSPSFNRSASPALSRSQSQRRAPNKLVKRPALELSHNAHSSSGRSSLASPT
                     FRRPATSYQRFEKSRHKPTHSLNFEPGSFTNAPPVQSPTANKAPELVNNEATVRPYLA
                     STVDTVDRLPERLVCKLSTAPTPRDHRLRRIIAPGTVAAPVLVRATSIRNRRSPSEEI
                     PASPITPATPATPASAPVQFRNPFQSVSGTSAERPETAYVPEEKADRPSVSFDDASTK
                     RDAQNAAPIDAEQRARGGSLTYRKKRALSTPLPQLPKSEREVSASFLPNGPRNITDPA
                     PAGIEGRQNFLPSSPVPRDFQSTMGSLQGRARRPSTSDSVARSALRSGSSPRQFDSNS
                     IVTTARQRPRRHSVAASDPASTIFGSDDTRVFTSGDEDETDFLSDAAFDSIRTQITTS
                     SKTASRRPRVDTIFDNAPTAGSPGLAKLEDLIPRGTFVPRSTVTDPFAPGIDKAPVPS
                     SLSFVSQERTDTRGGESSRLSLLSDLSDDDDDDDDDRSMLAALPGEMSGPLFPPKQRV
                     SRWPRHEYDLPGLDALDVFEDHNGARVSSNPYEFRNSSKETLESAPKINIFDWSEKPR
                     SDREMSGSESRPRTVHGKQALECRGSRAPGRKAPTTLHLRSQSVPVSRDPSISSESRQ
                     NSGKFGTWGLGSKGVSEDWDDDFEFDDDDEEDDFFGEKIAEPRQNTTRHGMAVPKAIM
                     DRQASLHGQFGHVQELTLLVEELKRLRHQASALDLVHGPSSELWKEADGIVNLATVDE
                     DDNTPSPPRSPSSLTFSFGDSEEESTFLRRVSGESWPASISGVSISSNINNNNNHKNH
                     NDNNNASRDRTCEESSSAKAKSVLDLIYQQRASAYNDADTPRPKKLPFDTQSLRDLVI
                     RAGVVTRSLKEVIRKAEGVRTTPEKGMVPADPPFSRIFERSSNDEDHAFCGL"
     gene            complement(<1170372..>1172365)
                     /locus_tag="ACHE_20399A"
                     /db_xref="GeneID:66979300"
     mRNA            complement(join(<1170372..1170545,1170604..1170682,
                     1170747..1171865,1171923..>1172365))
                     /locus_tag="ACHE_20399A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284698.1"
                     /db_xref="GeneID:66979300"
     CDS             complement(join(1170372..1170545,1170604..1170682,
                     1170747..1171865,1171923..1172365))
                     /locus_tag="ACHE_20399A"
                     /note="COG:G;
                     EggNog:ENOG410PFTW;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i149-169o189-209i216-234o240-263i275-297o309-326i382-
                     401o421-440i461-483o489-508i515-532o552-577i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133463.1"
                     /db_xref="GeneID:66979300"
                     /translation="MDPLSRDLEKAEIEASHPSQSLNHHHENRSSASVASSGLSASDS
                     SSISSSRSGFHDDDDYISRIQTAQTQRSTALERHPTAISRIATQRSQHSATVGALKSR
                     PSKKPLPEFGAGKPYPPPLPSKEEYVVEFSGPDDPLHPQNWSTKKKIATAVMLAWTTF
                     NATFTSSIYSTANSVVSSKFGVSTEVGTLALSLYVLGFACGPTLFSPLSELQGRKLPI
                     LIGMFGFTVFQFAVATAENLQTVIICRFFGGFFGSCPIAVVAAVFSDIFDNRNRGLAI
                     TVFTMTVFTAPLFAPFIGGFIVESYLGWRWTEYLTGIMGASAFVLDLFFLEETYPPVV
                     LVKKASDLRRRTKNWGIHAKQEEIEVDLLELIQKNFSRPVRILFTEPILLLLSIYMAF
                     LYGLLYLFMTAYPIVFQQIHGFNKGVGGLTYFGMIIGEFLGGFFIILLQPWYNKKLDS
                     NNGIPIPEWRLPPAILGGVSFSGGLFWFGWSGYRADIHWAIPAVSGLLTGFGLLCIFL
                     QCMNYIIDAYLVFAASALAANSILRSTAGAGFPLFATYMFNGLGVNWTGTLLGCVAAV
                     LMPIPLLFYLYGHKIRAKSTFSTDYIAAVQAHNDEAAD"
     gene            <1174821..>1177007
                     /locus_tag="ACHE_20400S"
                     /db_xref="GeneID:66979301"
     mRNA            join(<1174821..1175077,1175138..1176706,1176764..>1177007)
                     /locus_tag="ACHE_20400S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284699.1"
                     /db_xref="GeneID:66979301"
     CDS             join(1174821..1175077,1175138..1176706,1176764..1177007)
                     /locus_tag="ACHE_20400S"
                     /note="COG:S;
                     EggNog:ENOG410PMAD;
                     TransMembrane:1 (o79-99i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133464.1"
                     /db_xref="GeneID:66979301"
                     /translation="MHHHHQHSARYSRIYPRRPDAVPRDRIPLLEVPEVPEVPASGPT
                     LVPRAPVPVPVPSSGSSESSTSGEKPTSTTTTTTLPVVLGAVVPIVCAIVILVYLHRR
                     NVRRLRNEDANDKHKSLDFGMDIVDPPYKGMPMQEAEKGARVNHTKGLSLDVGHPYLM
                     PPGLHGSQDSFNIGGEDDRYRHAVSILAPDSASTRSHPRGPPSMLSNAAPSTNGRDNA
                     QKSMLNDPSQAGLHFDFPPSKSPSPGPFDDHKRHSAASSSDGTAADIRKSNSHLASAI
                     HRNSLPSDPFKHPDEAEISDDDSLHHHDVPVQEPAPVHLEQSPAVPTPRISLPVSDAG
                     SDYSNHRKTAASIPAVNISGAEDTQEPSHDASPLNPPPIPEEPQSKNSGLDPRRDTRR
                     MTFGLRPLPPEDPTDNPEQRANRIRSFYKEYFEDSKTGRETTYYEDFGPEFYGYPDDM
                     AHDPSYDDYYGPPPAPFAEPVTRRAMTPPPRAPPPFQPGGRHMPSGSVSGFSGFSSGF
                     GDPGPRAMSSASNRMPMPGPPRAPRRPAPPPAPLNILPTPHMLKDDAIMGAIDFAPGN
                     TFKDQREGRAETPLGGRRPFSPMTRAATPLASAFDELSVMPSPHALRKSGAYSNLDFA
                     PPPRFKTAETASDAGSIRSNGTGLSNAQLHNIRTGAYRVSRLPTSTVGTKDDMFSELR
                     PKWEMRT"
     gene            <1179049..>1180368
                     /locus_tag="ACHE_20401S"
                     /db_xref="GeneID:66979302"
     mRNA            join(<1179049..1179061,1179140..>1180368)
                     /locus_tag="ACHE_20401S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284700.1"
                     /db_xref="GeneID:66979302"
     CDS             join(1179049..1179061,1179140..1180368)
                     /locus_tag="ACHE_20401S"
                     /note="COG:S;
                     EggNog:ENOG410PPZR;
                     TransMembrane:1 (o169-191i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133465.1"
                     /db_xref="GeneID:66979302"
                     /translation="MSSSAAAAQASSNNAAASPTESTTAEASTTPTSTSSSTETTPTE
                     TSTTSSESSTTSDAVTSSTPDASSTTPTTTSTTPTSTSETPTTTSTSSDQPTTSSTPD
                     VVTTIVTQSSSSGNTAGPTTVIITSTEASPSQTAGSTADGSSSTSGGSAAIESSSNGD
                     SGLSAGGTIAVAVVVPVVSVAIIVLAALWFWRKWKGKKAAEEERRKEVEEYGFNPNND
                     PTLPPVAAGGAYEPSNDNVSGYRGWGTTSAGRKASTNLSSGAGVGLAMSEASSAPGYH
                     HATSPSDGTIQYSDGQGQPASGEDESIGVLGAAPVAANNRVSDIRRGPSNASSAYSAA
                     NRSEASDESHMSASHPTAPFYEDNPYYNEVHAPYGAYGDGPYGSPPQPVIRDVQARRN
                     TRIENPAVFPRQGNAGIAQNF"
     gene            <1182947..>1186790
                     /gene="PHO81"
                     /locus_tag="ACHE_20402S"
                     /db_xref="GeneID:66979303"
     mRNA            join(<1182947..1182948,1183077..1183161,1183228..1183350,
                     1183429..1183479,1183544..1183684,1183769..1183816,
                     1183904..1183921,1184004..1186239,1186309..1186478,
                     1186575..>1186790)
                     /gene="PHO81"
                     /locus_tag="ACHE_20402S"
                     /product="phosphate system positive regulatory protein
                     pho81"
                     /transcript_id="XM_043284701.1"
                     /db_xref="GeneID:66979303"
     CDS             join(1182947..1182948,1183077..1183161,1183228..1183350,
                     1183429..1183479,1183544..1183684,1183769..1183816,
                     1183904..1183921,1184004..1186239,1186309..1186478,
                     1186575..1186790)
                     /gene="PHO81"
                     /locus_tag="ACHE_20402S"
                     /note="COG:P;
                     EggNog:ENOG410PG41;
                     InterPro:IPR002110,IPR030395,IPR017946,IPR036770,
                     IPR020683,IPR004331;
                     PFAM:PF12796,PF03009,PF13637;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008081 - phosphoric diester hydrolase
                     activity [Evidence IEA];
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="phosphate system positive regulatory protein
                     pho81"
                     /protein_id="XP_043133466.1"
                     /db_xref="GeneID:66979303"
                     /translation="MKFGKQIQRRQLDLPEYAASFVNYKALKKLIKQLSATPTIPAQS
                     TTDVRHDVPDAQSALRANKEVFFFRLEREIEKVNAFYLQKEAEFSLRLKTLVDKKRVV
                     QSRTVTNSKAPANFVALFEGFQQFDGDLNKLQQFVEINETAMSKILKKWDKTSKSRMK
                     ELYLHRAVEVQPCFNRDVLRDLSDRATTARLELEAWAEGENIQFDAARPAAAAAQSLG
                     SEEEDLDAQVLQSTTAGNLQTLREWTTKLQSSPDGGERATRMFLAAINEFSDEVLALL
                     LESNLVDMQAEDDINERNCLHEASISGRDFVLKAGLAAGVDVSRLDVYGRIPLHYSCM
                     HGRVDMVRELLAAGPATVDLMDHDNFTPLIHSIVKDQLACAEQLLYSNARIDPASESD
                     HIPLNLACQHGSLPIVKMLLERNAQLLPDAEGLYPQHMVARASQSPQLLLLLQQHGAD
                     MNQRDKLYQWTPLFHAASEGCVGCLRTLLELGVDADAVDEKNLAAMYYAAWEGHLECM
                     LLLWSHRSDENAPTQTPLNILHSIRLQEPEGAMSDQFDSGDMETADGIPDLSLPPPII
                     PLRRYGHNFLDKKVFVQILFDQGNSGSIYFDQAGRHPAARLTISSKLSDLIPRTIMLP
                     IQDDSRTISFHVDNLDTFAVDFEIFPTFGSKVIAKSVALPVVFQAKDSSTGSCTLPLF
                     DPRLRSIGQLRFRFQVIKPYHGDPLEITHFATYWKATSALDSEHNGLVTGSSLSGDHV
                     QLFVQLTKDCVPVLHPQFTINHHGIEIPVCHLMYSQFQTIGAERGANRSEIVHFLQTQ
                     GMNDLAQVHRVLAASFLPLQDVLEQLPIGININISTLYPSPTEEHTLGMTSLPDVNTF
                     ADAILTNVFDHARVSRERHPDFMRSVVFTSYNPNICTALNWKQPNYPVLLCNDLGQIR
                     DLARDIGSLPDVHSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPALVETIKELG
                     LVLVADTSDDAGQPSQSEEMITTNPMGVAEWAYRMPDGVNGVMKANGILRFNDTIDM"
     gene            complement(<1187322..>1188140)
                     /locus_tag="ACHE_20403A"
                     /db_xref="GeneID:66979304"
     mRNA            complement(join(<1187322..1187464,1187522..>1188140))
                     /locus_tag="ACHE_20403A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284702.1"
                     /db_xref="GeneID:66979304"
     CDS             complement(join(1187322..1187464,1187522..1188140))
                     /locus_tag="ACHE_20403A"
                     /note="BUSCO:EOG09265B4G;
                     COG:S;
                     EggNog:ENOG410PNX1;
                     InterPro:IPR009688;
                     PFAM:PF06916;
                     TransMembrane:1 (i119-142o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133467.1"
                     /db_xref="GeneID:66979304"
                     /translation="MSLRHPLLSRWIASPTQFLQSASVLKSPPSVSQSLFMRHRPMGL
                     SGSPSLPSTSLSRSFSLGRPFQLQGRSLGRMNGRPRIESTRPRQQRQQQTRRGFSSSR
                     QAPESLSQKLRKLSREYGWSALGVYLLLSAIDFPFCFAAVRLLGADRIGHYEDVILQT
                     VADGIHTVWPSKQDKESDSEEAVEAKAEKTEEQTKQAAAKKKADQASLWTQLALAYAI
                     HKSLIFIRVPLTAAITPKVVKVLRAWGVDITRRRP"
     gene            <1188738..>1189707
                     /gene="MRPL9"
                     /locus_tag="ACHE_20404S"
                     /db_xref="GeneID:66979305"
     mRNA            join(<1188738..1189542,1189604..>1189707)
                     /gene="MRPL9"
                     /locus_tag="ACHE_20404S"
                     /product="54S ribosomal protein L9, mitochondrial"
                     /transcript_id="XM_043284703.1"
                     /db_xref="GeneID:66979305"
     CDS             join(1188738..1189542,1189604..1189707)
                     /gene="MRPL9"
                     /locus_tag="ACHE_20404S"
                     /note="BUSCO:EOG092642CB;
                     COG:J;
                     EggNog:ENOG410PJBS;
                     InterPro:IPR000597,IPR009000,IPR019927,IPR019926;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="54S ribosomal protein L9, mitochondrial"
                     /protein_id="XP_043133468.1"
                     /db_xref="GeneID:66979305"
                     /translation="MSPRLPPGLAQFPLALWAPQSIPTTTACHYMPARTFGIKSVTTP
                     KPSRFNVGPDLPILKSTPAAALERKANTLPLRSGAVAIKKGMTGIYDAQTGTRIPCTV
                     LQLDRVEVVSHKTREKHGYYAVQVGAGWKHPSNMTKSLLGHFSAQGLSPKRHVYEFRV
                     KDESGLPPVGQMISADWFQEGQYVDARSNTKGKGFTGVMKRHGFGGQDRSHGVSLTHR
                     SLGSAGPGQGGGSRVYPGKKMAGNMGNEQNTVQNLKILKVDAENGIVVVTGAVSGPKG
                     CMVRIQDAIKKPWPEVPAAAATEKSA"
     gene            complement(<1189981..>1190627)
                     /locus_tag="ACHE_20405A"
                     /db_xref="GeneID:66979306"
     mRNA            complement(join(<1189981..1190073,1190163..>1190627))
                     /locus_tag="ACHE_20405A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284704.1"
                     /db_xref="GeneID:66979306"
     CDS             complement(join(1189981..1190073,1190163..1190627))
                     /locus_tag="ACHE_20405A"
                     /note="BUSCO:EOG09265LIB;
                     COG:S;
                     EggNog:ENOG410PNZD;
                     InterPro:IPR014807,IPR042432;
                     PFAM:PF08695;
                     TransMembrane:1 (i58-79o);
                     go_process: GO:0033617 - mitochondrial cytochrome c
                     oxidase assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133469.1"
                     /db_xref="GeneID:66979306"
                     /translation="MSLQAAQWRIGARRLQTFPVRILTPRRNLIPAPSANSGPLMERR
                     ADRELPSVKAERRWLRTLPIFAVVVGAAMLGIFNYQKSSSSVVNSTLYALRTSPRARE
                     ILGDEIYFSQQMPWISGEMNQLHGRIDISFWVKGTKAQGKMRFRSIRPDRMSFFRTEE
                     WSLQLENGTLVQLLEGDSDPFNKTE"
     gene            <1190834..>1191611
                     /locus_tag="ACHE_20406S"
                     /db_xref="GeneID:66979307"
     mRNA            join(<1190834..1190921,1190975..1191036,1191099..1191423,
                     1191517..>1191611)
                     /locus_tag="ACHE_20406S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284705.1"
                     /db_xref="GeneID:66979307"
     CDS             join(1190834..1190921,1190975..1191036,1191099..1191423,
                     1191517..1191611)
                     /locus_tag="ACHE_20406S"
                     /note="COG:S;
                     EggNog:ENOG410PQAC;
                     TransMembrane:4 (i49-70o76-98i119-142o148-167i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133470.1"
                     /db_xref="GeneID:66979307"
                     /translation="MATTRLRRAFRYPEDSGDEGHEREELDEEEQERVIEQLQRQNDQ
                     RNAQYSTVFTALPLLSTLVFVPSVLYRSSTPTVRLFSFLSIMSLLVTTYIMKLFMSRL
                     LDRKSKRPAAEVERTTLVRQSLLFTNTGICGILVLVYLFANPSPSSIWPGLYIVPGAM
                     FGVILLVREAMVSVDLSHLQNLRYEYKGA"
     gene            complement(<1191929..>1194268)
                     /locus_tag="ACHE_20407A"
                     /db_xref="GeneID:66979308"
     mRNA            complement(join(<1191929..1193928,1194001..>1194268))
                     /locus_tag="ACHE_20407A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284706.1"
                     /db_xref="GeneID:66979308"
     CDS             complement(join(1191929..1193928,1194001..1194268))
                     /locus_tag="ACHE_20407A"
                     /note="COG:S;
                     EggNog:ENOG410PJN0;
                     InterPro:IPR018866,IPR003347;
                     PFAM:PF10497,PF02373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133471.1"
                     /db_xref="GeneID:66979308"
                     /translation="MPAQRPRAAFEPISPDLNIPALVDATPNFEFATKIHCNAIDRMG
                     LGAFEKLVQLCVVQGGTPLVVEGFNESLDSSIFSEKWLRTHHGKKTEFARNLTTKSDL
                     PLTIGHYLENMPLLTNQWTEFNYKDANLQRIYLKDIDCPPLWHDHLKRQIPPTVFYFN
                     ETPEAYDGPGSASAFIPDKSAAGVQIAKAGDLMSCLPPDMRAENLMCYIGHEGTYTPS
                     HQEMCASIGHNIMVEASDGSMEYGKHTKPGSSLWFMTENKDRHVVSEYWMSTLGHDIE
                     IEDHFAQMNAWKAAPFKTYIVEQSPGDLILIPPLAAHQVWNRGTRTMKVAWNRTTVET
                     LKMALTEALPHARMVCRDEQYKNKAIVFYSLERYSNLLCHVDDYNIDNPEVRQLINDF
                     QHLLTLYTHILLSESFSPRLPAEKDIEFTAFDSNITCSYCRGNIFNRFLTCPSCIGTP
                     TLEGEDTYDICMECYAMGRSCACISNLKWVEQFPWEELTNKYEVWRQQILGLVRDTNK
                     PYQQFSAEREGMGKKSLAEVCQEQLKVRPWVDITKPAVKKIEKVSDSEATSPARKKRK
                     AGRRNTPQGTGHCHICKYAEPLWKLVSCSFCKLNYCYGSLYRAFSIQPQDAMEKYHWM
                     CPRCQKICICAACRRDNTMNPFEPTSTVLGHDTKKIADPRSVESLVNFRHSNFKWLEK
                     TGVDDETRLSKRQKEADEERNQSSIDHAIRLEEVPQASNFDDNIPVDPSLEQLFLTPP
                     ESNAQERLQTSCECR"
     gene            <1195397..>1196227
                     /gene="COQ2"
                     /locus_tag="ACHE_20408S"
                     /db_xref="GeneID:66979309"
     mRNA            <1195397..>1196227
                     /gene="COQ2"
                     /locus_tag="ACHE_20408S"
                     /product="para-hydroxybenzoate--polyprenyltransferase,
                     mitochondrial precursor"
                     /transcript_id="XM_043284707.1"
                     /db_xref="GeneID:66979309"
     CDS             1195397..1196227
                     /gene="COQ2"
                     /locus_tag="ACHE_20408S"
                     /note="COG:H;
                     EggNog:ENOG410PFPH;
                     InterPro:IPR030470,IPR039653,IPR000537;
                     PFAM:PF01040;
                     TransMembrane:6
                     (n4-15c23/24o78-94i103-122o134-157i178-197o203-221i233-
                     252o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0016765 - transferase activity,
                     transferring alkyl or aryl (other than methyl) groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="para-hydroxybenzoate--polyprenyltransferase,
                     mitochondrial precursor"
                     /protein_id="XP_043133472.1"
                     /db_xref="GeneID:66979309"
                     /translation="MLQIIGTAGLFFTGALIMRGAGCAINDLWDRNLDPHVERTKFRP
                     IARGALSPQKAILFTGTQLLAGLGVLLQFPTQCLWYGIPSLLLVTTYPLAKRFTNYPQ
                     VILGLTFSWGAMMGFPALGVDLLANPDALKSAAALYSSCVAWTVLYDMIYAHMDIKDD
                     VAAGIKSIALRHEHNTKTVLSGLAATQVALLAAAGVTAGAGPMFFVGSCGSAILTLGA
                     MIWKVQLKNVQNCWWWFNNGCLFTGGGITLGLLLEYLAQTFGLFEKEELKTEAFPSPQ
                     "
     gene            <1196621..>1197212
                     /gene="GRX5"
                     /locus_tag="ACHE_20409S"
                     /db_xref="GeneID:66979310"
     mRNA            join(<1196621..1196647,1196710..1196989,1197061..>1197212)
                     /gene="GRX5"
                     /locus_tag="ACHE_20409S"
                     /product="monothiol glutaredoxin grx5"
                     /transcript_id="XM_043284709.1"
                     /db_xref="GeneID:66979310"
     CDS             join(1196621..1196647,1196710..1196989,1197061..1197212)
                     /gene="GRX5"
                     /locus_tag="ACHE_20409S"
                     /note="COG:O;
                     EggNog:ENOG410PNPZ;
                     InterPro:IPR004480,IPR036249,IPR002109,IPR033658;
                     PFAM:PF00462;
                     go_function: GO:0015035 - protein disulfide oxidoreductase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="monothiol glutaredoxin grx5"
                     /protein_id="XP_043133473.1"
                     /db_xref="GeneID:66979310"
                     /translation="MFSRTIVASAFRPLSRPASFVQPRTAAFQLPSALHARLLSTETK
                     AAIDKAVATAPVVLFMKGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDLELRQ
                     GIKEYSDWPTIPQLYLNKEFVGGCDILMSMHQNGELAKLLEEKSVLVAAD"
     gene            complement(<1197550..>1199104)
                     /locus_tag="ACHE_20410A"
                     /db_xref="GeneID:66979311"
     mRNA            complement(join(<1197550..1197864,1197927..1198701,
                     1198794..1198911,1198981..>1199104))
                     /locus_tag="ACHE_20410A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284710.1"
                     /db_xref="GeneID:66979311"
     CDS             complement(join(1197550..1197864,1197927..1198701,
                     1198794..1198911,1198981..1199104))
                     /locus_tag="ACHE_20410A"
                     /note="COG:I;
                     EggNog:ENOG410PGX0;
                     InterPro:IPR041723,IPR004821,IPR014729;
                     PFAM:PF01467;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133474.1"
                     /db_xref="GeneID:66979311"
                     /translation="MSASFEEPAPLPGNWPVDPQEDTPISENRVWVDGCFDFSHHGHA
                     GAMLQARKLGKELFVGVHSDEAILENKGPTVMTLEERVAAVEACRWASRCIPCAPYVT
                     SLPWVSHYGCQYVVHGDDITSDSNGDDCYRFVKAAGRFKVVKRTPGISTTDLVGRMLL
                     CTKSHFIKSVEATLAGEEGSRNWEERKEFAADLMQRIKDYATDETGLQPGPQVSTWSG
                     SSLAKLDGNVEEAGTFESLVHGKPPKPGQRIVYVDGGFDLFSSGHIEFLRQVLAQEET
                     DGHKRDWYNPEQKKSRLEESGEDYPPAYIIAGIHDDDVINKWKGLNYPIMNIFERGLC
                     VLQCRYIHAVVFSAPFSPSQPYLENMPFGVPDAVYHGPTTFIPLTYDPYTAPKKMGIF
                     RETESHAFQHVNAGEIVDRILKSREAYEERQRAKLQKGAIEDLAKAKEETA"
     gene            <1199743..>1200778
                     /locus_tag="ACHE_20411S"
                     /db_xref="GeneID:66979312"
     mRNA            join(<1199743..1199948,1200019..>1200778)
                     /locus_tag="ACHE_20411S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284711.1"
                     /db_xref="GeneID:66979312"
     CDS             join(1199743..1199948,1200019..1200778)
                     /locus_tag="ACHE_20411S"
                     /note="COG:S;
                     EggNog:ENOG410PM8W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133475.1"
                     /db_xref="GeneID:66979312"
                     /translation="MISSTFGPSLTRRDTAKSSVGQESTHGTIPPPLTSGGGTLGPQS
                     AGAIYQHIHDMATKRISTLDYLRKAHEGRVYWFNTVHFSRADLGRMSYFDPRKLSRRA
                     VNYLLLGLSLPPILDISSTPSEFLRALNALLLEFEAFQQVHPPDGSSSSTLARARIPQ
                     MFKRAAHAGTKVRRTSSATEIGLPMQSSDPSDLKAMAGNITPSATTAAAVSSFPQAES
                     SELLPGEEYSYLLTPSLPFEPDFFETFATLCDVLIDCYTRLISLVSTPSVCTVSLGEM
                     FSKADTKLRKIMVAGVVREFEDASRSSARNEVTGVSRVVLGGLLG"
     gene            complement(<1201213..>1201848)
                     /locus_tag="ACHE_20412A"
                     /db_xref="GeneID:66979313"
     mRNA            complement(join(<1201213..1201629,1201696..>1201848))
                     /locus_tag="ACHE_20412A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284712.1"
                     /db_xref="GeneID:66979313"
     CDS             complement(join(1201213..1201629,1201696..1201848))
                     /locus_tag="ACHE_20412A"
                     /note="BUSCO:EOG092641K1;
                     COG:U;
                     EggNog:ENOG410PIR9;
                     InterPro:IPR006797,IPR037365;
                     PFAM:PF04707;
                     go_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133476.1"
                     /db_xref="GeneID:66979313"
                     /translation="MKVFSSNCTFDYSWNEVSTANWRKYCPWNDKSTHVVGVDTLSRS
                     VDPSTGILRTERLITCDQSVPQWILSLFGGNATSHVYEISYVDPIAKKVTMCSTNLTW
                     SNVLNVQETVIYRPSPSKANSTDFNQEAKITALCGGWQKIKNKVEEASVERFSQNAKR
                     GREGFEAVLEMSRRVFGEQREHERKQLQS"
     gene            <1203460..>1203909
                     /locus_tag="ACHE_20413S"
                     /db_xref="GeneID:66979314"
     mRNA            <1203460..>1203909
                     /locus_tag="ACHE_20413S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284713.1"
                     /db_xref="GeneID:66979314"
     CDS             1203460..1203909
                     /locus_tag="ACHE_20413S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133477.1"
                     /db_xref="GeneID:66979314"
                     /translation="MRKQVLSYFPPVSMRYTLSTGLQTMTQGCRTTLQPLAHWSINAG
                     RRWDCQASPDLTKILHDQVEEHFHNYKNKFFDKNTIPLYPFFSGAGTGTSRNATELDK
                     TIYKCFDGTYFEKNELLTSQVHILFVFHSSFESGTSFGQLKTIHGEP"
     gene            <1204764..>1205315
                     /locus_tag="ACHE_20414S"
                     /db_xref="GeneID:66979315"
     mRNA            <1204764..>1205315
                     /locus_tag="ACHE_20414S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284714.1"
                     /db_xref="GeneID:66979315"
     CDS             1204764..1205315
                     /locus_tag="ACHE_20414S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133478.1"
                     /db_xref="GeneID:66979315"
                     /translation="MVKIRKIKSYVFKVSEWVTVEDIQGGAFMQAKRIRFVNHHLNDG
                     VANHHIQTKQTSIRTFRVVERRNSGEINLRNHKYIVLNAAGASAGDAVLSLDFDIPRT
                     ESQQCKNIQRGFPYLNKEHEKAASPDDVFTLFCTSSIPRQRDGATYNVPPGNVLPTVD
                     NWGNYFDPCAGRSYVYAREIRGN"
     gene            <1206621..>1207342
                     /locus_tag="ACHE_20415S"
                     /db_xref="GeneID:66979316"
     mRNA            join(<1206621..1206915,1206990..>1207342)
                     /locus_tag="ACHE_20415S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284715.1"
                     /db_xref="GeneID:66979316"
     CDS             join(1206621..1206915,1206990..1207342)
                     /locus_tag="ACHE_20415S"
                     /note="BUSCO:EOG0926578E;
                     COG:O;
                     EggNog:ENOG410PRGF;
                     InterPro:IPR036249,IPR013766,IPR000866;
                     PFAM:PF00578,PF08534;
                     go_function: GO:0016209 - antioxidant activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133479.1"
                     /db_xref="GeneID:66979316"
                     /translation="MVELRKRKASAQPNITETNKRGKKEEIPASDRQTGKTNDTTNAD
                     SLAGVPNVGDTIALDGFGSEIQTNDGTKTNLKELVATSKSGVVLFTYPRASTPGCTKQ
                     ACLFRAKYSHLTSTGLSIYGLSTDSPKANTTFRSKQNLPYPLLCDASAVLISAIGFKK
                     VPKGTIRGVFSVDKQGKVLLRQAGGPDATVDAVQKLVQVEGTPQTDVEAQAKNEI"
     gene            <1207688..>1208603
                     /locus_tag="ACHE_20416S"
                     /db_xref="GeneID:66979317"
     mRNA            join(<1207688..1207744,1207839..1207916,1208023..1208519,
                     1208579..>1208603)
                     /locus_tag="ACHE_20416S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284716.1"
                     /db_xref="GeneID:66979317"
     CDS             join(1207688..1207744,1207839..1207916,1208023..1208519,
                     1208579..1208603)
                     /locus_tag="ACHE_20416S"
                     /note="COG:S;
                     EggNog:ENOG410PP64;
                     InterPro:IPR016813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133480.1"
                     /db_xref="GeneID:66979317"
                     /translation="MSAVSHCKLLNLLWRRLKKVNVLPIMARDILKAAKSASNAIAVH
                     KKYTVQSYGIWERIRRLLSIAPERSTGVPLNAHYRLPTPGGLSPLTYDDPVTAPAGDI
                     ADNPYWKRDVRRNYPRLSTVNQADAVGLLTVGSQATPKDDVLQIGEAGQKQLVSIKQE
                     GEQRGLAAHFEKDKNGIQGVLGPNGLPPTPCNLNASATKYQLDHDNGYPEVYPCRTFV
                     "
     gene            complement(<1208937..>1209527)
                     /locus_tag="ACHE_20417A"
                     /db_xref="GeneID:66979318"
     mRNA            complement(join(<1208937..1209071,1209152..1209456,
                     1209512..>1209527))
                     /locus_tag="ACHE_20417A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284717.1"
                     /db_xref="GeneID:66979318"
     CDS             complement(join(1208937..1209071,1209152..1209456,
                     1209512..1209527))
                     /locus_tag="ACHE_20417A"
                     /note="COG:S;
                     EggNog:ENOG410PP5N;
                     InterPro:IPR013879;
                     PFAM:PF08570;
                     TransMembrane:4 (o14-35i56-81o93-114i126-145o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133481.1"
                     /db_xref="GeneID:66979318"
                     /translation="MTTLHYLPPVKPSAIALGTVFTHTASLGILAPVFGDTYHRAQAA
                     NSKEEFIKSKEAAGAAAAWGSSFVGSAVQAYGVAALINATGTLSYKGAAYLGSLIFMA
                     SSAPSFISQVFTEKRPLDTVAVGAVSRAFETVGLSLFLTWWGTRTNPFD"
     gene            <1210247..>1211031
                     /locus_tag="ACHE_20419S"
                     /db_xref="GeneID:66979320"
     mRNA            join(<1210247..1210500,1210557..>1211031)
                     /locus_tag="ACHE_20419S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284718.1"
                     /db_xref="GeneID:66979320"
     CDS             join(1210247..1210500,1210557..1211031)
                     /locus_tag="ACHE_20419S"
                     /note="COG:A;
                     EggNog:ENOG410QE65;
                     InterPro:IPR033684,IPR029063,IPR019410;
                     PFAM:PF10294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133482.1"
                     /db_xref="GeneID:66979320"
                     /translation="MEGHTPSPAASDSTDPFDVSESLVPIRKPQEAGNSSVSFDGLLN
                     DSLLLKEDLSEGCGGKLWPAGMVLAKYLLRQHRSNLANRTIIELGAGGGLVGLAVARG
                     CVVGPSPIYLTDQEPMLPLMETNIKLNNLSPLVTPMVLNWGEPLPDDIPPHPAVILAA
                     DCVYFEPAFPLLITTLQELIGPGSICYFCFKRRRRADLRFMKLAKKIFDISEIQDDPD
                     AESYKRENIFLYKIRARNSKAGGR"
     gene            complement(<1211240..>1213336)
                     /gene="MPP10"
                     /locus_tag="ACHE_20418A"
                     /db_xref="GeneID:66979319"
     mRNA            complement(<1211240..>1213336)
                     /gene="MPP10"
                     /locus_tag="ACHE_20418A"
                     /product="U3 snoRNP protein"
                     /transcript_id="XM_043284720.1"
                     /db_xref="GeneID:66979319"
     CDS             complement(1211240..1213336)
                     /gene="MPP10"
                     /locus_tag="ACHE_20418A"
                     /note="BUSCO:EOG09263ROQ;
                     COG:A;
                     EggNog:ENOG410PIGW;
                     InterPro:IPR012173;
                     PFAM:PF04006;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0005732 - small nucleolar
                     ribonucleoprotein complex [Evidence IEA];
                     go_component: GO:0034457 - Mpp10 complex [Evidence IEA];
                     go_process: GO:0006364 - rRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="U3 snoRNP protein"
                     /protein_id="XP_043133483.1"
                     /db_xref="GeneID:66979319"
                     /translation="MMSRSLPNIIEGSTPIEPLHSTLSTPWSFLHPTTELHDAIAGST
                     KYFFDTIALSVNNSQTSRLQNTRKRKRSEARQDQADRVLQLKQLYVEGFTSDQIWEQA
                     TRILDSTSKEMERDSIHAGKSARAPSANLAGSVSESERPGHDSIEDSEKESVIDHDDD
                     IDMDPGSEHNDPPNGELDAGDEIDEESDEDAASARSDDESEHDTYMEDRFGLNDGFFS
                     IDDFNAQAEAFERKDLRGGPTEEVDSNDEEIDWHANPLVSGNAMPVSKGSSRGNGTED
                     KMSDNSDEEGPTFGNANLQGDSDSEEDGDGVGADGGDSAGWIDTSDIKYADFFAPPPR
                     KVTTKKARPLPKTQPDTANLDNDVDRAMADVRRDLFEDEPSDDEVSADDNGDPKTQRS
                     THEKQRAHIADEIRRLEAANVAKKEWMLSGEARAAERPVNSLIEEDLDFERIGKPVPV
                     VTTEVSESIEDLVKRRILAKEFDEIIRRRPGTSDAQDAQKPRFELEDTKPQQSLAEMY
                     EADHLRATDPNYVDPKNQKLVKEHAEITNLWKEISSQLDTLSNWHYKPKAPQANINVI
                     TDVSTVMMEEARPTVSGAVNDLAALAPQEIYAPGSDGKATGEVVLKTGASVAKDEMTR
                     EDKAKLRRQQKKQKKAGAGHTNQRSSKAAEKQQLVSDLKQGGVKVIGKQGEITNIHGS
                     KVDGAGTRNSGDTLKL"
     gene            <1214373..>1215423
                     /locus_tag="ACHE_20420S"
                     /db_xref="GeneID:66979321"
     mRNA            join(<1214373..1214394,1214451..1214886,1214940..1215184,
                     1215236..>1215423)
                     /locus_tag="ACHE_20420S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284721.1"
                     /db_xref="GeneID:66979321"
     CDS             join(1214373..1214394,1214451..1214886,1214940..1215184,
                     1215236..1215423)
                     /locus_tag="ACHE_20420S"
                     /note="COG:Q;
                     EggNog:ENOG410PHD4;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133484.1"
                     /db_xref="GeneID:66979321"
                     /translation="MASQFQPGHRVPIQHLEKPGLQADLKEAPVSTHLPTEDGGYQLY
                     KAAGKLDGKKAIITGGDSGIGRAIALLFAMEGASSLIIYLPEEEKDAQETKKQVQEIG
                     RECHCLAIDLRRKENCKKVIDVALQSLGSIDILVNNAAFQHMLSDISELSEDQWERTF
                     DTNIHPFFYLSKYALPHMKRGSTIINCSSVNHYIGRPDLLDYTSTKGAIVAFTRGLSN
                     QQVGKGIRVNCVCPGPIWTPLIPSTMHTSAMEQFHTVPIGRPGQPSEVATCFVFLASQ
                     DSSFMSGQCLHPNGGVVVNG"
     gene            complement(<1215694..>1216558)
                     /locus_tag="ACHE_20421A"
                     /db_xref="GeneID:66979322"
     mRNA            complement(join(<1215694..1215788,1215847..1216202,
                     1216274..1216463,1216516..>1216558))
                     /locus_tag="ACHE_20421A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284722.1"
                     /db_xref="GeneID:66979322"
     CDS             complement(join(1215694..1215788,1215847..1216202,
                     1216274..1216463,1216516..1216558))
                     /locus_tag="ACHE_20421A"
                     /note="COG:C;
                     EggNog:ENOG410PGDV;
                     InterPro:IPR006138,IPR006137;
                     PFAM:PF01058;
                     go_function: GO:0008137 - NADH dehydrogenase (ubiquinone)
                     activity [Evidence IEA];
                     go_function: GO:0048038 - quinone binding [Evidence IEA];
                     go_function: GO:0051536 - iron-sulfur cluster binding
                     [Evidence IEA];
                     go_function: GO:0051539 - 4 iron, 4 sulfur cluster binding
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133485.1"
                     /db_xref="GeneID:66979322"
                     /translation="MLHLPKRAIPGAFSVRTCLTPGFHIQSTASLSTSSSKSATALER
                     QGHSGQPLTASGKVRREVPLPSQEKKEGAMQYVLTTLDQVTNWARQSSLWPMTFGLAC
                     CALEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRW
                     VISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMRHT
                     RITRMWYRR"
     gene            <1217475..>1221569
                     /locus_tag="ACHE_20422S"
                     /db_xref="GeneID:66979323"
     mRNA            join(<1217475..1217789,1217850..1217919,1217972..1221256,
                     1221316..>1221569)
                     /locus_tag="ACHE_20422S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284723.1"
                     /db_xref="GeneID:66979323"
     CDS             join(1217475..1217789,1217850..1217919,1217972..1221256,
                     1221316..1221569)
                     /locus_tag="ACHE_20422S"
                     /note="BUSCO:EOG09260EPS;
                     COG:U,Y;
                     EggNog:ENOG410PM1I;
                     InterPro:IPR037624,IPR014908,IPR007187;
                     PFAM:PF08801,PF03177;
                     go_function: GO:0017056 - structural constituent of
                     nuclear pore [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133486.1"
                     /db_xref="GeneID:66979323"
                     /translation="MFVPKATASLRSSRRRQRTSSGESIKQHKAKRQRSAQENVESEL
                     ENDRIERDYQRESVGLHVSESDKAKPETTENIGAQKQIAIRGPKKPDKRDDDNDIDGA
                     VVLSRTNLYTVSQLPALPDQIRESQSGHFACSFGTGHGYALVLTQSHAVIWPYSSSAS
                     SPSPAEVFTLSVPESCRNTTAEAPLGVLLSTATAGPPGLMVIIPSTGKVVYWETVSSA
                     TSLGLSRHKQNGLQGSISGLLYGEHVTEVVNGEPSGVIATLSSGRVAQITVRSSQGKP
                     TIVSNFLRNSTNGSMGLLGGIRNALAGGFWRKEVAAARPGISRQRGQRDILVSTTNGL
                     VEVWDTHWSNGSILRAQFDIRQHLAESLGPKLTDESGNHTLKILDLASGAGNDSNVRG
                     SQAPETEKWPLYFVVELPQGPNSTGLWVIRIILSDDGRVLSTRLIDLHHTRSGSNESK
                     LRLFVSKPGDTGFIVIGQSIIVLSLAQFDDTIAPQDSHPLPSLFCDRIDFRTGHEYEI
                     LGSGFEEAVHHNPLPACFVMVRGFGVVRVSAVPRRCGVGGEHVTTAKHKLEQAVFYGT
                     MLKNPLNLASRGGLDFPVDELEQAALEICRELLQSSSKYIPSSGIPLDQNLRSRAKAL
                     HDLASLLTQRGLPLNNLTQWELLWGAEKLAAQRAMWKIEGDLRKNADEPTFLSRVIDQ
                     MSEKFKAKFDSRHSDNDYVRHWFLHDTHRMEHIIPWIFNAIKLQKGQSKQGRKTAEQI
                     FQASEFSLAVLETAFRFRDEHASLYGLNEEFLEDGVLVTGYENLPEPWTSHNMAYVET
                     GHLLDLELGSCMAWIQQTVSTVDAPPNDIVEDIAKNCARQLRVLSQMHGERIRWLSSQ
                     GDPKSMDEVASAEQSHVKQRRWQLFKLAGIGQLDDAISLAEKFRDMSALVELIIELQD
                     QTKCQLFSEINSDDPDAVILDKKSGELGRKISHYFEKFGESWANAFFSRQISMGQSGV
                     LFAMRKFQPFITRFLRKNPAYQRLSWINDVVGENDYGTAAQCLKNLAIEQESDLWSHR
                     VELSLVKLSSLAAWESTDSAHDSIHQSDIKRFEDYAELDAVQEVIHAHITPALQDAID
                     QKAEIDLAVEQFGRHIAEYRPSLHEVLANALTRVVAREVVGIDQLVDLLTLLDTTRAP
                     DYEQTELSGKEFYLALRAIHLGCCGQRDQSYTSALQKLVWRRCMIRDSWEGMGATEGL
                     SNEAHDTALCHTLVLCLKDQHEHGDDSSLYVPISPADVMLSEPELDVLCLQFRSEQRA
                     RVARDLVKESETFSRYMELGNLEFWFKDLLSFARIVAASPGRADD"
     gene            <1235634..>1236209
                     /locus_tag="ACHE_20423S"
                     /db_xref="GeneID:66979324"
     mRNA            join(<1235634..1235654,1235850..>1236209)
                     /locus_tag="ACHE_20423S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284724.1"
                     /db_xref="GeneID:66979324"
     CDS             join(1235634..1235654,1235850..1236209)
                     /locus_tag="ACHE_20423S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133487.1"
                     /db_xref="GeneID:66979324"
                     /translation="MWPVTGQAGRPSSEPFSHDRWLQQLVTTITTLRLKFDIEEKELA
                     FIRDYAKTDGIAALQEAKVQQSSIDSADLISDDEEDEIDDVSQPTVLLGEDSTASKRQ
                     SSVLSEDSASEDESLLPQVLAKAS"
     gene            complement(<1245577..>1246353)
                     /locus_tag="ACHE_20424A"
                     /db_xref="GeneID:66979325"
     mRNA            complement(<1245577..>1246353)
                     /locus_tag="ACHE_20424A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284725.1"
                     /db_xref="GeneID:66979325"
     CDS             complement(1245577..1246353)
                     /locus_tag="ACHE_20424A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133488.1"
                     /db_xref="GeneID:66979325"
                     /translation="MPRGRPRTIAEETTLSSQDTITPEQIDTDLQAIHNRIAKLEELR
                     VARENLARLEAEVINPSEIGSVVNRDHPGNHPPESHTEELKIKNISTFTLNFNLQRRQ
                     DWLLDLRYTFRGAPRKYRTDGKKILAALNFLDHTCRHRWYRHVEEKSIEERQNIEDSW
                     AYFEEWTLSLIRNTTTLQADIMDQIERTCQLPNQDPREFHAYLDTLEQHFPRQAEKER
                     ALSFSLNSRATSRNIFENITLSCLKDERRWSPLPPTIGTS"
     gene            complement(<1251307..>1252502)
                     /gene="MRI1"
                     /locus_tag="ACHE_20425A"
                     /db_xref="GeneID:66979326"
     mRNA            complement(join(<1251307..1251922,1251976..>1252502))
                     /gene="MRI1"
                     /locus_tag="ACHE_20425A"
                     /product="S-methyl-5-thioribose-1-phosphate isomerase"
                     /transcript_id="XM_043284726.1"
                     /db_xref="GeneID:66979326"
     CDS             complement(join(1251307..1251922,1251976..1252502))
                     /gene="MRI1"
                     /locus_tag="ACHE_20425A"
                     /note="COG:J;
                     EggNog:ENOG410PFRZ;
                     InterPro:IPR042529,IPR011559,IPR005251,IPR000649,
                     IPR037171;
                     PFAM:PF01008;
                     go_process: GO:0044237 - cellular metabolic process
                     [Evidence IEA];
                     go_process: GO:0044249 - cellular biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="S-methyl-5-thioribose-1-phosphate isomerase"
                     /protein_id="XP_043133489.1"
                     /db_xref="GeneID:66979326"
                     /translation="MTLQAIRYVDGDLTIIDQLKLPFVEEYIPIRTAEEGWHAIKEMR
                     VRGAPAIAIVAALALASELHQLTTNKKLSAVAEEVRVFIVEKLHYLVTSRPTAVNLSD
                     AAYKLEALVTERANTAGSAGHDIATVFIRAAENMMVKDVEDNKRIGQNGAQWILANAL
                     KSGASKTSILTHCNTGSLATSGYGTALGVIRSLASNNGLRHAYCTETRPYNQGSRLTA
                     FELVHDGLPATLITDSMAAALLARTDADVNAIVVGADRVAANGDTANKIGTYGLAVLA
                     RYHGVKFLVAAPLTTIDLATKSGNEVIIEERPASEVTRIKGPSQKDDATGGLSLETIN
                     IAAKGINVWNPAFDITPATLIDGIITEVGVAEKDPSGHFHLDRLFP"
     gene            complement(<1253228..>1253589)
                     /gene="LSM6"
                     /locus_tag="ACHE_20426A"
                     /db_xref="GeneID:66979327"
     mRNA            complement(join(<1253228..1253250,1253303..1253416,
                     1253484..>1253589))
                     /gene="LSM6"
                     /locus_tag="ACHE_20426A"
                     /product="U4/U6-U5 snRNP complex subunit lsm6"
                     /transcript_id="XM_043284727.1"
                     /db_xref="GeneID:66979327"
     CDS             complement(join(1253228..1253250,1253303..1253416,
                     1253484..1253589))
                     /gene="LSM6"
                     /locus_tag="ACHE_20426A"
                     /note="COG:A;
                     EggNog:ENOG410PRHI;
                     InterPro:IPR016487,IPR010920,IPR001163;
                     PFAM:PF01423;
                     go_component: GO:0005732 - small nucleolar
                     ribonucleoprotein complex [Evidence IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="U4/U6-U5 snRNP complex subunit lsm6"
                     /protein_id="XP_043133490.1"
                     /db_xref="GeneID:66979327"
                     /translation="MENGAPSDGKDPSAFLSEIIGAPVTVKLNSGVVYKGELQSVDGY
                     MNIALEKTEEYVNGALRKSFGDAFVRGNNVLYISAQ"
     gene            <1253827..>1255041
                     /locus_tag="ACHE_20427S"
                     /db_xref="GeneID:66979328"
     mRNA            <1253827..>1255041
                     /locus_tag="ACHE_20427S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284728.1"
                     /db_xref="GeneID:66979328"
     CDS             1253827..1255041
                     /locus_tag="ACHE_20427S"
                     /note="COG:O;
                     EggNog:ENOG410PNMD;
                     InterPro:IPR029071,IPR000626,IPR022617;
                     PFAM:PF00240,PF11976;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133491.1"
                     /db_xref="GeneID:66979328"
                     /translation="MRSFFRRPSWAKRGIEDSTPDFYRRSEHTYADIIAATKEARERS
                     TIEFANNDQVADGKASKNRPTQNQVGVGEGTPSDKLSGVISDQNCSIGLGPGSHCVLQ
                     EEKELSSHGAQRMRSADKSDTVHNHNTSAPDRGPVADIQSIGRHCSHSSGLAPCMHEG
                     TNNASDDESASEGIPRDNNQTKYKATGHDKSIQDDVVVQILITSEIENTKPLIVHRKA
                     SQSLREVRLAWCKRQGLPEDMQLSVFLTWKGRRLFDVTTCKSLGINNVKDNFDGFSDF
                     HYSSVDDGRHIHMEAVTDDSFTFKQRQQRSPALSATESQAGPNPRAFGSHGRDVLMKI
                     ILRCPELDDFGAKVSQKSPVSQIISAFKDARRIPAQKCVHLLFDGDQLDPNACLLDYD
                     IADQDMVDVLIR"
     gene            <1255401..>1255900
                     /locus_tag="ACHE_20428S"
                     /db_xref="GeneID:66979329"
     mRNA            join(<1255401..1255586,1255651..1255840,1255896..>1255900)
                     /locus_tag="ACHE_20428S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284729.1"
                     /db_xref="GeneID:66979329"
     CDS             join(1255401..1255586,1255651..1255840,1255896..1255900)
                     /locus_tag="ACHE_20428S"
                     /note="BUSCO:EOG09265F2Y;
                     COG:S;
                     EggNog:ENOG410PPKG;
                     InterPro:IPR039127,IPR005651;
                     PFAM:PF03966;
                     go_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133492.1"
                     /db_xref="GeneID:66979329"
                     /translation="MKVVTVNFMTCAVKGCKASPASFPLHFHDAELELQELDFQAEFI
                     QNIVPRLDWNGLQVTANELGFPKIPDTKPDGDALNDEQTLRDLHRLLLETQVMEGKLK
                     CGNCGHEYMIKEGIANFLLPSHLV"
     gene            complement(<1256357..>1260115)
                     /gene="SET1"
                     /locus_tag="ACHE_20429A"
                     /db_xref="GeneID:66979330"
     mRNA            complement(join(<1256357..1256460,1256515..>1260115))
                     /gene="SET1"
                     /locus_tag="ACHE_20429A"
                     /product="histone methyltransferase set1"
                     /transcript_id="XM_043284731.1"
                     /db_xref="GeneID:66979330"
     CDS             complement(join(1256357..1256460,1256515..1260115))
                     /gene="SET1"
                     /locus_tag="ACHE_20429A"
                     /note="BUSCO:EOG09264CH7;
                     COG:B;
                     EggNog:ENOG410PH74;
                     InterPro:IPR035979,IPR001214,IPR024636,IPR012677,
                     IPR024657,IPR003616,IPR017111;
                     PFAM:PF11767,PF11764,PF00856;
                     go_component: GO:0048188 - Set1C/COMPASS complex [Evidence
                     IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0018024 - histone-lysine
                     N-methyltransferase activity [Evidence IEA];
                     go_process: GO:0034968 - histone lysine methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="histone methyltransferase set1"
                     /protein_id="XP_043133493.1"
                     /db_xref="GeneID:66979330"
                     /translation="MSRSTAGFADFFPTAPSVLQQKRSRAAQELPRPKLQNEHESSEE
                     RPACFAESNTVKDVMHSDTFAHQCSGSHDESGKISFETTGIGSLSFMSTGPSAAGSSL
                     SQSGVPHLNEMHPDTLTPLTNVESSPPCKSSPRPTKIMNGVADANQVKARGEEQRTAI
                     TPLHTPPTPQPQTHAIGNRVSGCKLVYDPDSDRRSSSLSKDRRRKPEYVEIVSNEQNG
                     CPPDPRLGIPNYTRGAGCKQKPKFRPSPYTLKPWPYDSATTIGPGPPTQIAVTGFDPL
                     TPIAPINALFSSFGEIAEINNRTDPITGRFLGICSIRYKDTSSFRGGSPILAASAAKR
                     AYLECKKEQRIGTRRIRVELDRDGVLAEKIVSKATDPRRLGQKKAEETKPDPLPKRNE
                     PPPTAPKGPSGRSSMRPVPAIPEGPRAVFSKPAVPSLVEETPVLNQIKRDPYIFIAHC
                     YVPVLSTTVPHLKKRLKLFNWKDIRCDKTGYYIIFENSRRGEEETERCYKICHMKPLF
                     TYIMNMESQPYGNPNYERSPSPERLEAENRERAEAERLEKEAEIDVEEEKKLRVIDLD
                     PCREVLTMIIRDLKDKLLEDVKSRIAAPALYDYLDPDRHAPKRKKLGIPDPEGTRRPT
                     FRLDFDTSSETPDSRSELSNVQRPFGTSNLNILALPRIRKAHRLNREDAFLDERRKQP
                     VRRREVRPLYHRLQQLHDHDDSDDDQRTPFTRDTDEQESRPLSRMSSSDSGSDNDEQS
                     MPGTLQTSVTELPVRQYYNETEGSDLVTQNAPNPESNEINGLSPTSRKRKRINEVHER
                     RKRQKENKESFDISSVGKTEDEQSKSPASLATEGDTTVTNCPSDIVLDSAILEEDQNS
                     KESSERCDLGASICEKDHAEKVHDSADGIDGAGHPEESKTEVEWRVSNDEPRPTVLDD
                     EAIILDLDGWQNLIKDEEDLHFLRDVLAGHPKASLGNLAAWAWRQKEIKALNRPGDIG
                     PVHDETIIHGYYVANATGAARTEGRKRILESEKSKYLPHRIKVQKAREEREAKAKSDP
                     QATAAEAARIAAAKTISKSTSRSTRVNNRRLIADINAQKQALPMQSGDGDVLRFNQLK
                     KRKKPVRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADMRERQYLKSGIGSS
                     YLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERDEEL
                     TYDYKFEREWDSDDRIPCLCGSTGCKGFLN"
     gene            <1262512..>1264895
                     /gene="GFA1"
                     /locus_tag="ACHE_20430S"
                     /db_xref="GeneID:66979331"
     mRNA            join(<1262512..1262516,1262586..1262888,1262972..1264365,
                     1264440..1264601,1264675..>1264895)
                     /gene="GFA1"
                     /locus_tag="ACHE_20430S"
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing)"
                     /transcript_id="XM_043284732.1"
                     /db_xref="GeneID:66979331"
     CDS             join(1262512..1262516,1262586..1262888,1262972..1264365,
                     1264440..1264601,1264675..1264895)
                     /gene="GFA1"
                     /locus_tag="ACHE_20430S"
                     /note="BUSCO:EOG09260SRF;
                     COG:M;
                     EggNog:ENOG410PG0E;
                     InterPro:IPR035466,IPR029055,IPR017932,IPR035490,
                     IPR001347;
                     MEROPS:MER0012158;
                     PFAM:PF13522,PF01380,PF13537;
                     go_function: GO:0097367 - carbohydrate derivative binding
                     [Evidence IEA];
                     go_process: GO:1901135 - carbohydrate derivative metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing)"
                     /protein_id="XP_043133494.1"
                     /db_xref="GeneID:66979331"
                     /translation="MCGIFGYINYLVERDRKFILDTLLNGLSRLEYRGYDSAGLAIDG
                     DKKKEVAAYKEVGKVAKLKELINECKPDLTKTFESHAGIAHTRWATHGTPSRQNCHPH
                     RSDLNWEFSIVHNGIITNYKELRALLESKGFRFETETDTECIAKLTKYLFDQQPDIDF
                     TVLAKAVVKELEGAFGLLIKSVHFPHEVIAARKGSPLVIGVRTSKKMKVDFVDVEYSE
                     DKPLPAEQASQNVAIKKSATGLLAPPDKSLLHRSQSRAFLSDDGVPQPAEFFLSSDPS
                     AIVEHTKKVLYLEDDDIAHVHEGQLNIHRLTKDDGTSNVRAIQTIELELQEIMKGAFD
                     HFMQKEIFEQPESIVNTMRGRLDVANKQVTLGGLRQYISTIRRCRRIIFVACGTSYHS
                     CMAVRGVFEELTEIPISVELASDFLDRQAPVFRDDTCVFVSQSGETADSLMALRYCLE
                     RGALTVGIVNVVGSSISLLTHCGVHINAGPEIGVASTKAYTSQFVAMIMFALSLSEDR
                     ASKQKRREEIIECLAKVSEQFKEILKLNEPIKQMCAKFFKHQKSLLLLGRGSQFPTAL
                     EGALKIKEISYLHCEAVMSGELKHGVLALVDENLPIIMILTRDNLFSKSLNAYQQVIA
                     RSGRPIVICNHDDPEFSSAQTEKIEVPKTVDCLQGLLNVIPLQLVAYWLAVGEGLNVD
                     FPRNLAKSVTVE"
     gene            <1265601..>1266352
                     /locus_tag="ACHE_20431S"
                     /db_xref="GeneID:66979332"
     mRNA            join(<1265601..1265643,1265706..1265871,1265935..>1266352)
                     /locus_tag="ACHE_20431S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284733.1"
                     /db_xref="GeneID:66979332"
     CDS             join(1265601..1265643,1265706..1265871,1265935..1266352)
                     /locus_tag="ACHE_20431S"
                     /note="BUSCO:EOG09264OYZ;
                     COG:H;
                     EggNog:ENOG410PMH7;
                     InterPro:IPR036467,IPR034964,IPR002180;
                     PFAM:PF00885;
                     go_component: GO:0009349 - riboflavin synthase complex
                     [Evidence IEA];
                     go_function: GO:0000906 - 6,7-dimethyl-8-ribityllumazine
                     synthase activity [Evidence IEA];
                     go_process: GO:0009231 - riboflavin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133495.1"
                     /db_xref="GeneID:66979332"
                     /translation="MASLKGPGAAPTYDGSGLRIAIVHARWNMAIISPLLEGAKKQLF
                     SAGVREENITVETVPGSYELPFAAQRMYAASQIQAAKGSPSAEGVSATDLLSSSTTDL
                     SKASTTTSQSSAASRPFDAVIAIGVLIKGSTMHFEYICDAVTHGLMRIQIESGVPVIF
                     GVLTLLNEEQGLERAGLGKSGMHNHGEDWGNAAVELGVKRANWAEGRV"
     gene            complement(<1266491..>1267639)
                     /locus_tag="ACHE_20432A"
                     /db_xref="GeneID:66979333"
     mRNA            complement(join(<1266491..1266832,1266889..1267215,
                     1267289..1267447,1267507..1267572,1267637..>1267639))
                     /locus_tag="ACHE_20432A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284734.1"
                     /db_xref="GeneID:66979333"
     CDS             complement(join(1266491..1266832,1266889..1267215,
                     1267289..1267447,1267507..1267572,1267637..1267639))
                     /locus_tag="ACHE_20432A"
                     /note="BUSCO:EOG092644WX;
                     COG:O;
                     EggNog:ENOG410PGK8;
                     InterPro:IPR029055,IPR001353,IPR023332,IPR037555,
                     IPR000426;
                     MEROPS:MER0000553;
                     PFAM:PF00227,PF10584;
                     go_component: GO:0005839 - proteasome core complex
                     [Evidence IEA];
                     go_component: GO:0019773 - proteasome core complex,
                     alpha-subunit complex [Evidence IEA];
                     go_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA];
                     go_process: GO:0051603 - proteolysis involved in cellular
                     protein catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133496.1"
                     /db_xref="GeneID:66979333"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAAKAVENGGTAIGIRCKD
                     GVVLAVEKIITSKLLKPGANKKIATVDRHVGIVSAGLNPDGRHFVARARDEASSWRNV
                     YKAPVPTSALANRLGSYVQAFTLYSSVRPFGVTSIVGGWDSEGELAVDGQVGTGPKSG
                     AGGKVEGAKAGGPGLYMIEPSGLYWGYYGAATGKGRQAAKAELEKLDLVSGNLSLVDA
                     VKEAARIIYVAHEDSKDKDFELEMTWISSLDGPTKGRHEEVPKELFEEAENAAKKALE
                     GEDDDEDEGAKGTANEGERMEE"
     gene            <1268474..>1269404
                     /locus_tag="ACHE_20433S"
                     /db_xref="GeneID:66979334"
     mRNA            join(<1268474..1268572,1268634..>1269404)
                     /locus_tag="ACHE_20433S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284735.1"
                     /db_xref="GeneID:66979334"
     CDS             join(1268474..1268572,1268634..1269404)
                     /locus_tag="ACHE_20433S"
                     /note="COG:S;
                     EggNog:ENOG410PQ99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133497.1"
                     /db_xref="GeneID:66979334"
                     /translation="MSSSILHRCPSCGQITDISTSLAAFIENPHCSQCGLSASESSLK
                     LQEDLAALFDRQMSMGTVEVPETPEPSLPASPTSSSQPSPITYSVSQHYHHSSHVARQ
                     TQVVGTEEQQSFGTYSAPTATDTSNILRSYDIDPFTLSPRQIELFEGAIPEQKSRLIQ
                     MWQICPDTAERGPATGACFLNYQYQYHVNTFVEDHGMDGMAQDEDEDEDGQQYAEPYM
                     ASGYEALAQRDYELSGRKSYQTSLPSEPTTGAPYRLASDPIYESKRWWEHTNPQPMER
                     QHGAFEQPQHSMV"
     gene            complement(<1270016..>1270345)
                     /locus_tag="ACHE_20434A"
                     /db_xref="GeneID:66979335"
     mRNA            complement(<1270016..>1270345)
                     /locus_tag="ACHE_20434A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284736.1"
                     /db_xref="GeneID:66979335"
     CDS             complement(1270016..1270345)
                     /locus_tag="ACHE_20434A"
                     /note="COG:S;
                     EggNog:ENOG410Q2WH;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133498.1"
                     /db_xref="GeneID:66979335"
                     /translation="MKFTLTALAAMIAATVVHAAAIPGDGDWCGLPGQHCGQMKRAVS
                     GASEVKRSADALAEAIKEMPKLHIPGWCALPGQICSKFKRAVEAADDVKRSADALAEA
                     AAALESH"
     gene            <1271318..>1272892
                     /gene="IDH1"
                     /locus_tag="ACHE_20435S"
                     /db_xref="GeneID:66979336"
     mRNA            join(<1271318..1271350,1271574..1271634,1271706..1271780,
                     1271848..1272751,1272808..>1272892)
                     /gene="IDH1"
                     /locus_tag="ACHE_20435S"
                     /product="isocitrate dehydrogenase (NAD(+)) idh1"
                     /transcript_id="XM_043284737.1"
                     /db_xref="GeneID:66979336"
     CDS             join(1271318..1271350,1271574..1271634,1271706..1271780,
                     1271848..1272751,1272808..1272892)
                     /gene="IDH1"
                     /locus_tag="ACHE_20435S"
                     /note="COG:E;
                     EggNog:ENOG410PFT1;
                     InterPro:IPR004434,IPR024084,IPR019818;
                     PFAM:PF00180;
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0004449 - isocitrate dehydrogenase (NAD+)
                     activity [Evidence IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD(+)) idh1"
                     /protein_id="XP_043133499.1"
                     /db_xref="GeneID:66979336"
                     /translation="MFSLRTAQPAQSFLRRATASTSFVRSSIPARSFASVQSDIFKPT
                     KYGGKYTVTLIPGDGIGAEVSESVKTIFKADNVPIEWEQVDVSGVDTGNKHSEELFKE
                     SIASLRRNKLGLKGILFTPVERSGHQSFNVALRQELDIYASIVLIKNIPGYETRHKDV
                     DLCIIRENTEGEYSGLEHQSVQGVVESLKIITRAKSERIAKFAFGFALANNRKKVTCI
                     HKANIMKLADGLFRSTFHKTAENYPTLEVNDMIVDNASMQAVSRPQQFDVMVMPNLYG
                     GILSNVGAALVGGPGLVPGANMGRDVAVFEPGCRHVGLDIKGKDQANPSAMILSGSML
                     LRHLGLDDHANRISKAVYDVIGEGKTRTHDMGGQATTHEFTRAVLDKMETL"
     gene            complement(<1273521..>1274428)
                     /locus_tag="ACHE_20436A"
                     /db_xref="GeneID:66979337"
     mRNA            complement(join(<1273521..1274334,1274406..>1274428))
                     /locus_tag="ACHE_20436A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284738.1"
                     /db_xref="GeneID:66979337"
     CDS             complement(join(1273521..1274334,1274406..1274428))
                     /locus_tag="ACHE_20436A"
                     /note="BUSCO:EOG092646EZ;
                     COG:Q;
                     EggNog:ENOG410PGDN;
                     InterPro:IPR039769,IPR029063,IPR022238,IPR013216;
                     PFAM:PF13649,PF12589,PF08241;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0016435 - rRNA (guanine) methyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0070476 - rRNA (guanine-N7)-methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133500.1"
                     /db_xref="GeneID:66979337"
                     /translation="MSRPEDVLPPDLFYNDNESRKYTTSSRIRNIQSDMTHRALELLD
                     LKSPSLILDLGCGSGLSGEILSSLPRQEGGPHTWIGMDISPSMLDVALQRDVEGDLLL
                     ADIGQGIPFRPGSFDAAISISAIQWLCNAETSDVSPEGRLRRFFEGLYACLRRGGRAV
                     CQFYPKNDAQRSMISAAAMHAGFGAGILEDDPGTKNSKLYLVLTVGGGGLKGDITGVV
                     QGMNEVDVLDARKSAMQNRTSSSKKGDRAWIMRKKDQMERKGKVVKATSRYTGRKRRP
                     AF"
     gene            <1274950..>1275710
                     /gene="SVP26"
                     /locus_tag="ACHE_20437S"
                     /db_xref="GeneID:66979338"
     mRNA            join(<1274950..1275019,1275073..>1275710)
                     /gene="SVP26"
                     /locus_tag="ACHE_20437S"
                     /product="erv26 super protein"
                     /transcript_id="XM_043284739.1"
                     /db_xref="GeneID:66979338"
     CDS             join(1274950..1275019,1275073..1275710)
                     /gene="SVP26"
                     /locus_tag="ACHE_20437S"
                     /note="COG:I,T;
                     EggNog:ENOG410PN1G;
                     InterPro:IPR007277;
                     PFAM:PF04148;
                     TransMembrane:5 (o6-30i44-61o67-84i96-112o145-164i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0097020 - COPII receptor activity
                     [Evidence IEA];
                     go_process: GO:0006888 - endoplasmic reticulum to Golgi
                     vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="erv26 super protein"
                     /protein_id="XP_043133501.1"
                     /db_xref="GeneID:66979338"
                     /translation="MWILPLLGYLGVIVGFAFLTLAIASGLYYLSELVEEHTVLARRL
                     LTRLIFSIIVIQILLFLFDRFPFFLSALSIVSHLVYASNLRRFPIVKLSDPLFVLSCI
                     LVGLNHWLWFRHFSKPLPASRSAGNWRQPYQANVEDMPTFTEVASYFGICVWLVPFAL
                     FVSLSAGENVLPSMGSEYATGEHVSTAGLARNALSIDGKVKNKGMAKALVDGARDWVM
                     ENGEVMGFWRGDRTRRF"
     gene            complement(<1276290..>1280741)
                     /locus_tag="ACHE_20438A"
                     /db_xref="GeneID:66979339"
     mRNA            complement(join(<1276290..1276900,1276958..>1280741))
                     /locus_tag="ACHE_20438A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284740.1"
                     /db_xref="GeneID:66979339"
     CDS             complement(join(1276290..1276900,1276958..1280741))
                     /locus_tag="ACHE_20438A"
                     /note="COG:T;
                     EggNog:ENOG410PFGB;
                     InterPro:IPR011993,IPR000198,IPR036871,IPR008936,
                     IPR001849;
                     PFAM:PF00169,PF00620;
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133502.1"
                     /db_xref="GeneID:66979339"
                     /translation="MSQVRRHGQGTDHHHHHHYQYQPYNLPIQPPPTSPLPPPPLSPP
                     TTARNLHSTSPHSPSSSSPSPSSSSFPLNGNLIPRDYLGPRSDQQQTSRSAAALGAPR
                     RTTPSPSPLQTGAHSHLPRPDELGASQSPLSPRTSAGTSTFQSRSPVGRLSHAAFPTP
                     PSSAGHSFYSSQIETADKKPLSGHHQHDRDMTEEKANQATPRKPSDTTDSNQSATSSP
                     ISGINSLHSMAGDRSGQRFMPRTSSIDSAISSLSSASQSHKSTFDANSVTQADIGNLI
                     STAGSAEAVIIHLLKEKHHAASQNSQLWRLVDKQRTLILGLNKDLERALKEKEKYKKK
                     AKESQVPLPSNSNDYTTQPRDTEGDAVGLPDQERQAQNQPDLLRNTGGYSQGNLNNQN
                     AITTNDSLVESHGKEDQGGISHISQAPIYLRRELSAASPSSLASSNDSSLSERPIQER
                     VPHPIRKPPPAPLKLGQIGGTIMEHPESDSGSEYEDIDAMDDMDRGRRKTRDDDDRER
                     EAALAKEDVQPSKPAHPSGSQPIAVGLPSSPRPMVTQSPSPIERSGSLASILSPRMAH
                     AGSLKEQRSFLSSAPKSPGLPVSPRPEDRPVGAPLPRMPRELPNGLTPVSIPSSNNSI
                     SGLALSPRTTRNPNPFAAPGNFISSPANIAPPIPIIDAAVKIDSPRSPDSSVNGIYQG
                     LVSDEYPGLLLSPNALPLIEVKVASSRLRPSRNSYMASRSSEEEPVFTLSIFSRADSM
                     ELWRVEKVIAALPQLDQQVRQLCPFTGKLPDRSIFTGHSPAKIDTRRAALTSYFDTLL
                     DTPMDEKAALVVCQFLTSDAIEARDDETSLLKSSNQMKADILRGPDGKPRKEGYLTKR
                     GKNFGGWKARYFVLHGPELRYFEAPGGAHLGTVKIPNAQIGKQSQNTSAQSASPPDDD
                     SDNQYRHAFLILEPKKKDSSALVRHVLCAESDEDRDAWVEALLEYVEGPAAEYESANA
                     TNTKSQPQTPTARTSDAGPKSTKMFPSGSKKNTKGSDGPDSDGPDTVQGFSFDDAVPA
                     EPPVLGSNFDKPTPKSPLFPSSTWGPSADSNQTVNTTLENGQLSSKIISAPTNGTVIQ
                     DAGAWGNKASNATAIKEKKRSIWGFGKTRSSMDIASQLQQVDRESPTSQAQGNASLDK
                     KDFVRPVFGIPLAEAVQYCAPQGVDVELPAVVYRCIEYLQAKGASSEEGIFRLSGSNV
                     VIKALKERFNTEGDIDFLAGDEYYDVHAVASLFKQYLRELPTTVLTRELHLEFLRVLE
                     LDERERKIAAFNFLVHRLPKPNLSLLRALSQFLIEIVNNSAVNKMTVRNVGIVFAPTL
                     NIPAPVFSMFLTDYDSIFDQSPEFGGSAMESAVDDFKAPDILRSPRRQVFSDMPTPSY
                     NQTTFRHDQLEDPRGAYDTGLTYAQSSHEHRAHLSENYNYMPASMNQMLNPNMENARS
                     AKANRRESSMLFMEPGNQNPSIPTSRAD"
     gene            complement(<1281789..>1284061)
                     /gene="MDM31"
                     /locus_tag="ACHE_20439A"
                     /db_xref="GeneID:66979340"
     mRNA            complement(join(<1281789..1281920,1281977..1283196,
                     1283248..>1284061))
                     /gene="MDM31"
                     /locus_tag="ACHE_20439A"
                     /product="mitochondrial distribution and morphology
                     protein 31, mitochondrial precursor"
                     /transcript_id="XM_043284743.1"
                     /db_xref="GeneID:66979340"
     CDS             complement(join(1281789..1281920,1281977..1283196,
                     1283248..1284061))
                     /gene="MDM31"
                     /locus_tag="ACHE_20439A"
                     /note="BUSCO:EOG092615Y4;
                     COG:S;
                     EggNog:ENOG410PFEP;
                     InterPro:IPR012571;
                     PFAM:PF08118;
                     TransMembrane:2 (o238-269i700-720o);
                     go_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA];
                     go_process: GO:0000001 - mitochondrion inheritance
                     [Evidence IEA];
                     go_process: GO:0007005 - mitochondrion organization
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 31, mitochondrial precursor"
                     /protein_id="XP_043133503.1"
                     /db_xref="GeneID:66979340"
                     /translation="MAGNFGRRLYSNLWEAANPLIGRALRTSRSPFFSDTPNPTQFSC
                     EFLFKRQTRYASSLPPRRTTQITRRFASGGFFALGVSPSSPAVETGATCAINPDKLLP
                     HRRYNFDRKLRNLAGSVWKRGLHTNKDDRLKPETPKDPSFKPDSNKSDSANLDRTGDE
                     IQKNPQTEKSTYGHQLGSLNRHLIDRLPHMPHIPHLQRPTKEELLAAATGFWSRLKVR
                     FKWFSIRSVRPFNLDEIAALFSWVFLGHVVWVVLGTTTFFSLLIIAINTVFAQETLAR
                     WIGNYLTKSSGVKVVFESAIVPKWKDGVITFKNVFVSRRPGQGTGDVSKGSSKTAAAV
                     AAAAALSEQPTADASDQRTMSDEEDTNYTQFDISIESVNVTLSFTKWINGKGLLRDVD
                     VKGIRGVVDRRHVHWSDVNLDPKSYRHEHHPGDFEIDRFKMDDVLVTIYQPDNFRPFS
                     VSIFSCDLPQLRKQWLFYDFLSANMMSGSFDNSLFTIHPRQTHGFTGAQLGNGLEEDG
                     KPSPWKKHSRIRIDGLNIDHLNRGVQGPFSWIHEGTVDIVADIMFPAENDESLTKVMT
                     DLYDRLEATVTSNRYDPASPDADVFKEDAAKEDRRFLVTDLRIHLNNARAVVPIFTRD
                     LSYINNALIRPIVAYINSRRTFIPVNCRLVKRVGDFDGSWTTFDSGLMDDLSAAAYDG
                     FARDVVDDQARKRRFKKVGFWSLQLAAQAIFMGMAGNIA"
     gene            <1284455..>1285362
                     /gene="PNO1"
                     /locus_tag="ACHE_20440S"
                     /db_xref="GeneID:66979341"
     mRNA            join(<1284455..1284536,1284589..1285235,1285306..>1285362)
                     /gene="PNO1"
                     /locus_tag="ACHE_20440S"
                     /product="pre-rRNA-processing protein pno1"
                     /transcript_id="XM_043284744.1"
                     /db_xref="GeneID:66979341"
     CDS             join(1284455..1284536,1284589..1285235,1285306..1285362)
                     /gene="PNO1"
                     /locus_tag="ACHE_20440S"
                     /note="BUSCO:EOG09264SQJ;
                     COG:A;
                     EggNog:ENOG410PG9H;
                     InterPro:IPR004087,IPR039912,IPR036612;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="pre-rRNA-processing protein pno1"
                     /protein_id="XP_043133504.1"
                     /db_xref="GeneID:66979341"
                     /translation="MPAPTALLRRPEEMASTEASTAAPPVPNQDDEVLIDAQDSAEND
                     FSNNPPAEPAQDSEMRIDEEGRPVFTPERNTNSVYRVETRKVPVPPHRMTPLKANWPK
                     IYPPLVEHLKLQVRMNIKNKTVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIAL
                     LRLDDLYIQSFELKDVKGSLNGEHIGRAIGRIAGKDGKTKFAIENASRTRVVLADQKI
                     HILGGFKNIHIAREAIVSLILGSPPGKVYGNLRTVASRMKERF"
     gene            complement(<1285582..>1286425)
                     /gene="PRE7"
                     /locus_tag="ACHE_20441A"
                     /db_xref="GeneID:66979342"
     mRNA            complement(join(<1285582..1286269,1286328..>1286425))
                     /gene="PRE7"
                     /locus_tag="ACHE_20441A"
                     /product="proteasome subunit beta type-6"
                     /transcript_id="XM_043284745.1"
                     /db_xref="GeneID:66979342"
     CDS             complement(join(1285582..1286269,1286328..1286425))
                     /gene="PRE7"
                     /locus_tag="ACHE_20441A"
                     /note="BUSCO:EOG0926457R;
                     COG:O;
                     EggNog:ENOG410PHF4;
                     InterPro:IPR035202,IPR029055,IPR001353,IPR023333;
                     MEROPS:MER0005692;
                     PFAM:PF00227;
                     go_component: GO:0005839 - proteasome core complex
                     [Evidence IEA];
                     go_function: GO:0004298 - threonine-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0051603 - proteolysis involved in cellular
                     protein catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome subunit beta type-6"
                     /protein_id="XP_043133505.1"
                     /db_xref="GeneID:66979342"
                     /translation="MTSLMGYQPQNEGVGYSFSQPTSAPIKEHSFYPYTDNGGSTLGI
                     SGSDFAILAGDTRSVAGYNINSRYVPKVFRIGGDDETGEGAHILLAVVGFAADGQALK
                     ERLDAVVKMYRYQHGKPMSVSACAQRLSTILYQKRFFPYYVQAILAGLDEEGKGALYS
                     YDPVGSYEREQCRAAGSAASLIMPFLDNQVNCKNQYIPGSGEGHALEPKMPEPLPRDT
                     VEQLVRDAFTSAVERHIEVGDGLQMLLVTRNGIEEIYHPLKKD"
     gene            <1286830..>1287676
                     /locus_tag="ACHE_20442S"
                     /db_xref="GeneID:66979343"
     mRNA            join(<1286830..1286904,1286957..1287008,1287069..>1287676)
                     /locus_tag="ACHE_20442S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284746.1"
                     /db_xref="GeneID:66979343"
     CDS             join(1286830..1286904,1286957..1287008,1287069..1287676)
                     /locus_tag="ACHE_20442S"
                     /note="COG:S;
                     EggNog:ENOG410PPRM;
                     InterPro:IPR012479;
                     PFAM:PF07818;
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133506.1"
                     /db_xref="GeneID:66979343"
                     /translation="MLGLGAYQSSSEDEGENELPLTAPKHETKEQPVQESQVTNVNAS
                     KKMEMTPEITTNAEPVGPVFGPSQPQGPHIASGSSSEGPSSPFSTSLALIHDLTLPPV
                     PNLDIPPSPPGSPDPKANVKFAHFLSLKKQGTHFNEKLAGSSSLKNPSLLKKMMSHAG
                     INDEAQYSTSLPPDLWDMSNLPKWGYKEELLQTQQEIRRKMEEKRLPGQRDSIEFVSG
                     ASGGTGRMDFPRSKTKANVASRPGQL"
     gene            <1288260..>1289162
                     /gene="PRE4"
                     /locus_tag="ACHE_20443S"
                     /db_xref="GeneID:66979344"
     mRNA            join(<1288260..1288289,1288348..1288495,1288558..>1289162)
                     /gene="PRE4"
                     /locus_tag="ACHE_20443S"
                     /product="proteasome subunit beta type-7"
                     /transcript_id="XM_043284747.1"
                     /db_xref="GeneID:66979344"
     CDS             join(1288260..1288289,1288348..1288495,1288558..1289162)
                     /gene="PRE4"
                     /locus_tag="ACHE_20443S"
                     /note="BUSCO:EOG09263XZN;
                     COG:O;
                     EggNog:ENOG410PGKS;
                     InterPro:IPR029055,IPR001353,IPR023333,IPR016295,
                     IPR016050;
                     MEROPS:MER0001711;
                     PFAM:PF00227;
                     go_component: GO:0005839 - proteasome core complex
                     [Evidence IEA];
                     go_function: GO:0004298 - threonine-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0051603 - proteolysis involved in cellular
                     protein catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome subunit beta type-7"
                     /protein_id="XP_043133507.1"
                     /db_xref="GeneID:66979344"
                     /translation="MNHFPESWGRPRNDIYGPYNPSFLQTTGPKAHTQSPAVTGTSVV
                     AVKFNGGVAIAADNLASYGSLARFTDVKRLRTFGDSAVVGFGGDVSDMQYIDRLLGSI
                     DIKENYSAHGNLLNAKNLHTYLSKVFYKRRSEFNPLWNHVLVAGFDGNGQPFLSSADL
                     LGTTYSAPHLATGFGAHLAVPILRRLFPEEKPIEEVSKEQAVAALKECIKVLWYRDAR
                     SLDSYSIAVISKDGIEVKEDEKLEAQSWAFAESIRGYGAQTV"
     gene            complement(<1289333..>1290393)
                     /locus_tag="ACHE_20444A"
                     /db_xref="GeneID:66979345"
     mRNA            complement(join(<1289333..1289465,1289526..1290247,
                     1290379..>1290393))
                     /locus_tag="ACHE_20444A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284748.1"
                     /db_xref="GeneID:66979345"
     CDS             complement(join(1289333..1289465,1289526..1290247,
                     1290379..1290393))
                     /locus_tag="ACHE_20444A"
                     /note="COG:Q;
                     EggNog:ENOG410PGFE;
                     InterPro:IPR011234,IPR036663;
                     PFAM:PF01557;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133508.1"
                     /db_xref="GeneID:66979345"
                     /translation="MPAFSHLIRFLAKDGQVYYGDAILPPGVTDIAKATQARVIKGDI
                     FGQHQVTHQTAEVKLLLAPLAREDIGTVRGLGLNYEQHAKESNLPIPKYPVLFYKPVT
                     SIGGPTDDIPVPYLVQGDEGLDYECELVIVIGKLAKDVPENRALDYVLGYAVGNDVSH
                     RDWQIKRGGGQWALGKSFDGWAPFGPGIVTTDVIRDPNALMISTKLNGQTVQRSSTKD
                     MIFHVAQTVSFLSKGTTLLPGDLIFTGTPQGVGMGRKPQLWLKDGDQVEVSLDNVGSC
                     VNKVVYEKPSPKL"
     gene            <1290727..>1291116
                     /locus_tag="ACHE_20445S"
                     /db_xref="GeneID:66979346"
     mRNA            join(<1290727..1290807,1290878..1290909,1290993..>1291116)
                     /locus_tag="ACHE_20445S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284749.1"
                     /db_xref="GeneID:66979346"
     CDS             join(1290727..1290807,1290878..1290909,1290993..1291116)
                     /locus_tag="ACHE_20445S"
                     /note="COG:O;
                     EggNog:ENOG410PRUS;
                     InterPro:IPR008011;
                     PFAM:PF05347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133509.1"
                     /db_xref="GeneID:66979346"
                     /translation="MARLSGLQRDVLSLYRKCLREIRRKPVESRDNFRTYARAEFQKN
                     ILVGKKDFTAIEYLLRKGHRQLEMYSSPGIRNIR"
     gene            <1291656..>1292306
                     /locus_tag="ACHE_20446S"
                     /db_xref="GeneID:66979347"
     mRNA            <1291656..>1292306
                     /locus_tag="ACHE_20446S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284750.1"
                     /db_xref="GeneID:66979347"
     CDS             1291656..1292306
                     /locus_tag="ACHE_20446S"
                     /note="COG:O;
                     EggNog:ENOG410PNWV;
                     InterPro:IPR008978,IPR002068;
                     PFAM:PF00011,PF17886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133510.1"
                     /db_xref="GeneID:66979347"
                     /translation="MAFFPHYTTNLSPLFYLLDDDDYDVHRSTYPKHNYNHKQHHNRR
                     QLSPVRYFSPNFDVREVNDAYYLDGELPGVDQNNVDIEFSDPQTLVIKGRVERNYNNL
                     NSMDEENQQKEEQSSETISNKSYQATVENEDEDEANYSSPVATPTYSEKFVAEETQKP
                     AYKYRNSERAVGEFRRVFNLPTRVDQDAVRAILRNGILSLVLPKEPAPKMKKIRIE"
     gene            complement(<1293434..>1295650)
                     /locus_tag="ACHE_20447A"
                     /db_xref="GeneID:66979348"
     mRNA            complement(<1293434..>1295650)
                     /locus_tag="ACHE_20447A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284751.1"
                     /db_xref="GeneID:66979348"
     CDS             complement(1293434..1295650)
                     /locus_tag="ACHE_20447A"
                     /note="COG:S;
                     EggNog:ENOG410Q0N1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133511.1"
                     /db_xref="GeneID:66979348"
                     /translation="MGSFHSIPSRSGRRRTNRLSKPLTKKVPFLSPISRKSPPKNSNV
                     TSPVLPRSSPRKDPLSSASVPVSPPASNHHDSLPQSLRSAPSQSRSLRRVSGWSESIA
                     EENPEEDRHGLPSPKSSAAASMSRRSSLRPTRRASFQPESLRDVFQPRNSPAQPKRSY
                     SLQSLPQSPRGTIYEDALEEATSSNTYFMVDNQRFSLTRRRSLLTRPGVATRKPSRQS
                     VRRLSPLINQESESPPDGFAEKQTLLQPPFPETEDATMKTISASNSTRPDTPSDFEYT
                     HLGALKLGSLRVVNGSTSPSSSDRTRLNIPGSTSPENSSDDVYTKESMVPNHANSRKL
                     HGHRSSSEDKWKMTSSDTSMFQLSASPDKDDAPGSPFSFERSPTMATFPRHASFLTQE
                     EDEGISLPNETSPIEDGASLLWKAHMRSHNRKRHSQSLAKADSGYSSATSARSSQDKP
                     TRRSTDSQRPGRQSKGSRKVSASCGFEGHGDHVENSLGLNYLAPIRRHSNHQVSRYDR
                     LQQLQPDTPLRSPRFADSTALRHAMSFSRPFGPLSSLEASIKDATEAPIPQRRRAGSI
                     GGRASHSYQNFHALNSPRLSRHQSISFAGSEQRIPGITSVYKTRDYTRFNDADAASCY
                     DRFDYRPQNQPIHRSSTTRAKQTRADMVNEHCHQSNNNMGGKAVLPRHSTDFALRKSN
                     SFLERMEPVQETDYGTLAGGSCGRARNPNIDEQQIKYARPVKRRSLNMPTSPFIFK"
     gene            <1297066..>1298021
                     /locus_tag="ACHE_20448S"
                     /db_xref="GeneID:66979349"
     mRNA            join(<1297066..1297233,1297328..1297459,1297529..1297750,
                     1297806..>1298021)
                     /locus_tag="ACHE_20448S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284752.1"
                     /db_xref="GeneID:66979349"
     CDS             join(1297066..1297233,1297328..1297459,1297529..1297750,
                     1297806..1298021)
                     /locus_tag="ACHE_20448S"
                     /note="COG:S;
                     EggNog:ENOG410PRC9;
                     InterPro:IPR007135;
                     PFAM:PF03987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133512.1"
                     /db_xref="GeneID:66979349"
                     /translation="MASLMPSRPSQESLLGFPFLTPDEFDYGCRVLCDRFHAWQISSP
                     NTGLSIRFVHQQTSDSILKISRHIENIGVHDEENALMHEPEDLQEPQLEDDSEHDPEA
                     LIRATKPNASLQVDYDIALSPTYQVPVLYFTLRWTNHKGPVFGIDAVYQYLVPDEYRK
                     QLKNVGIIGGISFDYHPITGAPMFFVHPCNTADAIRHIAGGQGVTPETYLIIWLGLVG
                     HCVGLNMPSELFATEAGARTPERLGQR"
     gene            complement(<1298151..>1298872)
                     /gene="MSL1"
                     /locus_tag="ACHE_20449A"
                     /db_xref="GeneID:66979350"
     mRNA            complement(join(<1298151..1298444,1298511..1298724,
                     1298799..>1298872))
                     /gene="MSL1"
                     /locus_tag="ACHE_20449A"
                     /product="U2 snRNP complex subunit msl1"
                     /transcript_id="XM_043284754.1"
                     /db_xref="GeneID:66979350"
     CDS             complement(join(1298151..1298444,1298511..1298724,
                     1298799..1298872))
                     /gene="MSL1"
                     /locus_tag="ACHE_20449A"
                     /note="COG:A;
                     EggNog:ENOG410PN5A;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     TransMembrane:1 (o42-60i);
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="U2 snRNP complex subunit msl1"
                     /protein_id="XP_043133513.1"
                     /db_xref="GeneID:66979350"
                     /translation="MATKPIPTRNNTQNKAPGAGLPNQTLYCTNLPDKLRKHDLRLSL
                     YTLFSTYGVVLDVVAMKTEKMRGQAHIVFKDIQASTQAMRALQGFEFFGKEMKIVYAK
                     GSSDVLARLRGTYNLPAPTAPIGGASTDLQKSIFSGPPGSAALPPKPTGGANGEAQAA
                     QGVKRQREEESDEEEAPMDEDSDVPMEASSDED"
     gene            <1299228..>1300511
                     /gene="ARC1_1"
                     /locus_tag="ACHE_20450S"
                     /db_xref="GeneID:66979351"
     mRNA            join(<1299228..1299450,1299520..1300106,1300175..1300415,
                     1300471..>1300511)
                     /gene="ARC1_1"
                     /locus_tag="ACHE_20450S"
                     /product="G4 quadruplex nucleic acid binding protein"
                     /transcript_id="XM_043284755.1"
                     /db_xref="GeneID:66979351"
     CDS             join(1299228..1299450,1299520..1300106,1300175..1300415,
                     1300471..1300511)
                     /gene="ARC1_1"
                     /locus_tag="ACHE_20450S"
                     /note="COG:Z;
                     EggNog:ENOG410PIRY;
                     InterPro:IPR017383,IPR036322,IPR015943,IPR001680,
                     IPR017986;
                     PFAM:PF00400;
                     go_component: GO:0005885 - Arp2/3 protein complex
                     [Evidence IEA];
                     go_component: GO:0015629 - actin cytoskeleton [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0030833 - regulation of actin filament
                     polymerization [Evidence IEA];
                     go_process: GO:0034314 - Arp2/3 complex-mediated actin
                     nucleation [Evidence IEA]"
                     /codon_start=1
                     /product="G4 quadruplex nucleic acid binding protein"
                     /protein_id="XP_043133514.1"
                     /db_xref="GeneID:66979351"
                     /translation="MATPQAHHLFHNPIADHSFSSDKQTLAVARDSNVELYQTAGNKF
                     TLTDELKGHEKTVTSVDIAPNSGKIVTCSQDRNAYVWEQTPSGWKPTLVLLRINRAAT
                     FVRWSPSERKFAVGSGARVISVCYFEEENDWWISKHLKKPIRSTITTLAWHPNSVLLA
                     AGSTDSHARVLSGFIKGVDTRPEPSAWGERLPFNTICGEFLNDSAGWIHGVGFSPSGD
                     ALAFTGHDSSITVVYPSAPEQPPRAMLNIPTRLLPLNCLIWNGENEIIAAGHDCEPYR
                     FQGDESGWNLTGPIESKSGGGAGSIREDTALNMFRQMDLKGQTQADTQLKTTHQNTIS
                     TIRAYEDADGAVNKFSTSGVDGRVVIWSI"
     gene            complement(<1306538..>1310161)
                     /locus_tag="ACHE_20451A"
                     /db_xref="GeneID:66979352"
     mRNA            complement(join(<1306538..1307693,1307748..>1310161))
                     /locus_tag="ACHE_20451A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284756.1"
                     /db_xref="GeneID:66979352"
     CDS             complement(join(1306538..1307693,1307748..1310161))
                     /locus_tag="ACHE_20451A"
                     /note="COG:S;
                     EggNog:ENOG410PGSW;
                     InterPro:IPR018946,IPR036020,IPR043904,IPR001202;
                     PFAM:PF00397,PF19050;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133515.1"
                     /db_xref="GeneID:66979352"
                     /translation="MSPTGSRQVPEGELFLSSQPAPVESPIVEPLRINKHDTRTPSPA
                     SKHSVTPPYPDDRPRPYQTSSSSSAAGSDRMGSPTMHIQSSTPAGSGSLNPLDYPPAL
                     RPRDGREPRPATLAERRGNAPKPLPESPGPDVPDKEGLFRKYTRVPAAAPAPNGNAYA
                     NYRQQYYPPPQPSSTPKPASAAATTSHLQIPNGNNAISRISSTASSSTTRAQRGSPPP
                     PETPVVGPGQQPGSDIEARYAASGIAGTSTLAGLQAQNSAAQRRAEPYAHQPARRPWT
                     PTEQPGTQPHGPPTVYQGDSIVSADNPPASPIPIQCTVPPSQSAPPRQQPSRIPPNPL
                     EQDLERMRITSSPPPAYSTVSGPASLQGYPVEKQRPAASSAPPGHPAMTAPTNGATMP
                     ANGAAIASPMVTAQNHPAFANDPRPSTQSPQNGMQNGQQVVYQQQQQQQQQQQPPPQP
                     LVSASPAPSVMPPASPPPLPEGWIAHLDSNSGQYYYIHLPTQSTQWEFPKGPTPLNLN
                     DTPLSPVGSIYSSHPLASPALSTFKPMVSPGLPLTPGFESLQSPVMGGFTGPPPSCGV
                     DLYRVAPTNGVYFGPYLRYTNMDIEHGIWLGSILLVTDTAQPPTIHLHQSLDLSPNPR
                     QLKAVGIATHQRWTFYRYDISLQMDETGPAKWTYAITSHLGCTRYEFLVAGRYETNWR
                     FITTSGNDFSLNVNANDRARLGGVGLMWKDIMQKHNEIGGFHAQLCLGGQIYADRMWK
                     EIASLKQWLAISGKDARKNMPWTAAHQEDVSHAYFHYYTSHFDQPYLRESFAQIPYIC
                     QLDDHDIFDGFGSYPDHMQFSNMFKNIGRVGIEMYLLFQHHTTLDILRNTRSDMDLFT
                     VTGTGWHFVKYLGPAVVVVGPDCRSERNPHQVMAGPTYQGIFPRVAMLPPSVQHCLWM
                     LSVPIIYPRLETAEHIAHTVATGKRAVTGAYNVLGKVTSSVAGVVGAKDMVGSGFDSV
                     KRAVGKSGLMGGILSPFGEFDLMDELRDQWTHESKELERTYLIRTLQTIAQSKNIRMT
                     FLSGAVNVCGAGLVHDPTRPSDHKTMYQLISSSVVNGPPPSYILKLLHSSNKPLYVPA
                     NGHRSNSQPTDTKEDMMEIFQTDVTGQSREYRKLMGRRNYAAVVAYDPEAVSAAYGQQ
                     TNGTGPGAGKLNLAVDFMVQGEGLYPTVAKYGPVIVPSLGPEK"
     gene            complement(<1310826..>1316564)
                     /gene="ECM29"
                     /locus_tag="ACHE_20452A"
                     /db_xref="GeneID:66979353"
     mRNA            complement(join(<1310826..1311229,1311293..1311366,
                     1311433..>1316564))
                     /gene="ECM29"
                     /locus_tag="ACHE_20452A"
                     /product="proteasome component M29"
                     /transcript_id="XM_043284757.1"
                     /db_xref="GeneID:66979353"
     CDS             complement(join(1310826..1311229,1311293..1311366,
                     1311433..1316564))
                     /gene="ECM29"
                     /locus_tag="ACHE_20452A"
                     /note="COG:S;
                     EggNog:ENOG410PH87;
                     InterPro:IPR016024,IPR011989,IPR024372;
                     PFAM:PF13001;
                     go_function: GO:0060090 - molecular adaptor activity
                     [Evidence IEA];
                     go_process: GO:0043248 - proteasome assembly [Evidence
                     IEA]"
                     /codon_start=1
                     /product="proteasome component M29"
                     /protein_id="XP_043133516.1"
                     /db_xref="GeneID:66979353"
                     /translation="MASDPASASFEARELSLISKVELRIALAETDTKLQSLLQTYLAP
                     LLLKLGSESLAVRNKVITVCTHINTRVQTPSIQLPVTALLKQFKEQKSQLIRHFDLIF
                     LQQGLDRLGADARIEILLPLLQGISEIGTSVNQGATVFNLVLRLLPLLKVPPKGSEED
                     VQLKNRLGLSDQDTKFLSFWLEKLLLLSPADENSTTCPGLSPKEYTFLNKDAPIKETW
                     NPSASGGLNLTETKANALKFLASGAFTDSERFLPALVATADANSRLADLGEEILKRFI
                     PSLEDPDVVQQLYNLYFGTEEADGTPSVRPSLQIKLLVYLGKSIKATKHTEKVIRLIE
                     EGLLSDAARSSRGLQASKLRTQIFTFTTWVVRMGSPSKLKGMAPKVVQGLRDFIQSQG
                     WPSPGASGQRLPATDISLRGLAYESIGIMVPKVDFQAQNDDEEFSGFGLIKWLFTSLS
                     CDDSSPEIFVSIEQALGSILNSSLDSWDKKYQEQLRPFLVDQMRNEPGEDDLLTGFSI
                     VRGPQYAAVRFANRFLPYHDVVARWIDIIAIARGSERRHEVVEEGKKGLHPYWYRLFN
                     PGNKSKGPDGSSQEQSYGPWYDFPSFSSATRFLFRPLDHPGNTNIGTLPASDILPGGY
                     RKAFAPTITFLRNILLWESFSKFGIVTDIEQDWDTKLDVLLTSDERAREALRQYIASS
                     DKESVLLFLQNALNGLLNEDREGLGLCGEHFVEICSAASNDIVGAIVPRVLSLKAPIF
                     SNDQDKQNTAARAIGILASHPAFTEDDLTGFVTELSSAFTTWKSAIGELVLVVRGSIL
                     ALSYLLSRLAFRGKLDKIPQAQVKSFIQTIFEIIESANDTLLRRAAQIAIGQLSLSGI
                     LSPTLLSGDGWKKMKESLTRDAKAETEVPILAMGRLSLAFSNEYIVDPQFSWLLDALY
                     GLHEIRSPEIHFSVGEALSDAAIGWKSKALIREFDVDEQYPQSLIPNTVLADMCDKII
                     ADCGASKPALRKASAIWLLCLVKNCGHMQEMQDRLRECQASFSSLLGDRDEIVQESGA
                     QGLGLVYEMGDQELKDDLVRDLVNSFTANNSNLKGGKVHENTQLFEPGALPTGQGQSV
                     NTYKDIMNLASEAGDPTLVYRFMSLASNNAIWTNRAAFSKLGISNIFTDSSVNGYLAK
                     NPKIYPKLFRYRFDPNPNVQRSMNTIWHTLVKEPSTVINTHFDGIMDDLLKSMMTGRE
                     WRVRQASCTAISDMIQGRQPEQYSKYMDDIFAKAFKLLDDIKESVRASALKLCQTITN
                     AVIRTLETSDADTKRANAMLGKAIPFLLSDKGMESGVQEVQGFAIGSLIQIIKKSPAK
                     SLRPFVPPILEQFLNSLSSLEPQAVNYVHLNADKYGLTSEEIDKMRLSSIRTSPMMEV
                     IERYLIDTLDETSVKDFAAKLEGVLRAAVGLPTKVGCSRVLVLLSMKTILFRPYADRF
                     IQLLSKYVVDRNDTVSASYCSSIGYLMRLASDDRVLKTIEYAKTLYLTAEDATQRVIS
                     GEILHSTSKLSNDRFMAFAASALPFVFVFKHDTDEHVREVFEKTWQDNVGGTRTVSLY
                     VNEITTLVSDNLESPRWAIKHTAALGIASAITSLDPELDLVTSDRLWPVLEKALAGKT
                     WEGKEAVLKAFVKFAGQAKKLWQEKKQFSDSMKAIAIREAKRNNAAYRPHGLSALGGV
                     AQARSDLNLMPDALAIASKVLEDVLDDDEDRMDIDSGRGQKSSIENTLAACIKCVLRC
                     VNSAAYASGAIQTYLTDLIPVVDKALRNGGRTVQVPLYEELSQLLTRLEEWTSPTDGR
                     GVDVHSIQGPLSMLAGELLTREIDVSVETIRTERAQAAIAYIVLSQQRGFEINEALCQ
                     SIQSWRARERSGPVQQILDQALAKLIR"
     gene            complement(<1316862..>1321559)
                     /locus_tag="ACHE_20453A"
                     /db_xref="GeneID:66979354"
     mRNA            complement(join(<1316862..1317404,1317460..1321209,
                     1321279..1321463,1321526..>1321559))
                     /locus_tag="ACHE_20453A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284758.1"
                     /db_xref="GeneID:66979354"
     CDS             complement(join(1316862..1317404,1317460..1321209,
                     1321279..1321463,1321526..1321559))
                     /locus_tag="ACHE_20453A"
                     /note="BUSCO:EOG09260OE9;
                     COG:L;
                     EggNog:ENOG410PIC1;
                     InterPro:IPR001841,IPR027417,IPR017907,IPR000330,
                     IPR038718,IPR001650,IPR014001,IPR013083;
                     PFAM:PF00176,PF13920,PF00097,PF13639;
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133517.1"
                     /db_xref="GeneID:66979354"
                     /translation="MVVQQVRLSFEDPVPDSLAAVIERTDAPDTKDPPKKRRKLTSKA
                     PRSLLELNGVSETGVPNGFIPLARVNLHLNYAEANPGLNSSDTCIDLPHRFPVQFHAR
                     NTNVSNKGGMTPTIVGREDTDHDCFRLELKSVIDGEVIFSEKSTDPALLNIGKLLQLI
                     SKSLCADFCRRDDPVACYQATLHCLPDRKSFRLELALLWIDSLEVRGLSQFRDDQLEI
                     YSRYVIREPQDDFEEGTSHIFRCSWQEKELNQQAKRWSPRDFYKNVHVPEDTPKTSAD
                     IKCGMVESQLYPFQRRAVRWLLQRERMELHPNGKVVPVQKASGNHLPASFQEFADADG
                     RPYFASRLFMTAATGFPDWYDAEENLKGGILAEEMGLGKTVEMITLMCLNRRKVAAEQ
                     SPSDVDGKNLKPSGATLIITPPAILEQWKQEIQQHAPALRVLEYTGIQRHEDHSDDTL
                     AGMLASYDVVLTTYNTLSREIHYTGGVPERNLRHQKKFEPRKTPLLRIDWWRVCLDEA
                     QMVEHGVSNAATVARLIPRHNVWAVTGTPIRKDMSDLYGLLLFLHYEPFCDQTATWNR
                     LCGRFQSVLADIVNTITLRHSKDHVRSELDLPPQKRFVITIPFTAVEEQHYGQLFEQM
                     CEDCGLDLFGAPLNNNWDSEDPATVEKMRGWLTRLRQTCLHPEIAGRNRRALGTGNGP
                     LRTVGEVLEVMIDQNDMAIRTEQRSMLLSQIRRGQLLENAGRRQEALDLWNGALELAS
                     AIVKDCRAQLKSELARSRSLGDTSSKVNVNQANGECESEDDQMEKNSRIGTYRQRLRA
                     ALEVEHICIFFTANAYYQIKSDPKLTAPDSEDFKSLEKQEAEAYEAAKLIRKEMLSEV
                     SQKVDRYMRSIKDKKKDEKFIHISELDPHVFSTGIESRRVLEKLEDFCDAMNEHAEQY
                     KKWRDVMVNLLLQSLIDQEEDTELEGNEYETSTKHQDEMYVYMEALRAMFADRHDALT
                     GQNNTLVAHEVKGGIIQAQGGEGPSPQLFLSVMDKRSLVKPDPELGSLRGIIGELRSL
                     VTSLEWQENEGSARAAAELQLVKAVLENASKMNAEQTKVSSALEKEVEMFRDTMNNRL
                     EYYRQLQQISDTVAPYDEESVGKPMNDTLFAEKLRQEEAIDEKTSSLKAKRRYLLHIK
                     EEPDSDGSSRICIICQTGFEHGVLTVCGHKYCKDCLQLWWKQHRTCPICKKRLKASDF
                     HQITYRPEDFVVREEKTPTKMVPVPERSSKNSSIYTDISAGTLREIKNIDVNGYFGTK
                     IDTLARHILWLRMYDPGSKSIVFSQYRGFLDVLSVALSHYKVGYSSVDSKGGIEKFKN
                     EPAIECFLLHAKAHSSGLNLVNATHVFLCEPLINTAIELQAIARVHRIGQHRATTVWM
                     YLVSGTVEEAIYDLSVSRRLSHITAKKEEEARASSKTHLSGNYTEGIDETTIDSANSM
                     ELQNTALSKIMASGASGGEIVKKDDLWQCLFGDPSKDKGSGHHSMSADSEVGKFLRAE
                     AAERRAAKN"
     gene            complement(<1321831..>1323240)
                     /locus_tag="ACHE_20454A"
                     /db_xref="GeneID:66979355"
     mRNA            complement(<1321831..>1323240)
                     /locus_tag="ACHE_20454A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284759.1"
                     /db_xref="GeneID:66979355"
     CDS             complement(1321831..1323240)
                     /locus_tag="ACHE_20454A"
                     /note="COG:S;
                     EggNog:ENOG410PKK1;
                     InterPro:IPR021102;
                     PFAM:PF12222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133518.1"
                     /db_xref="GeneID:66979355"
                     /translation="MYLGDTEVFRTSTAEPTAAGIVWSYIKDMSPYNALWNEPQKLIF
                     DLGNQITDIYNGSFTATLTATFSHSGNVKTADVIMPISGQKSDSNSPSAFTVPSDNTT
                     VQYKIPSSASRAVVSISACGQSTEEFWWSNVFSSDTKTFSGTLSGYSPFREVQLYIDG
                     VLAGVAWPFPIIFTGGVTPVFWRPVVGIDAFDLRQPEIDISPFLPLITDGQDHSFEIK
                     VVGLDLSADGSATLSKSVGSNWVVTGNIFIYLDGNDVSSSSRAIRDSSRVPVLDAAAP
                     KISVSRNLNQNSAKKNESLSYSILVERTLTIKSSDISWSQNLSYSNHNLLNQQGLDQV
                     THQSTSGVNTVTQNGQSSHVSFEYPLTVITTTHSAADESTIDAQMKRGLTIETTNVTG
                     ISTYTMSAGPSFLRNRQWGNAHYISKADGNSTSFGDTTTTLECEAEGKPYSRNVRAVN
                     GSIAHDIPGVPSQPSQAVL"
     gene            complement(<1324454..>1325573)
                     /locus_tag="ACHE_20455A"
                     /db_xref="GeneID:66979356"
     mRNA            complement(join(<1324454..1324511,1324570..1324903,
                     1325045..>1325573))
                     /locus_tag="ACHE_20455A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284760.1"
                     /db_xref="GeneID:66979356"
     CDS             complement(join(1324454..1324511,1324570..1324903,
                     1325045..1325573))
                     /locus_tag="ACHE_20455A"
                     /note="COG:S;
                     EggNog:ENOG410PINJ;
                     InterPro:IPR024461;
                     PFAM:PF07798;
                     TransMembrane:1 (o284-305i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133519.1"
                     /db_xref="GeneID:66979356"
                     /translation="MTPPKSFREVPRSILPRLTWNGTSARATVTPLSAGYQSQQQRHI
                     QGWNSVARQVHTLTLSPYSSRFLTTAASRDLASSSAVTRHPSTSSTRRPSVGPINNPV
                     RYNGVYVAVFKAARRAFHATASRQRDHHFDTLKFVQRLKAEGFSEEQAVAMMRVLNDV
                     IQESIQNLTRTMVLREDSERSTYTQKVDFAKLRSELLNADSTEAQLTRSSHEKIAADL
                     AKLNSRLRDEIGRTQASVRLDLNLEKGRIREEANGQEMRIKETETRIEQEVAGLRERV
                     EAVKFSTLQWLMGVCTGTAALILGAWRLFM"
     gene            complement(<1325931..>1326967)
                     /gene="SEC53"
                     /locus_tag="ACHE_20456A"
                     /db_xref="GeneID:66979357"
     mRNA            complement(join(<1325931..1326180,1326247..1326321,
                     1326397..1326776,1326863..>1326967))
                     /gene="SEC53"
                     /locus_tag="ACHE_20456A"
                     /product="phosphomannomutase"
                     /transcript_id="XM_043284761.1"
                     /db_xref="GeneID:66979357"
     CDS             complement(join(1325931..1326180,1326247..1326321,
                     1326397..1326776,1326863..1326967))
                     /gene="SEC53"
                     /locus_tag="ACHE_20456A"
                     /note="BUSCO:EOG09263YFH;
                     COG:G;
                     EggNog:ENOG410PHHP;
                     InterPro:IPR043169,IPR006379,IPR005002,IPR036412,
                     IPR023214;
                     PFAM:PF03332;
                     go_function: GO:0004615 - phosphomannomutase activity
                     [Evidence IEA];
                     go_process: GO:0009298 - GDP-mannose biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="phosphomannomutase"
                     /protein_id="XP_043133520.1"
                     /db_xref="GeneID:66979357"
                     /translation="MSTEAASVYPALQDRPVQGTICLFDVDGTLTPARRSVAPEMLEL
                     LSQLRHKCAIGFVGGSDLVKQQEQLGTPSINVTSLFDFCFAENGLTAIRLGKTLSSNS
                     FIQWLGEDKYQNLVNFCLKYIADVKLPKKRGTFVEFRNGMVNISPVGRSASVDERNEF
                     EAYDKEHNIRKTLVEALKKEFPDYGLTYSIGGQISFDVFPTGWDKTYCLQHVEAEKEI
                     SGVKYKTIHFFGDKSFAGGNDYEIYSDPRTIGHAVTGPEDTMKQLREIFQL"
     gene            <1329295..>1331917
                     /gene="CLA4"
                     /locus_tag="ACHE_20457S"
                     /db_xref="GeneID:66979358"
     mRNA            join(<1329295..1331286,1331343..1331442,1331505..>1331917)
                     /gene="CLA4"
                     /locus_tag="ACHE_20457S"
                     /product="protein kinase"
                     /transcript_id="XM_043284762.1"
                     /db_xref="GeneID:66979358"
     CDS             join(1329295..1331286,1331343..1331442,1331505..1331917)
                     /gene="CLA4"
                     /locus_tag="ACHE_20457S"
                     /note="COG:T;
                     EggNog:ENOG410PFNT;
                     InterPro:IPR000095,IPR008271,IPR011993,IPR001849,
                     IPR011026,IPR033923,IPR000719,IPR011009,IPR036936;
                     PFAM:PF15413,PF07714,PF00169,PF00069,PF00786;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA];
                     go_process: GO:0007015 - actin filament organization
                     [Evidence IEA]"
                     /codon_start=1
                     /product="protein kinase"
                     /protein_id="XP_043133521.1"
                     /db_xref="GeneID:66979358"
                     /translation="MYTSDQFMNPGPAPRPPAERPKLNIPTDHSSTATSFGQMSLSSP
                     TTPGSGNLSLFPNTSSPALSHTKTNQSGQGGVAIIKEGYVRSKEDKFLATWNQRYLIL
                     REFRLEFLKNETGKIVLSIPLNTVTGVSRSEDAKMAFEVVRLANPKDATSKSAMLSRE
                     VPTKSITCEVKSDDEIYDWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPQTGAFVGLP
                     PEWEKLLTASAITKEDYKKNPQAVIEVLEFYSDIKMREQNPQYFAGLASPPSPVGQQP
                     KPYSNNSVGSSIAPPRPPPPPPSQRLDTGASPSSSHPSNFSPQNDRAYEHQQQADRVR
                     EASDQERRRLEEETRRARDDQERRDQEAYNASLPKTRVPMAKQELGGYGPSDPSMNDR
                     YKPSRPAPPAPGSANRLPGGPGQLTAQRPAPPAPSSTNGYGASRAPGSRPDDRQTSPS
                     SRYPPHDPWNQAKGSQHAQGPPPTKLPAPVQPVKPLNIANKQTANKPDGVRQAEAALT
                     KKAEPRKEVRMSAMTENEVMDRLRAVVSKDNPNESYSKQRKIGQGASGSVYVARVKEH
                     AMSPVARELYRQYGPRCQVAIKQMDLRSQPRKELIVNEIIVMKDSQHANIVNFLDSFL
                     QEQSSELWVVMEFMEGGALTDVIDNNPVIQEDQIATICAETCRGLAHLHSQNIIHRDI
                     KSDNVLLDRAGHVKITDFGFCAKLTESKNKRATMVGTPYWMAPEVVKQKEYGPKVDCW
                     SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVDV
                     RSRATADELLAHEFLKQGCSLASLAELLRWKKNNGQ"
     gene            complement(<1332639..>1334664)
                     /locus_tag="ACHE_20458A"
                     /db_xref="GeneID:66979359"
     mRNA            complement(join(<1332639..1334456,1334527..>1334664))
                     /locus_tag="ACHE_20458A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284763.1"
                     /db_xref="GeneID:66979359"
     CDS             complement(join(1332639..1334456,1334527..1334664))
                     /locus_tag="ACHE_20458A"
                     /note="COG:S;
                     EggNog:ENOG410PIX3;
                     InterPro:IPR015943;
                     TransMembrane:1 (o453-473i);
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133522.1"
                     /db_xref="GeneID:66979359"
                     /translation="MAPAIPSAKLTLSCPLFAADFDPRNSDYLLVGGGGGEGRSGVGN
                     RIALLNTSKRDEITESTEIELSRDEDSVMSMAVAQASEDSMISLAGINSSTAEQKRDN
                     NQHLRSFKIDLPKKQGEKKMLEKTTIPVDSVEKSTLLSRTSLFRTKGAKAGSDTYQRI
                     VRISPWRGEKLSRVGAITTGLAQSGEIVFFQAISMPKESDVIGRIRLSDGEEAGDIDI
                     IDSGKEDGKFRVAYTNGVDVFTCQISSSTRSSTAPDVSRVYTIPLLEKGKRPKFRALR
                     FLSPTSLLLLQNAPDRSGSELVVLSLPASNEKNKAVTIVRRKKLRKTIKMGLGLDVCN
                     LGTGAENDQTQQIIIAVTGSDQSIELLTLEYNPEKGYGKLWPYASLHDVHPFSVTRIC
                     FSTFTPPSHPVTPEVGPQYIKLASVSMGNTVVVHTIPLSPFPVSSRTPRYVLAIPGES
                     ETWATLLSGFTALFTVLIVCVLLQGYMEIKGGAPSYLGVSEWLPPQVQSVLGHPTPSL
                     SVERIDTSTSSIPTATTTISVIPNTNTGNQRQSLRDILRPRQEQEAATDAVTAGVNNN
                     IIVRCTTTDDGTSNEILIETIPSEQQIQDETRPWEELGEEQQSLWKQRLADAGHWAVE
                     EGETILKGVLFAEYCGFVRELVGEELL"
     gene            complement(<1334941..>1336957)
                     /gene="GRS1"
                     /locus_tag="ACHE_20459A"
                     /db_xref="GeneID:66979360"
     mRNA            complement(join(<1334941..1335324,1335374..>1336957))
                     /gene="GRS1"
                     /locus_tag="ACHE_20459A"
                     /product="glycine--tRNA ligase 1, mitochondrial"
                     /transcript_id="XM_043284765.1"
                     /db_xref="GeneID:66979360"
     CDS             complement(join(1334941..1335324,1335374..1336957))
                     /gene="GRS1"
                     /locus_tag="ACHE_20459A"
                     /note="COG:J;
                     EggNog:ENOG410PH5K;
                     InterPro:IPR036621,IPR006195,IPR004154,IPR027031,
                     IPR033731,IPR002315;
                     PFAM:PF03129;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0004820 - glycine-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006426 - glycyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycine--tRNA ligase 1, mitochondrial"
                     /protein_id="XP_043133523.1"
                     /db_xref="GeneID:66979360"
                     /translation="MATVNTKTGQAVDRSVLDSLLRRRLFYTPSFEIYGGVSGLYDYG
                     PPGCAVLNNMIELWRKHFVLEEDMLEVDCTMLTPEEILKTSGHVEKFADWMCKDPKTG
                     EIFRADHLVEEVLEARLKGDKEARGQTVVVDEAKEAKKKKKVSTKAVQLPDAVVQEYE
                     EILAQIDNFDGVELEGIIAKHDIRNPTTGGNLLPPVAFNLMFQTAIGPSSNMPGYLRP
                     ETAQGQFLNFQKLLDFNQNSMPFASASVGKSFRNEISPRAGLLRVREFLMAEIEHYVD
                     PEGGKKHTRFDEVKDVQLSLLNRDVQSSGKTDIQKMTVGKAVETGLVDNETLGYFIAR
                     IQLFLLKLGVDPNKLRFRQHMANEMAHYASDCWDAELQTSYGWIECVGCADRSAYDLT
                     VHKNKTGAPLVVREPRAEPLKVEEWQIDLDKKKFGPRFKKDGKTVEAAINALSQDFRE
                     KLSLELEQNDKVEIDVEGVASGKVELEKDIIKIEKRTRVENTREYTPNVIEPSFGIGR
                     ILYSMIEHVYWSREGDEARGVLSFPPVIAPTKVLIVPLSSNQAFAPLSQRLMTKLRRM
                     GVSNRVDDSSASIGKRYARNDELGTPFGITVDFQSVKDNTFTLRDRDSTKQVRASEDE
                     IVHALKSLVDGDETWEDIRQRLPEFTGQDVE"
     gene            <1337355..>1338650
                     /locus_tag="ACHE_20460S"
                     /db_xref="GeneID:66979361"
     mRNA            <1337355..>1338650
                     /locus_tag="ACHE_20460S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284766.1"
                     /db_xref="GeneID:66979361"
     CDS             1337355..1338650
                     /locus_tag="ACHE_20460S"
                     /note="COG:J;
                     EggNog:ENOG410PI8V;
                     InterPro:IPR007109;
                     PFAM:PF04427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133524.1"
                     /db_xref="GeneID:66979361"
                     /translation="MARKGNRPPPGVTDEYKPKNKLARQDLHVKRKRAKDSARRAERF
                     ARKKEEAKDPNLKEDRLKRNIPLTIDRKRVWDDVDSDVEDPLGLSVDVERIKRQKQEE
                     EDELNRPLKDSEQSSEDEEDEGDDSGDVDSMLASSDEDDKDEDEDKQKDEDRGRRKSS
                     LPSATERATSPSQSTKSTNLNLAPEALAAKFPSLFSTELQQRPPKILITTVLYSTLHN
                     EAEQLVNFFPNSVYIRRNAHRYSHKFSIREIAKFATNRNFTALVVVNEDQKRISGLTI
                     IHLPGGPTFHFSISNWIDSKKIPGHGKATEHWPELILNNFRTPLGLLTAHLFRNLFPS
                     KPDFEGRNVVTIHNQRDYLFVRRHRYVFREKRETEKPVVGADGKEMQGAEGIRAGLQE
                     LGPRFTLKLRRVDKGIHKISGQEWQWKGGMEKERTKFQL"
     gene            complement(<1338862..>1340030)
                     /locus_tag="ACHE_20461A"
                     /db_xref="GeneID:66979362"
     mRNA            complement(join(<1338862..1339822,1339870..>1340030))
                     /locus_tag="ACHE_20461A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284767.1"
                     /db_xref="GeneID:66979362"
     CDS             complement(join(1338862..1339822,1339870..1340030))
                     /locus_tag="ACHE_20461A"
                     /note="COG:S;
                     EggNog:ENOG410PKR0;
                     InterPro:IPR029063;
                     PFAM:PF13489,PF13847,PF13649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133525.1"
                     /db_xref="GeneID:66979362"
                     /translation="MDGKGIWPSSKRTSQGMAVGERKVAYSLQGLDINDYQEKKEEED
                     DDDASDSGSMKSTKSFEAQNIHVTIEHGRRYCDDFYFMPNDETESTRLNIIHQIYLIL
                     LDGKLTTVPLAKDEPRILDVGTGTGDWAVEMSSLFPKATIVATDIGIFDTGLVHIDLP
                     NVFFQLDDAREEWTYHEPFDLIHLRGLSGAFNDWPAIYRQAFEHLNPGGYIEIADTDP
                     AGDSVTFPNSESSYFHIYTGAMRSAAEALKYPRDLCHLKPNMLSAAGFVDVRVFERTV
                     PIGLWPQDLHEKTLGKMTLIAVLEGLEAYGLRSLTATGWTADAVRDLCEKAKMEIMSA
                     DRMTARVKFMTGRKPISRVQMKEMRQRELLARALKKVEE"
     gene            <1340540..>1341229
                     /gene="PTH1"
                     /locus_tag="ACHE_20462S"
                     /db_xref="GeneID:66979363"
     mRNA            <1340540..>1341229
                     /gene="PTH1"
                     /locus_tag="ACHE_20462S"
                     /product="aminoacyl-tRNA hydrolase"
                     /transcript_id="XM_043284768.1"
                     /db_xref="GeneID:66979363"
     CDS             1340540..1341229
                     /gene="PTH1"
                     /locus_tag="ACHE_20462S"
                     /note="COG:J;
                     EggNog:ENOG410PSBJ;
                     InterPro:IPR001328,IPR036416;
                     PFAM:PF01195;
                     go_function: GO:0004045 - aminoacyl-tRNA hydrolase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="XP_043133526.1"
                     /db_xref="GeneID:66979363"
                     /translation="MSNIQQHQPPNTPKTTMPDLTKPAKRILFIASIGNPAPYRTTRH
                     SAGHILFESLVPLLSSRFSPTPNCTLSEAEQSVLYKTWKSPAYMNESGGKLVRRLHKW
                     ISTLDIQQRQPTLVILHDELESPLGKLRVKRGGAEAASLRGHRGLISIMEVLRGKGLY
                     PPRAPAENTGLSIMRVGVGIGRPESRERGSVADYVLTKMSPEELTVVRAAADPVVELL
                     LEELYREQEQS"
     gene            complement(<1341437..>1342435)
                     /gene="HOB3"
                     /locus_tag="ACHE_20463A"
                     /db_xref="GeneID:66979364"
     mRNA            complement(join(<1341437..1342038,1342088..1342161,
                     1342210..1342255,1342314..1342364,1342423..>1342435))
                     /gene="HOB3"
                     /locus_tag="ACHE_20463A"
                     /product="BAR adaptor protein Hob3"
                     /transcript_id="XM_043284769.1"
                     /db_xref="GeneID:66979364"
     CDS             complement(join(1341437..1342038,1342088..1342161,
                     1342210..1342255,1342314..1342364,1342423..1342435))
                     /gene="HOB3"
                     /locus_tag="ACHE_20463A"
                     /note="COG:U;
                     EggNog:ENOG410PGVR;
                     InterPro:IPR003005,IPR004148,IPR027267,IPR037429;
                     PFAM:PF03114;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0007015 - actin filament organization
                     [Evidence IEA]"
                     /codon_start=1
                     /product="BAR adaptor protein Hob3"
                     /protein_id="XP_043133527.1"
                     /db_xref="GeneID:66979364"
                     /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRFRTMEA
                     ASTRLQKEAKGYLDSLRAMTASQMRIAETIDAFYGDAGTRDGVSRSYKQAVEDLDAET
                     IKALDGPYRSTVLDPISRWCAYFPDINECIKKRNHKLLDYDAMRAKVKKLVEKPDKDA
                     TKLPRTERETEMAKQAYEQLNEQLFTELPQLIDLRVPYLDPSFEALVKIQLRFCAEAY
                     SRMAQVQQYLDAETRDQYARGDLDNRVEEVLQEIRDLSIAGTV"
     gene            complement(<1344082..>1345734)
                     /gene="SAT4"
                     /locus_tag="ACHE_20464A"
                     /db_xref="GeneID:66979365"
     mRNA            complement(join(<1344082..1344213,1344277..>1345734))
                     /gene="SAT4"
                     /locus_tag="ACHE_20464A"
                     /product="serine/threonine-protein kinase HAL4/sat4"
                     /transcript_id="XM_043284770.1"
                     /db_xref="GeneID:66979365"
     CDS             complement(join(1344082..1344213,1344277..1345734))
                     /gene="SAT4"
                     /locus_tag="ACHE_20464A"
                     /note="COG:T;
                     EggNog:ENOG410PG7W;
                     InterPro:IPR017441,IPR008271,IPR000719,IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="serine/threonine-protein kinase HAL4/sat4"
                     /protein_id="XP_043133528.1"
                     /db_xref="GeneID:66979365"
                     /translation="MTPQSTATSPVASAVSSATNSQIFSDPRDGDAAQVTRAFAGMNL
                     SAMNGDSLPAPPPPAATKPARPTMANRISRMFSSTKTATSKDHPSDSNRDFSDSSSDG
                     AKAPSANGSQKPGSKPSSKPPSRAPSRQTSTKGDDRDREKKPKSSSGKEQKDGTVNVS
                     KRFELQTDGTHAHHLRSARRQEKLTDLLRDMLGGSRKKDDHADDQQQLSLMSTWIDQF
                     KNERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPKDHKMEQLYA
                     VKEFRRRPQETAKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGG
                     DLYTLVLAAGKLEVAEADCLFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITD
                     FGNGECFRMAWEEEAHMTAGLCGSAPYIAPEEYIEKEFDPRAVDIWATGVIYMAMRTG
                     RHLWRVARKDEDEFYQRYLEGRKHEDGYAPIETLHRARCRNVIYSILDPNPTRRINAS
                     QVLKSEWLREIKLCKPGEEGF"
     gene            complement(<1349458..>1350202)
                     /gene="BET5"
                     /locus_tag="ACHE_20465A"
                     /db_xref="GeneID:66979366"
     mRNA            complement(join(<1349458..1349475,1349526..1349614,
                     1349671..1349816,1349891..1350107,1350166..>1350202))
                     /gene="BET5"
                     /locus_tag="ACHE_20465A"
                     /product="TRAPP subunit bet5"
                     /transcript_id="XM_043284771.1"
                     /db_xref="GeneID:66979366"
     CDS             complement(join(1349458..1349475,1349526..1349614,
                     1349671..1349816,1349891..1350107,1350166..1350202))
                     /gene="BET5"
                     /locus_tag="ACHE_20465A"
                     /note="COG:U;
                     EggNog:ENOG410PNSF;
                     InterPro:IPR007233,IPR011012;
                     PFAM:PF04099;
                     go_component: GO:0030008 - TRAPP complex [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="TRAPP subunit bet5"
                     /protein_id="XP_043133529.1"
                     /db_xref="GeneID:66979366"
                     /translation="MVVYSFYIFDRHAECIYKRRWLPRPVSITSKSSRPTSDLSIQNN
                     GGAPAVFGQTARTTDDDAKLIFGTVFSLRNMVRKLGGEDDNFVSYRTNQYKLHYFETP
                     TNIKFVMLTDLKSPSMRLALEQIYINLYVEYVVKNPLSPVEHPGGVGVNNELFEESLE
                     QFVTRVLT"
     gene            <1350693..>1353376
                     /locus_tag="ACHE_20466S"
                     /db_xref="GeneID:66979367"
     mRNA            join(<1350693..1350805,1350901..1350973,1351038..1351187,
                     1351252..1352046,1352101..1352238,1352291..>1353376)
                     /locus_tag="ACHE_20466S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284772.1"
                     /db_xref="GeneID:66979367"
     CDS             join(1350693..1350805,1350901..1350973,1351038..1351187,
                     1351252..1352046,1352101..1352238,1352291..1353376)
                     /locus_tag="ACHE_20466S"
                     /note="COG:T;
                     EggNog:ENOG410PHIQ;
                     InterPro:IPR017441,IPR008271,IPR000719,IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133530.1"
                     /db_xref="GeneID:66979367"
                     /translation="MATENVDATLPDARSESPLVGNLNDRSAFQRSTPARYASTPSSH
                     EGLPRHHRRNPMVRRPVKETLNARSEYTTSQDDGTAEHRINQYLIRQEIGRGSFGSVH
                     LAADQYGNEYAVKEFSKSRLRRRAQSHLLRRPRGPQRSGSGFNSSAHRPLPGSGDESA
                     GKAIDLIKAEIAIMKKLNHNNLVSLIEVLDDPKEDSLYMVMEMCKKGVVMRVSLEERA
                     DPYDDERCRCWFRDLILGIEYLHAQGIVHRDIKPDNCLVTTDDILKVVDFGVSEMFEK
                     DSDMFTAKSAGSPAFLPPELCIAKHGDVSGKATDIWSMGVTLYCLRYGKLPFEKGSIF
                     DLYEAIRNDEVVCEGETDDNLKDLMHRILEKDPAKRITMSELREHPWVTKNGLDPLLS
                     ESENTAEIIEPPTEEEMNSAITKTVGHILAVIKAVKKFKRLVDPNKEEPPMQSILGQE
                     YEAHFVEPPMEMEPDESFELSNSMSITSKSQSLDTYDRDASERDNVLQGYHQQRGGPA
                     ARFFPRRIDSGSVHSSGFRADFMDDLQGAWSPRSGSPSIPPLSRTDSVATKRSIEGTR
                     GHARDPLEEEFPYLFIGPSTYTGSSHNDTDGSQPATIFEEPESANLEDTPMTEVEDVP
                     IVSESPGAAEFDIYENAYREEIERICKRSVPRRGTAPKMYLTRRVDGKDDVMRLVQDH
                     EGSFEPNQRDQQSHSQTVPIGGKVAVTPSSSFSSAVGMIRTQLEGQRQQQQPQCESEP
                     EPRSQVQEVPEPPTSETNDKKTPSSPPENPRAKLRCLLGRVRGS"
     gene            complement(<1354887..>1355780)
                     /locus_tag="ACHE_20467A"
                     /db_xref="GeneID:66979368"
     mRNA            complement(<1354887..>1355780)
                     /locus_tag="ACHE_20467A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284773.1"
                     /db_xref="GeneID:66979368"
     CDS             complement(1354887..1355780)
                     /locus_tag="ACHE_20467A"
                     /note="COG:S;
                     EggNog:ENOG410PST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133531.1"
                     /db_xref="GeneID:66979368"
                     /translation="MPPGRSLNSCQLAFGHMCQQHVQQPVLPPSAMIPATSQPQPPHP
                     ELTAPAVVRKRLCPGMERPIAPRPSTVPYDQGSSASITSPDVNEPPKKRGRPTKAEAE
                     RKRTEEERKRAAAEARGERYPLPKRRGSGKSKASTSTVPNSPAGSLGTIGTSFSPRTN
                     ARGLEESKPEPQVHQGPSAGQPSDRPTGFRRNEQRPRAMSDQILKPVSSATSRELPRP
                     LEARQTLPSPQELQLGHPEPIQRFNPGHPPLEHFNPDRIPRVFDAPRPMLADSASNRR
                     PEYRIIAPTPTLDPATEKASR"
     gene            <1362675..>1365594
                     /gene="SET2"
                     /locus_tag="ACHE_20468S"
                     /db_xref="GeneID:66979369"
     mRNA            join(<1362675..1363161,1363302..1364899,1364952..1365032,
                     1365094..>1365594)
                     /gene="SET2"
                     /locus_tag="ACHE_20468S"
                     /product="histone methyltransferase set2"
                     /transcript_id="XM_043284774.1"
                     /db_xref="GeneID:66979369"
     CDS             join(1362675..1363161,1363302..1364899,1364952..1365032,
                     1365094..1365594)
                     /gene="SET2"
                     /locus_tag="ACHE_20468S"
                     /note="BUSCO:EOG09261B14;
                     COG:K;
                     EggNog:ENOG410PGM7;
                     InterPro:IPR003616,IPR006560,IPR001202,IPR036020,
                     IPR001214,IPR013257,IPR038190,IPR025788;
                     PFAM:PF17907,PF08236,PF00856;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0005694 - chromosome [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0018024 - histone-lysine
                     N-methyltransferase activity [Evidence IEA];
                     go_function: GO:0046975 - histone methyltransferase
                     activity (H3-K36 specific) [Evidence IEA];
                     go_process: GO:0006354 - DNA-templated transcription,
                     elongation [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA];
                     go_process: GO:0010452 - histone H3-K36 methylation
                     [Evidence IEA];
                     go_process: GO:0034968 - histone lysine methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="histone methyltransferase set2"
                     /protein_id="XP_043133532.1"
                     /db_xref="GeneID:66979369"
                     /translation="MSSHDNADSQSETVANAVTAMKLEHDDGDTASSVVNGSGGAVKK
                     EEEEKILVNGSALEVKSRSQSHSPTKKEEREEREVKDADEEEKVGGDITVQLEPGEPP
                     KLARSSSQKVVPRPPQLFLDLPDSTEEARSTFEVMEMCTYANKYMGYTEHAMECDCAE
                     EWDSTVGKNHACGEDSDCINRATKIECVNDCSCGPECQNQRFQRREYANVAVIKTDKK
                     GFGLRAESDLRPNQFIFEYVGEVINEGNFRRRMRQYDEEGIKHFYFMSLNKGEFVDAT
                     KKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAERFIQAGEELVFNYNVDRYGADPQ
                     PCYCGELNCTGFIGGRTQTERATKLSNATIEALGIDDADGWDTAVAKRPRKKKMGEAD
                     EEYVDSMQPKSLEENGVTKVMAALMQCQEKWIAVKLLGRIQRCEDERVRNRVVKMHGY
                     QILNSQLAMWKDDHNVALQIMDILDKFPRLTRNKIIDSKIESTIQPLATCGDERVEKN
                     AAALLQAWSTLEVGYRIPRMKRDPNSSSRAVNQFGRRENTRDERRRSRSRSRSRSRSL
                     DAPRGPRGDRGPRNHHRPRPFRRQPNPLPPGWFAAESNGRTYYYSARGDTTWTRPTTP
                     APQPPPPPKESKDKALQDIIDGIMNAKENTPKEKTTTPGTPQASKLTPEGKEGSKWKG
                     YSEEKQKKLYENTLFPHIKYVVDKFKHKLPKDDLKRHAKDVAKKLVNSDFKNSRVEDP
                     TAISDKQQKKVKNYCKEYFEKAVVKHREHEKKKAGKDGKETGDTANGESDEGVDVKMS
                     DDEGGKDTPGDGEETETPGSSLKRKRDDDPKREDGKRSPSPSKRQRSSTPPPPPPPPM
                     SPGQAESTPTDKQAMQYAPTPPPPPPIPTEQS"
     gene            complement(<1365975..>1366950)
                     /gene="TIF6"
                     /locus_tag="ACHE_20469A"
                     /db_xref="GeneID:66979370"
     mRNA            complement(join(<1365975..1366335,1366396..1366584,
                     1366646..1366732,1366786..1366857,1366916..>1366950))
                     /gene="TIF6"
                     /locus_tag="ACHE_20469A"
                     /product="eukaryotic translation initiation factor 6"
                     /transcript_id="XM_043284776.1"
                     /db_xref="GeneID:66979370"
     CDS             complement(join(1365975..1366335,1366396..1366584,
                     1366646..1366732,1366786..1366857,1366916..1366950))
                     /gene="TIF6"
                     /locus_tag="ACHE_20469A"
                     /note="BUSCO:EOG092644O2;
                     COG:J;
                     EggNog:ENOG410PFYZ;
                     InterPro:IPR002769;
                     PFAM:PF01912;
                     go_function: GO:0043022 - ribosome binding [Evidence IEA];
                     go_process: GO:0042256 - mature ribosome assembly
                     [Evidence IEA]"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 6"
                     /protein_id="XP_043133533.1"
                     /db_xref="GeneID:66979370"
                     /translation="MAVRAQFENSNEVGVFSRLTNSYALVAIGASENFYSVFEAELQD
                     VIPICHATIAGTRIIGRLTAGNRNGLLVPTTTTDQELQHLRNTLPDHVKIQRIEERLS
                     ALGNVICCNDHVALVHPDIERETEEIIADVLGVEVFRQTIADNVLTGSYMALSNQGGI
                     VHPKTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAVTGLDTTATELSVV
                     ESVFRLGEMGPRGLGMGEANKESIVESFY"
     gene            complement(<1367751..>1370261)
                     /locus_tag="ACHE_20470A"
                     /db_xref="GeneID:66979371"
     mRNA            complement(join(<1367751..1368473,1368526..1368630,
                     1368680..1370118,1370186..>1370261))
                     /locus_tag="ACHE_20470A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284777.1"
                     /db_xref="GeneID:66979371"
     CDS             complement(join(1367751..1368473,1368526..1368630,
                     1368680..1370118,1370186..1370261))
                     /locus_tag="ACHE_20470A"
                     /note="COG:S;
                     EggNog:ENOG410Q0DJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133534.1"
                     /db_xref="GeneID:66979371"
                     /translation="MAGAKRKLDTAHAPTASEGASQSANNAQNVRVTRRSAASQANRD
                     PRGSDKSHNNSTTTSSTSSNNSSNIPARRSRIVKLNTRGALANNANTNPINARETRTS
                     RGRATALSSSQQSEPIASAPSQVPETPRLKRMKRGSVAEETPRTTRQSARIRALGPNP
                     HASFDEAVEGKPLEASPTKASSIRANVEDKDDTTAAITKSPSPDEVNISEEPKVGDTD
                     DPEDPKTEWNPAEGTADANLNNDGASTNAHRETPTQSLSPPQKERNSPEAEVNTVTES
                     ADVFPTASEKKPKFEETDLDRALEQQLQNGTAEKHDSPSPADATEESRVDDESRQITD
                     VEESVVPNGVRSTARPTTVKGRQAARIARGRAKGKGRPKGKGPAARRAAAAAAAGRGR
                     QMESPELRSERSPSPFAAARKLLDRKLELDRAFKKVAAAQRLALHVMAVRTENQLARD
                     KNAHQKVPEFDKLEAVLTAYRQKRQDILRHEYEFRVEQENLLFTSEQDRLERKFRASA
                     RHIQEEHFLAAQGDYMAFVEGRRAAEDDEHTETDGSETEQYKRPRAPPIKEFIRGFNS
                     NHVREPAGAAAYERADTGWEQFVQRVRLGEDFDPQMKEMREIHPSGATNQPVFGTLEM
                     LLEATNAVANQPTSEIPAPAQTAPEMPAVALSALADVASSEGPIRTSRPSMLRTILPQ
                     PMTDPRPYMLPRPGPHPAPPQPGPARQQTRPLLPAGQQIPSINEQLGLPDPFVPGGGP
                     PQLPPPPGSNFQRPPPPGFLQSSPLYFPPPHHPSGPRPPY"
     gene            complement(<1373190..>1374518)
                     /locus_tag="ACHE_20471A"
                     /db_xref="GeneID:66979372"
     mRNA            complement(<1373190..>1374518)
                     /locus_tag="ACHE_20471A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284778.1"
                     /db_xref="GeneID:66979372"
     CDS             complement(1373190..1374518)
                     /locus_tag="ACHE_20471A"
                     /note="COG:S;
                     EggNog:ENOG410QEA2;
                     TransMembrane:4 (o6-30i37-56o76-97i109-132o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133535.1"
                     /db_xref="GeneID:66979372"
                     /translation="MHITVAYSLGGTALALTVITTILDGVCYAWSRSSLELAVLSLNA
                     VGCVVLALLLVLQTRYPKTKTKAGLWGTWQHTVHILVVAYLLLAAGITAGIIAKSLTM
                     APAQAQFISRNIFWVLSIIAQALFCGFLLIPRTRQQDEENTHSWPRPLSHELEMLDER
                     GSGDRIQERSDSPSLSITVESNRPSLSPHPKTSTDGLAPVRPYVSNVATRVSSRYSGK
                     TLFQQDSKHNSIDLHAGVMSSPSKPDISEGRDTCSVADQENQSTTTITGSTSNPAPKR
                     SDSDVKSMDSLLILPSPPSPTETSTNLESIATTSMRPPLLKLNPLPNEKNIHPLFRSD
                     SPSPPPTPMPGTMVKASPVAGTTISAKTLSRVRSTNSLRVSNNGRSRSPLLSERMSTA
                     EEGELSSSCPPSLTSSKSIPMPGIIMAGDLRKSMLQYEKKYDLNESPLEG"
     gene            <1376010..>1377568
                     /locus_tag="ACHE_20472S"
                     /db_xref="GeneID:66979373"
     mRNA            join(<1376010..1376027,1376095..1376142,1376217..1376289,
                     1376397..1376476,1376547..1376876,1376941..1377390,
                     1377449..>1377568)
                     /locus_tag="ACHE_20472S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284779.1"
                     /db_xref="GeneID:66979373"
     CDS             join(1376010..1376027,1376095..1376142,1376217..1376289,
                     1376397..1376476,1376547..1376876,1376941..1377390,
                     1377449..1377568)
                     /locus_tag="ACHE_20472S"
                     /note="BUSCO:EOG09264CST;
                     COG:L;
                     EggNog:ENOG410PIGA;
                     InterPro:IPR004806,IPR009060,IPR015360,IPR006636,
                     IPR015940,IPR000626,IPR029071,IPR036353;
                     PFAM:PF09280,PF00240,PF11976,PF00627;
                     go_function: GO:0003684 - damaged DNA binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IEA];
                     go_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133536.1"
                     /db_xref="GeneID:66979373"
                     /translation="MKLTFKDLKQQKFTIDAEPSETVGQVKEKISTEKGWEVPQLKLI
                     YSGKILQDDKTVESYNIEEKGFIVCMVSKPKPAPSSAASSQAPSTPTRAPTSTPAAPA
                     APAPSAATSTLAVPATPSPAGAPPASTDTPALNDPSALLSGSQSEPVIAQMESMGFAR
                     EDITRAMRAAFFNPDRAIEYLLNGIPEDIQQEQQQSAAAARAAQEPAGETPSAPAAPS
                     GEDEPVNLFEAAAQAGDGARGARPGGGAGGEALPNLDFLRNNPHFQQLRQLVQQQPQM
                     LEPILQQVAAGNPQIAQLIGQNEEQFLQLLSEDGEDVLPPGTQTISVTEDERDAIERL
                     CRLGFSRDLVIQAYFACDKNEELAANYLFENPDDPDDL"
     gene            complement(<1378105..>1380063)
                     /gene="SMP3"
                     /locus_tag="ACHE_20473A"
                     /db_xref="GeneID:66979374"
     mRNA            complement(join(<1378105..1379116,1379168..1379295,
                     1379344..1379726,1379955..>1380063))
                     /gene="SMP3"
                     /locus_tag="ACHE_20473A"
                     /product="alpha 1,2 mannosyltransferase"
                     /transcript_id="XM_043284780.1"
                     /db_xref="GeneID:66979374"
     CDS             complement(join(1378105..1379116,1379168..1379295,
                     1379344..1379726,1379955..1380063))
                     /gene="SMP3"
                     /locus_tag="ACHE_20473A"
                     /note="CAZy:GT22;
                     COG:G;
                     EggNog:ENOG410PG7I;
                     InterPro:IPR005599;
                     PFAM:PF03901;
                     SECRETED:SignalP(1-17);
                     TransMembrane:6
                     (n7-18c23/24o89-110i122-139o145-161i173-199o211-233i355-
                     376o);
                     go_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="alpha 1,2 mannosyltransferase"
                     /protein_id="XP_043133537.1"
                     /db_xref="GeneID:66979374"
                     /translation="MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPEIFAGRNFFYPS
                     IRPWEFTSDHPIRSVFPLWPVYDVPMSLLKWFYSEMGTGNPPPELVYNVIRGVMFLLT
                     FVLEDWAIYEFVPSPRHRRATIVLVASSYVTWTYQTHTFSNSIETLLVVWGLVLIRRI
                     IENKRRSSHFSCAVLAFIAVAGVFNRITFPAFLVLPGLLLLPHFQRKPLSIFSFTLSG
                     LFFAFVAILGDTIFYKPSASFLEALRSPVITPLNNFLYNSDASNLAHHGLHPHYQHFL
                     ANLPQLLGPAYIMMIASLSTGNLRRPLTIPSWVKNMRAASAISATILLSVFPHQEPRF
                     LIPCVPLLLSCFHLQSSRRQFMLLQGTWVIFNVALGVLMGIYHQGGVIPTQLAIPGII
                     ADHRAGQGDGAATVFWWKTYSPPRWLVGDSLDITTNDLMGIPGGELISHLNHALPTCP
                     VDANNTEKDKGTYVVAPKSATFLDRYIPSPSNEKKAADIELQELWYYENHLNLDDLHF
                     GDDGVIPTLSRVVSRRGLGVWAVKRRCLSEDKGPE"
     gene            <1380899..>1381621
                     /locus_tag="ACHE_20474S"
                     /db_xref="GeneID:66979375"
     mRNA            join(<1380899..1380953,1381019..1381104,1381159..1381326,
                     1381385..1381554,1381615..>1381621)
                     /locus_tag="ACHE_20474S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284781.1"
                     /db_xref="GeneID:66979375"
     CDS             join(1380899..1380953,1381019..1381104,1381159..1381326,
                     1381385..1381554,1381615..1381621)
                     /locus_tag="ACHE_20474S"
                     /note="BUSCO:EOG09264ZWF;
                     COG:O;
                     EggNog:ENOG410PN0Q;
                     InterPro:IPR001232,IPR011333,IPR036296,IPR016072,
                     IPR016073,IPR016897;
                     PFAM:PF03931,PF01466;
                     go_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133538.1"
                     /db_xref="GeneID:66979375"
                     /translation="MATSTITLTSSDGVEINVERDVAERSILIKNMLEDLGESDEAIP
                     IPNVNEAVLRKVIEWCTHHKSDPPSTGDDDDSRRKTTDIDEWDQKFMQVDQEMLFEII
                     LAANYLDIKALLDVGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAED
                     R"
     gene            complement(<1382463..>1382876)
                     /gene="RPL39"
                     /locus_tag="ACHE_20475A"
                     /db_xref="GeneID:66979376"
     mRNA            complement(join(<1382463..1382511,1382662..1382762,
                     1382871..>1382876))
                     /gene="RPL39"
                     /locus_tag="ACHE_20475A"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_043284782.1"
                     /db_xref="GeneID:66979376"
     CDS             complement(join(1382463..1382511,1382662..1382762,
                     1382871..1382876))
                     /gene="RPL39"
                     /locus_tag="ACHE_20475A"
                     /note="COG:J;
                     EggNog:ENOG410PRU9;
                     InterPro:IPR023626,IPR000077;
                     PFAM:PF00832;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_043133539.1"
                     /db_xref="GeneID:66979376"
                     /translation="MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTINYNAKRRHW
                     RKTRLGL"
     gene            <1387910..>1392035
                     /gene="MDR1_2"
                     /locus_tag="ACHE_20476S"
                     /db_xref="GeneID:66979377"
     mRNA            join(<1387910..1388263,1388327..1391622,1391678..>1392035)
                     /gene="MDR1_2"
                     /locus_tag="ACHE_20476S"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_043284783.1"
                     /db_xref="GeneID:66979377"
     CDS             join(1387910..1388263,1388327..1391622,1391678..1392035)
                     /gene="MDR1_2"
                     /locus_tag="ACHE_20476S"
                     /note="COG:Q;
                     EggNog:ENOG410PGKJ;
                     InterPro:IPR017871,IPR027417,IPR003593,IPR011527,
                     IPR003439,IPR036640;
                     PFAM:PF00005,PF00664;
                     TransMembrane:12
                     (i98-131o151-172i224-242o248-271i327-350o362-382i762-
                     787o807-835i886-906o912-933i994-1014o1026-1050i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_function: GO:0042626 - ATPase-coupled transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="GTPase-activating protein"
                     /protein_id="XP_043133540.1"
                     /db_xref="GeneID:66979377"
                     /translation="MAQPGDGSKALEKAVDDGPVVSTQQQTPSRASSTTIGLHAGKEK
                     EAKSTPVANSSDSDALFAHLPEHERRILKDQLDGPEVKASFVTLFRYASKWDILIMIV
                     SAICAIAAGAALPLFTILFGSLATAFQGISLGTMPYDQFYDKLTTNVLYFVYLGIGEF
                     VTVYICTVGFIYTGEHVTQKIREHYLEAILRQNMAYFDCLGAGEVTTRITADTNLVQE
                     GISEKVGLTLTAIATFVTGFIVAYIKGPKLAGICTCTIVAIVLIMGGSSQFIIRFSKQ
                     ALGNYGAGGTVAEEVISSVRNATAFSTQDKLAKQYEAHLAEGEKWGIKVKIIVGIMIG
                     AMFGIMFMNYGLGFWMGSRFLVAQEMNVGQVLTILMAILIGSFSLGNVGPHGQAFTNA
                     LAAAAKIYNTIDRHSPLDPFSDEGKTLEHFEGNIEFQDVKHIYPSRPEVTIMDGVSLS
                     MPAGKTTALVGPSGSGKSTVVGLVERFYLPVGGTVLLDGHDIQTLNLRWLRQQISLVS
                     QEPVLFGTTIYQNIRYGLIGTKFEQESEEKVRERVENAARMANAHDFVTALPEGYETN
                     VGQRGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDRAAEGRT
                     TIVIAHRLSTIKSAHNIVVFVNGQIAEQGTHDMLVDREGPYRSLVEAQRINEEKDADA
                     MEVEEEIDEKQVAAEEVARIKTATSASGSMNEKTDQPLGRTDTKQSISSVVLSQMPPE
                     TQKKYSLWALIKFIAGFNKPELFYMFIGLVFSVLSGGGQPTQAVLYAKAISSLSQPLS
                     MSDKIRHDANFWSLMFFVVGIAQFINFGIQGTAFAICSERLICRARSKAFRAMLRQDI
                     TFFDREENSTGALTSFLSTETNHLSGISGATLGTILMTTTTLGAAIIISLSLGWKLAL
                     VCISVVPVLLSCGFLRFYMLARFQNRSKKAYESSANYACEATSAIRTVASLTRENDVW
                     EQYHGQLEEQGRKSLVSILKSSLLYAASQALVFFCVALGFWYGGTLLGHKEYDIFHFF
                     VCFAEILFGAQSAGTIFSFAPDMGKAKNAAAEFRKLFDRKPAIDTWSEEGEKIESMKG
                     EVEFRDVHFRYPTRGEQPVLRGLNLSVKPGQYIALVGPSGCGKSTTIALLERFYDALA
                     GNVLVDGKDITELNVNSYRSFLSLVSQEPTLYQGTIKENILLGSSKEEVSEEDLVKTC
                     KDANIYDFIMSLPEGFNTVVGNKGGMLSGGQKQRVAIARALLRNPKILLLDEATSALD
                     SESEKVVQAALDAAARGRTTIAVAHRLSTIQKADIIYVFDQGKIVESGSHQELIRLKG
                     RYFELVNMQSLGKAQ"
     gene            complement(<1392354..>1392826)
                     /locus_tag="ACHE_20477A"
                     /db_xref="GeneID:66979378"
     mRNA            complement(join(<1392354..1392513,1392565..1392650,
                     1392707..>1392826))
                     /locus_tag="ACHE_20477A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284784.1"
                     /db_xref="GeneID:66979378"
     CDS             complement(join(1392354..1392513,1392565..1392650,
                     1392707..1392826))
                     /locus_tag="ACHE_20477A"
                     /note="COG:L;
                     EggNog:ENOG410PTNP;
                     InterPro:IPR010760;
                     PFAM:PF07061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133541.1"
                     /db_xref="GeneID:66979378"
                     /translation="MPSSPDPSQSQPSQHDSPHLTSSENGQNLCPEQLQREKKVKTLQ
                     ASINDLQSQTQQLEGEIAEVKAKLKNDPSITVKRHIRLLHDYNEIKDVGQGLMGLIAE
                     ARGMRQIEVQREFGIGEKD"
     gene            <1393425..>1395096
                     /locus_tag="ACHE_20478S"
                     /db_xref="GeneID:66979379"
     mRNA            join(<1393425..1393559,1393619..1393696,1393752..1394594,
                     1394648..1394777,1394834..>1395096)
                     /locus_tag="ACHE_20478S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284785.1"
                     /db_xref="GeneID:66979379"
     CDS             join(1393425..1393559,1393619..1393696,1393752..1394594,
                     1394648..1394777,1394834..1395096)
                     /locus_tag="ACHE_20478S"
                     /note="COG:S;
                     EggNog:ENOG410PJ4V;
                     InterPro:IPR018827,IPR018825;
                     PFAM:PF10355,PF10348;
                     SECRETED:SignalP(1-27);
                     TransMembrane:11
                     (n11-22c27/28o51-72i79-96o108-130i142-165o185-208i220-
                     237o249-269i281-298o310-330i346-364o384-406i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133542.1"
                     /db_xref="GeneID:66979379"
                     /translation="MTIPNPLHLRCGGVLAALFFLAPSVLAHGGHEQVPEGSAVSEDP
                     IDSTLWIHMILMGLAFGIIFPLGMVLGITRSRWHVPLQVVGTTIAVLAYFLGHAHKGR
                     QFAKNVHAPFANILMLQLIAQVVLGVYLKLHLSKGIHGRIRRFIVILHGILGKAMPVV
                     SWAQMLFGGITAMGFCRDDHMGQCLAHFIMGSAFIAYGILLTLLLLVGQYWLRRTGRS
                     QEFFDSLVIAAWGCVNTFTEHRWGGPWVHNDLQHTTMGIVWWCAGLLGVWLSRKRNGG
                     PKRNIIPGIVIMLTGYAMSGHPQHSMISTMIHSFFGYTLMAAGATRIIEIAFVLRDRS
                     TLSVDGTNPNSFQYLPPFLLYASGFLFMGATEEQMQLLEDAGITHVSYILILFSIAFI
                     LFLFVNILLHIYAVHAWPESTKAQPNDDDIDAEDGARPKPSRANGHARSPSEAQHIHD
                     AEAFELQGLISDEEEEARAGRHQKNEDEEPQT"
     gene            complement(<1395450..>1396820)
                     /locus_tag="ACHE_20479A"
                     /db_xref="GeneID:66979380"
     mRNA            complement(join(<1395450..1396373,1396431..1396602,
                     1396655..1396712,1396781..>1396820))
                     /locus_tag="ACHE_20479A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284787.1"
                     /db_xref="GeneID:66979380"
     CDS             complement(join(1395450..1396373,1396431..1396602,
                     1396655..1396712,1396781..1396820))
                     /locus_tag="ACHE_20479A"
                     /note="COG:O;
                     EggNog:ENOG410PGH4;
                     InterPro:IPR000594,IPR035985,IPR000011;
                     PFAM:PF00899;
                     go_function: GO:0008641 - ubiquitin-like modifier
                     activating enzyme activity [Evidence IEA];
                     go_process: GO:0006464 - cellular protein modification
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133543.1"
                     /db_xref="GeneID:66979380"
                     /translation="MASQENTTQSISADEIALYDRQIRLWGVKAQEKLRSANILLITI
                     KALANEIAKNLVLAGIGGLTILDHEAVTEEDLGAQFFVREEHVGQNRAQAASAEIRVM
                     NPRVQLRVDTENVRIKQPDYFGQFDIIIATELDFSTYTTINASCRLANRPFYAAGLHG
                     FYGYVFSDLISHDFVIERSKSNVPSQSQETPTRSVLNINTKVESDKVIEMVTKREVYS
                     PLILANTSPLPENFTRLPRRRRQVTPLLTCLRALWEFQKLPGNHTPLPTLSSRQDLET
                     FTKLARDRHHELKLDISTLDSTFLRTFLENLGSELSPVAAFVGGSLAQDVINVLSARE
                     QPLQNLLLFDGDKSVAPVYPLHPFFPPEVENALPAVTPAAVNAIPVHSGPAAANNNAV
                     TDLTQ"
     gene            complement(<1400131..>1403018)
                     /locus_tag="ACHE_20480A"
                     /db_xref="GeneID:66979381"
     mRNA            complement(join(<1400131..1402114,1402172..1402892,
                     1403000..>1403018))
                     /locus_tag="ACHE_20480A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284788.1"
                     /db_xref="GeneID:66979381"
     CDS             complement(join(1400131..1402114,1402172..1402892,
                     1403000..1403018))
                     /locus_tag="ACHE_20480A"
                     /note="COG:K;
                     EggNog:ENOG410PGE4;
                     InterPro:IPR039779,IPR036390,IPR036388,IPR003150;
                     PFAM:PF02257;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133544.1"
                     /db_xref="GeneID:66979381"
                     /translation="MLPPEMGRAASQSSSAASQSTQIVPPHSRPGTADPMRARSEHVI
                     SRNSRRPRSRGSTASIHSQQTQDQNVTDGFAQFLPTQQATGHNVFGNNPEDIIMRFGP
                     NLSHPVHGTSLDPTLPDAHHPVMPRAEDFSHHALQTHAISQQAMPPELAGHGLSGVSM
                     SQYQSLYDNGIENHVPEHMLEDNDNSEAGGGKKKKGSSSSLANDNELRKLLRQYEGYS
                     LKQMAAEVLKHEGAGGKAEKVKQVFAMIWLRENCRKSSGSVRRDRVYCCYAEKCGTER
                     VSVLNPASFGKLVRIIFPNVQTRRLGVRGESKYHYVDLTVIEEKQQKPQSLGSQLSSN
                     ASVPPENRAEDALSKGYVGKHDKHNDHYRRSDKGNSAGAVPPPPADTAVFPSPTASFA
                     PRMSASLPTVGCDCHSASRGDLEPPMTLENVGSHAGKMIHHMLRFPSADTYCVDNDSL
                     QLPDIHPYLPPNADLKVAAALAALYRSHCISVIDSFRYCKERNLLRYFSAFHGTLTVP
                     VQKLLTHLDIAPWIKECDWLMYQKMIAFVAPLTTQVVPKLVLDAFSSISQRLTAHITE
                     TFKSQPAHVSLARLIPANIFCSLLRHMLDVNQSANAAAAWLCHPDNRNQMWFDFKTLI
                     DPKEMISKANIPRCAERVTEQILKHDIRALLTPVSDPSVAPCQPFFGTPDTEDDIQAH
                     KYPVQSSTGDDYNFPDKWVSFILNLALMFPNHRTQCVIEKADALWDCVLRRLTLGGAQ
                     SFSAWWMTKVFFHEMMVWQTEQGGFMRSSPSTLQNATLRTESSEMNNFAMRQPSFAIS
                     DKNDTVMATESQQDRQSVSRAPSTAATSEAPQNQEQCLNGRRMETESNQSNLDNPKPT
                     TVAENIANFHAGNNDDSAIDLDDDSMLMSVGKYGDMMASDPADAEGDVVVI"
     gene            <1403788..>1404708
                     /locus_tag="ACHE_20481S"
                     /db_xref="GeneID:66979382"
     mRNA            <1403788..>1404708
                     /locus_tag="ACHE_20481S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284789.1"
                     /db_xref="GeneID:66979382"
     CDS             1403788..1404708
                     /locus_tag="ACHE_20481S"
                     /note="COG:S;
                     EggNog:ENOG410PTJJ;
                     InterPro:IPR032567,IPR005162,IPR036875;
                     PFAM:PF03732;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133545.1"
                     /db_xref="GeneID:66979382"
                     /translation="MDPFQELRNEFSSTIRALQNEIESVKNEPKPLQRPKPCLPDPEK
                     FNGQSLKFDTWLASMKAKLRIDAPAIGDAVAQFYYVYLNLESKVQALVLPQLSYAEDT
                     NTWDYNTILDQLSLVYDNPNKVQEAEDYLLVLKQDSGESVAAYIAKFERILYEAKGKD
                     WPDVTKISAFRKGLNPTLRGRLNQQLNLPKSYTDFLRVVQQLGSHSFSSNSTNVSHSQ
                     SHQSGSHTKSDPMDLSVININSLSAASTSLDERNRRRQQGSCVRCGSSDHWVKDCSMK
                     AHKESNKIWNQQMIARLEANRLDDLNDLDD"
     gene            complement(1405312..1405446)
                     /locus_tag="ACHE_t20009A"
                     /db_xref="GeneID:66987343"
     tRNA            complement(1405312..1405446)
                     /locus_tag="ACHE_t20009A"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:66987343"
     gene            complement(1405859..1405972)
                     /locus_tag="ACHE_t20010A"
                     /db_xref="GeneID:66987344"
     tRNA            complement(1405859..1405972)
                     /locus_tag="ACHE_t20010A"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:66987344"
     gene            complement(<1406897..>1408323)
                     /gene="TCA8"
                     /locus_tag="ACHE_20482A"
                     /db_xref="GeneID:66979383"
     mRNA            complement(join(<1406897..1407397,1407463..1407545,
                     1407600..1407625,1407688..1407750,1407813..1407939,
                     1408021..1408049,1408157..>1408323))
                     /gene="TCA8"
                     /locus_tag="ACHE_20482A"
                     /product="succinate--CoA ligase [ADP-forming] subunit
                     alpha, mitochondrial"
                     /transcript_id="XM_043284790.1"
                     /db_xref="GeneID:66979383"
     CDS             complement(join(1406897..1407397,1407463..1407545,
                     1407600..1407625,1407688..1407750,1407813..1407939,
                     1408021..1408049,1408157..1408323))
                     /gene="TCA8"
                     /locus_tag="ACHE_20482A"
                     /note="BUSCO:EOG092638CT;
                     COG:C;
                     EggNog:ENOG410PFCD;
                     InterPro:IPR017440,IPR016102,IPR005810,IPR005811,
                     IPR036291,IPR033847,IPR003781;
                     PFAM:PF02629,PF13607,PF00549;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="succinate--CoA ligase [ADP-forming] subunit
                     alpha, mitochondrial"
                     /protein_id="XP_043133546.1"
                     /db_xref="GeneID:66979383"
                     /translation="MQAFRRGTLSALQNVAAVQRRGYASASAIYSETVPNLRINGDTK
                     VIFQGFTGKQGTFHAEQAIAYGTKVVGGTNPKKAGSTHLDRPVFANVSDAVKETGATA
                     SAIFVPPPLAAKGIEEAIEAEVPLAVCITEGIPQHDMVRITDILKTQNKTRLVGPNCP
                     GIIAPGQCKIGIMPGFIHKRGRVGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPF
                     SGTNFIDCLRIFLEDPETEGIIMIGEIGGSAEEDAAEFFKANNKYNKPAVSFIAGISA
                     PPGRRMGHAGAIVSGGKGGADSKISALQDAGVVVERSPAALGKTLLAEFVKRDLV"
     gene            <1408692..>1410468
                     /gene="ELP3"
                     /locus_tag="ACHE_20483S"
                     /db_xref="GeneID:66979384"
     mRNA            join(<1408692..1408995,1409045..>1410468)
                     /gene="ELP3"
                     /locus_tag="ACHE_20483S"
                     /product="elongator subunit"
                     /transcript_id="XM_043284791.1"
                     /db_xref="GeneID:66979384"
     CDS             join(1408692..1408995,1409045..1410468)
                     /gene="ELP3"
                     /locus_tag="ACHE_20483S"
                     /note="BUSCO:EOG09261VI3;
                     COG:B,K;
                     EggNog:ENOG410PG0I;
                     InterPro:IPR006638,IPR023404,IPR016181,IPR007197,
                     IPR039661,IPR032432,IPR000182,IPR034687;
                     PFAM:PF04055,PF16199,PF00583;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0008080 - N-acetyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0051536 - iron-sulfur cluster binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="elongator subunit"
                     /protein_id="XP_043133547.1"
                     /db_xref="GeneID:66979384"
                     /translation="MATMTMTVPPPSNKPKKTAKLPPENERYMRACSDIANVLIQDYE
                     SQIDPIKPKKDINLNKLRGQISRKHCLSSQPPLTAIIAAVPEHYKKYILPKLIAKPIR
                     TSSGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRA
                     RYDPFEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLPEDYRESFISQLHNALSGYQT
                     DNVDEAVQAAEMSNVKCVGITIETRPDYCLDTHLSSMLRYGCTRLEVGVQSLYEDVAR
                     DTNRGHTVAAVAETFKLSKDAGFKVVSHMMPDLPNVGMERDLYQFHEYFENPAFRTDG
                     LKIYPTLVIRGTGLYELWRTGRYKNYTPNALVDLVARILALVPPWTRIYRVQRDIPMP
                     LVTSGVENGNLRELALARMKDFGTSCRDVRTREVGINEVKNKIRPSQVELVRRDYTAN
                     GGWETFLAYEDPKQDILIGLLRLRKCSATHTFRPEFTGQQTSIVRELHVYGTAVPVHG
                     RDSRKFQHRGFGTLLMEEAERIAREEHGSRKISVISGVGVRSYYGRLGYMLDGPYMSK
                     MLDPIEDEE"
     gene            complement(<1411063..>1411572)
                     /locus_tag="ACHE_20484A"
                     /db_xref="GeneID:66979385"
     mRNA            complement(join(<1411063..1411140,1411215..1411307,
                     1411408..1411465,1411535..>1411572))
                     /locus_tag="ACHE_20484A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284792.1"
                     /db_xref="GeneID:66979385"
     CDS             complement(join(1411063..1411140,1411215..1411307,
                     1411408..1411465,1411535..1411572))
                     /locus_tag="ACHE_20484A"
                     /note="COG:S;
                     EggNog:ENOG410PSDZ;
                     InterPro:IPR026770;
                     TransMembrane:2 (i7-31o51-71i);
                     go_function: GO:0004521 - endoribonuclease activity
                     [Evidence IEA];
                     go_process: GO:0090305 - nucleic acid phosphodiester bond
                     hydrolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133548.1"
                     /db_xref="GeneID:66979385"
                     /translation="MKPIVSALNAWSCVVISFFAVIILSVLGTLYQHDHPGYTGSEGD
                     PENGPAVAASIFTAVIVYAAFFVFCAFQAYLHIRASRGGAISLS"
     gene            complement(<1411986..>1412877)
                     /gene="HIS6"
                     /locus_tag="ACHE_20485A"
                     /db_xref="GeneID:66979386"
     mRNA            complement(join(<1411986..1412269,1412336..1412522,
                     1412578..>1412877))
                     /gene="HIS6"
                     /locus_tag="ACHE_20485A"
                     /product="enzyme that catalyzes the fourth step in the
                     histidine pathway"
                     /transcript_id="XM_043284793.1"
                     /db_xref="GeneID:66979386"
     CDS             complement(join(1411986..1412269,1412336..1412522,
                     1412578..1412877))
                     /gene="HIS6"
                     /locus_tag="ACHE_20485A"
                     /note="BUSCO:EOG092640IZ;
                     COG:E;
                     EggNog:ENOG410PGN7;
                     InterPro:IPR011060,IPR006062,IPR011858,IPR013785;
                     PFAM:PF00977;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003949 -
                     1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino]imidazole-4-carboxamide isomerase
                     activity [Evidence IEA];
                     go_process: GO:0000105 - histidine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="enzyme that catalyzes the fourth step in the
                     histidine pathway"
                     /protein_id="XP_043133549.1"
                     /db_xref="GeneID:66979386"
                     /translation="MTKFRPCIDLHSGQVKQIVGGTLSDVSSDLRTNYVSKLPADHYA
                     GLYQKHDLRGGHVVKLGPGNDDAAKEALSTWPGGLQVAGGITDQNAQYWIDQGAEKVI
                     ITSFLFSEGKFSQERLERVLAALGGDRSKLVLDLSCRRKDDTWFVAMNRWQTITEMEI
                     NQESISFLEPFCSEFLIHAADVEGLQQGVDEDLVAKLAKWCTIPVTYAGGARHLQDLE
                     KVHVSSQGKVDLTIGSALDIFGGSGVTFDECIEWNKAH"
     gene            <1413048..>1413964
                     /locus_tag="ACHE_20486S"
                     /db_xref="GeneID:66979387"
     mRNA            join(<1413048..1413401,1413455..>1413964)
                     /locus_tag="ACHE_20486S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284794.1"
                     /db_xref="GeneID:66979387"
     CDS             join(1413048..1413401,1413455..1413964)
                     /locus_tag="ACHE_20486S"
                     /note="COG:S;
                     EggNog:ENOG410PSA1;
                     InterPro:IPR027973;
                     PFAM:PF15375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133550.1"
                     /db_xref="GeneID:66979387"
                     /translation="MIGKRKRDTSVVSRFTTKKEQEQDTSVPTTPTEVSHDLFRKFFE
                     SQFEPLDIGPRVSRKEETKVEEGDDDDEEGSEAGSDWDGLSGDDYGDKVEVIEHQDSS
                     VKTSGLLDKKARKAFMNAKPPSFDVDTSKSETKPTKDSGEDEEDKVTDATNLKNDLAL
                     QRLLKESHLLDSATDLVPTGKNRHKALDMRMQSLGAKASLYDQKMPSAHRRGIKTKVA
                     TKEDKRRREAKENGIILEKPAPKKQTSNKRRERGVGGPSVGKLSGGTLNLSQRDINSI
                     TRRSKGSKGRR"
     gene            <1419788..>1422196
                     /gene="STE12"
                     /locus_tag="ACHE_20487S"
                     /db_xref="GeneID:66979388"
     mRNA            join(<1419788..1419911,1419968..1420067,1420147..1421670,
                     1421792..1421875,1421932..>1422196)
                     /gene="STE12"
                     /locus_tag="ACHE_20487S"
                     /product="homeodomain transcription factor ste12"
                     /transcript_id="XM_043284795.1"
                     /db_xref="GeneID:66979388"
     CDS             join(1419788..1419911,1419968..1420067,1420147..1421670,
                     1421792..1421875,1421932..1422196)
                     /gene="STE12"
                     /locus_tag="ACHE_20487S"
                     /note="COG:K;
                     EggNog:ENOG410PFQA;
                     InterPro:IPR036236,IPR003120,IPR013087;
                     PFAM:PF00096,PF13894;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="homeodomain transcription factor ste12"
                     /protein_id="XP_043133551.1"
                     /db_xref="GeneID:66979388"
                     /translation="MYPHHGPPMPPPQKPETFMLSSEAQQSLPHDAQVALQQVDNLKY
                     FLLSAPVDWQPDQFVRRFLLPTGEHISCVLWSNLFHISGTDIVRCLAFRFTAFGRPVK
                     NSKKFEEGIFSDLRNLKAGTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHD
                     RLFLDALERDLKREKMGQEATTVAVSEPALSFEFDSSQSLYEQLTKAQQANTSSFAAH
                     ASTTFGQPTSPIVRSVDAMPPPQMAPQMAPPALPFLPDDSANTAIYNAIPLPPTLAQN
                     FIKREQDFAPIQYDRNGMPIARMHQRHASMPTFVEYSPAPSFVSSHFEDYSNRGLSFE
                     PVTPPQHHVPLGPEPAYIANEDTGLYTAIPDISSAPSFNPLMQLPPSNLASAHFPAPT
                     RTFPYSVIEGSPTYKQRRRRSSVTPGAANAAMTTPQTTAAPAQTMAYAAHKPSDLRRS
                     MSSSVAPAVTEGGNESQTQRATASYPAVLPQKDLLQEISRHGTPLSNLEETTSQNALS
                     LNNVQDDLAAFPTDETVDAAVQNSATNKAERYVPGPVRRARSATMMELGPYPQKSHSC
                     PIPSCGRLFKRLEHLKRHVRTHTQERPYPCPYCNKAFSRSDNLAQHRRIHEAQQDGQP
                     PLSTHEEELENEENEFGSPDEDLSPQDTSIPTSMMNMTTMTSMPTTMATTMSMSPMHT
                     MVAPNMIAPQLLQQQI"
     gene            <1423395..>1425458
                     /locus_tag="ACHE_20488S"
                     /db_xref="GeneID:66979389"
     mRNA            join(<1423395..1423588,1423643..1423682,1423739..1424060,
                     1424119..>1425458)
                     /locus_tag="ACHE_20488S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284796.1"
                     /db_xref="GeneID:66979389"
     CDS             join(1423395..1423588,1423643..1423682,1423739..1424060,
                     1424119..1425458)
                     /locus_tag="ACHE_20488S"
                     /note="COG:G;
                     EggNog:ENOG410PHUS;
                     InterPro:IPR036259;
                     PFAM:PF13347;
                     TransMembrane:10
                     (i54-72o84-105i126-144o164-183i209-229o241-263i307-
                     329o359-381i450-470o476-498i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133552.1"
                     /db_xref="GeneID:66979389"
                     /translation="MTCSEPDHTNMTEAANESSPLVGPDREDDADIRYEPNDNPVLHR
                     EDTSETKSSLYLFLLTLSIGGLQVVWSVELSSGTPYLQSLGMSKALLAFVWIASPLAG
                     TLVQPYIGIRSDNCRISWGKRKPFMFAGAAGTIIALLALAWVQEIMGGLLGLFGADPN
                     SGGVRTTIIIVATALMCCLDFAINTVQAGIRCFIVDNAPTHQQESANAWASRMTGVGN
                     ICGFIFGYIDLPNILPFLGKTRFQILCAIASLLLGITLLISCSYIKERDPRLDSPPAS
                     SSLGLVSFFEQVFKAIRHLPPQIAKVCEVQLAAWIGWFPFLYYATTYIGQLYVNPIFE
                     DHPNPSDKDIDQAWEDATRIGSLALLIYAIVSFVANITLPVLVVPSYKPIVASDRQHG
                     EGLLEGEEESDTGARRMSASSIPYGAPLEQQPQGSKANKDGPAWLAYLQIPGFTLRRA
                     WLISHVLFAACMFSTFFVYTHQAGSAVIGLLGISWAMTLWAPFALISAEVSRIDTAYR
                     IRRVRAARTVAEGSRDAATTAADRHRYSHHDEDLENGHEVPPMKAPGKEDENPAQAGI
                     VLGLHNVAVSAPQIISSLVCSAIFKTFQKPRGEPWDDSVGWVLRFGGVAALGAAYLTS
                     RLTEGGR"
     gene            <1425838..>1428274
                     /gene="NHX1"
                     /locus_tag="ACHE_20489S"
                     /db_xref="GeneID:66979390"
     mRNA            join(<1425838..1425880,1425988..1426020,1426134..1426283,
                     1426347..1427006,1427055..>1428274)
                     /gene="NHX1"
                     /locus_tag="ACHE_20489S"
                     /product="monovalent cation:H+ antiporter, CPA1 (nhx1)"
                     /transcript_id="XM_043284798.1"
                     /db_xref="GeneID:66979390"
     CDS             join(1425838..1425880,1425988..1426020,1426134..1426283,
                     1426347..1427006,1427055..1428274)
                     /gene="NHX1"
                     /locus_tag="ACHE_20489S"
                     /note="COG:P;
                     EggNog:ENOG410PHYC;
                     InterPro:IPR004709,IPR006153,IPR018422;
                     PFAM:PF00999;
                     TransMembrane:13
                     (o36-58i70-87o99-118i130-152o164-188i195-214o234-260i272-
                     288o294-313i325-344o356-381i402-425o431-453i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0015299 - solute:proton antiporter
                     activity [Evidence IEA];
                     go_function: GO:0015385 - sodium:proton antiporter
                     activity [Evidence IEA];
                     go_process: GO:0006812 - cation transport [Evidence IEA];
                     go_process: GO:0006814 - sodium ion transport [Evidence
                     IEA];
                     go_process: GO:0006885 - regulation of pH [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="monovalent cation:H+ antiporter, CPA1 (nhx1)"
                     /protein_id="XP_043133553.1"
                     /db_xref="GeneID:66979390"
                     /translation="MAGQIVGDALHQVLRRAADSDTDPDDVPEAGTKEFFSSWALFIM
                     IMLLMCALFTSYILQQKKIQAVHETVLSIFGGMFVGLIIRLSPESPIQDSVTFDYQFF
                     FNLLLPPIILASGYELHQANFFRNIGTILTFAFVGTFISAIVLGLVLYVWTRIPLDGL
                     NISFVEAISVGATLSATDPVTILAIFNLYKVEPKLYTVIFGESILNDAIAIVLFETAQ
                     KYAESEAGSLTFLNLFEAIGLFLLVFFGSMIVGIIVGIMTALGLKYTHVRRMPKIESC
                     LIVLIAYASYFFSNGVYLSGIVSLLFCGITMKHYAYYNMSRRTQLTTKYLFQVMAQLS
                     ENFIFIYLGLDLFVESNLQFKPLFILVAVLGICLARYLAVFPLSKAINWFIRYRARRR
                     GVEVADELPFAYQAMLFWAGLRGAVGVALAAGLKGVNAPALRATVLVVVVLTVIIFGG
                     TTARMLEILGIRTGVVEELDSDDEFDIEVTHGGTYYKRDTALGYTPRRMDSTIPLDGM
                     QREGLDRTHSYSTGNSRRPSPPPNRSSSRGHARMYSNAYGPKDTQTRRDRSSTATLLN
                     SGTGGLSDDSAGSEDEFGLKTTKNTGKSRATAEPDPDEFEIDVEESEDDHGLPPSATP
                     ASRLRRSHSQPQQESTSSRVSPSPSRHEAISAREALRDLFSGGPTGDHAAWFRQLDEG
                     YIKPRLLLDQSNHKGPGAV"
     gene            <1429521..>1434744
                     /gene="INO80"
                     /locus_tag="ACHE_20490S"
                     /db_xref="GeneID:66979391"
     mRNA            join(<1429521..1430027,1430100..1430618,1430673..1434495,
                     1434551..>1434744)
                     /gene="INO80"
                     /locus_tag="ACHE_20490S"
                     /product="putative DNA helicase Ino80"
                     /transcript_id="XM_043284799.1"
                     /db_xref="GeneID:66979391"
     CDS             join(1429521..1430027,1430100..1430618,1430673..1434495,
                     1434551..1434744)
                     /gene="INO80"
                     /locus_tag="ACHE_20490S"
                     /note="COG:L;
                     EggNog:ENOG410PFTZ;
                     InterPro:IPR027417,IPR000330,IPR038718,IPR001650,
                     IPR020838,IPR014001,IPR031047;
                     PFAM:PF00176,PF00271,PF04851,PF13892;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0031011 - Ino80 complex [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA];
                     go_process: GO:0006338 - chromatin remodeling [Evidence
                     IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative DNA helicase Ino80"
                     /protein_id="XP_043133554.1"
                     /db_xref="GeneID:66979391"
                     /translation="MTGAPPYNPHSPTQQSRYPAYSPPNKTPHPFLPGNDQYQQHPPQ
                     TPPAYPPHSALARSPHYAHATPSLPATLPPLSSDPSAQYQMHSAAPTPQFSLPRPYSG
                     SMLPGSGASPYAQSTPSHAPPPPRLESHSQSPTKRETDSSYSMVGNNAPGYSMMREPP
                     RPASPTQEAKPARAADPMSFASILSGPTEEERLPPKRPSPPPAQMAPVAPPPPPLYIA
                     GQTPKESEQVPVYPMPRFEEKQPIRERRRNVEQEEHLVGSLPVASSANGDVPDIKKTS
                     APIRVPAPRKLTERDMEIINKITADIDNGEKSDVEAPGFEAEYERYISKGKKRALSTE
                     KAESMKRKRRRQDFLIRLGKTFEKQSTTGMDRFRYDHEEKVIFEVQDKEIQDEKERKK
                     DMQRKRRRENTVRLEMQRKLEAERKANETDDAATKAKLMREVERAQKKIKSTKRALEG
                     VTSPEEIGEVTPLAPNLEGGTTSSFHIGRSSPSRRKSNRGGTTARPKKSKEQKQAEKD
                     AAEAAYAAMASDEPTSLAPMEDPRMESLKKETKGGRSKESTPIPMASYDSKGYNQIYE
                     QIWRDIARKDIPKVYRIKATSLGTRQENLRKTAQLASKQSRKWQERTNKSMKDTQARA
                     KRTMREMTTFWKRNEREERDLRRLAEKQEIESAKKAEAEREANRQRRKLNFLISQTEL
                     YSHFIGRKIKGTEADASGDTAVDGSNEIVQSGKGQEHTVDMPPSVADPNTKVTTSFDE
                     LDFDAEDETALRQAAMANAQNAVQQAQDRARAFNAEQDQMAAFDEGELNFQNPTSLGD
                     IEISQPTMLTTKLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTIQSISVMAYLAEY
                     HNIWGPFLVIAPASTLHNWQQEITKFVPNIKVLPYWGSSKDRKILRKFWDRKHITYTK
                     DSEFHVLVTSYQLVVIDAQYFQKIKWQYMILDEAQAIKSSQSSRWKNLLGFSCRNRLL
                     LTGTPIQNNMQELWALLHFIMPTLFDSHDEFSEWFSKDIESHAQSNTKLNEDQLRRLH
                     MILKPFMLRRVKKHVQQELGDKVEKDIFCDLTYRQRAYYANLRNRVSIMDLIERAAVG
                     DEADSTTLMNLVMQFRKVCNHPDLFERAETKSPFSQAHFAETASFVREGHFVDFAYST
                     RNIIEYDLPRLLCDSAGRIDMAGPDNKQAGFRNKYLAHMLNIWTPENIKKSAEEDSAF
                     SFLRFVDTSAEEAYKTSHLGVFERAYRRRGKTNRLSRLNVVYDGDEDDGNSVLSHSML
                     NIVDRNDRHALDEVATEGYMRDLMTVSSSTFERKGLSIIEPSASPAASAPPIQVSCSN
                     QGAYKEIRDSFFNIPVRHALYGIPSRSIDEQILEHKADPRLFTAAPILPKPISDKGRY
                     THIEVPSMHRFVTDSGKLAKLDELLRELKAGGHRVLLYFQMTRMIDLMEEYLTYRNYK
                     YCRLDGSTKLEDRRDTVADFQQRPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPT
                     IDSQAMDRAHRLGQTRQVTVYRLITRNTIEERIRKRALQKEEVQRVVITGGAAGGVDF
                     NTRNRESRTKDIAMWLADDEQAELIEQKEKEAAERGEVLGAAKASKKATQKKKKELSL
                     DDMYHEGEGNFDDANKQQSGAATPDIGTPTSTPAPKRGRGRGGGSAKGTSKRAKTTNE
                     RLRLIDGDGGLS"
     gene            <1435479..>1437487
                     /gene="HEM1"
                     /locus_tag="ACHE_20491S"
                     /db_xref="GeneID:66979392"
     mRNA            join(<1435479..1435842,1435893..>1437487)
                     /gene="HEM1"
                     /locus_tag="ACHE_20491S"
                     /product="mitochondrial 5-aminolevulinate synthase"
                     /transcript_id="XM_043284800.1"
                     /db_xref="GeneID:66979392"
     CDS             join(1435479..1435842,1435893..1437487)
                     /gene="HEM1"
                     /locus_tag="ACHE_20491S"
                     /note="BUSCO:EOG09261NLR;
                     COG:H;
                     EggNog:ENOG410PHKA;
                     InterPro:IPR001917,IPR004839,IPR015424,IPR010961,
                     IPR015421,IPR015422;
                     PFAM:PF00155;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003870 - 5-aminolevulinate synthase
                     activity [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA];
                     go_process: GO:0033014 - tetrapyrrole biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 5-aminolevulinate synthase"
                     /protein_id="XP_043133555.1"
                     /db_xref="GeneID:66979392"
                     /translation="MESLLQQSRAMCPFLKRTAPSALRSLATATRPSTSPGGGTMSNL
                     QILARRCPVMSKALAVQSARMSGTKRFTSCAAGVAGLGSAGHGNGIHEKKHLRGRQAL
                     HTTAGNGASIQSETYKKEHAPNLSQIEKTPIEVASAMAGSCPQAPENKRFDYNSFYNG
                     ELEKKHKDKSYRYFNNINRLAHEFPRAHTASAEERVTVWCSNDYLGMGRNPEVLATMH
                     ETLDTYGAGAGGTRNISGHNQHAVALENTLAKLHGKEAALVFSSCFVANDATLATLGS
                     KMPDCVILSDSLNHASMIQGIRHSGAKKMVFKHNDLVDLETKLASLPLNIPKIIAFES
                     VYSMCGSIAPIEKIQDLADKYGAITFLDEVHAVGMYGPHGAGVAEHLDYDIYASQDTP
                     NPYSTKGTIMDRVDIITGTLGKAYGCVGGYIAGSAALVDTIRSLAPGFIFTTSLPPAT
                     MAGANTAIQYQGRHNRDRVLQQLHTRAVKETLKELDIPVIPNPSHIIPLLVGDAEVAK
                     QASDKLLEEHGIYVQAINYPTVPRGEERLRITPTPGHVKEHRDHLVAAIQSVWNDLGI
                     KRTSDWKATGGFVGVGVEAAEAENTPMWSDAQLGLQPSENQDLEAAVEREFAAAAASV
                     LRMQTPTPASARVQPAAAMGASPIGVAA"
     gene            complement(<1437876..>1439485)
                     /gene="RPA49"
                     /locus_tag="ACHE_20492A"
                     /db_xref="GeneID:66979393"
     mRNA            complement(join(<1437876..1439281,1439338..>1439485))
                     /gene="RPA49"
                     /locus_tag="ACHE_20492A"
                     /product="DNA-directed RNA polymerase I subunit rpa49"
                     /transcript_id="XM_043284801.1"
                     /db_xref="GeneID:66979393"
     CDS             complement(join(1437876..1439281,1439338..1439485))
                     /gene="RPA49"
                     /locus_tag="ACHE_20492A"
                     /note="BUSCO:EOG09262BVA;
                     COG:K;
                     EggNog:ENOG410PITZ;
                     InterPro:IPR009668;
                     PFAM:PF06870;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit rpa49"
                     /protein_id="XP_043133556.1"
                     /db_xref="GeneID:66979393"
                     /translation="MPSDKIDKKRKRHSDRHERPSKKPALELQNLPPLSASLIEDNSE
                     LAPVIVTTPGVNQPRSINLQPYLKPRANTSSTSFSTRNKGIVSSEILLQSSEHPKLDF
                     VGREANDDADSQLKHYIAVIDPEKKTWQFVEARKVTLRGAVRKMKPLEDEESSEDEEM
                     VTSLPTLSLEMQMLIVQQTMRAQKTALTHAFGTKQSKKVVQSMAENAQLSNAPAGAAN
                     AAESALLSSMPADSATDMASKTAAVQAQVQAAKPLPQANLAATHPADVYPVDVLVPNG
                     SSTLRQLPGVKEWTETVGSGLAVTTTSRYVSRRVEAVVKSGNTTQIQILRFILLLLEF
                     ARSLRPGGRDAGPGSKRLPPRDDLRRVLSSSSGSISAKNTLASAPTSTENTLPDPVID
                     AIRRRFAPQGSHLSKNDITLLHTTICALSLHIPPQPAKDGGSSTQGGNSANELATDPS
                     DLRDDLRLDNTVVTQYFRELGCRVDKPRETEFAKWGIKGGKAEAAARRVARLKVPVEF
                     PKVSRGGRK"
     gene            complement(<1440091..>1440462)
                     /locus_tag="ACHE_20493A"
                     /db_xref="GeneID:66979394"
     mRNA            complement(join(<1440091..1440174,1440234..1440315,
                     1440386..>1440462))
                     /locus_tag="ACHE_20493A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284802.1"
                     /db_xref="GeneID:66979394"
     CDS             complement(join(1440091..1440174,1440234..1440315,
                     1440386..1440462))
                     /locus_tag="ACHE_20493A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133557.1"
                     /db_xref="GeneID:66979394"
                     /translation="MAHTKSSAAAFPGSFLQPSSFILAEVFYEDESQVEKEARSSFKE
                     KAKKDESEIEVNDSPLSTSVSCDRSTLNAEHDNFDA"
     gene            complement(<1441008..>1443004)
                     /locus_tag="ACHE_20494A"
                     /db_xref="GeneID:66979395"
     mRNA            complement(join(<1441008..1441252,1441302..1441619,
                     1441669..1441716,1441769..1441822,1441875..1442231,
                     1442286..1442315,1442379..1442471,1442525..1442685,
                     1442739..>1443004))
                     /locus_tag="ACHE_20494A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284803.1"
                     /db_xref="GeneID:66979395"
     CDS             complement(join(1441008..1441252,1441302..1441619,
                     1441669..1441716,1441769..1441822,1441875..1442231,
                     1442286..1442315,1442379..1442471,1442525..1442685,
                     1442739..1443004))
                     /locus_tag="ACHE_20494A"
                     /note="COG:G;
                     EggNog:ENOG410PFT2;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i72-92o112-134i141-160o172-189i201-222o234-256i305-
                     325o345-362i369-387o399-422i434-453o465-487i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133558.1"
                     /db_xref="GeneID:66979395"
                     /translation="MGATGSCSSATIFPFPLVPILPMPRMFSLTCGRRVSIIDPEDKG
                     ESQIQMSSSDLPPLTTTTERKLMAKVDWHVIPCLCVMYLLAFLDRVNISNAAVLGLKE
                     DLGILHGTKYNTALTIFFVPYIIFEIPSNLLLKKLKPHVWLSLCMFGFGIVMLCQGFV
                     KNWGGLMATRWFLGMFETGLFPGCFYLMGMWYKRSEAQKRFSFFFSSTTLAGAFGGVL
                     AAGIGEMDGIRGIAGWRWVFIIEGILTAVVGLICFFVVPGFPEEVKWLNEEEREFLRA
                     KLAQDVGKANHDAKLGWRDVLDVFKDYKIIIAGWMYFGQVVTAYGYAYFAPTIIQTYG
                     YSSIKTNLYSIPPWAVAFVFSMMVAYLSDKVKHRYAFTIVPMLIAIAGYGILLNVHGK
                     DQKNTQYGALFLVTSGCYSAMPVIVCWFTMNLGGHRRRGVGSAWQIGFGNIGGIISTY
                     SFLEKDAPLYRPGYIISLSFLCFSAALCTCYFAACWWDNRRRDRALANGTAPVPTEDE
                     LAYMGDMAPNYRYLY"
     gene            complement(<1444335..>1446124)
                     /gene="PEX3"
                     /locus_tag="ACHE_20495A"
                     /db_xref="GeneID:66979396"
     mRNA            complement(join(<1444335..1444998,1445048..1445444,
                     1445502..1445890,1445967..>1446124))
                     /gene="PEX3"
                     /locus_tag="ACHE_20495A"
                     /product="peroxin"
                     /transcript_id="XM_043284804.1"
                     /db_xref="GeneID:66979396"
     CDS             complement(join(1444335..1444998,1445048..1445444,
                     1445502..1445890,1445967..1446124))
                     /gene="PEX3"
                     /locus_tag="ACHE_20495A"
                     /note="COG:U;
                     EggNog:ENOG410PI1H;
                     InterPro:IPR006966;
                     PFAM:PF04882;
                     TransMembrane:1 (i16-34o);
                     go_component: GO:0005779 - integral component of
                     peroxisomal membrane [Evidence IEA];
                     go_process: GO:0007031 - peroxisome organization [Evidence
                     IEA]"
                     /codon_start=1
                     /product="peroxin"
                     /protein_id="XP_043133559.1"
                     /db_xref="GeneID:66979396"
                     /translation="MIGATRRWFRRNRKGLAIGAGVIGAGYLAGQYVLTKISEARERM
                     SSDRIARENLRRRFEQNQNDCTYTVLALLPTATEDILEALPVEELTKELQRKRAERLA
                     RLNAGEATGSDLSSVSPSLPDDDRRSLASEGFAHASQAGEAPGEGDGQPQQQPEQQEQ
                     QQQSPPRVKRNKTQLWNDVKILSITRAFTLIYTLSLLTIFTRIQLNLLGRRNYLSSVI
                     SLATPPANTSTIRLEDHDDDDHTQTLGNDYETNRRYLAFSWWLLHKGWKQLMERVQAA
                     VMETFGPLNPREDISVSKLSELTVQIRMKIEGSTEEERRSQKWLSYLLPPREEEDCLL
                     VESGVLGVTAAASPQTASTLRHLLDETADLIESPTFGHVLTLLNNEGFATLIERKCAN
                     DAFKSSLAPETSTQPLHSTTTIAERKTKLANVLAVLARQAHVIGNGANPPNEYLTAMD
                     QGARELEAFAAVIYSSNFGLESPESEQPKIKTESLMTDQEEEDTTSLTPPTADAGSTV
                     VVGETDPGSAFEKAWGKAVEEDEKPLS"
     gene            <1446864..>1447645
                     /locus_tag="ACHE_20496S"
                     /db_xref="GeneID:66979397"
     mRNA            join(<1446864..1446999,1447060..1447325,1447385..1447536,
                     1447597..>1447645)
                     /locus_tag="ACHE_20496S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284805.1"
                     /db_xref="GeneID:66979397"
     CDS             join(1446864..1446999,1447060..1447325,1447385..1447536,
                     1447597..1447645)
                     /locus_tag="ACHE_20496S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133560.1"
                     /db_xref="GeneID:66979397"
                     /translation="MSSAQETVSLSEKHIQEEPAEYKILFNDPLWNTNPDLTKPASDT
                     KAAEVTKEPPSQPKWSLSHGERIKELRSLLKDSNLKYDKENIQAAIKYHKTFKPEEQC
                     GSKKAFFKHGSQVDEEEFKHPQACNCIGGWAEPPYENPWGQIIDERVYNANQRVREGT
                     EAKAEKEREKELCELNKGTLHGLASSMLEPFRRLNKAFRN"
     gene            <1450137..>1450907
                     /locus_tag="ACHE_20497S"
                     /db_xref="GeneID:66979398"
     mRNA            join(<1450137..1450215,1450286..1450645,1450714..>1450907)
                     /locus_tag="ACHE_20497S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284806.1"
                     /db_xref="GeneID:66979398"
     CDS             join(1450137..1450215,1450286..1450645,1450714..1450907)
                     /locus_tag="ACHE_20497S"
                     /note="COG:S;
                     EggNog:ENOG410PJG8;
                     InterPro:IPR012445;
                     PFAM:PF07855;
                     go_process: GO:0006914 - autophagy [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133561.1"
                     /db_xref="GeneID:66979398"
                     /translation="MEPRRTPPEYFLEIFADSTTVRDVLKGILNLIFFHRYFPSIRPT
                     TFDVLDLTLPAINDVDLETLIDTRVSSLVRQHLSSAAGSNNVLDGGSGGVRGRIAVEF
                     YERKRRRPGMWFGGLAGMTGKGEEEVCWEIWTLDVTIATPRTESERAKVRKAMENMLQ
                     KAAFKILAVVNRDKDHIPPITTSESNPFPYRIVLNPRSDSWQNRIGIGLY"
     gene            complement(<1451562..>1452546)
                     /gene="YOP1"
                     /locus_tag="ACHE_20498A"
                     /db_xref="GeneID:66979399"
     mRNA            complement(join(<1451562..1451679,1451730..1451787,
                     1451843..1451906,1452101..1452109,1452180..1452386,
                     1452493..>1452546))
                     /gene="YOP1"
                     /locus_tag="ACHE_20498A"
                     /product="ER membrane protein DP1/Yop1"
                     /transcript_id="XM_043284807.1"
                     /db_xref="GeneID:66979399"
     CDS             complement(join(1451562..1451679,1451730..1451787,
                     1451843..1451906,1452101..1452109,1452180..1452386,
                     1452493..1452546))
                     /gene="YOP1"
                     /locus_tag="ACHE_20498A"
                     /note="BUSCO:EOG09264USX;
                     COG:U;
                     EggNog:ENOG410PP88;
                     InterPro:IPR004345;
                     PFAM:PF03134;
                     TransMembrane:2 (i39-72o92-117i)"
                     /codon_start=1
                     /product="ER membrane protein DP1/Yop1"
                     /protein_id="XP_043133562.1"
                     /db_xref="GeneID:66979399"
                     /translation="MATFQDRAQHMVAQLDKELSKYPILNNLERQTNVPKVYAILGLV
                     GVYFFLVFFNIAGEFLVNFAGFLIPGYYSINALFTPGTRDDTQWLTYWVVYALLTVVE
                     SAISAAYWFPFYYIFKFVLVLWMSLPQTNGAQIVFHSFLQPVLGRFFNNGSTSANLRA
                     QAEAAAKSQ"
     gene            1453706..1453818
                     /locus_tag="ACHE_t20011S"
                     /db_xref="GeneID:66987345"
     tRNA            1453706..1453818
                     /locus_tag="ACHE_t20011S"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:66987345"
     gene            complement(<1454423..>1458922)
                     /locus_tag="ACHE_20499A"
                     /db_xref="GeneID:66979400"
     mRNA            complement(join(<1454423..1454620,1454678..1458405,
                     1458491..1458710,1458830..>1458922))
                     /locus_tag="ACHE_20499A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284809.1"
                     /db_xref="GeneID:66979400"
     CDS             complement(join(1454423..1454620,1454678..1458405,
                     1458491..1458710,1458830..1458922))
                     /locus_tag="ACHE_20499A"
                     /note="COG:K;
                     EggNog:ENOG410PH8Z;
                     InterPro:IPR027417,IPR036427,IPR014978,IPR000330,
                     IPR038718,IPR001650,IPR014001,IPR029295,IPR014012,
                     IPR001487;
                     PFAM:PF00176,PF00439,PF08880,PF14619,PF07529,
                     PF00271,PF04851;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0042393 - histone binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133563.1"
                     /db_xref="GeneID:66979400"
                     /translation="MASLQSTPNMATGNMGLPPNLTQATVQETIKKFKQMQEQGVRPD
                     DPEYLKAHNFLSAVQRQQVFHRQRYAQQQQQQQQQQQQLQAQQRQQQLNGATPDAMTN
                     GHGRNGSVSSTGASQDAPTPTGALSQPSGQASAAQNAPVTSGSFSAEQLATLRNQILA
                     FKMLSKNLAIPPRVQQQLFASKKPQTPAPADNVSAAESILDGVVQDKTSQPPESAEPT
                     PPAREYYDSFQSPYDSLAKSITYGDHASRANRARVPALFPAGLDLEQVREDRETVLYN
                     KINARKAELAELPANLGVWDTSRSDAPTGDDSLKLKALIEYKMLNLLPKQRLFRKQIQ
                     NEMFHYDNLGMTANRSSHRRMKKQSLREARITEKLEKQQRDARETREKKKQYDHLQAI
                     LSHGIELQNAAQQQRNRMHKLGRMMLQHHQYMEREEQKRVERTAKQRLQALKANDEET
                     YMKLLGQAKDSRISHLLRQTDNFLKQLADSVREQQRSQAERYGEDEQQFYEEEEEEMI
                     TGEDDDEGGGKKKIDYYAVAHRIREEVTDQPKILIGGTLKEYQMRGLQWMISLYNNNL
                     NGILADEMGLGKTIQTISLITYVIEKKRNNGPFLVIVPLSTLTNWNLEFEKWAPAVSR
                     VVYKGPPNARKQQQQQIRYGNFQVLLTTYEYIIKDRPILSKIKWTHMIVDEGHRMKNT
                     QSKLSSTLSTYYSCRYRLILTGTPLQNNLPELWALLNFVLPNIFKSVKSFDEWFNTPF
                     ANTGSQDRMELSEEEQLLVIRRLHKVLRPFLLRRLKKDVEKDLPEKQERVIKCRFSAL
                     QAKLYRQLVTHNKMVVSDGKGGKTGMRGLSNMLMQLRKLCNHPFVFEPVEDQMNPSRI
                     SNDLLWRTAGKFELLDRILPKFRATGHRVLMFFQMTQIMNIMEDFLRLRSLKYLRLDG
                     ATKSDDRSDLLKLFNDPNSEYFCFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQA
                     QDRAHRIGQKNEVRILRLISSNSVEEKILERAQFKLDMDGKVIQAGKFDNKSTNEERD
                     ALLRTLLETAEAADQIGDHDEMDDDDLNAIMSRSEEELAAFQAIDRERAKNEPYGPGK
                     IPRLMAEDELPEIYMAEDNPVTEEVEAEVAGRGARERKTTRYDDGLTEEQWLMAVDAD
                     DDSIEDAIARKEARVERRRVNKEKRTRKGLPVESSPEPSRDGSETPQPKKRGRRGPAP
                     KRKAEEQVEETPQPKRKRGRQAKPVETLSSTDRAALQDITNNVYQSLMEMEQELPAEE
                     SESEDGPVTRAVIDPFMKPPPKSQYPDYYMIIQNPIAMEMIRKKINREEYQSAKAFFD
                     DIRLMCQNARTYNEDGSILFQDANDIEARCVSELKKQTENYPQFANFDDPGASESAGN
                     LPDGPIAAAPPGQPKLKLTFNNIGANGAAEFGEE"
     gene            complement(<1459783..>1461279)
                     /locus_tag="ACHE_20500A"
                     /db_xref="GeneID:66979401"
     mRNA            complement(join(<1459783..1460380,1460435..1460715,
                     1460767..1460882,1460942..1461109,1461159..>1461279))
                     /locus_tag="ACHE_20500A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284810.1"
                     /db_xref="GeneID:66979401"
     CDS             complement(join(1459783..1460380,1460435..1460715,
                     1460767..1460882,1460942..1461109,1461159..1461279))
                     /locus_tag="ACHE_20500A"
                     /note="COG:I,T;
                     EggNog:ENOG410PI7Q;
                     InterPro:IPR004148,IPR027267;
                     PFAM:PF03114;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133564.1"
                     /db_xref="GeneID:66979401"
                     /translation="MNRKFDRFRQWAGERMGNEVRTNLSDDFKAMETEMNVRHEGLDR
                     IHKALASYLKSISKRSEGDDKEKTLPIGHLGTSMVTHGEDFDAYSEYGRCLTMFGRTE
                     ERIARVQESYIAQANATWLESLDRSMTQMKDYQNARKKLDNRRLAYDTSLSKMQKAKK
                     EDYRVEEELRTQKVKYEESNDDVCRRMQDVKETEGEGIIDMAAFLDAQLKYHEECTEA
                     LLQLKNEWPGGKHGSPRTPNNGRRIGRTRSNTAHSYHERFEPLHEENANTLQPTPIVR
                     SSKPALPDSPVRDPYAADIDTQRPVVSRTSTFEGPTQLRQEPVYNNTYSSRTTSENLS
                     ARISQLRPVSRVASDPYTDHSDNYSTGTSLDGYYGERSSPTPSYGNDFYQGGSSMNGS
                     GTFKKAPPPPPPSRAKKPPPPPPPMKRPVFAGGAY"
     gene            complement(<1464110..>1464328)
                     /locus_tag="ACHE_20501A"
                     /db_xref="GeneID:66979402"
     mRNA            complement(<1464110..>1464328)
                     /locus_tag="ACHE_20501A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284811.1"
                     /db_xref="GeneID:66979402"
     CDS             complement(1464110..1464328)
                     /locus_tag="ACHE_20501A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133565.1"
                     /db_xref="GeneID:66979402"
                     /translation="MSLLIKHLDEKLLGYEVDPETAASALDGYVEDVMLPIVNRFNET
                     PAVTCLQIPPMSDDCVDVFYEDAFQRFM"
     gene            complement(<1466448..>1467401)
                     /gene="RPL2A"
                     /locus_tag="ACHE_20502A"
                     /db_xref="GeneID:66979403"
     mRNA            complement(join(<1466448..1466585,1466645..1467222,
                     1467353..>1467401))
                     /gene="RPL2A"
                     /locus_tag="ACHE_20502A"
                     /product="60S ribosomal protein L2A"
                     /transcript_id="XM_043284812.1"
                     /db_xref="GeneID:66979403"
     CDS             complement(join(1466448..1466585,1466645..1467222,
                     1467353..1467401))
                     /gene="RPL2A"
                     /locus_tag="ACHE_20502A"
                     /note="COG:J;
                     EggNog:ENOG410PIUY;
                     InterPro:IPR022669,IPR008991,IPR022671,IPR022666,
                     IPR014726,IPR002171,IPR012340,IPR014722;
                     PFAM:PF03947,PF00181;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L2A"
                     /protein_id="XP_043133566.1"
                     /db_xref="GeneID:66979403"
                     /translation="MGRVIRNQRKGRGSIFTAHTRLNKAPAQFRTLDYAERHGYTRGV
                     VKEIVHDAGRGAPLAKVQFRHPYKFKQVTETFIANEGMYTGQFIYAGKNATLTVGNVL
                     PLASVPEGTVITNVEEKSGDRGALGRTSGNYVTVIGQNPEDGKTRIKLPSGAKKVVKN
                     TSRGMVGIVAGGGRTDKPLLKASRAKHKFAVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTMSRYAARGQKAGLIAARRTGLLRGTQKTKE"
     gene            <1468721..>1470730
                     /locus_tag="ACHE_20503S"
                     /db_xref="GeneID:66979404"
     mRNA            join(<1468721..1468915,1469012..1469181,1469297..1469426,
                     1469485..1469853,1469912..>1470730)
                     /locus_tag="ACHE_20503S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284813.1"
                     /db_xref="GeneID:66979404"
     CDS             join(1468721..1468915,1469012..1469181,1469297..1469426,
                     1469485..1469853,1469912..1470730)
                     /locus_tag="ACHE_20503S"
                     /note="COG:S;
                     EggNog:ENOG410PKIA;
                     InterPro:IPR028942;
                     PFAM:PF15612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133567.1"
                     /db_xref="GeneID:66979404"
                     /translation="MSSLSDSDLSSLSSAPPTDDENAPMAVDEPVGITKYFKKESETP
                     PPKREPSPPHEYVLADNPDIAFIVMFRARFHEVFPRSTPHCGPQDIERGAVESPPGDY
                     IERLLCALLGLVLNRKKDVERNHYQRPLEEAVQTHASQWPKAWQGKNPLHGGRNFASM
                     EPNERLLLLKSLILWALSSSEAVQAKIKESYKQARHDDDLNQPLSVQPWGRDGLKRRY
                     WLIEGMDDTHFRLYREGNPALKNVTWWSVAGSIPELQGFADKLGEDKSTHSKKLSERI
                     KNSIPRFEGSEEKRKRRDYRIARKAAFSRPEPGFSLYEGRTRGKKLKYTYSEDEEIFS
                     DDQPTTRRSTRNASGTATPAEAAGPRFTASGRQIRSRAGGLYGEALLANQRDDAADEE
                     DTGRPQRTRTTRTNGYAGYDIDIGFEGGQSSENEWQGGDDEEEEDNDFEGDDEEESSG
                     DESVANGETPSLVVQLRYGKGRASNGSEAADHSGDHSGKQPSTSTQQESGVNGNEPTD
                     TAQDTNTQMQLDDIPAAAGQSLKSQKEQPSGFNQGPHVTSVSQPAAVGSETG"
     gene            complement(<1471171..>1471895)
                     /locus_tag="ACHE_20504A"
                     /db_xref="GeneID:66979405"
     mRNA            complement(join(<1471171..1471218,1471328..1471522,
                     1471581..>1471895))
                     /locus_tag="ACHE_20504A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284814.1"
                     /db_xref="GeneID:66979405"
     CDS             complement(join(1471171..1471218,1471328..1471522,
                     1471581..1471895))
                     /locus_tag="ACHE_20504A"
                     /note="COG:S;
                     EggNog:ENOG410PPTY;
                     InterPro:IPR013898;
                     PFAM:PF08589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133568.1"
                     /db_xref="GeneID:66979405"
                     /translation="MAEPTIEIAETIQTASVNPDPCPAHDINPTTSVSEKKSHVPESA
                     ITDDTDSIPSDVVDPSRMVRTVVRQKHLPPLPDLRFEQSYLASLKDADTWGRVAWITI
                     RDQVILPLVQGTLWTLALSGWRYWNRNASLSGRTLGSRIRRWWYEVNNWKLPPLKFTK
                     DSRFAGQVEDFLQFYKTQFANAGSD"
     gene            <1472177..>1473544
                     /gene="ADO1"
                     /locus_tag="ACHE_20505S"
                     /db_xref="GeneID:66979406"
     mRNA            join(<1472177..1472219,1472276..1472291,1472343..1472493,
                     1472551..1472892,1472946..1473283,1473340..1473453,
                     1473508..>1473544)
                     /gene="ADO1"
                     /locus_tag="ACHE_20505S"
                     /product="adenosine kinase"
                     /transcript_id="XM_043284815.1"
                     /db_xref="GeneID:66979406"
     CDS             join(1472177..1472219,1472276..1472291,1472343..1472493,
                     1472551..1472892,1472946..1473283,1473340..1473453,
                     1473508..1473544)
                     /gene="ADO1"
                     /locus_tag="ACHE_20505S"
                     /note="BUSCO:EOG09263HYJ;
                     COG:F;
                     EggNog:ENOG410PHCU;
                     InterPro:IPR029056,IPR002173,IPR001805,IPR011611;
                     PFAM:PF00294;
                     go_function: GO:0004001 - adenosine kinase activity
                     [Evidence IEA];
                     go_function: GO:0016773 - phosphotransferase activity,
                     alcohol group as acceptor [Evidence IEA];
                     go_process: GO:0006166 - purine ribonucleoside salvage
                     [Evidence IEA]"
                     /codon_start=1
                     /product="adenosine kinase"
                     /protein_id="XP_043133569.1"
                     /db_xref="GeneID:66979406"
                     /translation="MAGYPLLCLENPLLDIQAVGDAALLEKYGLKDNDAILAEDKHMG
                     LYDELMKLDAKLIAGGAAQNTARGAQYILPDNSVVYIGCVGKDKYADLLKDACTKAGV
                     HTEYRVDDVQPTGKCGVIITGHNRSMCTHLAAANEYKPEHLKQPQIWDLVEKAQVYYV
                     GGYHLTVSVPAILALAEEAAAKNKIFMLSLSAPFIPQFFKDQLDTVLPYTDYTFCNET
                     EARSYSESHGWGTDDIVEITKKLAQLPKKNTSRPRIAIVTQGTLPTVAASVKPDGQVE
                     VKEFAVREISKDAITDTNGAGDAFAGGFAAGIVQGKSLEESIDMGQWLASLSIQELGP
                     SFPATKRTYTKQ"
     gene            complement(<1474253..>1477287)
                     /locus_tag="ACHE_20506A"
                     /db_xref="GeneID:66979407"
     mRNA            complement(join(<1474253..1475344,1475404..1475957,
                     1476016..1476609,1476669..1476846,1476919..1477045,
                     1477115..1477201,1477259..>1477287))
                     /locus_tag="ACHE_20506A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284816.1"
                     /db_xref="GeneID:66979407"
     CDS             complement(join(1474253..1475344,1475404..1475957,
                     1476016..1476609,1476669..1476846,1476919..1477045,
                     1477115..1477201,1477259..1477287))
                     /locus_tag="ACHE_20506A"
                     /note="COG:A;
                     EggNog:ENOG410QDF2;
                     InterPro:IPR018834,IPR019458,IPR011990;
                     PFAM:PF10374,PF10373;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133570.1"
                     /db_xref="GeneID:66979407"
                     /translation="MASEFQNTWQTALEAERELFKSLAEKEPTFVGTSHYLSTLRAAC
                     QNAILQDFESARSIDVEGRLWDAHLKINSRFRKLLSRYREENGKKKKPVEKRKLEKHY
                     LEFIKSSQRFYRGYIQQLSSHFGGIPELEKVARKFNHENLSAQSAVQTAEESLRTRIL
                     QSCHATVIRLGDLSRYRETELVTKDRNWGPAIGYYDLAMVIYPASGASHNQLAVIALA
                     DGNHLRATYHLYRALSAHEPHPSARGNLEIEFRKVMSAWAKRELIRPEDAGIPGRALA
                     PWFVYLHAQCYKGVDFPEHDELESEVLSQLAVDLKERSLEGTLQKFCLINIAAEDFAR
                     KRSDEDSSSNARLFFQRINVKTFFTLLQILLAELERFAVEDQDPSNKDGKPSPEKVTV
                     VARRVLPALRNYSSWLLTVSSLLVAYNKEDTPLSVQIAEFWKIYANTLTLLALTFEVV
                     NLPDIDYLLEEDEETLGFAPLDQKAASRRYLDANGQRKPRVHDEGVERSHPSIEMLYR
                     IREFVIDGLDLVVGNKIPIALVDDNDKKSFIYKEEGLPSQFFASPSNHHHTLSSTSIG
                     RDDIQRAVQDSNHIADSRSVYDGSQSASASMSEMHRIVEDVERLVESDTYENAPNVSE
                     QPGFLNNSQLPTPSVNLFDSDRGSSAFRKESMIPRSTPMAPPGLGPPMTNPAAPPSSQ
                     SFTPLPSILPSIWNTGLSPSGEASSLGTPRPPGLDQQPNSMYQPSMNITTPGFRPSQS
                     SPSSVVPGLMFYQQQQLLRNQYPNRLKASAPLSSPWTPSSPPSSMPMHARSSGLGAGW
                     DILASSPAPAPFGPSAPASSNPMPSSSARALANASWPNDAFIASNSHFPPPSMGYPGG
                     HGYSPGFENSRRSGTQLGAIGETPPCGQGG"
     gene            <1477992..>1478890
                     /locus_tag="ACHE_20507S"
                     /db_xref="GeneID:66979408"
     mRNA            join(<1477992..1478342,1478416..1478505,1478570..>1478890)
                     /locus_tag="ACHE_20507S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284817.1"
                     /db_xref="GeneID:66979408"
     CDS             join(1477992..1478342,1478416..1478505,1478570..1478890)
                     /locus_tag="ACHE_20507S"
                     /note="COG:U;
                     EggNog:ENOG410PQTV;
                     InterPro:IPR039258,IPR013087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043133571.1"
                     /db_xref="GeneID:66979408"
                     /translation="MSKRFRSLSNSPPIDQSPLEIRARSPSPATPQGRSKQLHLQDTV
                     NPTVEVMRCSLPPHRETISFASYADYEVHYRQAHVNRCVECAKNFPTDLFLNLHIEEN
                     HDSLMIVRRERGEKTYGCFIEGCERKCSTPRKRRMHLIDKHMFPKSYNFSIVNDGIDK
                     QTSLLQPMNSSNRRRLSSAPTSPKEGRLRNRQTSISQQGSQPVPISPTGGASQTQNKK
                     DLDNMDIADLEKSMSALRFVPTSVTRNRTKPGSRA"
     gene            complement(<1479175..>1482038)
                     /locus_tag="ACHE_20508A"
                     /db_xref="GeneID:66979409"
     mRNA            complement(join(<1479175..1481701,1481774..1481828,
                     1481906..>1482038))
                     /locus_tag="ACHE_20508A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043284818.1"
                     /db_xref="GeneID:66979409"
     CDS             complement(join(1479175..1481701,1481774..1481828,
                     1481906..1482038))
                     /locus_tag="ACHE_20508A"
                     /note="COG:K;
                     EggNog:ENOG410PFYS;
                     InterPro:IPR036236,IPR007219,IPR013087;
                     PFAM:PF13894,PF04082,PF00096;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evide