GenomeNet

Database: RefSeq
Entry: NC_057365
LinkDB: NC_057365
Original site: NC_057365 
LOCUS       NC_057365            3787471 bp    DNA     linear   CON 15-SEP-2021
DEFINITION  Aspergillus chevalieri M1 DNA, chromosome 4, nearly complete
            sequence.
ACCESSION   NC_057365
VERSION     NC_057365.1
DBLINK      BioProject: PRJNA727462
            BioSample: SAMD00269937
            Sequence Read Archive: DRR262018, DRR262019, DRR262020
            Assembly: GCF_016861735.1
KEYWORDS    RefSeq.
SOURCE      Aspergillus chevalieri
  ORGANISM  Aspergillus chevalieri
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1
  AUTHORS   Kadooka,C., Mori,K. and Futagami,T.
  TITLE     Aspergillus chevalieri M1 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3787471)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3787471)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus chevalieri M1 genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP024419.
            Please visit our web page
            URL:https://chem.agri.kagoshima-u.ac.jp/honkaku/index.html.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Canu v. 2.0; Flye v. 2.8-b1674
            Assembly Name         :: AchevalieriM1_assembly01
            Genome Coverage       :: 357.6x
            Sequencing Technology :: MinION; Illumina NovaSeq 6000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3787471
                     /organism="Aspergillus chevalieri"
                     /mol_type="genomic DNA"
                     /strain="M1"
                     /db_xref="taxon:182096"
                     /chromosome="4"
                     /country="Japan:Kagoshima, Makurazaki"
                     /collection_date="2018"
     gene            <4799..>5134
                     /locus_tag="ACHE_40001S"
                     /db_xref="GeneID:66981796"
     mRNA            <4799..>5134
                     /locus_tag="ACHE_40001S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278151.1"
                     /db_xref="GeneID:66981796"
     CDS             4799..5134
                     /locus_tag="ACHE_40001S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135959.1"
                     /db_xref="GeneID:66981796"
                     /translation="MVLANPPSLCLLTPTPTQPPDSPAAANKTPQTTGYGPPGCAAPA
                     TQSPPQCPRRRPAIPPVAAAMPPECPPPMAHAASSPPWGSKPPGTDTGRPAPTRRISS
                     AASHRKNTR"
     gene            <5207..>5971
                     /locus_tag="ACHE_40002S"
                     /db_xref="GeneID:66981797"
     mRNA            <5207..>5971
                     /locus_tag="ACHE_40002S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278152.1"
                     /db_xref="GeneID:66981797"
     CDS             5207..5971
                     /locus_tag="ACHE_40002S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135960.1"
                     /db_xref="GeneID:66981797"
                     /translation="MNINRAGHPPGPWRRYNIDPATAEPPAPQTPHPAMPGTVAGGIE
                     CRPRPTGAGVGGGLRTGAAAGGGSGSGAGAGVGSGSGSGSGYGLGLSYRCGAGADLGL
                     GSGLGSGSGSGYGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADL
                     GLGSGSGYGSGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADLGL
                     GCGSAYGSGSGVGYGSGFGLGCMSPLLCWNHTPFRA"
     gene            <6066..>6416
                     /locus_tag="ACHE_40004S"
                     /db_xref="GeneID:66981799"
     mRNA            <6066..>6416
                     /locus_tag="ACHE_40004S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278154.1"
                     /db_xref="GeneID:66981799"
     CDS             6066..6416
                     /locus_tag="ACHE_40004S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135961.1"
                     /db_xref="GeneID:66981799"
                     /translation="MVQAHTPGLMPSLMPGLITTHVPYMPLHITPITCLLVPVIPAML
                     PPVSIHCPIQIIVQYHPPAPPTCHHPHVLLHQLHLRCAQLSLILRPPRRLDNDRLAGL
                     PIPPGSPAFLCIIQ"
     gene            complement(<6623..>8299)
                     /locus_tag="ACHE_40003A"
                     /db_xref="GeneID:66981798"
     mRNA            complement(<6623..>8299)
                     /locus_tag="ACHE_40003A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278155.1"
                     /db_xref="GeneID:66981798"
     CDS             complement(6623..8299)
                     /locus_tag="ACHE_40003A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H;
                     InterPro:IPR027417,IPR014001,IPR011545;
                     PFAM:PF04851,PF00270;
                     TransMembrane:1 (o364-387i);
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135962.1"
                     /db_xref="GeneID:66981798"
                     /translation="MAAPSPYLWGPDPGMQRPWTPERFREVLKRETQARLGQALNIPA
                     YRDIAIGISRRFLRASSTFTSDRQDETEQAAALDADCEDGMDADQWMAHMTDLQAGHS
                     SHVAGMVYGRQLMEQAGTTSHRRAMFRQSSVDWHQFLGFGCGTGVPGDVHADIDAGGL
                     RAGLVDEGSCPSRRPGQEQVRARLVDDPGQEWVRACLVDDPGQEWVRACLVNDPGQER
                     VRARLVSDPSQEGVRARLVDEGNRPIHHPGQERVRARLVDEGSCPIHHPGQERVRACL
                     VNDPGQERVRARPVLGKRKRAPWQVEAEEHHMERRHQLQTMDMAAALQQMTGQAGMQF
                     QGIQAPAMAAIQQGKSPVVAVMPTGGGKSMLFMLPAWAVPGGTTIVVVPLISLRQDMQ
                     QRCRRLGIPCMAWDRQQPCDEAAIVLVTPESAVTPDFHSFINRLVVMQRLDRVVIDEC
                     HIIMNQQKNFRSAMAQLGKLVRARTQMVFLTATLPPRWNRSSASAFTTHRIRSIYIGP
                     ARAAAMWHMGCGGHRFHTLHHMDMDGSRMPGLFSSCRRSSSGPGPGGGRW"
     gene            <8534..>9580
                     /locus_tag="ACHE_40005S"
                     /db_xref="GeneID:66981800"
     mRNA            join(<8534..9157,9194..>9580)
                     /locus_tag="ACHE_40005S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278156.1"
                     /db_xref="GeneID:66981800"
     CDS             join(8534..9157,9194..9580)
                     /locus_tag="ACHE_40005S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135963.1"
                     /db_xref="GeneID:66981800"
                     /translation="MPFTVPFGVPFHVPFNVLFDVPFTVPARVPFHVPFDVPFNVPIG
                     MLFVVPFNMLFDVPFNVLFDVPFSVSFDMPFAVPFDVPFSVPFALPFSVPLTVPARVP
                     FHVPFNVLFDVPFTVLARVPFAVPACVPISVPFSMPFAVPFSVPFNVPACVPFHVLFN
                     VLFNVPFDVPFDMPFTVPFTVPFTVPARVPFNVPFDVPFDIPFDVPFDIPFDVPFTVP
                     CAVPACHAVNWPMNGIASHIYHTTNSPTARGTYRWISLLSLLAWKPLWYAVTSVTIPS
                     SMNTLRNWLFGVLTYCTLSSSGARAGCPAVIWMATASFSLNRATRARYCATNGPWIAP
                     GA"
     gene            complement(<9620..>10787)
                     /locus_tag="ACHE_40006A"
                     /db_xref="GeneID:66981801"
     mRNA            complement(join(<9620..10321,10377..>10787))
                     /locus_tag="ACHE_40006A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278157.1"
                     /db_xref="GeneID:66981801"
     CDS             complement(join(9620..10321,10377..10787))
                     /locus_tag="ACHE_40006A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135964.1"
                     /db_xref="GeneID:66981801"
                     /translation="MQEWCGPLPVYGMTARQQRKWQILWQLAMPTMARPQQAPHRARA
                     RAVHMFPGAGRILEQGGNPGSYRATEGRGVSPGDQPTAGHGVSPEHVEEAEETGNAGS
                     TEPAWMMSPMERACLEFCIELLNQRHRAHEYESPLLPPILSRMIKLARFMVVQKALWL
                     DPHVGDIIQMWQAQASTANGTVNGTVNGTVNGTPASPIAWPLASADAQLADIDEGCDS
                     ASPTRHTPTTVHDRPSFHDHVQQMVSRFMIRGTHGPMQTLLDWRTYGLKIHYNSTAPG
                     HVAWMGADELLYKDLHFTMGEFRGFIHGLVGATRELLCELLCIADGSSSAHTPSTMPL
                     PAIPWQGLYDDPTQGHPGWNFCTIAEPGGPWMAGGG"
     gene            complement(<11098..>11432)
                     /locus_tag="ACHE_40007A"
                     /db_xref="GeneID:66981802"
     mRNA            complement(join(<11098..11346,11394..>11432))
                     /locus_tag="ACHE_40007A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278158.1"
                     /db_xref="GeneID:66981802"
     CDS             complement(join(11098..11346,11394..11432))
                     /locus_tag="ACHE_40007A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135965.1"
                     /db_xref="GeneID:66981802"
                     /translation="MQQLPSPGHTCSVQAGHGSWAAGTVYARGLQEAPGHIQARRVQY
                     RAISREWHAFLGFQVSLGPRKRGWGEGKGEEPAAKRQRQQQPYVTVEMKEN"
     gene            complement(<18019..>18369)
                     /locus_tag="ACHE_40008A"
                     /db_xref="GeneID:66981803"
     mRNA            complement(<18019..>18369)
                     /locus_tag="ACHE_40008A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278159.1"
                     /db_xref="GeneID:66981803"
     CDS             complement(18019..18369)
                     /locus_tag="ACHE_40008A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135966.1"
                     /db_xref="GeneID:66981803"
                     /translation="MRLAADLEDAERSNDEALARLSETSAKLARLRKHKRFLEARNKA
                     MLENDVALLEELDSQVSWPVAETASLDAQLAAVTDDPSLSQMMNSPSFWENFDSAVAG
                     GIPSPTGGNQSSSQ"
     gene            complement(<20909..>28244)
                     /gene="TOR1_1"
                     /locus_tag="ACHE_40009A"
                     /db_xref="GeneID:66981804"
     mRNA            complement(join(<20909..21298,21353..27035,27090..28041,
                     28118..>28244))
                     /gene="TOR1_1"
                     /locus_tag="ACHE_40009A"
                     /product="phosphatidylinositol kinase- protein kinase
                     tor1"
                     /transcript_id="XM_043278160.1"
                     /db_xref="GeneID:66981804"
     CDS             complement(join(20909..21298,21353..27035,27090..28041,
                     28118..28244))
                     /gene="TOR1_1"
                     /locus_tag="ACHE_40009A"
                     /note="COG:L;
                     EggNog:ENOG410PGA0;
                     InterPro:IPR016024,IPR011989,IPR036738,IPR003152,
                     IPR003151,IPR036940,IPR018936,IPR009076,IPR024585,
                     IPR011009,IPR026683,IPR014009,IPR000403;
                     PFAM:PF11865,PF00454,PF02260,PF08771,PF02259;
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016301 - kinase activity [Evidence IEA];
                     go_function: GO:0044877 - protein-containing complex
                     binding [Evidence IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol kinase- protein kinase
                     tor1"
                     /protein_id="XP_043135967.1"
                     /db_xref="GeneID:66981804"
                     /translation="MAQAGPIRDVTSRLFVELKSKNEEARVRAAYDLYDNVLAISRDW
                     SPEKFLEFYNAVSQRIAQLVVTGSDTNERIGGLLALDRLIDFDGVDAAQKTVRFASYL
                     RSALRSNDTLVLAYAARALGRLAKPGGALTAELVESEIQSALEWLQSERQESRRFAAI
                     LVMRELAKGSPTLLYGFVPQIFELIWVPLRDPKVLTRETAAEAVSECFEIIAARDIQV
                     RQLWFARIYEEALLGLKSNHVDWIHGSLLVLKELLLKGAMFMNDHYRNACEIVLRLKD
                     HRDPKIRTQVVLTIPILASYAPVDFTEIYLHRFMIYLQAQLKRDKERNSAFIAIGKIA
                     NAVGVAIAQYLDGIIIYIREGLAMKARNRSAVNEAPMFECISMLSLGVGQALSKYMEA
                     LLDPIFACGLSESLTQALVDMAHYIPPIKPTIQEKLLDMLSIILYGTPFRPLGCPENR
                     LPPMPSFAKDFAPQELHSDSDIALALHTLGSFDFSGHILNEFVRDVAINYVENDNPEI
                     RKASALTCYQLFVHDPIINQTSSHSIQVVSEVIDKLLTVGIGDPDPEIRRTVLWSLDR
                     KFDRHLARPENIRCLFLAVNDETFSVREAAICIIGRLSSVNPAYVFPPLRKLLVDLLT
                     GLGFASTARQKEESAQLISLFVSNATKLIRSYVDPMVTTLLPKATDANPGVASTTLKA
                     VGELANVGGGEMNHYLPQLMPIILDSLQDLSSHAKRESALRMLGQLARNSGYVIDPYI
                     EYPHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKYQQISEDAPGIHHINEVQQ
                     VSDVALIMQGLTPSNEEYYPTVAINTLMQNILQENSLSQYHSAVIDAIVTIFKTLGLK
                     CVPFLGQIIPGFIAVIRGSPHSRLESYFNQMAILVNIVRQHIRAFLPGIIDVIHDFWE
                     TSYPVQATILSLMEAIAFSLEGEFKKYLASLVPPMLDTLDNDSTPRRQPSERILHSFL
                     IFGSSGEEYMHLIVPSIVRLFDGTQNPPSIRKSAIESLTKLSHQVNVSDFASLIFHSL
                     SRVVGGSERSLRQPAMDCICALIFQLGQDFTHYIHLLNKVLKTNQITHVNYQILVTKL
                     QKGDPLPQDLNPDENYATLEDDTSFAEIDQKKMVVNQQHLKNAWDASQKSTREDWQEW
                     IRRFSVELLKESPSSALRACASLAGIYQPLARDLFNAAFMSCWTELYDQYQEELVWSI
                     EKALTSPNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKELE
                     FEQDQNSAAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAA
                     YKRRERIDPDSFGVTMGKMRCLHALGEWKVLSDLAQEKWNQASLENRRAIAPLAAAAA
                     WGRGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFDEATMYIEKAQNGLDMELSAL
                     LGESYNRAYNVVVRVQMLAELEEIIMYKQNIGDPEKQDAMRHTWNKRLLGCQQNVEVW
                     QRMLKVRALVTSPCENLDMWIKFANLCRKSNRMGLAERSLQSLETVVSDGNGTRAIAP
                     PEVTYARLKFSWAMGRQRDSLTMLREFNANLTEDFTRFNAFLVSQIDHAVNGVNGIID
                     ANHADIVGLRERVGDVNKLRRLLAKSYLRQGEWQTALQRGEWRPELVREVLNAYSAAT
                     KYNCDSYKAWHSWALANFEVVTTIASQANREGQPPVMVPQHIVTEHVIPAIHGFLRSI
                     ALSSTSSLQDTLRLLTLWFTHGGDQDVNGVVTEGFTAVNIDTWLAVTPQLIARINQPN
                     FRVRSAVHRLLAEVGKTHPQALVYPLTVAMKSNVTRRSQSASNIMDNMRQHSARLVEQ
                     ADLVSHELIRVAGLWHDLWHEGLEEASRLYFGDHNVEGMFATLAPLHDMLDQGAETLR
                     EVSFTQAFGRDLAEAKQYCMLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLK
                     YVSPKLKDCSDLDLAVPGTYQSGRPIIRIISFDPILHVLQTKKRPRRMTLNGSDGSSY
                     MYLLKGHEDIRQDERVMQLFGLVNTLLDNDSESFKRHLSVQRFPAIPLSQSSGLLGWV
                     SNSDTLHALIKEYRESRRILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKD
                     LYRILWLKSRSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLLLDRITGKVVHI
                     DFGDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYRITCEAVMRVLRENKDSL
                     MAVLEAFIHDPLINWRLGVREEPDRIPFAAERRQSMVGNLNTEHGVQPSNYSRHRRPS
                     ILEGGILDAQEGIPNEARELQNARALQVLARVKEKLTGRDFRLYEELNVSDQVDKLLA
                     QSTNVENICQHWIGWCSFW"
     gene            <32654..>33890
                     /locus_tag="ACHE_40010S"
                     /db_xref="GeneID:66981805"
     mRNA            join(<32654..32938,33011..33197,33259..33755,
                     33825..>33890)
                     /locus_tag="ACHE_40010S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278161.1"
                     /db_xref="GeneID:66981805"
     CDS             join(32654..32938,33011..33197,33259..33755,33825..33890)
                     /locus_tag="ACHE_40010S"
                     /note="COG:U;
                     EggNog:ENOG410QDYJ;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:6
                     (i106-123o143-163i175-194o200-221i233-257o269-293i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135968.1"
                     /db_xref="GeneID:66981805"
                     /translation="MIETIRDSAFGKLLRLLSGGSLLQYPEEMDDSAWYTYLQTSETG
                     QPEESTESNDEGLLQTYGLYAVMSQASSRSRRGPRGKIPEIISWGGPNDSENPQNWST
                     DKKIFVSLLIWLLTFSIYIGSAIYTPGIPGVSEQFHVSREVAVLGLTLFVLGYGLGPM
                     IWAPLSELPAVGRSPVYVVTLVIFVFFQFAVIYAKNIGMLLAFRFLTGFLGSPVLATG
                     GASMGDIWDPRVRDYMIAIWGCFAISAPVLGPLVGGFAFSAEGWTWTIWELLWISGLA
                     LFVLFFFLPETFAPSIISRRARRVRRITGDQKYASRAEIEIAGVSSKDVLIEALIRPI
                     ELCFLEPSSF"
     gene            complement(<36354..>39258)
                     /locus_tag="ACHE_40011A"
                     /db_xref="GeneID:66981806"
     mRNA            complement(join(<36354..36571,36632..36758,36809..37337,
                     37391..38155,38211..38447,38497..39076,39147..>39258))
                     /locus_tag="ACHE_40011A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278162.1"
                     /db_xref="GeneID:66981806"
     CDS             complement(join(36354..36571,36632..36758,36809..37337,
                     37391..38155,38211..38447,38497..39076,39147..39258))
                     /locus_tag="ACHE_40011A"
                     /note="COG:C,G;
                     EggNog:ENOG410PK3H;
                     InterPro:IPR002213,IPR004276;
                     PFAM:PF03033;
                     go_function: GO:0008194 - UDP-glycosyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0030259 - lipid glycosylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135969.1"
                     /db_xref="GeneID:66981806"
                     /translation="MGDVAASNIPLALHSPPEYWQPHGHYADGLNSMAHVTDNGRVEI
                     ALNADDAQVGSLLSALQRQPNRRSSEKKKGGTQFPLRLNVVIHVVGSRGDVQPFIALG
                     RAMREHGHRVRLATHLVFRDFVKENGLEFFNIGGDPAELMSFMVNNPKLFPRMKTLLQ
                     GTIGRRRKELRTMISGCWRSCFEVGEGVDITSDEGITTPPFVADTIIANPPSFAHFHC
                     AQKMGVPLHLMFTMPCSPTQAFPHPLSNIHLRDMKRSIANFASYGLTEILVWQGVGDL
                     VNRFRRFELGLEQLDAMSAPSLLHRLHVPFTYFWSPSLLPKPDDWHEHINVTGFNFLA
                     ADPGYTPARDLAEFLDAGPPPLYIGFGSIVVDDPDALTRTILDAVEMTGQRALISKGW
                     GGLGADKINRRDVFFVGNCPHDWLFPRVSLVVHHGGAGTTATGLASGRPTIVVPFFGD
                     QLFWGGLVAQNGAGPSPIPNRDLTSNRLASAIHFCLKQETVKKAQKLGENIRAEDGVR
                     TALESFHQRLDVHRLQCALCPNRPAVWRIRRTKVLLSAFAATVLVEEKKLNPKNVKLY
                     RSQHYDTNYGCLGTEAFTGAMSNFLTGLVDMPVNAVQNLSQPASDRFAFNYNLPSRIQ
                     TPAILDLDVDLPAGSSRSVGTQNDNWMSTSTLSSGATTQSQVGTPSMVLKRNPLQKAA
                     ANASYMARRVLNWGIEVPMGLALMFSQGLHNTPRLYHDRTVRDTPEVTGFKSGFVAAG
                     KEFGYSSYDGITGVVTQPSQGWKDGGFSGVARGLGGLILKPQAGMWGLLGYPLCGIHR
                     EIERSYGADREDYVVKSRIQQGLAESNVASPKERAAVLEKWSVYEGGVHSKNETHAR"
     gene            <44437..>45227
                     /locus_tag="ACHE_40012S"
                     /db_xref="GeneID:66981807"
     mRNA            join(<44437..45000,45072..>45227)
                     /locus_tag="ACHE_40012S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278163.1"
                     /db_xref="GeneID:66981807"
     CDS             join(44437..45000,45072..45227)
                     /locus_tag="ACHE_40012S"
                     /note="COG:K;
                     EggNog:ENOG410Q1WU;
                     InterPro:IPR007219;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135970.1"
                     /db_xref="GeneID:66981807"
                     /translation="MPCGNCCRTQADCVIDEHSDNRRRSTLKRKLDSLEDDRELLIRL
                     VETLRDSGDTRISALLNLIRSNASLTELKSYINEQLCRPQSPELAKAHDEISRLHEAT
                     SQTCRSVLDVKRLCDQPVFRVPAKPWTTVTDDDGLVSHLISLYFTWYHPCFPWMDRDI
                     FIRDMKGGNVKSQFCSPFLVNAILAAGCPYSDYAEAYTDPDDSGTAGVHFYNEAKKCL
                     EMEEGHMSIATVQGLEVLSMW"
     gene            <45921..>46502
                     /locus_tag="ACHE_40013S"
                     /db_xref="GeneID:66981808"
     mRNA            <45921..>46502
                     /locus_tag="ACHE_40013S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278165.1"
                     /db_xref="GeneID:66981808"
     CDS             45921..46502
                     /locus_tag="ACHE_40013S"
                     /note="COG:K;
                     EggNog:ENOG410Q1WU;
                     TransMembrane:1 (o54-75i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135971.1"
                     /db_xref="GeneID:66981808"
                     /translation="MYYYTITIMVFGFAKNIADDKDSLNSEFHRFAADTCLQSARQIA
                     KLVDIHRSSWGLDLFVVTYIQWITVSLFTLLEDLNDPMNREAFASLSVAAKVASRRWV
                     LGKGMLRAVQVTARKMEVSLPSETDVLFSDFEKQSWGPKDRRELSSSYPNFAVSIGSF
                     QTDEVELDKFLEKWDTLDISDSGEVDKSRSPAE"
     gene            complement(<46966..>47849)
                     /locus_tag="ACHE_40014A"
                     /db_xref="GeneID:66981809"
     mRNA            complement(join(<46966..47091,47143..47495,47549..>47849))
                     /locus_tag="ACHE_40014A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278166.1"
                     /db_xref="GeneID:66981809"
     CDS             complement(join(46966..47091,47143..47495,47549..47849))
                     /locus_tag="ACHE_40014A"
                     /note="COG:K;
                     EggNog:ENOG410PSSN;
                     InterPro:IPR004827;
                     PFAM:PF00170,PF07716;
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135972.1"
                     /db_xref="GeneID:66981809"
                     /translation="MLHLELFGLFGLITPHPTHRPPPLLTAMSCSIGVQPTSTSIYDP
                     WGASLSLWHADGQIEGLESIPPTFSTWDFPLGQDLYNPGLPLNTFHGPERSPKNDIGQ
                     QLSESLSTQPVPSNGQLKNRKSRGAKPAKTGIQKTSSRERFLERNRQAASRCRQKRKE
                     HTQVLEERFKEQSTKHQQLQSEFRCLRMEILGLKNEVLKHAHCTDNHISEYLAQMLET
                     VHEYGQQDRTSSIGGSSELESTESLDDCLAQGDLDGLLVPE"
     gene            <49686..>50264
                     /locus_tag="ACHE_40015S"
                     /db_xref="GeneID:66981810"
     mRNA            join(<49686..50116,50189..>50264)
                     /locus_tag="ACHE_40015S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278167.1"
                     /db_xref="GeneID:66981810"
     CDS             join(49686..50116,50189..50264)
                     /locus_tag="ACHE_40015S"
                     /note="COG:I;
                     EggNog:ENOG410PRKF;
                     InterPro:IPR001375,IPR029058;
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135973.1"
                     /db_xref="GeneID:66981810"
                     /translation="MPTSGFLSDRFALTARWELDSTFLDGCFGKPGLGKMLNEVEYAK
                     RAAAVPEDIKPGFLQLFVTENYPPSVLVHGTADEVVPDKESVKQYEQLRKLDIKTELL
                     LVQDGRHGLADFGSGFPPQPATGSTEAYGRALKFIAEVFVSNSTKNNVSYLEPFWKSL
                     SALLDAHS"
     gene            <50459..>51577
                     /gene="PLR1_2"
                     /locus_tag="ACHE_40016S"
                     /db_xref="GeneID:66981811"
     mRNA            join(<50459..50585,50635..51040,51121..>51577)
                     /gene="PLR1_2"
                     /locus_tag="ACHE_40016S"
                     /product="pyridoxine 4-dehydrogenase"
                     /transcript_id="XM_043278168.1"
                     /db_xref="GeneID:66981811"
     CDS             join(50459..50585,50635..51040,51121..51577)
                     /gene="PLR1_2"
                     /locus_tag="ACHE_40016S"
                     /note="COG:C;
                     EggNog:ENOG410PHVT;
                     InterPro:IPR023210,IPR036812;
                     PFAM:PF00248"
                     /codon_start=1
                     /product="pyridoxine 4-dehydrogenase"
                     /protein_id="XP_043135974.1"
                     /db_xref="GeneID:66981811"
                     /translation="MPEILGKEIGPIGFGLMGFTWRATPPSQEQAFATMRAALSHGCN
                     FWNGGEFYGPPNYNSLVLLKHYLEKYPEDAGKIMLSIKGGVNPHTHASDGSAENTRRT
                     IDDSTAQLNGRKKIDLFEFARRDQGVSMSETFGVMDKEYVQTGKIGGVSLSEVRAETI
                     HEAVKHVKIHAVEVELSLFSTEVLENGVAAACAQYGIPLIAYSPIGHGMLSGKIRRFE
                     DIPEDSIMRMFPRFQPGNFEINMQLVQQVEAMAVKKGCTPAQLAINWTRGLSRRPGMP
                     LIIPIPGATTIARVEENSKLVDLTDDEMAQIDVTLAKFTPAGSRYPDSIPVDT"
     gene            complement(<52271..>52814)
                     /locus_tag="ACHE_40017A"
                     /db_xref="GeneID:66981812"
     mRNA            complement(join(<52271..52400,52451..52573,52624..>52814))
                     /locus_tag="ACHE_40017A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278169.1"
                     /db_xref="GeneID:66981812"
     CDS             complement(join(52271..52400,52451..52573,52624..52814))
                     /locus_tag="ACHE_40017A"
                     /note="COG:S;
                     EggNog:ENOG410PP28;
                     SECRETED:SignalP(1-20)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135975.1"
                     /db_xref="GeneID:66981812"
                     /translation="MKVFYSLVAALPLAMSATLSQRSIICLEVGATATATWTNRDGQT
                     CSFVGVVGSDYGTNSNGSGDYSCNGRCGAGCTGTAIGDVYTQDCFSHDICSYFNNATG
                     GSSDPNCGDAYDAAVDDTVGGAVAGCSQTNPSSAVSKPATSPTCA"
     gene            complement(<53425..>55033)
                     /locus_tag="ACHE_40018A"
                     /db_xref="GeneID:66981813"
     mRNA            complement(join(<53425..53532,53591..53783,53835..54020,
                     54080..54257,54307..54469,54518..>55033))
                     /locus_tag="ACHE_40018A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278170.1"
                     /db_xref="GeneID:66981813"
     CDS             complement(join(53425..53532,53591..53783,53835..54020,
                     54080..54257,54307..54469,54518..55033))
                     /locus_tag="ACHE_40018A"
                     /note="COG:S;
                     EggNog:ENOG410PU80;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135976.1"
                     /db_xref="GeneID:66981813"
                     /translation="MAPFKVIIVGGGLAGALLANGLRNNNVDVTVYERDESDMEREGY
                     QIRLGESAMLGFRACLRGQDIAAISKSFGQSSVSGSTAPTIMNSRCEEILDLTAIPSY
                     AKSFAISRAVLHDILTEPLKQNGLVKYGNAFLRYEIIHEADGDERVRAYFSDSSFDDC
                     DILIGADGSRSQVNKEVGLQNLVSINTHWAFLAKGSLTLNQVYELPSQLRRGPIIVFA
                     KGATLYYSLYLPSLQTEDGGHSGSDLKEAFFFWVLSIPRGYSHYRNVAEIPDKFRFCL
                     DFIQDWDPRFKRLLLTAAKDDGTADIYVSPLRASTKPSPRWRSIVERTAEPFRGHPRV
                     WLIGDAIHAMQANRGQGANQALHDCAEVLPELLSLHEAAKTGIPLSTEQIREACSRYE
                     NQMAERSFAWVKKSGGTSIVNLDMDGFLGTVVYYVGRILIPIWSFLHKTFRTETP"
     gene            <56017..>57319
                     /locus_tag="ACHE_40019S"
                     /db_xref="GeneID:66981814"
     mRNA            join(<56017..56078,56128..56359,56431..56706,56764..56883,
                     56940..57103,57157..>57319)
                     /locus_tag="ACHE_40019S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278171.1"
                     /db_xref="GeneID:66981814"
     CDS             join(56017..56078,56128..56359,56431..56706,56764..56883,
                     56940..57103,57157..57319)
                     /locus_tag="ACHE_40019S"
                     /note="COG:Q;
                     EggNog:ENOG410PG1V;
                     InterPro:IPR001128,IPR017972,IPR002401,IPR036396;
                     PFAM:PF00067;
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135977.1"
                     /db_xref="GeneID:66981814"
                     /translation="MLKKINRLKESHSINVYDAFRCLTTEVIMEFAFAKSANMLEENE
                     TTFESWFLTAFDSVAGSLWKLQEWPLVRKSLSFVPINLVSLVDPQIAHVARMLKFAES
                     CLQHYTIHGNKTPHPVVFDHLTSVSYDLKVTEALDVLIAGADTTASTLMAGILHILSD
                     PGIDAKLRQALNETDPAGVKLLELEKIGYLTACVKESLRIGMAVPGRLPRVVPHDLPQ
                     PFVVDNRIIPPGTVVSMSAYTMHTNEDVWGPDARRFNPDRWLQPESKGLDQYLCTFSK
                     GARMCIGQNVAYAEITIVMAYLFRNFKLTLPQNFVPPHRRDMFTMEYSEPGLPIHFSG
                     LGKE"
     gene            <57755..>58875
                     /gene="UXS1_1"
                     /locus_tag="ACHE_40020S"
                     /db_xref="GeneID:66981815"
     mRNA            join(<57755..57793,57843..57982,58038..58228,
                     58283..>58875)
                     /gene="UXS1_1"
                     /locus_tag="ACHE_40020S"
                     /product="UDP-glucuronic acid decarboxylase 1"
                     /transcript_id="XM_043278172.1"
                     /db_xref="GeneID:66981815"
     CDS             join(57755..57793,57843..57982,58038..58228,58283..58875)
                     /gene="UXS1_1"
                     /locus_tag="ACHE_40020S"
                     /note="COG:G;
                     EggNog:ENOG410PIR7;
                     InterPro:IPR016040,IPR036291;
                     PFAM:PF04321,PF01073,PF16363,PF01370"
                     /codon_start=1
                     /product="UDP-glucuronic acid decarboxylase 1"
                     /protein_id="XP_043135978.1"
                     /db_xref="GeneID:66981815"
                     /translation="MTQAKSLTILVTGAAGFLGSNLVDFLLAEGHQVIGVDSFQTGSP
                     KNLKHLEGHEKFTLLNQNIQSPIEGLGHIDQIYNLACPASPIQYQKDPVSTLRTCFRG
                     TENLLELAKERNVRLLHTSTSEVYGDPHLHPQPESYWGNVNPFGPRSCYDEGKRVAEA
                     LCYAYREKGVEVRISRIFNTYGPRMNAADGRVVSNFIAAALDGEELRITGDGKATRSF
                     QYVTDCIKGLYTLMNSDYGDGPVNIGNDGEFTIQELADIVTELVSKVTGKPAVPVTYH
                     SRPVDDPLVRRPQITLAKEKLGWAPMVPLREGLQKTIEWHINES"
     gene            <59204..>60606
                     /locus_tag="ACHE_40022S"
                     /db_xref="GeneID:66981817"
     mRNA            join(<59204..60428,60476..>60606)
                     /locus_tag="ACHE_40022S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278173.1"
                     /db_xref="GeneID:66981817"
     CDS             join(59204..60428,60476..60606)
                     /locus_tag="ACHE_40022S"
                     /note="CAZy:AA7;
                     COG:C;
                     EggNog:ENOG410PJHR;
                     InterPro:IPR006094,IPR036318,IPR016169,IPR016166,
                     IPR016167,IPR012951;
                     PFAM:PF08031,PF01565;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135979.1"
                     /db_xref="GeneID:66981817"
                     /translation="MVRYGRQARGTPLTTPVESSSLTNLPKGVVVMPSDVADVQTALL
                     WAQQHHVDLAIKGGGHSVAGTSSSENGLVIDLSQLKGVSVDTAAKTVTVQGGATWKEV
                     DEAAWEHGLAAVGGTVNHTGVGGLTLGGGYGWLSGLYGLTIDNLLSARVVLADGRLVT
                     ASESENPDLLWGLKGAGYNFGIVVEFTYRAHEQKNPVFAGIISFPPDKLEAVVEQLNE
                     TLLNPDPRGGVMCFLAQPPGAPVPMINVLCYYNGTKEEGEKRYGGLLELEPVVNTLDM
                     VPYSLLNSLQNPMATYGGRKSFKGIFYQPPMDPQFVRTILTDLTAKIQEDEDLKASAL
                     ILEFFDMRKVCEVPSAATAFASRNSTQNGIICLRWSDSSKDSQNRAWAREMQARWKEQ
                     LKTPDTDVPQYINYAEPGDSAVSNIYGANLGKLQEIKAKYDPTNVFHKMHPIEMNAPT
                     A"
     gene            <60883..>61831
                     /locus_tag="ACHE_40023S"
                     /db_xref="GeneID:66981818"
     mRNA            join(<60883..61080,61127..>61831)
                     /locus_tag="ACHE_40023S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278174.1"
                     /db_xref="GeneID:66981818"
     CDS             join(60883..61080,61127..61831)
                     /locus_tag="ACHE_40023S"
                     /note="COG:S;
                     EggNog:ENOG410PVBI;
                     SECRETED:SignalP(1-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135980.1"
                     /db_xref="GeneID:66981818"
                     /translation="MYTTRLSWALLACGSLCTTGAAQATSPDKYTFSELWDLQNVLWK
                     NFVYPNNLKQINATDESVFTPEVEGRVDVTRTFDGRELNAEYIFGLFSEPDHVSLVGV
                     PIEYNITQFVANDDIASATTVFNFNATTFGLVVPVTIDTWIQWNDDGKIVRYDATFRW
                     FDHLIETLFGAMGKKLNTTSEEQIAEHISQVLAQTICKTHEENCHGENQQYESTDQCL
                     DFLLNQTRFGKPFELGRDTLLCREVHELMVKYRPEIHCSHIGPTGGDYCVDDRPYMKV
                     VTEQYFSESWIPFGYGKGQNIWLP"
     gene            complement(<62035..>63135)
                     /locus_tag="ACHE_40021A"
                     /db_xref="GeneID:66981816"
     mRNA            complement(join(<62035..62259,62310..62924,62971..>63135))
                     /locus_tag="ACHE_40021A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278176.1"
                     /db_xref="GeneID:66981816"
     CDS             complement(join(62035..62259,62310..62924,62971..63135))
                     /locus_tag="ACHE_40021A"
                     /note="CAZy:CE16;
                     COG:S;
                     EggNog:ENOG410PK3Q;
                     InterPro:IPR001087,IPR036514;
                     PFAM:PF00657;
                     go_function: GO:0016788 - hydrolase activity, acting on
                     ester bonds [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135981.1"
                     /db_xref="GeneID:66981816"
                     /translation="MRFSLLAFPALAAAWNLEKFTNLVVFGNSYTDESRWDYFASHNG
                     SAPPVGWDEPVSNDTNSGGFSWPRFAANQTGTKLSDYAVSGADCSKEITPRIEPSTKI
                     PYPSVLEYEVPAYLADSASQRPPPESTVYAIWIGTNDIGYEGFLTDSQNTNYTLAAYV
                     NCVYRALDDVYRSGGKYFVLMNLAPLHLAPLYAVPEKGGITGKESLYWPWKSGNITEI
                     SHRMREQVIALNQVFDYRTPYELLIAKRYPGARFAVMDTYSLISDIYYNNTKYPNITN
                     VTGHNNHCDQKTNKCTRLPHPETFLWFDELHPSEQADKIIAEQFIQVVKGESKWASYW
                     "
     gene            complement(<64979..>66312)
                     /locus_tag="ACHE_40024A"
                     /db_xref="GeneID:66981819"
     mRNA            complement(join(<64979..65793,65844..>66312))
                     /locus_tag="ACHE_40024A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278177.1"
                     /db_xref="GeneID:66981819"
     CDS             complement(join(64979..65793,65844..66312))
                     /locus_tag="ACHE_40024A"
                     /note="COG:S;
                     EggNog:ENOG410PIG5;
                     InterPro:IPR001810,IPR036047,IPR032675;
                     PFAM:PF00646,PF12937;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135982.1"
                     /db_xref="GeneID:66981819"
                     /translation="MRSSLTNRLLDLPNELLDIILPFVDASSLACLSRVCRTLQLLVE
                     PHLYHTVSLRNNHRDTISNAIERIPARAEFVRELWIHYHDVADETDAPMQLEALSPTI
                     AQLYNLESLLIKGVNDGGPMSLGLYRYMEQSKKFEDLLLEATMPDSQVLRSLRTCTIN
                     LSEQGSWELAQLDALFLLPTLRRLTIANARMACFTSFSSAEPRSTDLRELILITCDIR
                     PSHLRDILSMPRALEHFTTKGSAWRARSVSGDDRASNLDALRMHASSLVTLDLDLFLD
                     DDRPPIQPLAFIDFVALRRLAIELWIIRGHIEQGILPQKALLPRSIEELTLKCAIQHV
                     DLESYYLEPIYRWLQEGALPELKKIVLETTSPIPNVPKAMFRGGQTVGRAFAAAGVDL
                     SMMEEAPGGYVPFECDCCWYRYRNPGWRLAYTNFY"
     gene            complement(<66532..>67257)
                     /locus_tag="ACHE_40025A"
                     /db_xref="GeneID:66981820"
     mRNA            complement(join(<66532..66826,66884..>67257))
                     /locus_tag="ACHE_40025A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278178.1"
                     /db_xref="GeneID:66981820"
     CDS             complement(join(66532..66826,66884..67257))
                     /locus_tag="ACHE_40025A"
                     /note="COG:O;
                     EggNog:ENOG410PUK6;
                     InterPro:IPR036249,IPR040079,IPR036282,IPR010987,
                     IPR004045;
                     PFAM:PF13409,PF00043,PF13417,PF13410,PF02798;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006749 - glutathione metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135983.1"
                     /db_xref="GeneID:66981820"
                     /translation="MQPLVLHAHATGPNPIKVALALEALHLPYNVQQWQFGDDPKNGV
                     KGETFLHINENGRVPALEDPNTGVTSWESGACLNYVRRVYDKQNILGPVGDTEQDRVD
                     FDKWEYFLLTTLGPMTGQTNWFRHYNGTPNDNALERYAAQTYRCYDVLEGQLKKSGGR
                     SILPGRITAVDYHFEPWVRQYEFAGLSLDKYPNIARWLREITASEEVRQAYTKVKGAA
                     PEFP"
     gene            <67827..>68974
                     /locus_tag="ACHE_40026S"
                     /db_xref="GeneID:66981821"
     mRNA            join(<67827..67850,67898..68341,68387..>68974)
                     /locus_tag="ACHE_40026S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278179.1"
                     /db_xref="GeneID:66981821"
     CDS             join(67827..67850,67898..68341,68387..68974)
                     /locus_tag="ACHE_40026S"
                     /note="COG:Q;
                     EggNog:ENOG410PIBP;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135984.1"
                     /db_xref="GeneID:66981821"
                     /translation="MWAAQLVKYNAPYTLLAVPIPAIRPNELLVRVHAAGFCHSDLQV
                     LQGEFNSPLPMIPSHEPAGVVVEAGDEAAQSWKIGDRVGILNFKNACSKCPDCISTQK
                     RYGTLDARFCRRRETAGFQHDGAFAEYIVADAATTIALPDSVSFEQAAPLLCAGATVY
                     GAIQKVAPFLQRGDSIGIIGIGGLGQLGVQFATALGYRTVAIDNHDSSLQLIDGMPPM
                     LRPEARINSTCTDAKEQIMQFTNDQGLAAAVVCTDPVSVTGWSLELLRIGGVLVPLGL
                     PPDKWQFDSQTLLFRELVIRGNYVAGKQEVEDMMQLVAKQDIKSQLTVVRRDDIPSIP
                     DIYKKRAFRGRLVVQCQ"
     gene            <69329..>70126
                     /locus_tag="ACHE_40027S"
                     /db_xref="GeneID:66981822"
     mRNA            join(<69329..69429,69483..69719,69772..>70126)
                     /locus_tag="ACHE_40027S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278180.1"
                     /db_xref="GeneID:66981822"
     CDS             join(69329..69429,69483..69719,69772..70126)
                     /locus_tag="ACHE_40027S"
                     /note="COG:E;
                     EggNog:ENOG410PWAR;
                     InterPro:IPR024688,IPR018357,IPR011004,IPR001451;
                     PFAM:PF14602,PF00132,PF12464;
                     go_function: GO:0016407 - acetyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135985.1"
                     /db_xref="GeneID:66981822"
                     /translation="MATTEKRPEIIELARGLTGIPWCEEYEKMISGMMYNPTVPQLLE
                     ARHRCRGLAADFNQVDAKKYTYDKIGDVRMEILKKLIGRVGEGTFIEPPFMPDYGCNM
                     IIGKDCFFNWNMTVLDTSLVVIGDRVQFGPNVSIFSAGHDTSVLSRIKFVEFGHPVFI
                     EDDCWIGGSVIILPGVRIGKGSTVGAGSVVTKDIPPYSVAVGNPCKVRKTIPSVEEEV
                     NDPNNPYRDLVR"
     gene            complement(<70189..>72074)
                     /locus_tag="ACHE_40028A"
                     /db_xref="GeneID:66981823"
     mRNA            complement(join(<70189..70306,70367..70719,70770..70828,
                     70873..71057,71102..71390,71438..71660,71708..71867,
                     71914..>72074))
                     /locus_tag="ACHE_40028A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278181.1"
                     /db_xref="GeneID:66981823"
     CDS             complement(join(70189..70306,70367..70719,70770..70828,
                     70873..71057,71102..71390,71438..71660,71708..71867,
                     71914..72074))
                     /locus_tag="ACHE_40028A"
                     /note="COG:E;
                     EggNog:ENOG410PVHK;
                     InterPro:IPR002293;
                     PFAM:PF00324,PF13520;
                     TransMembrane:12
                     (i45-72o78-103i124-156o168-188i200-223o243-264i276-
                     300o336-356i377-399o405-428i440-468o474-493i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135986.1"
                     /db_xref="GeneID:66981823"
                     /translation="MPDIKAKVGTTTTHDKKIVGEALDIDDAALRAQGREAELKRSFS
                     WVGALGLAFGITNSWLGYASCFGLALSYGGGQTAVFGLITAGVVQWIVLLGLAELSSA
                     LTSSGGQYHFTYILAPQPFKDFAAYTVGIINVIAWWVTTASGTFLTAISAFGIARFWH
                     PGFASEQWQIYLCYVLVIIISLIPIFTIPHRHIDYLTKTCMYLSVVGFLMVLAITLVM
                     GNGTYHPSNLVEYHGSSGWGAGPALMMSIGIGEYAFGAAGACTHIAEEIPRPSRRVPL
                     VINLTMVVGMVTAVPWILAAATLIQDMESVQNSFLPSLELFYQATKSKSAATFMQAYM
                     TLLYYSCIPSQWITSSRIAWAFSRDNGLPFSRYWNHIHPRYDIPVRTTLLSAGFCLLY
                     GLLYVASSRAFNTIINTAVIMLNLTYTVPQGILATWGRHRLPRRPFDLGAWGYAVNVF
                     SVLWLIVSGTFFCFPVALPTTVGSMNYSSVVLVGIFVLVRLLWIERRKKFSGPVIDWD
                     MLNASNS"
     gene            <73991..>75815
                     /locus_tag="ACHE_40029S"
                     /db_xref="GeneID:66981824"
     mRNA            join(<73991..74322,74383..75309,75418..75549,
                     75599..>75815)
                     /locus_tag="ACHE_40029S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278182.1"
                     /db_xref="GeneID:66981824"
     CDS             join(73991..74322,74383..75309,75418..75549,75599..75815)
                     /locus_tag="ACHE_40029S"
                     /note="COG:G;
                     EggNog:ENOG410Q1FC;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:11
                     (i112-130o150-169i181-199o205-224i236-256o268-287i344-
                     363o383-402i437-458o464-486i498-520o);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135987.1"
                     /db_xref="GeneID:66981824"
                     /translation="MPEEKMMDKIEDDSSREIGVLEYDSSPDSIAPHERRPSNCDSIE
                     LQRISTYRLQQQQTVGSCHNRPPKDEWLPMGATKPYPPSLPDPENYVVEFEGAEDPMH
                     PQNWPMHNRIFLAALLTFSAYVCAYTSAMFPTAAQGVQNEFGFGQEVAALGTTVYVLG
                     FAAGPTIWAPGSELLGRRGPLLVGIFGFSIFTIACAAAKDTQTIMLARFFSGFFAASP
                     IALVPASLSDLFNSVHRGVAVGMYTMAVFIGPFTAPIIGGFTASNLGWRWTLYIPSFF
                     GFFVLTLLVLLGRETYAPTILVEKATILRRQTRNWGIHARQDELEIDFRELITKNLAR
                     PVRLLFTEPIVFLLTLYMSFIYGLAYALLQAYPVVFGEVYGMPAGVNGLPFIALILGL
                     ILGTLFVLSLQKSYIEKLKDNNNVPVPEFGWTGFTTSIHWMAPTAAGLLVGFGMVTIF
                     MQGWNYLLDSYLNFAASAFAANTMLRSLVGACFPLFAKQMFENLGVQWAGTLIGCIAT
                     LMIPIPIAFRLYGPKLRQKSRLSPTRV"
     gene            complement(<76252..>77536)
                     /locus_tag="ACHE_40030A"
                     /db_xref="GeneID:66981825"
     mRNA            complement(join(<76252..76356,76402..76581,76632..77018,
                     77067..77147,77197..77349,77396..>77536))
                     /locus_tag="ACHE_40030A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278183.1"
                     /db_xref="GeneID:66981825"
     CDS             complement(join(76252..76356,76402..76581,76632..77018,
                     77067..77147,77197..77349,77396..77536))
                     /locus_tag="ACHE_40030A"
                     /note="COG:Q;
                     EggNog:ENOG410PIPS;
                     InterPro:IPR026992,IPR027443,IPR005123;
                     PFAM:PF03171,PF14226;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135988.1"
                     /db_xref="GeneID:66981825"
                     /translation="MTETFSSIPIIDFSRLQDRSTKEQTLAQLRDAIFRVGFLYLTNH
                     GLEELTKRAHAALPDLFALSDETKNKCNMINSPSFVGYTKLGAETTAAKTDWREQFDF
                     GTPEMKPWTEQDPIWYRLEGDSQYPDYSGAKELVNEYITRSAALNTTFLRHVSECLSL
                     PPTTLEEFKGNMDRLKFIKYPQAPHDSQGVGPHKDSTGLFTFLSQDDTGGLQVLNKNG
                     AWIDVPPIENSLVVNIQQGLEAITGGVCAATTHRVKAPTSKTRYSIPFFSAVRLDLTL
                     EGLRSSAAHIVQKIPVSDDRKKRAVDVPSEFLSPLYQCFGEAYLRNRILSHPDVGQKW
                     YPELYEKYSKQVLK"
     gene            complement(<83882..>84356)
                     /locus_tag="ACHE_40031A"
                     /db_xref="GeneID:66981826"
     mRNA            complement(join(<83882..84080,84143..84266,84320..>84356))
                     /locus_tag="ACHE_40031A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278184.1"
                     /db_xref="GeneID:66981826"
     CDS             complement(join(83882..84080,84143..84266,84320..84356))
                     /locus_tag="ACHE_40031A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135989.1"
                     /db_xref="GeneID:66981826"
                     /translation="MEANYLRHMSRERRGHKRQRLSSTAESERQASSQNFEISHENSR
                     GSSSQVADNESTTSSRNLRRVASTNILTIEQRRQELELRDLEAEVKRKEEEVRLKQLQ
                     NEQLELELIVMGRSLAI"
     gene            <88663..>89648
                     /locus_tag="ACHE_40032S"
                     /db_xref="GeneID:66981827"
     mRNA            join(<88663..88865,88915..89069,89125..>89648)
                     /locus_tag="ACHE_40032S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278185.1"
                     /db_xref="GeneID:66981827"
     CDS             join(88663..88865,88915..89069,89125..89648)
                     /locus_tag="ACHE_40032S"
                     /note="COG:S;
                     EggNog:ENOG410Q0BK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135990.1"
                     /db_xref="GeneID:66981827"
                     /translation="MAQQESLDRAAMHPGSQPYSKDELVNIIMESLDKSTEEETLEFH
                     EVDISTAWQTIDELERREGPRLHRTTYDSHQKILKLVIRPCIIHDIHFTWFIHQITLN
                     PSLIVKEKMDLHIFASPRFENFQAPYTASHKEPDQCILPPGKSLPTVVIESGWSETKQ
                     QLYRDRDLWLKGGVGNIQVVIILKWGADPERKVRGDIEVYDLDTLGNIRCISCEVSGN
                     DLDQPMVYLPNTRKAILPCPPAEIAATQRISLTKGQLFGPSLFPARNDDAVVDLDMKE
                     LREIAAMYILQQGYTPM"
     gene            <91977..>92356
                     /locus_tag="ACHE_40033S"
                     /db_xref="GeneID:66981828"
     mRNA            join(<91977..91982,92047..92102,92154..92222,
                     92281..>92356)
                     /locus_tag="ACHE_40033S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278188.1"
                     /db_xref="GeneID:66981828"
     CDS             join(91977..91982,92047..92102,92154..92222,92281..92356)
                     /locus_tag="ACHE_40033S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135991.1"
                     /db_xref="GeneID:66981828"
                     /translation="MANHRYMVCFLTGSGMSRTRTQINHSGGKELPQRRLSAPALTFE
                     GPEDLAGQLEGNDDVVEVRDEGLV"
     gene            complement(<92717..>94284)
                     /locus_tag="ACHE_40034A"
                     /db_xref="GeneID:66981829"
     mRNA            complement(join(<92717..93033,93087..93544,93608..93731,
                     93790..93916,93982..>94284))
                     /locus_tag="ACHE_40034A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278189.1"
                     /db_xref="GeneID:66981829"
     CDS             complement(join(92717..93033,93087..93544,93608..93731,
                     93790..93916,93982..94284))
                     /locus_tag="ACHE_40034A"
                     /note="COG:S;
                     EggNog:ENOG410PKUF;
                     InterPro:IPR001077,IPR036388,IPR016461,IPR029063,
                     IPR036390;
                     PFAM:PF00891;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0008171 - O-methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135992.1"
                     /db_xref="GeneID:66981829"
                     /translation="MTGLNATQNGNGDASSHVDDNANGTANDHSKGTSPFVKDQIPIS
                     PNAPQEVPGLLSRIVSHGDAFLSADPDARLKLLEDARALVNALETPRESMIRYCWAQS
                     TIYAAIETGVDINLFHKLSRSDRPKSAAELAENTGCDPVMLSRLLKHLAAMGVIAEAG
                     QDLYRRTGFTIALCSEKYSDGFPLMTRRFTAGIHALPAYLKKNGYRNPTNPKDTALQL
                     GFNTNLHFFDITEQDPVTARQFNNHMSVYSLGRPSWMDVGFFPVQERLIEDSKITNDD
                     VLLVDMGGSIGHDLSEFKRKWPDAPGRLILQDLPTVVCHAQGLDPAIQVTPHDFFTPQ
                     PVKGARAYYMHSILHDWPDDMCRKILANLIPSLRPGYSKVLINENVIPDTGAYWETTS
                     LDLIMMAIGSGERTRRHWHALLESAGLKIVNIWTAPAQKGVESLIECELV"
     gene            <99477..>101090
                     /locus_tag="ACHE_40035S"
                     /db_xref="GeneID:66981830"
     mRNA            <99477..>101090
                     /locus_tag="ACHE_40035S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278190.1"
                     /db_xref="GeneID:66981830"
     CDS             99477..101090
                     /locus_tag="ACHE_40035S"
                     /note="COG:S;
                     EggNog:ENOG410PPP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135993.1"
                     /db_xref="GeneID:66981830"
                     /translation="MSATWSNGSGPAQTMEPSSDSCDTALPPIQSHNMSLSRRRPGYR
                     PDSTAIIGNFRGMQRPGAPFHTTHDPVSNMISRGPGMHRRSESTLRTVMRKIFHRKRR
                     SQTDGLEEDPVMESYGPRPSNSLPRKSESRSRKDAQAISLGTKNSPLQKDLRPTLMDL
                     NKLDPLPVHRRRNTLPSLVFSEEECHGITHEEDNGPEAGKEPENLRVRRALRNKRRSR
                     STNSLRRKANEHRMSPIQWTRRSTEITYLGSPAFGAVSDSELSFRPPTRNTVASLSKP
                     DEPCDAPEANDAEQQTEVESVPPSVGNLVHTMQNHDNLTIEQRVTTLEVKLMDLEFAI
                     ARLQDKRGDFSPTAKSASKKSSTPDGRQPAPLFSPATGSGNSPRISEDRPVSTGTVRP
                     NLHRSRTYRPPSSPPHIDGASSISIEQYSALVTLLRREQSARRNLEGQVSSLRDDVQQ
                     LQKMARGSMSMSMGTMYPIQSTDSVEPYHLRPVDSHSSPQSSYIPRTERIIPHPHYDS
                     GTGTDLERDSKNDLALRKLERRIEIAGMI"
     gene            complement(<101510..>102503)
                     /gene="GPI11"
                     /locus_tag="ACHE_40036A"
                     /db_xref="GeneID:66981831"
     mRNA            complement(join(<101510..101666,101720..102006,
                     102063..>102503))
                     /gene="GPI11"
                     /locus_tag="ACHE_40036A"
                     /product="glycosylphosphatidylinositol (GPI) anchor
                     assembly protein"
                     /transcript_id="XM_043278191.1"
                     /db_xref="GeneID:66981831"
     CDS             complement(join(101510..101666,101720..102006,
                     102063..102503))
                     /gene="GPI11"
                     /locus_tag="ACHE_40036A"
                     /note="COG:G;
                     EggNog:ENOG410PMW8;
                     InterPro:IPR009580;
                     PFAM:PF06699;
                     TransMembrane:4 (i142-173o179-200i220-241o247-268i);
                     go_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA];
                     go_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycosylphosphatidylinositol (GPI) anchor
                     assembly protein"
                     /protein_id="XP_043135994.1"
                     /db_xref="GeneID:66981831"
                     /translation="MTSTPPSPPHRTGTSSSSSSNPIQYSQANASAQAPPPKPPAPAV
                     SILPGQLARVYSFAHPVLLLALLTVRFGKFVEDPVGELLGDLPVLAGLQVLYAVLCLP
                     PAGAPSLKAGGGEASSSGEGTFLRPGRVGLRRKHAKEVGISVKVVPALIALTLTTLLA
                     TPILSILLVLFGAPLTTHNLETILCAAHMAVLSATALVYVHGVDGSTWREVWGVARPA
                     DAVWGGALGTGVGAWFGAVPIPLDWDRPWQAYPITILTGAYIGYAVGSLISRSSWLFG
                     KRIQFTPEVEEDMDKKTE"
     gene            complement(<103278..>106057)
                     /locus_tag="ACHE_40037A"
                     /db_xref="GeneID:66981832"
     mRNA            complement(join(<103278..105439,105501..105653,
                     105916..>106057))
                     /locus_tag="ACHE_40037A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278192.1"
                     /db_xref="GeneID:66981832"
     CDS             complement(join(103278..105439,105501..105653,
                     105916..106057))
                     /locus_tag="ACHE_40037A"
                     /note="COG:T;
                     EggNog:ENOG410PGBJ;
                     InterPro:IPR000198,IPR008936;
                     PFAM:PF00620;
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135995.1"
                     /db_xref="GeneID:66981832"
                     /translation="MVTGKPEPFQAFAPTPSQPVAFSPPSKRDLTSWWRQFKRNTRKE
                     DAKDVPRGIFGIPLNVSIKYANVAISLTNDNGESFIYGYVPIVVAKCGVFLKEKATDV
                     EGIFRLNGSAKRIKDLQEIFDSPERYGKGLDWTGYTVHDAANVLRRYLNQLPEPIVPL
                     DFYEQFRQPLRTYQRQVQGLAPSNEAEIFDHAKAVAAYQQLIRELPPLNKQLLLYILD
                     LLAVFASKSEQNRMTSANLSAIFQPGLLSHPQHDMSPDEYKLSQDVLIFLIENQDHFL
                     FGMNGTAADEETVKAVESGGLAPRAPTTTQTSIRRSVSSASGGADSFRKYGSLRRNVS
                     VSSKNSRNSNATASPSTPSSLSGVHRSNTLPSKMAPPMQRRAVQEPTTGNATAPAPSA
                     KPSPSPSRTPPSTESNNHIRIQAPSGPDGSAVIGTSGMAYVHSATHGPIPKRFAGHVT
                     VPEPQPPREASVSPPPPTVVTPTKERKLSNFFSKSPPPSGEQRQPNRLRKKRSPGSVC
                     ESAQSSSQSLQGVTADNIPRTVPSENGVAANGAQDESQPNNQENGTSQSENGQTQTTD
                     TSLKPRSRTPSMRSRSSFTDQSDLEQLDETARVDRKEYRQSWRFPRSSKRSSEQIGLV
                     SPPLGATNPNATRSASSIGSWHQASRSSPSDLQQFVNDPANQPLSLDAELNNNGSPKE
                     IEPERRSLFGKFKAKVGLSRDGKDTDSLRDRTRSPVNSDTENSVSNLALSPPPSKVQS
                     NGSKSAPAEANGPDESTQTPVSPLPGSGMPPAIPEEPGSPESPVAPAFVEQNKEAVTS
                     APEPVPAQTEPATEPPKALN"
     gene            <107062..>107445
                     /gene="TIM9"
                     /locus_tag="ACHE_40038S"
                     /db_xref="GeneID:66981833"
     mRNA            join(<107062..107069,107129..107198,107254..>107445)
                     /gene="TIM9"
                     /locus_tag="ACHE_40038S"
                     /product="protein transporter tim9"
                     /transcript_id="XM_043278193.1"
                     /db_xref="GeneID:66981833"
     CDS             join(107062..107069,107129..107198,107254..107445)
                     /gene="TIM9"
                     /locus_tag="ACHE_40038S"
                     /note="BUSCO:EOG09265L8N;
                     COG:U;
                     EggNog:ENOG410PQZ5;
                     InterPro:IPR004217,IPR035427;
                     PFAM:PF02953"
                     /codon_start=1
                     /product="protein transporter tim9"
                     /protein_id="XP_043135996.1"
                     /db_xref="GeneID:66981833"
                     /translation="MDGLNASEQRELASRMERKQLKEFMGMYSKLVQRCFDDCVNDFT
                     TRSLASREEGCVLRCVDKYLKGSARLNERFQEQNAAMMQNAQGGR"
     gene            <108183..>109537
                     /gene="FDH1_1"
                     /locus_tag="ACHE_40039S"
                     /db_xref="GeneID:66981834"
     mRNA            join(<108183..108203,108267..108281,108328..108442,
                     108501..109274,109323..>109537)
                     /gene="FDH1_1"
                     /locus_tag="ACHE_40039S"
                     /product="formate dehydrogenase (NAD+)"
                     /transcript_id="XM_043278194.1"
                     /db_xref="GeneID:66981834"
     CDS             join(108183..108203,108267..108281,108328..108442,
                     108501..109274,109323..109537)
                     /gene="FDH1_1"
                     /locus_tag="ACHE_40039S"
                     /note="BUSCO:EOG09262PIH;
                     COG:Q;
                     EggNog:ENOG410PVH9;
                     InterPro:IPR013154,IPR013149,IPR002328,IPR036291,
                     IPR014183,IPR011032;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0051903 - S-(hydroxymethyl)glutathione
                     dehydrogenase activity [Evidence IEA];
                     go_process: GO:0006069 - ethanol oxidation [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="formate dehydrogenase (NAD+)"
                     /protein_id="XP_043135997.1"
                     /db_xref="GeneID:66981834"
                     /translation="MASTVGQTITCKAAIAWGAGEPLSIEDVEVAPPKAHEVRIQIHH
                     TGVCHTDAYTLSGKDPEGAFPIVLGHEGAGVVESVGEGVTSVKPGDYVVALYTPECRE
                     CKFCKSGKTNLCGKIRATQGKGVMPDGTSRFKARGQDILHFMGTSTFSQYTVVADISV
                     VAVTPKISTDRSCLLGCGITTGYGAAVVTAGVEEGSNIAVFGAGCVGLSVIQGAVKNK
                     AGKIIVVDVNDGKEAWARKFGATDFVNPTKLNGKTIQEQLIDMTDGGCDYTFDCTGNV
                     GVMRAALEACHKGWGESIIIGVAAAGQEISTRPFQLVTGRVWKGCAFGGIKGRSQLPG
                     LVDDYLNGQLMVDEFITHRQPLSNINGAFEQMKEGDCVRCVVDMS"
     gene            <109958..>111013
                     /locus_tag="ACHE_40040S"
                     /db_xref="GeneID:66981835"
     mRNA            <109958..>111013
                     /locus_tag="ACHE_40040S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278195.1"
                     /db_xref="GeneID:66981835"
     CDS             109958..111013
                     /locus_tag="ACHE_40040S"
                     /note="COG:E;
                     EggNog:ENOG410PI5H;
                     InterPro:IPR036052,IPR027278,IPR005965,IPR001926;
                     PFAM:PF00291;
                     TransMembrane:1 (o198-221i);
                     go_function: GO:0008660 -
                     1-aminocyclopropane-1-carboxylate deaminase activity
                     [Evidence IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0009310 - amine catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043135998.1"
                     /db_xref="GeneID:66981835"
                     /translation="MSTLTLPEPLSSIPRTPLLLGPSPIHPLPRISADLGGNATIYAK
                     RDDLNSAYAYGGNKTRKLEYLLADALSQSADTLVSIGGVQSNHTRQVAAVAARSGLKA
                     ALVQEKWVDWEDGGYESVGNIQLSRLMGADVRLEREEGFGIQHKGTVKGVIEDIQKNG
                     GKPYYIPAGASDHPLGGLGFARWAFEVRQQEKEMGVEFGTVIVCAVTGSTFAGMIAGF
                     KLIEKLEPELPKKKVIGIDGSATPAQTKEQVLRIARNTAKKIGLGEEDITEEDVILDE
                     RYHAGTYGIPDKQTWEAIEYAARMEAFITDPVYEGKSFAGMVDMIRKGEIQGNVLYAH
                     LGGQLALNAYSQLGATK"
     gene            complement(<111130..>112771)
                     /gene="INO1"
                     /locus_tag="ACHE_40041A"
                     /db_xref="GeneID:66981836"
     mRNA            complement(join(<111130..112027,112074..>112771))
                     /gene="INO1"
                     /locus_tag="ACHE_40041A"
                     /product="Myo-inositol-1-phosphate synthase"
                     /transcript_id="XM_043278196.1"
                     /db_xref="GeneID:66981836"
     CDS             complement(join(111130..112027,112074..112771))
                     /gene="INO1"
                     /locus_tag="ACHE_40041A"
                     /note="COG:I;
                     EggNog:ENOG410PGB6;
                     InterPro:IPR036291,IPR013021,IPR002587;
                     PFAM:PF01658,PF07994;
                     go_function: GO:0004512 - inositol-3-phosphate synthase
                     activity [Evidence IEA];
                     go_process: GO:0006021 - inositol biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0008654 - phospholipid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Myo-inositol-1-phosphate synthase"
                     /protein_id="XP_043135999.1"
                     /db_xref="GeneID:66981836"
                     /translation="MAPHANSDVANGAVNGSVSNAPLFTVNSPNVVYTDNEIKSQYAY
                     HTTDISRTADNKLVATPKATNYNFKVDRKVGKLGVMLVGWGGNNGSTVTAGIIANRDG
                     LVWETREGRQAANYYGSVVMSSTVKLGTDAKTGEEVNVPFHDMLPMAHPNDLVVGGWD
                     ISSMNLADSMDRAQVLEPGLKQLVRKEMSTMKPLPSIYYPDFIASNQEDRADNVIEGD
                     KACWAHVERIQSDIRNFKAQNGLDKVIVMWTANTERYADIVPGVNDTADNLLEAIKTG
                     HLEVAPSTVFAVASILENVPFINGSPQNTFVPGALDLAEKRGAFIGGDDFKSGQTKMK
                     SALVDFLINAGIKLTSIASYNHLGNNDGKNLSSQKQFRSKEISKSNVVDDMVAANKLL
                     YAEDEHPDHTVVIKYMPSVGDNKRALDEYYAEIFMGGHQTISLFNICEDSLLASPLII
                     DLVLITEIMTRIGWKTDEAAEYKGFHSILSVLSYMLKAPLTPPGTPVVNALGKQRSAL
                     INIFRACVGLQPESDMTLEHKLF"
     gene            <115043..>117509
                     /locus_tag="ACHE_40042S"
                     /db_xref="GeneID:66981837"
     mRNA            join(<115043..115142,115201..115311,115363..>117509)
                     /locus_tag="ACHE_40042S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278197.1"
                     /db_xref="GeneID:66981837"
     CDS             join(115043..115142,115201..115311,115363..117509)
                     /locus_tag="ACHE_40042S"
                     /note="COG:T,Z;
                     EggNog:ENOG410PM47;
                     InterPro:IPR001781,IPR034962;
                     PFAM:PF00412;
                     go_process: GO:0035023 - regulation of Rho protein signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136000.1"
                     /db_xref="GeneID:66981837"
                     /translation="MAALDAGILPTIKCSNCGVGVDISAMGDHVCVNDRGPSPTPPAP
                     PPKSDPTPPPGYSWEKPLPRIDPLVANRPFLQATGNNDEDASNSNQSPPYGGLQRSNT
                     IPISSEPPSPEWGNGIPAFPLPRSMSSRRPGALANMQPLGSAPPISIPHSHYADMDQG
                     PMSARPGPIERERSLPPPPPLPKDDDVVDDVADNVAPLPEFFHRRGDSVDSRSSYGTA
                     SIKYDTGSKRSTMMSSRRPSFGSMARDPQAFLDDGPLSRSAPLETLTENPTHQEYGEE
                     DTVYHNEQHDSSYSGFDFGISEKSNREAAIHRPSDSEQLDLSSFHSRSDSRSAQLYSQ
                     RSPSQSSHSPAPSVDRFRDSREPFTGQYHGVHQPSGSNHYLHPNNLSIDEGNRRKNSD
                     ASEGGSSVSNFARALGLDDAGHSTESSTVSSEFSPSESRSGTSLSSLPSEASLSRRKA
                     SEASRLGPVVEENQHHYDQPSSVPRSLMLEEASQAGSPLEPPKIPHFLQPPDSPTDPA
                     LSQGSLSLVSDQQSPRSENSVDSPSDEQSPVSPAKERPEAIALAPPRAPRSKGRCRGC
                     GEAIFGKSVSSADGRLTGRYHRDCFACCYCRIPFQTADFYVLQNKPYCAQHYHELNGS
                     LCSTCNSGIEGQYLETDERMGRGPSDRRKFHPDCLTCRTCNVNLKGEYFEWNGQVYCE
                     RDARRAAASVPPPRFRRPTMPSSPLSRPPDPYGPPGPMGPGPMGRPPFPPGPGRRLPA
                     PMGPAMGPDLLGPPGAFGPAYGPAYGPPPGAKRFPERRTTRLMMI"
     gene            complement(<117895..>119050)
                     /locus_tag="ACHE_40043A"
                     /db_xref="GeneID:66981838"
     mRNA            complement(join(<117895..118470,118533..118712,
                     118771..118925,118978..>119050))
                     /locus_tag="ACHE_40043A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278199.1"
                     /db_xref="GeneID:66981838"
     CDS             complement(join(117895..118470,118533..118712,
                     118771..118925,118978..119050))
                     /locus_tag="ACHE_40043A"
                     /note="COG:C;
                     EggNog:ENOG410PH8J;
                     InterPro:IPR030395,IPR017946;
                     PFAM:PF03009;
                     TransMembrane:1 (o291-310i);
                     go_function: GO:0008081 - phosphoric diester hydrolase
                     activity [Evidence IEA];
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136001.1"
                     /db_xref="GeneID:66981838"
                     /translation="MIFDMEEQHQKNPPSQEKPSPDSTTTDAPQIIAHRGFKRKYPEN
                     SLSAFKGAVEAESNAIELDLALSKDGVVVISHDASLKRCFGVKKQVANCDYEYLKTVT
                     MIQEPHEPVPRLYELLQYLAQPEAAHIWAFLDVKLTNDPVAIIPQIAKTIASVPPAEN
                     KPWHTRLILGCWSSAFIPQCIAHLPEFPLSLVCFDLHAARRFFPLPNLVAYNVNQQVL
                     MGPLGRGFLEDAHKAEKKVFVWTPNDESAIRWCIRKRVDGVVTDDPELCRQLVGTTDP
                     SAASDAITFSQKTEILTISLLVTLFGWLFRLKFLPKVKVDVPPKAKPPSVH"
     gene            <120837..>121994
                     /locus_tag="ACHE_40044S"
                     /db_xref="GeneID:66981839"
     mRNA            join(<120837..120975,121031..121477,121528..>121994)
                     /locus_tag="ACHE_40044S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278200.1"
                     /db_xref="GeneID:66981839"
     CDS             join(120837..120975,121031..121477,121528..121994)
                     /locus_tag="ACHE_40044S"
                     /note="COG:Q;
                     EggNog:ENOG410PIQ2;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240,PF13602;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136002.1"
                     /db_xref="GeneID:66981839"
                     /translation="MSVRKWVTTLKGLDTLHLQEDIIPTPGKGEVLVEIRAVSLNYRD
                     TEVCNGEYTHHKSIGQDDSIVPCSDSCGVVIQVGDGVTTLKTGDRVLSPFLPDHLTGQ
                     VTEKELASGLGFPLDGVLASHRVFSACGLVKAPEYLSNVEAATLPIAPVTAWMSINGM
                     RPMGQDGGAGEYVLLQGTGGVSIAGLQIAKAAGAKVIITSSSDEKLAQAKALGADYTI
                     NYRTNPDWEKIVMEMTNNHGADIVLETGGAKTLKKSFDCIAFGGLIDCIGYLSGKVDE
                     PDDRTNVNVLALRRNVTLKGIINGPKDRFEEMIGFYEKHQIRPVVNRVFPFDQAKEAF
                     NFLYSGSHFGKVVITV"
     gene            complement(<122024..>122647)
                     /locus_tag="ACHE_40045A"
                     /db_xref="GeneID:66981840"
     mRNA            complement(<122024..>122647)
                     /locus_tag="ACHE_40045A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278201.1"
                     /db_xref="GeneID:66981840"
     CDS             complement(122024..122647)
                     /locus_tag="ACHE_40045A"
                     /note="COG:S;
                     EggNog:ENOG410QDZM;
                     InterPro:IPR014710,IPR011051,IPR013096;
                     PFAM:PF07883;
                     SECRETED:SignalP(1-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136003.1"
                     /db_xref="GeneID:66981840"
                     /translation="MFLPTILLSSISILNQITTTMATNTDTKQLSPLPKPTRFITSHN
                     SDAKSVVHTEDAATWTNLGDEMGFFVPYTTSQFPVDMNNETDIAQNREVTSSGKLGLV
                     NPGGTVCRYVDFAPGNKPVMHQTVSLDYGIVLEGEVEMILDSGEKKLLKRGDVAIQRG
                     TMHAWKNPSQTEWARLLFVLQASENVVINGKALREDIPSDANIQPSQ"
     gene            complement(<123052..>124227)
                     /locus_tag="ACHE_40046A"
                     /db_xref="GeneID:66981841"
     mRNA            complement(<123052..>124227)
                     /locus_tag="ACHE_40046A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278202.1"
                     /db_xref="GeneID:66981841"
     CDS             complement(123052..124227)
                     /locus_tag="ACHE_40046A"
                     /note="COG:G;
                     EggNog:ENOG410PJ5Z;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i12-32o38-58i70-92o104-124i173-192o212-231i238-256o268-
                     287i299-320o332-354i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136004.1"
                     /db_xref="GeneID:66981841"
                     /translation="MLGKKFGPARVLPILMFTFGSFTLLSAAAYNFGGLFAIRWFLGM
                     AESAFLPLVIYYLTTFYRRGELARRLAIFYAASNIANAFSGLIAFGVFQIKNSNIPNW
                     RYLFIIEGGVTVLLAIFAYWYLPRSAAEAKFLSEEEKALAFHRIQVDSSTVVNEPFRF
                     RDAIRIFLHPSTYVFLCLEICTGVPIQAVNLFLPQIVQRLGFSTVKTNLYTVAPNVTG
                     AVMCVILAFASDFTRLRSPFIALAYLLTFSGFMIYASIDNVHTQLHLAYFATFMMTWG
                     TSAPSVLLSTWYNNNIAHEGRRVLLTSIGVPLANLMGLVSSNVFRSEDKPKYLPALIT
                     VGVFGATGAILAGLLGGYMWMDNVRRDRRDGVKARAIDVPTERLRDGPAAAEFRWFL"
     gene            complement(<124962..>126179)
                     /locus_tag="ACHE_40047A"
                     /db_xref="GeneID:66981842"
     mRNA            complement(<124962..>126179)
                     /locus_tag="ACHE_40047A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278203.1"
                     /db_xref="GeneID:66981842"
     CDS             complement(124962..126179)
                     /locus_tag="ACHE_40047A"
                     /note="COG:F;
                     EggNog:ENOG410PGQ0;
                     InterPro:IPR009486;
                     PFAM:PF06516;
                     SECRETED:SignalP(1-22);
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136005.1"
                     /db_xref="GeneID:66981842"
                     /translation="MRLPSLSAGLLAVSSLWTAVSATPGHGVQLTGKHKITPKVFIVS
                     MFAPEAEAWWDIPEFNLLAHNITVPGLSPLFPDVHCTADYSVCQLVTGEGEINAAVTL
                     SSLLFSPIFDLTHTYFFVAGIAGVNPKVTTINSATFARYAVQVALQYEIDLRELPDNW
                     TTSYFPQGAQKPFEYPTSIYGTEVFELNADLRSIAASFARRANLSDSTAAQEYRAKYT
                     TDDEVYAAGTKAPSVVECDVTTTDVYFSGSLLSDAFDKTTSVLTNGTGVYCSTAQEDN
                     ATLEALLRAAKHNLTDFSRIIVMRTGSDFERGYEGQSALDNLLYADQGAFEPAVQNLY
                     NAGVQVVQGILRGWDTTFAAGVKPSNYIGDIFGTLGGKPDFGPGSEQAKEDAGALTKR
                     GMGLAKRSRSVRR"
     gene            <128096..>128485
                     /locus_tag="ACHE_40048S"
                     /db_xref="GeneID:66981843"
     mRNA            <128096..>128485
                     /locus_tag="ACHE_40048S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278204.1"
                     /db_xref="GeneID:66981843"
     CDS             128096..128485
                     /locus_tag="ACHE_40048S"
                     /note="COG:S;
                     EggNog:ENOG410PY06;
                     InterPro:IPR027843,IPR032710;
                     PFAM:PF14534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136006.1"
                     /db_xref="GeneID:66981843"
                     /translation="MPSIHERIRDDLLVRERALWTALTSADPAPAIEKLSSPEANLIF
                     PQMPIVTLDGSDPSLQDLVQPPFHRFDSFSLGDARTIILDLMAGVITYKITATKGNEV
                     YNATGSSTWSQGSDGEWKLACHQETLL"
     gene            <132153..>133829
                     /locus_tag="ACHE_40049S"
                     /db_xref="GeneID:66981844"
     mRNA            join(<132153..132252,132314..132559,132609..132902,
                     132952..133473,133518..133691,133741..>133829)
                     /locus_tag="ACHE_40049S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278205.1"
                     /db_xref="GeneID:66981844"
     CDS             join(132153..132252,132314..132559,132609..132902,
                     132952..133473,133518..133691,133741..133829)
                     /locus_tag="ACHE_40049S"
                     /note="COG:U;
                     EggNog:ENOG410Q2XK;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690,PF06779;
                     TransMembrane:12
                     (i21-45o65-82i94-121o127-146i153-176o182-202i262-279o299-
                     319i331-347o362-381i410-432o438-458i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136007.1"
                     /db_xref="GeneID:66981844"
                     /translation="MTSASLSQGPAWGQRWRSSTAFIVATMAMALFTDSFLYTFVVPI
                     LPYMIETRIGLDPEYTQRVSFALLSQSAFVSVIASPIIGHYADKSSTKRVWLLSSLVV
                     CLVGTFALAVATSAVVVFIGRLVQALASSVMWVIGFSTIADFVKQEHLGKVYGIISVA
                     VAVGTSVGPMLSGILFDFGGYWVAWSSAFIVIVLDILLRLLMLERPKDKGKKPATTDV
                     DHLPDPENAPLLQPQPPEVIPIQLRMRERTGLRFYITLFQHRKFVAGAVSYLVFAILT
                     ASFDTTLPLHVRDVFGWGSTQTGLLFVALQSPGIPLSPIVGWIKDRLGTRHPITVGFL
                     VLAPLTWLLGVPGDERFPWANEGDRGHIIYSVTVALIGVTICALNGAGTMEATMAVDE
                     IESKQPGIFGPNGGYSRALSISSMGWTLGSFIGPLLSGVLVEEGGYYAMCCVLALICL
                     ASSINAYVNLSATWDPGDEVQEQS"
     gene            complement(<133944..>135066)
                     /locus_tag="ACHE_40050A"
                     /db_xref="GeneID:66981845"
     mRNA            complement(join(<133944..134408,134458..134543,
                     134593..134678,134729..>135066))
                     /locus_tag="ACHE_40050A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278206.1"
                     /db_xref="GeneID:66981845"
     CDS             complement(join(133944..134408,134458..134543,
                     134593..134678,134729..135066))
                     /locus_tag="ACHE_40050A"
                     /note="CAZy:PL1;
                     COG:G;
                     EggNog:ENOG410PI0Z;
                     InterPro:IPR012334,IPR002022,IPR011050;
                     PFAM:PF00544;
                     SECRETED:SignalP(1-21)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136008.1"
                     /db_xref="GeneID:66981845"
                     /translation="MANFRFLAALATGYLASLALAAPTPTVNHVKRASVSDVAHGYAS
                     LNGGTTGGVGGTTTTVSSYAEFSSAVSGDDAKIIYVDGTIKETADQVKVGSNTSIIGK
                     DSSAMLEGFGIMVKEASNVIIRNLGVKKVLADNGDALAVQKSTNVWIDHCDVSSDRDH
                     DKDYYDGLVDLTHAADYVTVSNTFIHDHWKASLVGHSDSNGDEDKGHLRITFNNNYWY
                     NLNSRGPSFRFGTGHLYNNYFEDVSDGINTRQGAQLLVESNQWVNPKKPLYSTDDGYA
                     VAKDNDFGDGENAAEEGTLTSVPYDYDLVGPGKVRDAVYGTAGQTLSF"
     gene            complement(<138127..>138524)
                     /locus_tag="ACHE_40051A"
                     /db_xref="GeneID:66981846"
     mRNA            complement(join(<138127..138407,138458..>138524))
                     /locus_tag="ACHE_40051A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278207.1"
                     /db_xref="GeneID:66981846"
     CDS             complement(join(138127..138407,138458..138524))
                     /locus_tag="ACHE_40051A"
                     /note="COG:S;
                     EggNog:ENOG410Q1S1;
                     TransMembrane:1 (o6-28i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136009.1"
                     /db_xref="GeneID:66981846"
                     /translation="MLLLRPLPILSLAILAIFALAIAGLFFYRRADHDESHCASCIGY
                     ALKVNSMISDAGDNVRGNTQFFRYAVDKACAGRLLDGGRCLEYRRGFLRNKTRFAYRI
                     EDPYAACRAISAC"
     gene            <140573..>141127
                     /locus_tag="ACHE_40052S"
                     /db_xref="GeneID:66981847"
     mRNA            <140573..>141127
                     /locus_tag="ACHE_40052S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278208.1"
                     /db_xref="GeneID:66981847"
     CDS             140573..141127
                     /locus_tag="ACHE_40052S"
                     /note="COG:S;
                     EggNog:ENOG410PYU2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136010.1"
                     /db_xref="GeneID:66981847"
                     /translation="MTDCTTPPLASNIFSLVRNPDQPTLDNPNSNPPIEDFQTGFEGY
                     SDTDLRQYAKQRTTDLRCQRNHSLVAEWIAVLDQRSVAEGNVVMHHYMEKSAWEGMLQ
                     DAEEEVFIPGQADVNEAKDSIWWMWRVPFSSAFNLWNSVESLEWEGLELYSRFEYLGE
                     DGVVQTHIPDQIVSGGIVDPKNMI"
     gene            complement(<144296..>145764)
                     /gene="URG1"
                     /locus_tag="ACHE_40053A"
                     /db_xref="GeneID:66981848"
     mRNA            complement(join(<144296..144301,144353..144634,
                     144687..145643,145693..>145764))
                     /gene="URG1"
                     /locus_tag="ACHE_40053A"
                     /product="uracil-regulated protein 1"
                     /transcript_id="XM_043278210.1"
                     /db_xref="GeneID:66981848"
     CDS             complement(join(144296..144301,144353..144634,
                     144687..145643,145693..145764))
                     /gene="URG1"
                     /locus_tag="ACHE_40053A"
                     /note="COG:H;
                     EggNog:ENOG410PG38;
                     InterPro:IPR036144,IPR000926,IPR022163,IPR032677;
                     PFAM:PF00925,PF12471;
                     go_function: GO:0003935 - GTP cyclohydrolase II activity
                     [Evidence IEA];
                     go_process: GO:0009231 - riboflavin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uracil-regulated protein 1"
                     /protein_id="XP_043136011.1"
                     /db_xref="GeneID:66981848"
                     /translation="MTAEDTPISPVQAPNSTSYSKHIVLTTYPGQSGIDPVPLTWGAA
                     DAKSRGPVVVSRSGPLLKRRNAMGAHGGSYSIYNALAIAAGDLPPDFRPDFRNSEPTF
                     NFPWQPAWADKTKIVSMDPYGHDIVNQFREELDAGWDIRPTMAITRANMKLAEIEEAV
                     RKGDLEVDGNIVVDESGEVRVTKVAVEPVWYLPGVAERFGVDEGTLRRTLFEHTGGSY
                     PELITRPDLKIFLPPIGGQTVYIFGPPERVSDENVKLALRIHDECNGSDVFQSDICTC
                     RPYLAFGIREAIREAQNGGSGVVIYFRKEGRALGEVIKYLVYNARKRGGDTADKYFTR
                     TENIAGVRDMRFQALMPDILHWLGIKKIDRMLSMSNMKHDAIVQTGIKILERIPIPED
                     MIPSDSRVEIDAKINAGYFTTGKQYTMEDLANVRGRGWEKWEDVTH"
     gene            complement(<146598..>148339)
                     /gene="DBP5"
                     /locus_tag="ACHE_40054A"
                     /db_xref="GeneID:66981849"
     mRNA            complement(join(<146598..146870,146923..147123,
                     147173..147410,147461..147958,148011..148188,
                     148252..>148339))
                     /gene="DBP5"
                     /locus_tag="ACHE_40054A"
                     /product="RNA helicase required for poly(A+) mRNA export"
                     /transcript_id="XM_043278211.1"
                     /db_xref="GeneID:66981849"
     CDS             complement(join(146598..146870,146923..147123,
                     147173..147410,147461..147958,148011..148188,
                     148252..148339))
                     /gene="DBP5"
                     /locus_tag="ACHE_40054A"
                     /note="BUSCO:EOG09261MPU;
                     COG:A;
                     EggNog:ENOG410PGTJ;
                     InterPro:IPR027417,IPR001650,IPR014014,IPR014001,
                     IPR011545,IPR000629;
                     PFAM:PF00270,PF00271;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="RNA helicase required for poly(A+) mRNA export"
                     /protein_id="XP_043136012.1"
                     /db_xref="GeneID:66981849"
                     /translation="MSAEQPTEAPPAGGSLADRVSKPEGSEPAAPAEKIDWSESVSPN
                     DGASELQNGSNLQEPEYNVEVKLSDLQDDPNNPLYSVKNFSDLGLDENILKGLSAMNF
                     RKPSKIQERALPLLLSNPPKNLVGQSQSGTGKTAAFVLNILSRLDLSSEQMQKTPQAL
                     ILAPTRELARQIVGVVQVMGQFLTGLLIGTAVPADSNSRPTKLEASVVVGTPGTVMDM
                     IKRRTMVAARLKVLVLDEADNMLDQQGLGDQCIRVKGLLPRDVQVVLFSATFPAHVHR
                     YASKFAPSANEITLQHEELTVEGIKQLYIDCSNDEDKYQTLVNLYGLLTVGSSIIFVK
                     TRVYASEIEKRMIQEGHSVASLTGGIEGSQRDAVIDEFRSGKAKVLITTNVLARGIDV
                     STVSMVINYDIPEIHQPGKQEKQADYQTYLHRIGRTGRFGRVGVSISFVSNRDEWNML
                     MQIGKYFNVDIQRLDTTDWDEVEETIKKTIRNPRSNATFGK"
     gene            <148928..>151365
                     /locus_tag="ACHE_40055S"
                     /db_xref="GeneID:66981850"
     mRNA            join(<148928..148972,149029..149055,149105..149632,
                     149677..149757,149812..150934,150983..>151365)
                     /locus_tag="ACHE_40055S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278212.1"
                     /db_xref="GeneID:66981850"
     CDS             join(148928..148972,149029..149055,149105..149632,
                     149677..149757,149812..150934,150983..151365)
                     /locus_tag="ACHE_40055S"
                     /note="BUSCO:EOG09260XMI;
                     COG:Z;
                     EggNog:ENOG410QDEW;
                     InterPro:IPR001060,IPR027267,IPR035459,IPR036028,
                     IPR002219,IPR031160,IPR020454,IPR001452;
                     PFAM:PF14604,PF00018,PF00130,PF00611;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0035556 - intracellular signal transduction
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136013.1"
                     /db_xref="GeneID:66981850"
                     /translation="MATLDAAPQFGAELKDSFKPVNNWVTNGISWLDEIQQFYRERST
                     IEKEYAAKLNALCKKYSDRKAKKISQLSVGDTPTMTPGSLEAASLTTWGTQLTAVESH
                     AGERDKFANDLLIQVAEPLKHAAVQYDEVRKCHVDFHAKLEKERDASYSDLKKVKGKY
                     DGACQEVENKRKKMESSFDHGKQKSQAAYQQQILEMNNVKNTYLIHINITNKMKEKFY
                     HEYVPEMIDGLQDLNETRVAKLNSLWSLAAELENSYMAKSMDHMLNLLNEIPRNAPHL
                     DSHMFLRHNVTQTQEPPNLTFEASPIWHDDELIVTDEAAKVFLRNLLSKSKTQVRELR
                     VEADKHKREVDSSRRNRERARQGQEGVSEVDVVRTLFHQQEAFHEIDRKRVAAEVETS
                     TIMAVVGDLSVGAQNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCE
                     MKVPAECPGEQSKEEKKRLKAERQEQATSMPPLDLEASTTSSAAPSLTRKDTMNSLSS
                     GYATNVNRSVSNVTSQPASGAETPISPVPPVESKPAPVRRVLAPPPAAYISPPPEPAP
                     KPSEPRGRMLYPYQAQGEDEVSVQEGDSVVIVEPDDGSGWLNVRSGTQTGLVPASYVE
                     AAPAPAQSPVPSVTDRRNSVYSNSSAAGHAPGKKIGPAVAPRRGAKKLQYVEAMYDYT
                     ARSEMEWDMAEGDRFVLVNRDGGDGWADVERGGVTKSVPANYIQEV"
     gene            complement(<151519..>152425)
                     /locus_tag="ACHE_40056A"
                     /db_xref="GeneID:66981851"
     mRNA            complement(join(<151519..152061,152129..152265,
                     152350..>152425))
                     /locus_tag="ACHE_40056A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278213.1"
                     /db_xref="GeneID:66981851"
     CDS             complement(join(151519..152061,152129..152265,
                     152350..152425))
                     /locus_tag="ACHE_40056A"
                     /note="COG:S;
                     EggNog:ENOG410Q257;
                     InterPro:IPR036395,IPR001083;
                     PFAM:PF00649;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136014.1"
                     /db_xref="GeneID:66981851"
                     /translation="MLINGHKYSCEACIRGHRVTTCKHHDRPLTKINRKGRPFSTCGI
                     CHRTPCAVPDEHARLRREVESKSHHHKKPNGRYARPFQGFLPIAPRPMGVKSGLSIAM
                     QTQSAPVSVAGRSPEGRSLDVHAEPESKFTIGTSGSQTMPTTISGVDIPSASVPSLSG
                     SLPSTSSIASSASSSASSSDLLPMPPLDLPLDLELELPLPILESNWDNLDTGGKNTDN
                     GLGMWPLDQSGFCGLDDMSAFPGQNTQFWVGEL"
     gene            complement(<153175..>156067)
                     /locus_tag="ACHE_40057A"
                     /db_xref="GeneID:66981852"
     mRNA            complement(join(<153175..153843,153896..>156067))
                     /locus_tag="ACHE_40057A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278214.1"
                     /db_xref="GeneID:66981852"
     CDS             complement(join(153175..153843,153896..156067))
                     /locus_tag="ACHE_40057A"
                     /note="CAZy:AA3;
                     CAZy:AA8;
                     COG:E;
                     EggNog:ENOG410PHG9;
                     InterPro:IPR036188,IPR038697,IPR000172,IPR015920,
                     IPR007867;
                     PFAM:PF01266,PF16010,PF00732;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136015.1"
                     /db_xref="GeneID:66981852"
                     /translation="MRSLTWLTALTTALGVAASTTESSAYSDSATGIDFQRWCDEKSG
                     MCFGMALPETVKSDFIGQMIVPLSDSKGWGGVSLSPSMTESLLIAAWPNGDSGVGTLR
                     QATSYTNPDVYQGASIAEIPDGVSINSTHLTYTFLCKGCIVGSSTSFKASADTSFLGW
                     ALSKTNPTTPSSPSSVLSYHAAGFGTFEVLLSKAKSAKYSTWAAKAKSTTTPSGSATP
                     SSSALASQTPTPSVAPTVSNATYDYIVIGGGAAGIVAAERLAETKKKVLLIERGAASI
                     ASMGADNILSWNSSLTPYDVPALGSSLSELGLVSDYLCPDTAGMAGCVLGGGTIINAM
                     SFIHPPSRDFDDKWPEGWKWNDISAAAKRVYERNAGSMLPSADGKRYDQSLFKVLSSF
                     LNRLGWKYVNQHENPDERHQMYSYPSWSVADGIRAGPVRSYLPLAQEMDNFNLRLLTK
                     VRRLVRRGGRVTGVEVEKENGDIEIIHVRAGGKVVLAAGSMSTPRILFNSGIGPDEQL
                     KNVQSGSTGVTLPPSGEWINLPVGQNLKDHPMFTIKVDTRANFTTFNTSSVIPGPSAI
                     VQRLYEQASGVLTQGGHRLQFWTSLEGTDGITRYFQASCSAAENGVVTMKLYLTHGAT
                     SSGVLGINGQGSTTIETEPYLQTEEDKEATTRFLQGLVKDLKNSPMGFSIQDFSDIET
                     LLAQKTAGDHYLGTAKMGTDDGRKNGSSVVDTSAKVYGTENLYIVDASIHPDLPTGNT
                     QAIVMIAAEAAIEKIVSGSELGQGISGAAPSSVVLSASAQHTVIAAATSTVDAVTTSI
                     VDETQTTTKTESAAGPSDVAATGVPAPSAPSDAAPAPSDVPAPTVPSENGAAPSHSAA
                     PSDNGSYNAATVPVPMRTPTPSDASAEGQNEQPSHIVSTIYMTATPTATHTNIVTLTH
                     SSVSTVTVTAGQGHAQGQGQVQGQPECTCEVH"
     gene            complement(<157260..>158654)
                     /gene="GEL1"
                     /locus_tag="ACHE_40058A"
                     /db_xref="GeneID:66981853"
     mRNA            complement(<157260..>158654)
                     /gene="GEL1"
                     /locus_tag="ACHE_40058A"
                     /product="beta-glucanosyltransferase"
                     /transcript_id="XM_043278215.1"
                     /db_xref="GeneID:66981853"
     CDS             complement(157260..158654)
                     /gene="GEL1"
                     /locus_tag="ACHE_40058A"
                     /note="CAZy:GH72;
                     COG:G;
                     EggNog:ENOG410PHUW;
                     InterPro:IPR017853,IPR004886;
                     PFAM:PF00150,PF03198;
                     SECRETED:SignalP(1-19);
                     TransMembrane:1 (n3-14c19/20o442-463i)"
                     /codon_start=1
                     /product="beta-glucanosyltransferase"
                     /protein_id="XP_043136016.1"
                     /db_xref="GeneID:66981853"
                     /translation="MKGSTIATSLVLGASSVLAAPSHNTIKARDDVTPITTKGNAFFK
                     GNDRFYIRGVDYQPGGSGDLADPIADADGCKRDIEKFKSLGLNTIRVYSVDNSKDHDE
                     CMNALADAGIYLVLDVNTPKYSLNRKDPKQSYNDVYLQYIFATVEMFAQYKNTLAFFS
                     GNEVINDGPSSKAAPYVKAVTRDIRQYLRERNLRTVPVGYSAADIDTNRLQMAQYMNC
                     GTDDERSDFFAFNDYSWCDPSSFTTSGWDQKVKMFDGYGLPLFLSEYGCNTNTRKFEE
                     VEALYSTKMTGVYSGGLVYEYSQEPSNYGLVKVDGDSVNELKDFDALKTAFEKTSNPE
                     GDGGFNKTGGSNGCPKQQKPAWDVDNDDLPAIPEPAKKYFKDGAGKGDGFSGSGSQSK
                     GTSSTGTAEPGSASVSGSDYSSSGSGGSSSSSPSGSAGAAAGLKVPSLTMAPVVVGMV
                     TIMSTLFGASLIMV"
     gene            complement(<160017..>160751)
                     /locus_tag="ACHE_40059A"
                     /db_xref="GeneID:66981854"
     mRNA            complement(<160017..>160751)
                     /locus_tag="ACHE_40059A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278216.1"
                     /db_xref="GeneID:66981854"
     CDS             complement(160017..160751)
                     /locus_tag="ACHE_40059A"
                     /note="COG:I;
                     EggNog:ENOG410PNC6;
                     InterPro:IPR006694;
                     PFAM:PF04116;
                     TransMembrane:1 (o18-43i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0008610 - lipid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136017.1"
                     /db_xref="GeneID:66981854"
                     /translation="MEAWANIVKSYSPQSIEFIGTLVVQLLTFWLPSLYYVSLDALFP
                     SFSQRHKIQPAPKQPTGKDIRHCVAVVAKNQLLSTTLHFLLITAKTNAGLPPSYRIET
                     TLPTLFELTRDFIISLLLREALFYYSHRFLHRPYFYVRIHKQHHRFTAPIALAAQYAH
                     PVEQMFANILPIVLPPQILKSHILTFWAFLGYELFGTATVHSGYDFLRGQARMHDLHH
                     EKFNLNYGSMGVLDWVHGTDRLRKRE"
     gene            <162471..>163076
                     /locus_tag="ACHE_40060S"
                     /db_xref="GeneID:66981855"
     mRNA            <162471..>163076
                     /locus_tag="ACHE_40060S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278217.1"
                     /db_xref="GeneID:66981855"
     CDS             162471..163076
                     /locus_tag="ACHE_40060S"
                     /note="COG:S;
                     EggNog:ENOG410Q27A;
                     InterPro:IPR005247,IPR036610,IPR008914;
                     PFAM:PF01161;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136018.1"
                     /db_xref="GeneID:66981855"
                     /translation="MIPLLHALAWALLAILVHGDREYSKLFIKGPAFSLYPDPTFTVV
                     SPELGRSGAWMSSNYTADGSGRFPGLEWKSPSPYVKEYLLVSEDPDAPLSHPIVHGLY
                     YGIPRVFTGLGDEDFQYGTEPYTVSGGFKYGVCRGGGVYLPPSPMAGHGPHRYFFEVI
                     ALNERIDTGKLKSPVTLDKISHAIEGKVIGWGMWIGLVERK"
     gene            <164161..>165267
                     /locus_tag="ACHE_40061S"
                     /db_xref="GeneID:66981856"
     mRNA            join(<164161..164431,164552..>165267)
                     /locus_tag="ACHE_40061S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278218.1"
                     /db_xref="GeneID:66981856"
     CDS             join(164161..164431,164552..165267)
                     /locus_tag="ACHE_40061S"
                     /note="COG:S;
                     EggNog:ENOG410Q0JU;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136019.1"
                     /db_xref="GeneID:66981856"
                     /translation="MTRLSFVLLSLLASSIAASPTEYQHRDDLLNTHNDYDHDHSPIH
                     NALHRLSARFRDGIFPSDTDAVSALQHEDESLGKRLLDLVKRQDVGDISSLLPSSDQA
                     SSTEASSADQPSSTAASTSDQLSSSAGSTGSSSAESTTESSTAESSTANSSSAGSSTT
                     DSSSTGSSSASETESSTPASTSASSTGASSTAGSSTGGSSTNPSTTMSTSASPSSTSA
                     STSSPSTSTSSSPASTTSTTSTTSTASSSSSTETTTQHTTPYTSTYQSTTTMANGERS
                     TVTMFTVVHPTASSTSSAKPGLQTDTSGAGTTNLKREFLAIVGGAAVVAMAL"
     gene            complement(<165533..>166191)
                     /locus_tag="ACHE_40062A"
                     /db_xref="GeneID:66981857"
     mRNA            complement(join(<165533..165858,165921..>166191))
                     /locus_tag="ACHE_40062A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278219.1"
                     /db_xref="GeneID:66981857"
     CDS             complement(join(165533..165858,165921..166191))
                     /locus_tag="ACHE_40062A"
                     /note="COG:O;
                     EggNog:ENOG410PQC3;
                     InterPro:IPR016135,IPR023313,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136020.1"
                     /db_xref="GeneID:66981857"
                     /translation="MNSPPPPHSDTTTCTSTTPCIRSTTLPLVHTHPDTVKKMASPST
                     TQRLLRELKDYTKSPNEALLHLGPIDEDDLLHWEAVLKGVKGTPYEGGLWSLTITIPP
                     NYPLTPPTIRFRTRISHPNISFTTGEICLTLLTTEHWSPVYTLSTTLTAIQQLLTDPR
                     PESPLNVDVAALLRDGDLVGWESVVRFWTEEERWGGQG"
     gene            <166310..>167500
                     /gene="NTG2"
                     /locus_tag="ACHE_40063S"
                     /db_xref="GeneID:66981858"
     mRNA            <166310..>167500
                     /gene="NTG2"
                     /locus_tag="ACHE_40063S"
                     /product="DNA N-glycosylase and apurinic/apyrimidinic (AP)
                     lyase"
                     /transcript_id="XM_043278221.1"
                     /db_xref="GeneID:66981858"
     CDS             166310..167500
                     /gene="NTG2"
                     /locus_tag="ACHE_40063S"
                     /note="BUSCO:EOG09263R4M;
                     COG:L;
                     EggNog:ENOG410PIPF;
                     InterPro:IPR003265,IPR000445,IPR004036,IPR023170,
                     IPR011257,IPR030841;
                     PFAM:PF00730,PF00633;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003906 - DNA-(apurinic or apyrimidinic
                     site) endonuclease activity [Evidence IEA];
                     go_function: GO:0019104 - DNA N-glycosylase activity
                     [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA];
                     go_process: GO:0006284 - base-excision repair [Evidence
                     IEA];
                     go_process: GO:0006285 - base-excision repair, AP site
                     formation [Evidence IEA]"
                     /codon_start=1
                     /product="DNA N-glycosylase and apurinic/apyrimidinic (AP)
                     lyase"
                     /protein_id="XP_043136021.1"
                     /db_xref="GeneID:66981858"
                     /translation="MRTSRTSQETSKILQALSPRRTRGSANLNLNLQSFAYDNPPEVK
                     DEDVSSLSSVNTVDIEDILEPPAKRRKAASASAAPVRTKKTTETTAPPTKRARRTPAR
                     KIKAENGSPTVQPPSDWETIYNTVKRMRERNPTAPVDTMGCAELYWRASSAKDQRFHI
                     LVALMLSSQTKDTVTAVAMQRLHTELGDPGVKEEDGVKKEDDAVKQEGKEEEIKTEDD
                     VKKENDIRQEDVKKEDEKAQPSALTLKNILAVSPQRLNELIRTVGFHNNKTKYIKAAA
                     QILHDKYNSDIPSTAPELMSLPGVGPKMAYLCMSAAWGKHDGIGVDVHVHRITNLWGW
                     HKTKNPEETRAALESWLPRDKWHEINKLLVGLGQTVCLPVGRRCGECDLAGTKLCKSE
                     VRGK"
     gene            <167720..>169401
                     /locus_tag="ACHE_40064S"
                     /db_xref="GeneID:66981859"
     mRNA            join(<167720..167761,167809..>169401)
                     /locus_tag="ACHE_40064S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278222.1"
                     /db_xref="GeneID:66981859"
     CDS             join(167720..167761,167809..169401)
                     /locus_tag="ACHE_40064S"
                     /note="COG:S;
                     EggNog:ENOG410Q1PS;
                     InterPro:IPR038883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136022.1"
                     /db_xref="GeneID:66981859"
                     /translation="MSPKRAKTEKQSPREDKMDLDEDKFEPLSPTKDRMDTSPTNTPS
                     SSRLTFFDLPEQIRTRIYFLSGLSRPCTTRIDTSWPKNYSSRNNFCELEREDLRVSRQ
                     GGYYTAATTNRFCTHPNFPMALLMVSRQVREEAARVFLRNRFAMLLAYRSDLDYFQVS
                     LGWAFSRLRALHIELRPGDGRFLKMRGGMHTTAWNTWAAFCAQVKESMSALDVFSLKC
                     KVRIPEVAERLFDHMQGFPKLLSCGIHLDPSPHDYLQVKVRHFCWKMTGRLDPPSFPF
                     ARLPKEMQLLILEFLLTNRPDPYSPRAGNSLSEGFRCLESVVTFQNRRYLRAHDVRPM
                     MCCGTCSPSQAMCFCFSRQCAFSTTCSCFSTPLPYFLVSREFYKMARHIFYSKNVFAF
                     VEEDPEDMLRITHSIPTSTFMQIRRLAFKFPYHHRMPYRLNAQRIEETAFLSWSVLRR
                     FIREHFDLPKLSISIIDVGGADTFSRTRMISSRNRYLRKLLLSFADLKGLRDFWVFLA
                     DDPGFEEEAKAVVLGKKEADDSGVYEEDTFLYREEL"
     gene            <169934..>172311
                     /locus_tag="ACHE_40065S"
                     /db_xref="GeneID:66981860"
     mRNA            join(<169934..170472,170539..172025,172103..172163,
                     172227..>172311)
                     /locus_tag="ACHE_40065S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278223.1"
                     /db_xref="GeneID:66981860"
     CDS             join(169934..170472,170539..172025,172103..172163,
                     172227..172311)
                     /locus_tag="ACHE_40065S"
                     /note="BUSCO:EOG092617S2;
                     COG:L;
                     EggNog:ENOG410PFJA;
                     InterPro:IPR041677,IPR027417,IPR003593,IPR041679,
                     IPR014001;
                     PFAM:PF13245,PF13086,PF13087,PF04851,PF00580, PF13604;
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136023.1"
                     /db_xref="GeneID:66981860"
                     /translation="MPPTHIPIPLFANTQLSLLHTEHQAEISSSSLASTAASVSPSTR
                     RTLQATGYALTGLILSQTKTGLGGRVVGEFAADPATATKGKDKDEGKSGEPGLGAHGI
                     RVGDVVRVNDIGSGAKKAGKEKEKEKGKDSGKGLEGVVTRVAERAVWIAFGQRGGNTG
                     SRSREDDEAIEELWGKKLWLIKLANDVTFRRMNQTMEKMAKMTENEHTHFMRVAFGYT
                     TPLQVDYEGVGSVEFTDPTLNDSQKEAIRFALASKDVVLIHGPPGTGKTHTLIELILQ
                     MVQRNQRVLVCGPSNISVDNIVERLAPKKVPVVRIGHPARLLPSVLEHSLEVLTHTSE
                     AAGIVKDVRAEINDKQASIRKTRTGRERRAIYDDLKELRREFRERESKCVDNLVRGSS
                     VVLSTLHGAGGHQLRNSKFDVVIIDEASQALEAQCWIPLLSASKVVLAGDHLQLPPTV
                     KSTVQKSKDSKAQKNGNNDANLSPEEKEIAKSISLERTMFDRLLSLHGPGIKKMLTTQ
                     YRMHEKIMRFPSDELYESKLMAGEAVKARLLKDLPYEISETDDTKEPVVFWDTQGGDF
                     PEKTEDDDIGKKEALLGESKSNEMEAMVVAKHVSNLVDAGVRPEDIAVITPYNGQLAV
                     LSQMLRERYPGLELGSVDGFQGREKEAVVVSLVRSNDEHEVGFLGERRRLNVAMTRPR
                     RHLCICGDSETISRGSSFLKRWMAFLEEHADLRYPDAGELV"
     gene            <173311..>174114
                     /locus_tag="ACHE_40066S"
                     /db_xref="GeneID:66981861"
     mRNA            <173311..>174114
                     /locus_tag="ACHE_40066S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278224.1"
                     /db_xref="GeneID:66981861"
     CDS             173311..174114
                     /locus_tag="ACHE_40066S"
                     /note="COG:S;
                     EggNog:ENOG410PNSB;
                     InterPro:IPR038656,IPR000250,IPR013320;
                     MEROPS:MER0001321;
                     PFAM:PF01828;
                     SECRETED:SignalP(1-20);
                     go_function: GO:0004190 - aspartic-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136024.1"
                     /db_xref="GeneID:66981861"
                     /translation="MKLFESLKLLPLLVAAQATAFPIIKIAAPSLTDSSDSDSHNNTE
                     TTSHSPSSQTTAYSNNWSGTVLSQPPSGDEFTHVSTMFTIPKVSSDGLDSYQSASVWV
                     GIDGATVSDAILQTGVDVGIRDGSPLYTAWYQWYPEASVTWPDFELQAGDVVVTTVNA
                     TSKTSGICIVENKSTGQKATKTLESPNPSSTLSGQNAEWIVEDFLSDGKPVPLVDFGE
                     ITFEESRAETKKGKSVGVSGATPYVMVIDGEQVSEVDIVNDSQFKVKHT"
     gene            <178220..>179848
                     /locus_tag="ACHE_40067S"
                     /db_xref="GeneID:66981862"
     mRNA            <178220..>179848
                     /locus_tag="ACHE_40067S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278225.1"
                     /db_xref="GeneID:66981862"
     CDS             178220..179848
                     /locus_tag="ACHE_40067S"
                     /note="COG:U;
                     EggNog:ENOG410QDYE;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i95-115o135-155i162-180o186-207i219-242o254-271i327-
                     353o365-384i404-424o430-455i475-493o499-519i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136025.1"
                     /db_xref="GeneID:66981862"
                     /translation="MDSKDQSNQPSHTENASTSSSQEKPQFGRLVGGKYAQEVNDDES
                     FPEYGSLQQVDVDIPLTFTETTNHNGRQIIILDFRHGDPENPFNWSGKKKAFLSSLLC
                     LMTLFIGLATTAYSSGISRMCEEFGVSEELGQLGLFFFNFTCALAPMFLAPFCELVGR
                     KIVYVGGYVCFAIMFIGLSLGKNIATILVCRALLGLFGCIGTILVGGTFGDMYTPENR
                     AIPMASFSYIAILGTVGAPIYAGFIDQALGWRWVEGIQGLANIPLGIAIIVFFRETRG
                     SVALNKRAKALRKATGDDRYITRTELEAPGVKEMLHNSSVKAVKMLFTEPVVFFFGLW
                     IAFAWFLTFLFLSVIPITFQEKHGWGEGAAGLPYISLCIGTTIGFGMNFFQIRKYNSL
                     RVANNGRVQPEARLYGALFGAIWLPIGLFIYSFTQYAYLVWVGPIISLALITIGIFFI
                     FESCYSFTSDCYGENSSSAIAGQGLMRNTLGAVSPLFASQFFHNVGSQYAGLILALIA
                     TVLTFLPFVLFKFGPQIRARSKLASSTTRAMGVD"
     gene            <184375..>185358
                     /locus_tag="ACHE_40068S"
                     /db_xref="GeneID:66981863"
     mRNA            <184375..>185358
                     /locus_tag="ACHE_40068S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278226.1"
                     /db_xref="GeneID:66981863"
     CDS             184375..185358
                     /locus_tag="ACHE_40068S"
                     /note="COG:E;
                     EggNog:ENOG410PM2D;
                     InterPro:IPR002220,IPR013785;
                     PFAM:PF00701;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016829 - lyase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136026.1"
                     /db_xref="GeneID:66981863"
                     /translation="MGSISTNKPHVPKPGVWCPAVTFFDPSTDEIDFASQSKYFTYLS
                     TTGLAGLVILGTNSEAFLLTREERSRVISTARQAVGSDFPLMAGVGAHSTKQVLELVR
                     DAKEAGADYALVLPPAYFGKATDMNVVKRFFSDVARESPLPVVVYNFPGVCNGVDLDS
                     ETITAIVQESKKSRPDGVSNVVGVKLTCASVGKITRLAATFPKEEFAVYGGQSDFLIG
                     GLSVGSAGCIAAFANAFPKTASRVYDLYTTGKIDQAIELQRKAALAESPVKSGIASTK
                     YAAAVFTAPLAGIEGAEKKLKPRTPYGEPAEGVKKSVKEGMGGLLEVEQSL"
     gene            <189741..>191337
                     /locus_tag="ACHE_40069S"
                     /db_xref="GeneID:66981864"
     mRNA            join(<189741..189912,189962..>191337)
                     /locus_tag="ACHE_40069S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278227.1"
                     /db_xref="GeneID:66981864"
     CDS             join(189741..189912,189962..191337)
                     /locus_tag="ACHE_40069S"
                     /note="CAZy:GH32;
                     COG:G;
                     EggNog:ENOG410PI7R;
                     InterPro:IPR023296,IPR013148,IPR013189,IPR013320,
                     IPR001362;
                     PFAM:PF00251,PF08244;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136027.1"
                     /db_xref="GeneID:66981864"
                     /translation="MRLGLLALPFLAATVQAADYSGPLRPQVQFSPPKGFMNDPNGLF
                     YDAKRSIYHYYYQYNPSEPVVGNQHWGHATSPDLYHWTNHPPALEPDNEDTFIFSGSA
                     IIDSENTSGFFPDQDDGVVAIYTAHSPTKETQHIAYSTDGGYTFTKYANNPVIDSHTD
                     DFRDPKVIWHAESQKWVMVIAWAHARKIGIFTSPNLKDWTPTSNYTQEGLPGVEFECP
                     NLVTFPIDDADSGETTKDVLAISVNPGAPLGGSGTFYIVGQFNGTHFNSEVKEETLFD
                     FARDNYAAQWFYGLPEGSKPVSIGWASNWDYTNEVPSGDREGWRSSTTLPREQTLIKV
                     DGAWRVAQAPFQGLSPVKGDELEKKTFSEGDVSVDFSSVESNAVYFDVAIKHLPSANV
                     TGELSFNFTSSASGEYLDGAVELNSGSFWINRAGTHLFTTADNGNFAGQFGTSISVPE
                     SGQFTFSGVIDRSVFEVFLEEGKQSGTMSFFPTKPLDKVTFAATGLGEHVTVDVGVWG
                     LKSGWSS"
     gene            <193238..>196306
                     /locus_tag="ACHE_40070S"
                     /db_xref="GeneID:66981865"
     mRNA            <193238..>196306
                     /locus_tag="ACHE_40070S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278228.1"
                     /db_xref="GeneID:66981865"
     CDS             193238..196306
                     /locus_tag="ACHE_40070S"
                     /note="COG:K;
                     EggNog:ENOG410QDD9;
                     InterPro:IPR011598,IPR036638,IPR019006;
                     PFAM:PF09427,PF00010;
                     TransMembrane:1 (i413-436o);
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     go_process: GO:0032933 - SREBP signaling pathway [Evidence
                     IEA];
                     go_process: GO:0045944 - positive regulation of
                     transcription by RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136028.1"
                     /db_xref="GeneID:66981865"
                     /translation="MSFAGMENDFQLFSPVQSSDRKSSHTDAIPPSTDDSQDWTQWMR
                     WDDQVFSDPKENAPFDASLTSPNTSLGANFSQHEFSPDIAQGLPSLPFDASGRDRSGM
                     LPSDGIQQQSQPSLTGSPDSLGTTRKRKTSSDDDGSTVSGVPQNGGKKMPTKKRAHNV
                     IEKRYRANLNDKIAELRDSVPSLRASSKGTNGTLLDDEDADGVTPASKLNKASILSKA
                     TEYIKHLEIRNRRLEDENTALKNRLRQVDKAAEQTVTSAASVSSPSNYTESGASSSPS
                     VFSHTEDAPSDHSPSSLYPPEGLLQVPDSFKKMQASSKDNAWSQSYIQYPSNGNRTTQ
                     TGGGGRRRSNFPNKYMLGALAGLMVLEGLGTEEDTESNEKGLLAVPVHLLKYLPQINS
                     PSLAYWNAVVRSYWASWHARAIIHFGILASLVVGSAFVVFVYLFNAEPKHSDTSSKVP
                     VSSGSSLSPYNFRRQAWLTSIQQVGVPRHRFFREWYVVTSRCTEYVLRCLMGWKLYSR
                     ITGITEEDEKGRVKTWDIAIDAQLAGGDAEISKSRLVLTIFAAGTLPRSPMRMMLKAL
                     HCRILLWRVGDPGSWSFYISNDVARALARYQWDLARQMHRALPKDHPDALPSHLAALL
                     TIDSEDVMIDGIVQRAANLTWNRPTQEASDDHEALLDIVEEDPAIQSSLDALAAWWSC
                     HLLQRALLKYFEASSGGPDSKQSRDLFKSKINLALNVAPQPSAAHTRALVMKAVFFEQ
                     DRVKNIGAVLAALPSDNGKNKKSHNFNFLDSSLPVPVREEICIAVRCAMIAAIFSART
                     TGDTSLPASFTMQKAINWFNQLPLDPVELTLLGFASVYHLLHVLVSDTDYLSSSDSSA
                     SSSPVPNASAASSADDEADEEAPQPVRDRERMAPSTSFPNLGRVAAELMYWARNAYNP
                     AFYGFTSDLVDIVEKECTSLCQSAGVDIADYSRLREHKLKTKRRKNKKRRKSVKYSTE
                     DGVGNEKQEAPAAVPSRAEGSKPSSSDGTKGHDQKGLGKACAEAPILSAS"
     gene            <197992..>200019
                     /locus_tag="ACHE_40071S"
                     /db_xref="GeneID:66981866"
     mRNA            join(<197992..198595,198645..198706,198764..198949,
                     198997..199396,199443..199607,199661..>200019)
                     /locus_tag="ACHE_40071S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278229.1"
                     /db_xref="GeneID:66981866"
     CDS             join(197992..198595,198645..198706,198764..198949,
                     198997..199396,199443..199607,199661..200019)
                     /locus_tag="ACHE_40071S"
                     /note="COG:P,Q;
                     EggNog:ENOG410PFX0;
                     InterPro:IPR017938,IPR017927,IPR013130,IPR013121,
                     IPR039261,IPR013112;
                     PFAM:PF08022,PF01794,PF08030;
                     TransMembrane:5 (o23-42i103-125o178-196i216-235o247-265i);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136029.1"
                     /db_xref="GeneID:66981866"
                     /translation="MGVELAGSGNGEPPMNPALATPLYVLAGVVGVFFVCRMEILIRH
                     RRRLRGILRNEDQSKYTKISEFQAKFKRHVLYAPLFSTRHNRELQLMGRLHMGTIPLR
                     FEAGVLLGYIVLNLVFFFCLIDWPADFQEKMFQFKYAAGHLAVMNSPALVLTAGRNNP
                     LIPLLGISFDAFNLLHRWIGRIMAVEAVVHMACVVAGKARLMSMDEITHMMWNEPFFI
                     YGLVALIGFVLIFFQAMSALRHAWYETFLHLHILLAVMSFVALWYHLKNLLQQRVLLG
                     TVILWGLERAARAACLLWRNCGKQFTTATVEVLPANVARVDVAMARTWKFKAGQYLYL
                     YIPSLGLWTSHPFSVAWTSTDRADVNEKRSSGDSLNTLIGGPQRHKMSFLIKGRDGFT
                     KKLLKKARRTTGGSLKVTALAEGPFGGLHPLSSYGTVLLIAGGIGITHPVSYLHEFVN
                     VFFTPKHSAIRQVSLIWVVRSIDHLTWIQSWMPTLMSHPSLQTSTIALSIHIYITAPQ
                     STTDEYVTSSNPWAHHAPPNVPVTINWGKPDFVYILENAKICQVGAMAVSVCGPGAMG
                     DDVRRAVRERQGGTVVDLYEESFSW"
     gene            <200767..>202458
                     /locus_tag="ACHE_40072S"
                     /db_xref="GeneID:66981867"
     mRNA            join(<200767..201667,201720..202070,202128..202207,
                     202264..>202458)
                     /locus_tag="ACHE_40072S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278230.1"
                     /db_xref="GeneID:66981867"
     CDS             join(200767..201667,201720..202070,202128..202207,
                     202264..202458)
                     /locus_tag="ACHE_40072S"
                     /note="COG:T;
                     EggNog:ENOG410PIFQ;
                     InterPro:IPR019819,IPR002018,IPR029058;
                     MEROPS:MER0033198;
                     PFAM:PF00135;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136030.1"
                     /db_xref="GeneID:66981867"
                     /translation="MWLTPFLLPLAAVASALPSASKSSQPTPSITLGYTTVIPTAGSY
                     SLGYYKYQNIRFAAVPTGDLRFAKPQWPPVEEAINDGTLADADVDCASTEDCLYLDIW
                     APANAHGKKLPVMVWSYGGGFTSGSKSDNTPEGLFALNKEFIFVAYNYRLGITGNANG
                     PRLPHEGGTSNVALYDAQHAFQWVRKYIGAFGGDPNRITAVGFSAGASQTIFQMTRFA
                     GRAEQLYNQAYIMSPGYVPGAGHHQAEMFWRNVSTAVGCDGGHLDCMRGVWFEELGSA
                     ASDVVGKYDYQLQPRVDGDFVGDTYEAQLYRNCFNFTGPLVITHEKHENNSQAWPGVS
                     TTADIPKELRRFFPSITDDVVGRLLELYPESDYSSPGLRFADMKQSFDMTAHNYALTR
                     ALGNQTWNGMVDLGKATHGTDQSYYWYSTYSLSGNGTTSGFGSSMPIDTSVARKMQKY
                     LLSFVHTGNPNTMWPNDKIYWPKYGSNATQIVFNSTIHLEKDNLANAKSEHWNEALWY
                     "
     gene            complement(<202582..>203690)
                     /locus_tag="ACHE_40073A"
                     /db_xref="GeneID:66981868"
     mRNA            complement(join(<202582..203321,203378..>203690))
                     /locus_tag="ACHE_40073A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278232.1"
                     /db_xref="GeneID:66981868"
     CDS             complement(join(202582..203321,203378..203690))
                     /locus_tag="ACHE_40073A"
                     /note="COG:C;
                     EggNog:ENOG410PIZJ;
                     InterPro:IPR006140,IPR036291,IPR006139,IPR029753;
                     PFAM:PF00389,PF02826;
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136031.1"
                     /db_xref="GeneID:66981868"
                     /translation="MAKLRVLHIGDNIKYNHDVYQRFASEFELIQPTTAERQRDEFIR
                     ALKERRWGDFDAVFRPFWNTGGEMGRWDAELIPLLPKSVKVMASAGAGYDWADVDIFA
                     KHGIVYCNGAAASSESVADMTLFLILAVFRNFAWSHQAAHSVNPARFLDAHQNSPLTA
                     YNPRGRSLGIIGMGQIGYMIAQKAHAAFGMKIQYNDLFRKSPQQEKTVQATFFKELDD
                     LLANSDCVVVATPFAGQKLITTERLQNFKKGSRFINIARGSLVDEEALLQALDSGHLS
                     GAGLDVHDNEPNVHPRLANHPKVMMMSHNAGGTVDTHVGFERLAMENIEGYLLKGKAL
                     TPVNLHMLPKGPTSKL"
     gene            <205460..>206110
                     /locus_tag="ACHE_40074S"
                     /db_xref="GeneID:66981869"
     mRNA            <205460..>206110
                     /locus_tag="ACHE_40074S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278233.1"
                     /db_xref="GeneID:66981869"
     CDS             205460..206110
                     /locus_tag="ACHE_40074S"
                     /note="SECRETED:SignalP(1-19);
                     TransMembrane:1 (n3-14c19/20o151-172i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136032.1"
                     /db_xref="GeneID:66981869"
                     /translation="MHILPLVSVTFSLCGQLLAAPMSNTTSNGCDISNETIQQLRAQL
                     IPLEFEPLESDEEHGDAISISKVNCDSRPETAPSESSVFCLRASSADDALRYSNYGTK
                     IAPFISHIRNKAVRCDVVEYMSDMDMDSEDIKLRCSCVDSPPSAMERPWVPKLLIFAV
                     FWVTGCTIRKVWVERRARGASKQAVSRPKMSMSEKASVVSVEDVEDEFDDSDYPMG"
     gene            complement(<206271..>207915)
                     /locus_tag="ACHE_40075A"
                     /db_xref="GeneID:66981870"
     mRNA            complement(join(<206271..206522,206575..207102,
                     207151..207308,207359..207398,207451..207617,
                     207663..>207915))
                     /locus_tag="ACHE_40075A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278234.1"
                     /db_xref="GeneID:66981870"
     CDS             complement(join(206271..206522,206575..207102,
                     207151..207308,207359..207398,207451..207617,
                     207663..207915))
                     /locus_tag="ACHE_40075A"
                     /note="COG:P;
                     EggNog:ENOG410PFX2;
                     InterPro:IPR009716,IPR036259;
                     PFAM:PF06963;
                     TransMembrane:7
                     (o51-71i83-102o184-204i261-287o293-317i329-348o420-442i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005381 - iron ion transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0034755 - iron ion transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136033.1"
                     /db_xref="GeneID:66981870"
                     /translation="MTATHEPANPSIARGLYISHFLSTWNSRVFEFGSVLYLASIFPN
                     TLLPMSVYALARGASAIVFSQAVGWYIDTRDRLRVVRASIVIQRLAVAASCVVFRLLA
                     TGRMLSDLELWLLGVLSLFACVEKLCDIMNTISVERDWVVVVAMDGAEALEVLNAEMR
                     RIDLICKLVGPFVIAMIDGFSTEIAIVVNFAMNILSIFVEYYAIERVYQMVPSLQAPK
                     QPPAPAIDEQTSITNGSRVDRWSTKEFLLGTLRGSTRYFQHQVFLPSFALAILNFTVL
                     SFSGRMVAYLLSVGYNSYHVAIARSASVAVEISATWIGPLLMAKIGVLRAGMWLLSWQ
                     TVALAGAAGTFLVVKPETLAATALVAGTVLSRVGMWGFSLSAQILVQEEVEPENRGAF
                     SSTEASWHNTFELLSYATTIFFSRPEQFQWPVLMSFIAVFTSCNLFAAFVKVRAKCFG
                     GKWDERVEFGYETLP"
     gene            <208637..>209674
                     /locus_tag="ACHE_40076S"
                     /db_xref="GeneID:66981871"
     mRNA            join(<208637..208799,208845..>209674)
                     /locus_tag="ACHE_40076S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278235.1"
                     /db_xref="GeneID:66981871"
     CDS             join(208637..208799,208845..209674)
                     /locus_tag="ACHE_40076S"
                     /note="COG:S;
                     EggNog:ENOG410PUXR;
                     InterPro:IPR015915,IPR011043;
                     PFAM:PF13418,PF01344,PF13415;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136034.1"
                     /db_xref="GeneID:66981871"
                     /translation="MTITGTWHKALEAEILQRSSQIVSVVDGNAYIFGGELRPREPRD
                     NDVHVFSFGGDATLSTKQASQSPSARVGAASATLHGKIYIFSGRDGAEAAPLNEAGSL
                     WEFDPATGSWTVVSPSDSTSRYPASRSYHCMTSDGIDKIYLHAGCLEQGRGGDLWAFS
                     LSTKEWTELSTAPGSPRGGTSITFANGKLYRMNGFNGKTEEGGVLDIYSPEKNTWSSH
                     EFAPDGKSGPTPRSVAALLPVSVSGKTYLATLFGERDPSSLGHQGAGKMLSDVWVFDI
                     ESKMWEEVDVKGGVPDARGWFDADVLGEDTVVVQGGLGEDNERLRDVWILKLNP"
     gene            complement(<209801..>213451)
                     /locus_tag="ACHE_40077A"
                     /db_xref="GeneID:66981872"
     mRNA            complement(join(<209801..213234,213292..>213451))
                     /locus_tag="ACHE_40077A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278236.1"
                     /db_xref="GeneID:66981872"
     CDS             complement(join(209801..213234,213292..213451))
                     /locus_tag="ACHE_40077A"
                     /note="COG:O;
                     EggNog:ENOG410PIYY;
                     InterPro:IPR012317,IPR016135,IPR000608;
                     PFAM:PF00179;
                     TransMembrane:1 (i168-186o);
                     go_function: GO:0003950 - NAD+ ADP-ribosyltransferase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136035.1"
                     /db_xref="GeneID:66981872"
                     /translation="MPRKDFQRDLRQAANAQFPYLSNIKAGDNDGSIAFRFFHRAESI
                     KIEFQAVVSDSSDYPRLHSYFVFTTSDDVPKEITAAVEGVQPLLEGVSIARLLATVSQ
                     VVQSAIYGEDSLSDSLEKIGSDDEVEYDYEDEEWEATSDGHVLASMKPAAEARSMLRR
                     DLRVVKNAGFKLGYLGIATGSVIIVVSCRVSKLGISEDAMQAWDVKPSEYLVLLLRYP
                     SAYRNLEELLRNVGNRMPLLQMYVGLCTSYKPSHEDAVRVFQGSTAEQQQSNGPAESG
                     APGGASGPGIRRLFIDRAINSLLNERLLTIISYRLKLGLSWTGAELYAHQFQGKPSNF
                     EDQLSDEYFEPDSWSSGTPDLLMADHVVDSNLGKSQLSLPVLAMQFTLRHFVKCTEFC
                     LVCHCRVSTEFEALKPFVCSNNLCLYQYMALGMGPSLEYEILSQPYVVDLLISLTYCR
                     AKSGRLEDFPTGLGMKVPGGLGWTIKANLERNYYNPSNQQPALRPKPTATFYTAELNS
                     ASLELRVDDNERPPLKVGDWIAIMGFESDKDTNANNANANDSNLYLYNYMDMPPSGKG
                     QWHSRVQLIDDRIIHISSPINYSDLVAGPKKGESQKGKKDTVRTVKFVIYDQNFDKLD
                     DNEKRGVIPLILNTLPSLEAMTQYLNMASDGGSLALWKDLISPAALDILRWIVASNRS
                     FIMLDGDDNPEHLVPGMEGYVQFRLVQGAPDKEQKFESAVRKHTANPKHPSIFTWHGS
                     PLCNWHSILREGLNFKYTANGRSCGHGVYMARDFASSTGYSQQYGYTAYNDWPQSKLR
                     ISMAISLNEVVNATTNFVHASNVYVVSQVDWIQPRYLFVKCENAPPTSKAPAASLVYK
                     QDPALTVVGPTGHNLALPTSKLGGRGQQLRQMSKVDQTPKVQPVKETPASKQAKNPPA
                     KRAAPKSTAKKPKRRRTKNNEPEPEPESEPRPGPGPEIPTIDLTAKDDDTASVATLYE
                     DLEILLSDAEDEEPVDVIPKTDFVPGTLDESTLPILSHPKHASSSATKALQQHLKVTL
                     ETQNREYPGALGWYVDPKLINTVYQWIVELHSFDPDLPLAQDLKKANLKSIVLELRFP
                     PKFPHAPPFVRVIRPRFLPFQNGGGGHVTAGGAMCMELLTNTGWLPTATIESVLLQVR
                     MALCSQDPAPARLLNGGIGDYTVGEAVQAYKRACQTHGWGVPDNLNKVSWS"
     gene            <215911..>217047
                     /locus_tag="ACHE_40078S"
                     /db_xref="GeneID:66981873"
     mRNA            <215911..>217047
                     /locus_tag="ACHE_40078S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278237.1"
                     /db_xref="GeneID:66981873"
     CDS             215911..217047
                     /locus_tag="ACHE_40078S"
                     /note="COG:C;
                     EggNog:ENOG410PV9B;
                     InterPro:IPR023210,IPR036812;
                     PFAM:PF00248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136036.1"
                     /db_xref="GeneID:66981873"
                     /translation="MSQPLLSRYRQLAPTASVRVSPLCLGAMTFGTANSERYGQCSKE
                     SAFEILDYFYNQGGNFIDTANTYREEQSEIWLGEWLASRKNRDEMVIATKYTTGYQNH
                     HKGKIQANYGGNGTKSMRVSIEASLRKLQTDYIDLFYVHWWDYTVSIPEVMHSLNDLI
                     VSGKVLYLGISDAPAWVVSKANQYARDHGLRQFVVYQGMWNAAMRDFERDIIPMCRDE
                     GMGLCPYGVLNQGRFQTEEGFKEREKKNDGRNFIPLSQHDRNVSRVLEDVSKAKGVEL
                     LQVALAYVFQKTPYVFPIVGARKVDHIRGVVPASGISLSEEEVQKIESAYEFDPGFPH
                     TFLSGTLFSDGPPKGGYGPGDVWLTKALGTFDWVEPSKPITSQK"
     gene            complement(<219133..>220155)
                     /locus_tag="ACHE_40079A"
                     /db_xref="GeneID:66981874"
     mRNA            complement(join(<219133..219970,220037..>220155))
                     /locus_tag="ACHE_40079A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278238.1"
                     /db_xref="GeneID:66981874"
     CDS             complement(join(219133..219970,220037..220155))
                     /locus_tag="ACHE_40079A"
                     /note="COG:S;
                     EggNog:ENOG410PXZA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136037.1"
                     /db_xref="GeneID:66981874"
                     /translation="MQRSWTTGSHTGKGAQNNGQILERKDHSDEVTEYSQPDFSCEDG
                     LVKLQFGKRKESYSVPTCLVKKVQELATRLKPMADPIIWLEEIDEDIGHTIVHYLYTG
                     EYQTLRQSGTAHKRQTEYKRSVLVYCAAANLEIPHLQRIAAGHMERFANSVDIYQTLN
                     LVKTLFSSVPWWDGGLYFHIIKRLRNAFRADATIFERREFLGCLGGDLELDKLMVQIM
                     VSLWEPSKSKPWNHIQSVPENSLREGFPAMERCFELCSISRAPTPIGSEPYVKPDPVG
                     LSPVLGVDYFGQPSTGGEILKRRGSFSENPRKRIRNKFSGNL"
     gene            complement(<221795..>223312)
                     /locus_tag="ACHE_40080A"
                     /db_xref="GeneID:66981875"
     mRNA            complement(<221795..>223312)
                     /locus_tag="ACHE_40080A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278239.1"
                     /db_xref="GeneID:66981875"
     CDS             complement(221795..223312)
                     /locus_tag="ACHE_40080A"
                     /note="COG:Q;
                     EggNog:ENOG410PKUU;
                     InterPro:IPR001128,IPR002401,IPR036396;
                     PFAM:PF00067;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136038.1"
                     /db_xref="GeneID:66981875"
                     /translation="MLGLALLSILLVMYILFTRKRIQLPPGPQSVPFIGNLHQVPPSR
                     PWLGFEKWHKVYGPIISFKLGPQTFISLGSHQIAHNLLDKRSAIYSSRPRSIIAGECI
                     TKGLGIVFMPYGRQWRTQHRIQAEFLNPTLSQRYCALQDVETRQVVYDLLSSNDFSES
                     FHRMSSSLIFSLAYGKRMPRGDEHEVREIDELMTNLAEKQAPGKWMVDIFPVLNYLPR
                     FLASWKGLGDEYHHREATLFGDNMKKAESARSWNWSKDMKRIKEAKGLSDAELAYIIG
                     VLYEAGSDTTAGTLDYFVLACVLYPNAVCKAQQEIDDVVGAVRLPTFDDIPNLPYVNA
                     FLMEVMRWRPLAPLGIPHAVTQDDEYMGYHIPKGATILPNHWALSLDEEVFENPTSFK
                     PERWIENPKLPLDGFGFGRRVCTGRHIAMNSMQMIVTRVLWAYDIGYAYENGKKVEVD
                     PYGMVDAAVSKPVSFKADFQIRSPTRREIVEETWKGTEKDLDVIMDGVGPSRKNS"
     gene            complement(<223833..>224894)
                     /locus_tag="ACHE_40081A"
                     /db_xref="GeneID:66981876"
     mRNA            complement(join(<223833..224063,224112..>224894))
                     /locus_tag="ACHE_40081A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278240.1"
                     /db_xref="GeneID:66981876"
     CDS             complement(join(223833..224063,224112..224894))
                     /locus_tag="ACHE_40081A"
                     /note="COG:B;
                     EggNog:ENOG410PK2I;
                     InterPro:IPR001214;
                     PFAM:PF00856;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136039.1"
                     /db_xref="GeneID:66981876"
                     /translation="MAIGLQPKSTTPTAKQSHVHPHISQSYDPDKGRQLHATAPVKAG
                     DVLVVDPPYAAIPVVDDPAHSDEVLCSNGDCRRKIPRVGRIGCSNRCAVEVVWCDVGC
                     RDADRIRHGLECEWLRGYAPSLREDEGEYYFGVLWLIVRVLAARYEEKKQGSSMSMSK
                     EKFSSGWTAMTELCDNRKLWPEADLLHWQSLVEKYICADPSLRNILLSPDSILTLICQ
                     QESNSFGLYPKATGLASMSDRGEQYGAAIYPRSSIANHSCCPNITHKPDDHGRMVFTA
                     SRDIAPGEECCISYMDLFGDVDISTRRKHLREQFSFTCQCERCRAEENPEEGWDALPF
                     LDD"
     gene            <227354..>227733
                     /locus_tag="ACHE_40082S"
                     /db_xref="GeneID:66981877"
     mRNA            join(<227354..227525,227579..>227733)
                     /locus_tag="ACHE_40082S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278241.1"
                     /db_xref="GeneID:66981877"
     CDS             join(227354..227525,227579..227733)
                     /locus_tag="ACHE_40082S"
                     /note="COG:S;
                     EggNog:ENOG410PZQA;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136040.1"
                     /db_xref="GeneID:66981877"
                     /translation="MQLSILSIVSTLAATAIAVPVAVPGENHHSTATVKFLGAADASF
                     TQDFRTDGTETDIHNVLSISKISVPAGVTCTFDGIDGSVTKVSNQAVVDVGPPQTQVS
                     GACWNL"
     gene            complement(<227980..>228806)
                     /locus_tag="ACHE_40083A"
                     /db_xref="GeneID:66981878"
     mRNA            complement(join(<227980..228698,228746..>228806))
                     /locus_tag="ACHE_40083A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278243.1"
                     /db_xref="GeneID:66981878"
     CDS             complement(join(227980..228698,228746..228806))
                     /locus_tag="ACHE_40083A"
                     /note="COG:S;
                     EggNog:ENOG410PNU4;
                     InterPro:IPR005645,IPR029058;
                     PFAM:PF03959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136041.1"
                     /db_xref="GeneID:66981878"
                     /translation="MRVLCLHGKGTSGAIFKSQTASFRAHLAPLNIDFDFVDAPIPSS
                     PAPGVDLFYSPPYYSWWEGESAEAIKTARQWLKTHLILSGPYDAVMMFSQGCTLGSSS
                     LLLHAIEEPRSPPLFKAAIFICGGPPLAVAETLGYQMSFEMRERDNWSRAALAQQADS
                     SAILTQGAARWRGGWWDIPDEEQLREEMEFPWRIEIPTVHIYGDKDPRYLAGVQLSAL
                     FDTDNMKTYAHDGGHEIPRKDVVNRKIAELVKWALESAKLQ"
     gene            <229502..>230299
                     /gene="RRP46"
                     /locus_tag="ACHE_40084S"
                     /db_xref="GeneID:66981879"
     mRNA            join(<229502..229837,229889..>230299)
                     /gene="RRP46"
                     /locus_tag="ACHE_40084S"
                     /product="exosome non-catalytic core subunit rrp46"
                     /transcript_id="XM_043278244.1"
                     /db_xref="GeneID:66981879"
     CDS             join(229502..229837,229889..230299)
                     /gene="RRP46"
                     /locus_tag="ACHE_40084S"
                     /note="COG:J;
                     EggNog:ENOG410PMYB;
                     InterPro:IPR027408,IPR036345"
                     /codon_start=1
                     /product="exosome non-catalytic core subunit rrp46"
                     /protein_id="XP_043136042.1"
                     /db_xref="GeneID:66981879"
                     /translation="MVGPTATLTPLARTDGSASYQCPATGFNILSSVNAPVELPGRRD
                     ALKPEDATVEVLVKPGTAPNGVGEQYVKEIIKNMLGKLVLGRERGFPRRGVVVTLAVI
                     GGESVARGDSYLTMLPALLHASLLALLSAAVPLSMTFSATVLAVTRPGDIVSEPSLKI
                     AKAATSLHALAFSSKGHLLLNESQGTFDFDTWERVHDRALTLCRGQAGGSDEDVSMAE
                     NGDGQPLEGFIRETVEDKVHRDYAWKIDED"
     gene            <231099..>233106
                     /gene="UTR1"
                     /locus_tag="ACHE_40085S"
                     /db_xref="GeneID:66981880"
     mRNA            join(<231099..232542,232595..>233106)
                     /gene="UTR1"
                     /locus_tag="ACHE_40085S"
                     /product="NAD(+) kinase"
                     /transcript_id="XM_043278245.1"
                     /db_xref="GeneID:66981880"
     CDS             join(231099..232542,232595..233106)
                     /gene="UTR1"
                     /locus_tag="ACHE_40085S"
                     /note="COG:G;
                     EggNog:ENOG410PGK0;
                     InterPro:IPR017438,IPR016064,IPR017437,IPR002504;
                     PFAM:PF01513;
                     go_function: GO:0003951 - NAD+ kinase activity [Evidence
                     IEA];
                     go_process: GO:0006741 - NADP biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0019674 - NAD metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="NAD(+) kinase"
                     /protein_id="XP_043136043.1"
                     /db_xref="GeneID:66981880"
                     /translation="MASFSASHGPLKHDTNNSDADSSSSSSPSPATSTATTAATARIA
                     TGPPPSAAPSLHSRDHVAHIDTSQTIETTPKASVNRSSSDSRSTVVAAQRFELPRTES
                     ESLLSSPSPSFLSLRSLTAPNHHPYRHRNALSSDTIPHQTIMKAIASRPSWSGSDSNM
                     PPAASLGPLPSNTYPSPPAEKEEQLSSQSLAAALNRLQPEHELLDRSLVLQSPCFFHQ
                     RFDDAVNIKKVLEEIADDEWLSHSRLVQTATGVREVSKQLQRRPIKRAVKNVMIVTKA
                     RDNSLVRLTREVAAWLLSTPRYGSDLGVNVYVDAKLRNSKRFDAAGLLQSEPRFAHML
                     HYWTPDLCWSAPEKFDLVVTLGGDGTVLFTSWLFQRIVPPILSFSLGSLGFLTNFDFD
                     DYKSHLNAVMGDVGMRVNLRMRFTCTVFRKDRSKGAEAGAVEEGEQFEVLNELVIDRG
                     PSPYVSNLELYADNELLTVVQADGCIFSTPTGSTAYSLSAGGSLVHPSIPGILLTPIC
                     PHTLSFRPMVLSDSSLLRIAVPINSRSTAYCSFDGKGRIELRQGDYVTIEASQYPFPT
                     VVSGNGEWFQSVRRALRWNTRGAMQKGWNGPSPDDPDFAVDGNEDEEWDIDTDVGLGG
                     TDSGVGPSEDGDVPTSPIRRQMSLLQM"
     gene            <233537..>234335
                     /locus_tag="ACHE_40086S"
                     /db_xref="GeneID:66981881"
     mRNA            join(<233537..233539,233601..233734,233830..234151,
                     234225..>234335)
                     /locus_tag="ACHE_40086S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278246.1"
                     /db_xref="GeneID:66981881"
     CDS             join(233537..233539,233601..233734,233830..234151,
                     234225..234335)
                     /locus_tag="ACHE_40086S"
                     /note="COG:T;
                     EggNog:ENOG410PNJ2;
                     InterPro:IPR000614,IPR029016,IPR003018;
                     PFAM:PF13185,PF01590;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136044.1"
                     /db_xref="GeneID:66981881"
                     /translation="MPHADSSYFAPGLSKDEVYTQMIEQTRGLIYGQRNWVRMFPRIL
                     TDNLSNTASLLWHAYAVLPSNINWAGFYIRDDKFPLTSTPQSSDRVLLLGPFQGKPAC
                     QLIHFGRGVCGTAAAKQETVVVDDVMAFPGHIACDAESRSEVVVPILVGDETVAIIDI
                     DCTEEKGFDEVDRKHLEALAGVLAEGCDW"
     gene            complement(<234433..>236160)
                     /locus_tag="ACHE_40087A"
                     /db_xref="GeneID:66981882"
     mRNA            complement(join(<234433..234734,234790..235632,
                     235690..235922,235974..236034,236082..>236160))
                     /locus_tag="ACHE_40087A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278247.1"
                     /db_xref="GeneID:66981882"
     CDS             complement(join(234433..234734,234790..235632,
                     235690..235922,235974..236034,236082..236160))
                     /locus_tag="ACHE_40087A"
                     /note="COG:E;
                     EggNog:ENOG410PMI1;
                     InterPro:IPR002293,IPR004840;
                     PFAM:PF13520,PF00324;
                     TransMembrane:10
                     (i32-59o65-83i120-145o157-176i188-206o226-246i267-292o312-
                     333i434-457o469-489i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0006865 - amino acid transport [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136045.1"
                     /db_xref="GeneID:66981882"
                     /translation="MSGKESQVFSGSSNEDVRLGDLGYEQELKRSFGLLGMVGFSFSV
                     VTSWTALCGVFVVGITSGGPPVMVFSFLAISIITLAVAIPMAEMCSMYPVAGGQYSWV
                     AALAPPSIARGLSYVSGWFMLIGVLAMGATNNSIAANFVLGMANLVFPSYTIERWQTV
                     LVAYLVALLGTAVNLWGAHLLNRISRFILIWNVGSFLITMIVLLATNDNKQPASFVFQ
                     DFQNFTGWGSSMAAIVGILQACFGMCCYDAPSHMTEEMKSASKEAPKAIILSVILGAV
                     TGFAFLLTLCFCIGDINETANTTTGVPVIQILYDSTGSKAGTCVLASMISVIVIVAGN
                     NLIAEGSRSIYAFARDHGLPFSGFLSRVSTKKQVPVNAVLLTLAVQLALDAIDFGTTT
                     GFETVIAIATEGFYLSYATALSSRLLGYVTGHKTHLTGPFSLPLPISIALNVLGLLFL
                     LFAAITFNFPTTYPISHESMNYTSAAIGVIAVIALFTWLTTGRKRFAGPGGVTFS"
     gene            <236782..>237819
                     /locus_tag="ACHE_40088S"
                     /db_xref="GeneID:66981883"
     mRNA            <236782..>237819
                     /locus_tag="ACHE_40088S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278248.1"
                     /db_xref="GeneID:66981883"
     CDS             236782..237819
                     /locus_tag="ACHE_40088S"
                     /note="COG:C;
                     EggNog:ENOG410PFM7;
                     InterPro:IPR023210,IPR036812;
                     PFAM:PF00248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136046.1"
                     /db_xref="GeneID:66981883"
                     /translation="MKYVKLGSSGLRVSPICVGCMSFGQPDKQFQWTLPEEEALPVLD
                     HCYRSGLNFFDTANVYTNGNSEGILGKAIKKFNWRREAIVIATKLCAPVGHSQDETPL
                     FMSEDDRNNAGYVNQYGLSRKHIFESVDASLERLGLPYVDLLQIHRADPSTPAKETME
                     ALHDIVKSGKVRYIGASSMWAHQLLEYQYTARLHGWTEFISMQNLYNATYREEEREMF
                     PACAQFGMASIPWSPVAMGFLARPWKAFQESARGQSMNGAFMGHPITDVDKKINEKIE
                     EIASARDVSMAIVALAWALSKPFITSPIVGMSKKERVDEAVKAIEFKLSEEEIKNIDE
                     LYVPKGVIGHR"
     gene            complement(<238062..>240205)
                     /locus_tag="ACHE_40089A"
                     /db_xref="GeneID:66981884"
     mRNA            complement(join(<238062..238174,238229..238674,
                     238732..239054,239110..239837,239905..>240205))
                     /locus_tag="ACHE_40089A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278249.1"
                     /db_xref="GeneID:66981884"
     CDS             complement(join(238062..238174,238229..238674,
                     238732..239054,239110..239837,239905..240205))
                     /locus_tag="ACHE_40089A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136047.1"
                     /db_xref="GeneID:66981884"
                     /translation="MLTTLRRLRGVFPQRNPPAETSPPLQTSPRTSTSSPPEIRSSLQ
                     DEAFAVKMLLGRCQVAKNDYKCPCKNGKSVSRTGVLDKTALCEECIHPLYLHDQFTEK
                     SPAAPTSLPPRVRFSDYPQYCPRTDTVQKIATLLDQEKIIHIRGTPASGKSLLANFLY
                     EYFFSRNQEVYLIDEWPQDRKETALELVLSACLPEGRRTIAQLIQSNLILILDESQYT
                     YSDSGLWYKFLKIAGGNARPANGVRVCLFSSYGSPTTGAPQMDYPESITPPMFSNHQR
                     VSLVPSSEPGSPDISLFFTREEYNDVVIRYCKMAKEYMINTDLAEYVFMATNGHPGLV
                     MAIMDYIFDFYRSNLKRIRISILTMDNTRVALVDNNRLFSSIADRFASRSLPIRELLG
                     TDEGPIIDSLLNVLRHGYAPLTSDDYGLNRSFRRGFVHTTLDPDTRGMICVFPSPLHA
                     RYVEFMYGQGGGAAFPKDRFPGIEDLCKAVVKGFSRRILCQIRDGRRPGTSGQLRPLE
                     ASFQDEFYRSFWREVPNGGLSSEWSFGGSGRVDFFVIGPGWGVELLRDGDRLDQHCSR
                     FKGGDGAYYADIEAGIMKDWLILDCRHNHPRTPRPTERRLWRLIFSNDYSRVDILDCE
                     NNVIEQYALGNW"
     gene            <243061..>244478
                     /locus_tag="ACHE_40090S"
                     /db_xref="GeneID:66981885"
     mRNA            join(<243061..243357,243428..244014,244079..>244478)
                     /locus_tag="ACHE_40090S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278250.1"
                     /db_xref="GeneID:66981885"
     CDS             join(243061..243357,243428..244014,244079..244478)
                     /locus_tag="ACHE_40090S"
                     /note="COG:S;
                     EggNog:ENOG410PGIZ;
                     InterPro:IPR018713;
                     PFAM:PF09995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136048.1"
                     /db_xref="GeneID:66981885"
                     /translation="MRLYFMSTSIMSYALGKSGKRISAQQRFLYALLGLCAYLALVSS
                     LRFRRCRKLHRAYPYRTRGEMSKMTDYDAWAIQKQIMQGEFPFMMLKALQFALFRTYG
                     IPTISSLLLKMSQFSDPGTSFKRYADTGTLIGEFIAFEPYSDRAQTAIARTKYLHKGY
                     RASGKILESDMLYTLSLFATEPIRFVTLYEWRDLTNMERCAVGTYWKSLGDALGINYD
                     ALPSGRTGFQDGITWLEEISAWSQQYEAEHMRPHPRNKEIADKTIDVLLYYMPRFMKP
                     MGVNLIAYLMDDRLRNAMMMEPVPPALSAALAAIFRLRRFYIRYLALPRPDWNRLNAF
                     TDKPNEHGRHFLLQLQGAPYYVRPTIWNRWGPAACVKRVLGQPLPGDEGDKYSPQGYY
                     TPDLGPKYFEGKGRKEMEAIKLGLQQTRQGQCPFP"
     gene            complement(<247164..>250147)
                     /locus_tag="ACHE_40091A"
                     /db_xref="GeneID:66981886"
     mRNA            complement(join(<247164..249883,249944..250072,
                     250129..>250147))
                     /locus_tag="ACHE_40091A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278251.1"
                     /db_xref="GeneID:66981886"
     CDS             complement(join(247164..249883,249944..250072,
                     250129..250147))
                     /locus_tag="ACHE_40091A"
                     /note="COG:M;
                     EggNog:ENOG410PY8W;
                     InterPro:IPR002110,IPR036770,IPR020683;
                     PFAM:PF12796,PF13637,PF13606;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136049.1"
                     /db_xref="GeneID:66981886"
                     /translation="MDIFASAPSPDTPEWVVVCTPVSPGMRLEWNASLPWLRFISLLR
                     PGPNQDAPSPSSSLTVPSPREVNVSCHIASRELMRRLASIVQWDRLNNPPNIYSSSRT
                     TAALMILMPEDSEVKHLTLSSALGDSNQSGRNRLILELFLLSNNLVSHAPGGRSEGSM
                     LSDDRRVMEMFNESGWNNIKHIQMLLSTHEPTAGAIAEKLFASAVRLVAMDTVKNMLE
                     AGMDPNATVDTIHYGPVSSLQFAALSGKKGLELMQLLLSYGADVNFSHNGNSALEFVI
                     CGSKMVSQVLLDHGAIVTPSCLSAVATCKIIDDFVMNIINACPDVNERTGWQDPSALT
                     RAVSHSNVEMIGLLLGRGADVNELVAIDFDNDLAVTTVLGLAAKSMNPQMVQRLLWAC
                     RNVNPEFDGLPYVSPLALAVETGNVEITRLLLQGGVNIEVADGQGSMTLLERATRKGP
                     SLWRLLMEYGARVDRPLSDTKHPSSAILVAIKEKQSDLVELLINSGARLNDEYSQPPG
                     TVLGAAIELGDPVLIDKLLTAGARVLKGKLLSRIGNLHTAMHLQQRGVLQRILQISGP
                     TILAAALSARDDDFSHYLLEQNADIAKGFTSSQDSRSVKTPLGAAIRTGNFIFAGTLL
                     SRGAEVTDGDLADAIGHLVVNAEFLQRLLSGVRGNIPTAVGVAVLGNHQYLEVLREAN
                     VDPTGAPQLFQDFWDLEEFEFEPPQSVLEIAVILGKEALSLLLHWTTWNPRLTGRALA
                     AAIVFKECDLVDSLLACGPDMQQEVAIRYLLWEDEEDETATERHEIFTPLQAAVKEQL
                     VPVAKVLAKSADVNYLGGGARRRTPLQHAVEKGNMELIKMLLQHGARVDSPPARDGGA
                     TALQIAAFQGYIGIARRLIDLGASVNEAPARFNGRTALQGAAEHGRIDMLQMLLDEGA
                     LIVGDGEQQYQRAVELAERNGHKAAARLLRSYRNSVQLSTP"
     gene            complement(<250191..>250520)
                     /locus_tag="ACHE_40092A"
                     /db_xref="GeneID:66981887"
     mRNA            complement(join(<250191..250347,250402..>250520))
                     /locus_tag="ACHE_40092A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278252.1"
                     /db_xref="GeneID:66981887"
     CDS             complement(join(250191..250347,250402..250520))
                     /locus_tag="ACHE_40092A"
                     /note="InterPro:IPR025676;
                     PFAM:PF14420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136050.1"
                     /db_xref="GeneID:66981887"
                     /translation="MAGAEWEPFKLETERLYCYENKTLRQVKDYMASKYDFDKSIQQY
                     QRQLAKWGFRKNPTRPGDWEFIGRRTEKRKRNDDKESEVHVWGRASA"
     gene            <251830..>252472
                     /locus_tag="ACHE_40093S"
                     /db_xref="GeneID:66981888"
     mRNA            join(<251830..252191,252265..>252472)
                     /locus_tag="ACHE_40093S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278254.1"
                     /db_xref="GeneID:66981888"
     CDS             join(251830..252191,252265..252472)
                     /locus_tag="ACHE_40093S"
                     /note="COG:S;
                     EggNog:ENOG410Q2M8;
                     InterPro:IPR013087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136051.1"
                     /db_xref="GeneID:66981888"
                     /translation="MAWPADQSSWNQGNIYFGYHSADPSPSVPLPQLPGLSWELPADG
                     VHPWGCYPPDCVSCRVMSASVPSPRVVASGPNPDRSDHSDPTGTISTSHQPSVEGSVH
                     QEPKSQSQTKKKNTRQTPDHLSGAPLQCKWEGCRYSGYFNREHELIRHLRKIHIAPLA
                     HPCPVENCTKVCNRGDNLLQHMKNRHGLG"
     gene            <253934..>255727
                     /locus_tag="ACHE_40094S"
                     /db_xref="GeneID:66981889"
     mRNA            join(<253934..254077,254176..254448,255101..>255727)
                     /locus_tag="ACHE_40094S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278255.1"
                     /db_xref="GeneID:66981889"
     CDS             join(253934..254077,254176..254448,255101..255727)
                     /locus_tag="ACHE_40094S"
                     /note="COG:S;
                     EggNog:ENOG410Q29X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136052.1"
                     /db_xref="GeneID:66981889"
                     /translation="MPNNSKSTKIPDPPMLTDGKEPRFEDWLLLMSQKLAANADHFDL
                     SQLFDTLNHLKTIYNDPNRVTTAKHQFQQLYMKTSDKFHDFLSESLCLAAEAGVAEDD
                     LRDELYTKLTTKLQELCISSSISDGTFQEFSSAASQTAFLISDLGQHDMIIERKWFDS
                     HDVWLNAKHRKLVLPEHRSYLGDVQSKQYLEALKQGLQCPKPDSIHQADMERRDRQIE
                     KEEQRERYQAPWKEESGQRSDMAKVSHTLQGQEIGAITTNSKPRRKTTTNQPTVQTDI
                     AAIGAAPFQRYLEKDTEVFITSLSEIGRVLKEKRAEERQEEDRQEQELIYSCYACFLP
                     LRAHPVVFDESSP"
     gene            complement(<257428..>258313)
                     /locus_tag="ACHE_40095A"
                     /db_xref="GeneID:66981890"
     mRNA            complement(join(<257428..258068,258127..>258313))
                     /locus_tag="ACHE_40095A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278256.1"
                     /db_xref="GeneID:66981890"
     CDS             complement(join(257428..258068,258127..258313))
                     /locus_tag="ACHE_40095A"
                     /note="COG:S;
                     EggNog:ENOG410PP0S;
                     InterPro:IPR037401,IPR032710;
                     PFAM:PF13577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136053.1"
                     /db_xref="GeneID:66981890"
                     /translation="MAYNGTAKETEPNTWLHLNGTADQILDRYCVSELVRGWPLYVDY
                     SEWKNYRACFADDAWVLTLCSGGSQPIDNFVKNSQTGRKNGVFMAHRELGTLVDLNPS
                     TNRAVGKMKVTITQRFIDPSTKIEYDVDCDARFIMYCLKTPAPANTGSPVPGTGLGPR
                     ANSGGWKIQYVKLIYEKDKVVSVDGKTVPTFPKEELDQYPYAHRYLAAARARQGEHPR
                     KDMPTLIETEQFWNMYHAIDEWLNGQDVKKTLGIRVDVYKYGALTGTRDCDRYLNLA"
     gene            complement(<261299..>261974)
                     /locus_tag="ACHE_40096A"
                     /db_xref="GeneID:66981891"
     mRNA            complement(join(<261299..261503,261559..>261974))
                     /locus_tag="ACHE_40096A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278257.1"
                     /db_xref="GeneID:66981891"
     CDS             complement(join(261299..261503,261559..261974))
                     /locus_tag="ACHE_40096A"
                     /note="COG:S;
                     EggNog:ENOG410Q2M8;
                     InterPro:IPR036236,IPR013087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136054.1"
                     /db_xref="GeneID:66981891"
                     /translation="MSCPHDFDWHAPDARANGHKRTAGTPQNVPGLLNNTSNLALLGH
                     AAASSQELLNQGYPGAAGDPEWYLGSLSWLSDETPFGQSSNGHDEATGHQDTHHSIDV
                     PPLDSNAGSSAQVPHIPTAGPSGSSRRRTTSLKERRSDAVTGAGPVKCEWKGCTYPDV
                     FSRRIELKRHVETKHIFPRSYECPEPGCQKLFNRGDNLRQHLHRMH"
     gene            <265946..>266662
                     /locus_tag="ACHE_40097S"
                     /db_xref="GeneID:66981892"
     mRNA            join(<265946..266004,266053..>266662)
                     /locus_tag="ACHE_40097S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278258.1"
                     /db_xref="GeneID:66981892"
     CDS             join(265946..266004,266053..266662)
                     /locus_tag="ACHE_40097S"
                     /note="COG:K;
                     EggNog:ENOG410PIN0;
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136055.1"
                     /db_xref="GeneID:66981892"
                     /translation="MSETGEIDELMFQAHLLIHVSTIGVHRPLSALKFNAVENVSSCA
                     REPPLDTPTPDLVNVHTLRVLRAIEAQIRLLALPVRQFHHTPFTTCMVSEGMLALLSA
                     CSAILKERDLATARDQIRMTLGCLKVLGEVWPRTARNVREIQTIAQCVLGLGCVATGG
                     STPKPSEHPSLGGEGACLDFSTSGLPGSNIDMIASIGSIEDLCGWYNPGNLDDIPWGV
                     SDGL"
     gene            complement(<266891..>267751)
                     /locus_tag="ACHE_40098A"
                     /db_xref="GeneID:66981893"
     mRNA            complement(join(<266891..267349,267614..>267751))
                     /locus_tag="ACHE_40098A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278259.1"
                     /db_xref="GeneID:66981893"
     CDS             complement(join(266891..267349,267614..267751))
                     /locus_tag="ACHE_40098A"
                     /note="COG:C;
                     EggNog:ENOG410PJPN;
                     SECRETED:SignalP(1-19);
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136056.1"
                     /db_xref="GeneID:66981893"
                     /translation="MQQMGIIGIAFAGVCTALSAKCVIELNVGEDVGIAVTIVSPKPK
                     LIASNFEEHLLSLASLPSSPARNAVVVGGCGFTRTEIAAELPSCLRSILSVPDVRPVI
                     VEQANQIDRELGSNPRTVILCGLKKQDVEMNLGSAVASVGKRRRDCHRRAYPNLHRSL
                     DSWTRSSLLDAADIRRERQSQSRRGYLVLPILTVKDLI"
     gene            <270655..>271141
                     /locus_tag="ACHE_40099S"
                     /db_xref="GeneID:66981894"
     mRNA            join(<270655..270680,270748..>271141)
                     /locus_tag="ACHE_40099S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278260.1"
                     /db_xref="GeneID:66981894"
     CDS             join(270655..270680,270748..271141)
                     /locus_tag="ACHE_40099S"
                     /note="COG:S;
                     EggNog:ENOG410PPVM;
                     InterPro:IPR014710,IPR011051,IPR013096;
                     PFAM:PF07883;
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136057.1"
                     /db_xref="GeneID:66981894"
                     /translation="MQEPTYDSQCPMATTTVAYQYRLVNCPGRTIVGMLVEYPPNGAT
                     PPHRHGGASVSAYVIHGSLLNKMNDEPMRMIERGGSWYEAPGCHHRISANASQTEPAA
                     FFVNFVIDSETLEREGPSVLLQYDAEYKDIVAQKMQV"
     gene            <271712..>272728
                     /locus_tag="ACHE_40100S"
                     /db_xref="GeneID:66981895"
     mRNA            <271712..>272728
                     /locus_tag="ACHE_40100S"
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /transcript_id="XM_043278261.1"
                     /db_xref="GeneID:66981895"
     CDS             271712..272728
                     /locus_tag="ACHE_40100S"
                     /note="COG:C;
                     EggNog:ENOG410PWJX;
                     InterPro:IPR036291,IPR020843,IPR011032;
                     PFAM:PF13602,PF00107;
                     SMCOG1028:crotonyl-CoA reductase / alcohol dehydrogenase;
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /protein_id="XP_043136058.1"
                     /db_xref="GeneID:66981895"
                     /translation="MQAIRVHPDPSKSTPYSPFNPAPSTSLQLDHDVPIPRPSQPGEL
                     LVRVKATTVIRDMLAWPETYTHEYAILGNDLAGVVTEVFSPDSKFNPGDKVFGMANVD
                     RAATWAEYTVVKEHEVALKPTALTFAQAAALPLSAQTAYEALFDHAGLPLPTMEEIMS
                     RSALRKDQHVLITGAAGAVGIYLVQLAAAAGVRVVAATSSNARNGEFLRGLGADETVE
                     YGMLECYRGAFDVIIDMVGGEVLEQCWEYISKTGVLVSVDSASFNFVEEHEKRGLRKA
                     GVHALFFIVKGSTEALHYLAELADMGAIQSFVVDSWPLAKAREAYDIANGRYSGRGKF
                     ILTV"
     gene            complement(<278980..>279340)
                     /locus_tag="ACHE_40101A"
                     /db_xref="GeneID:66981896"
     mRNA            complement(join(<278980..279178,279240..>279340))
                     /locus_tag="ACHE_40101A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278262.1"
                     /db_xref="GeneID:66981896"
     CDS             complement(join(278980..279178,279240..279340))
                     /locus_tag="ACHE_40101A"
                     /note="TransMembrane:2 (o24-44i65-82o);
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136059.1"
                     /db_xref="GeneID:66981896"
                     /translation="MTKEVKSAGRAYENVHRYPACSRVFYYVRWILIMLAVGSIALPV
                     EHYVKCRYYQKNEKAACRGESNSVMIVLGCAFLVWWPIERAMFYLARQYVRNPTQ"
     gene            <279948..>280998
                     /locus_tag="ACHE_40102S"
                     /db_xref="GeneID:66981897"
     mRNA            join(<279948..280189,280251..>280998)
                     /locus_tag="ACHE_40102S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278263.1"
                     /db_xref="GeneID:66981897"
     CDS             join(279948..280189,280251..280998)
                     /locus_tag="ACHE_40102S"
                     /note="COG:S;
                     EggNog:ENOG410Q1H0;
                     SECRETED:SignalP(1-19);
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136060.1"
                     /db_xref="GeneID:66981897"
                     /translation="MKFIPVAVGLLYLIQLGLSAPLNNEDPLGALAQHGDTPGIQSLD
                     PRSTNEAHGALTQLEARAPRCINRAIELLNLRDSSAVLSYVTLSGLMAHSICEHYHDE
                     ECAYWVKLVTGAINFVFAVSRRGARTQGAVGESPDNEVSSFARRALLAESYADAVAQA
                     FSELGMEYNGIEDVDILSLSHTKRDAIEPDLTRRLIVRGIKADSFTHDIAFNQYSNGG
                     HVLHLGGLNESLQANPSSEIAKRTSFGQEGLKVSAFVEAPSTLNIADSNEVANAIGED
                     WVHRAAYNDISEYIGYVMGGSKINFIYRIIPKVQGFGLNYEDVGVCGAVGPPK"
     gene            complement(<282450..>282755)
                     /locus_tag="ACHE_40103A"
                     /db_xref="GeneID:66981898"
     mRNA            complement(<282450..>282755)
                     /locus_tag="ACHE_40103A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278265.1"
                     /db_xref="GeneID:66981898"
     CDS             complement(282450..282755)
                     /locus_tag="ACHE_40103A"
                     /note="COG:S;
                     EggNog:ENOG410PV0Z;
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136061.1"
                     /db_xref="GeneID:66981898"
                     /translation="MADFLINYRPFKFTASAAISDGIRCSIDISFIHTSVSAELSTEL
                     TLWAPPETGRVHANLVTSFDINFGDSQAITDPITLMNFYEFVLQSSQKTPSALQICL"
     gene            complement(<283801..>286584)
                     /locus_tag="ACHE_40104A"
                     /db_xref="GeneID:66981899"
     mRNA            complement(<283801..>286584)
                     /locus_tag="ACHE_40104A"
                     /product="putative NRPS-like protein biosynthetic cluster"
                     /transcript_id="XM_043278266.1"
                     /db_xref="GeneID:66981899"
     CDS             complement(283801..286584)
                     /locus_tag="ACHE_40104A"
                     /note="COG:I;
                     EggNog:ENOG410QDSG;
                     InterPro:IPR000873,IPR009081,IPR036736,IPR029058,
                     IPR001031,IPR000253,IPR042099,IPR020845;
                     PFAM:PF00501,PF00550,PF00975;
                     SMCOG1002:AMP-dependent synthetase and ligase;
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016788 - hydrolase activity, acting on
                     ester bonds [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative NRPS-like protein biosynthetic cluster"
                     /protein_id="XP_043136062.1"
                     /db_xref="GeneID:66981899"
                     /translation="MSIGNLQQLLEAVSAEEGSGNVIAYSQGNLGHLKVYSYKQVLEA
                     AQKASWALRSRGETYRPGSVILLHFEAHWDAIVWFWATLFAGCIPCMSTALSNNSAIR
                     LNHLEHLSKALINPSCLTTSTLLHEFADQEHINPIPIESLNAEKATSDELNNINRESK
                     QTDVALLMLTSGSSGNSKAVCLTHHQIFTAIAGKYSVIELPEGTSFLNWIRLDHVAAI
                     VEIHLQALFARKDQIHVQAPDFLADPLQYVNLIDKHRVSRTFAPNFFLAKLRAALQGL
                     EAQNNPRNWDLSCLKYIASGGEANVVKTCDVVSQLLSQYGAPAHVIVPGFGMTETCAG
                     SIFNTKCPTYDKERSLEFTSVGACMPGIKMRITEGSNNETVPAGVVGNLEISGPVVFK
                     SYFNNPTATEESFSSDGWFKTGDKGSIDETGYLTLQGRAKEAMIINGVKYNPHEIETA
                     LDESKIPGLTPSFNCCFSYFPAGCETEEICVTFLPSFTPEDTVARVETVDAISKSVMM
                     ATGSKAQVLPLDRSQLQKSALGKLSRNKIKTAYQKGEYRTYEDINNETVSQYRAATRQ
                     NPQNELEQQLLDIFIRCLGLPENDFDIKTPVFNMGITSVELIKLKKNIEEHLDLTQEI
                     PMITLMTNTTVHDLAKALYDLQAPHEYNPVVTLQSQGYKTPLWLIHPGVGEVLVFLNL
                     AKFIVDRKVYALRARGFNESEQPFQSIPEVASTYHTAIKQKQPEGPYALAGYSYGSML
                     AFEVGKLLESNCDKVSFLGSFNLPPHIKTRMRQLDWKECLLHLSYFLDLMTEAHARKL
                     AAELRGATREQAMAKVMEDADQDRLFELALSPEALNKWATLAFALQSMAVDYDPSGSI
                     ASMDVFYCIPLAVVASSKEQWRNEHLSKWVDFTRSEPRFHEVGGAHYTMLGPEHVFNF
                     QKTLRAALDARGI"
     gene            <288190..>289519
                     /locus_tag="ACHE_40105S"
                     /db_xref="GeneID:66981900"
     mRNA            join(<288190..288207,288254..>289519)
                     /locus_tag="ACHE_40105S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278267.1"
                     /db_xref="GeneID:66981900"
     CDS             join(288190..288207,288254..289519)
                     /locus_tag="ACHE_40105S"
                     /note="COG:C;
                     EggNog:ENOG410PV1Z;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     SMCOG1087:hypothetical protein;
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136063.1"
                     /db_xref="GeneID:66981900"
                     /translation="MEGNKKVIIIGAGICGLATAIRLRDHNGLEPVIYEIRGRDAGTL
                     GGSLGIPCNGLLLLNRLGLWDSVSVRGVDIAKTVLHSTSGGILKEVDVSTEPKEKTGF
                     GYHRINRSKLMDCLMEGVERSQISIHWEKRLVSINDNADSITVNFSDGTSETASLLLG
                     CDGIHSTVRTLHVDPGFKPEYSGISAVSSIVDVPNPNDKQPCLHSTLTPQGMLASAPC
                     PNNQTFWFFSKQVPLPSQDSEDARYGWSLHRQKEMTEFRESLSTVLDGVHGDWGQHLR
                     RLVDTSKDVHFYPHYRLPLGGKWFKPGTTRCLLLGDAAHAMQPHAGQGVSIVMEDVFL
                     ISGLLKKFENKEYDSLEAVFAKFDEIRRPRIDRISLTAQRNGAKRKNQNPWVVWAKEW
                     VVWAMSYVSSVWGMSVSGVDHGDVIYDVEDELKNC"
     gene            <291252..>293521
                     /locus_tag="ACHE_40106S"
                     /db_xref="GeneID:66981901"
     mRNA            join(<291252..291614,291677..292054,292104..292397,
                     292447..292568,292618..292950,293004..293295,
                     293357..>293521)
                     /locus_tag="ACHE_40106S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278268.1"
                     /db_xref="GeneID:66981901"
     CDS             join(291252..291614,291677..292054,292104..292397,
                     292447..292568,292618..292950,293004..293295,
                     293357..293521)
                     /locus_tag="ACHE_40106S"
                     /note="COG:S;
                     EggNog:ENOG410PNHK;
                     InterPro:IPR041640,IPR002227,IPR008922;
                     PFAM:PF00264,PF18132;
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136064.1"
                     /db_xref="GeneID:66981901"
                     /translation="MVTKPPSYPIKGINTLDPQGRRPVRKNIDDWYKEQTMDDNSQRI
                     QLTLFVEALAIVQALPFEDVRSWFRIAGIHSQPWVAWDNASAPKGPKEVPKDRVPGYC
                     VHNDYTFPTWHRVYVTLLEQVLHEAMNEFIDKNVPDQWETEWRNEAKQWRLPYWDFAR
                     FANKPEVEVPEGAVGELRLPILLVKPNVEIRSVSKNKTTVETKTVANPFYKYTAPKVM
                     GKLDSPYKIQTETRTKTDHNGKSTSWTIPWDKCISTTKYGLLEGYHVDIWADGGQNWL
                     RSNLALNEHAWGPQPAKPQQTVQFMTWKLLQQNGGPTSWTAFSSTRYCRSHDEKPEYW
                     LSLEMIHNNIHAFVGGSQFIRPDEKHMKLWGMGHMASPLVAAFDPIFFIYHCNIDRLT
                     AIWQFLNPTKWFDGDSASALNNDLLPFSKNDKHETYKSEDVKDWRKLGYDYEILQDKN
                     DHNQEHIKQVKKDIDTLYSKRTRALFPGLDKEERDESDYIITIYYNRYALNGEPYKIN
                     LFVGEKPEEDFIGPGSKNFVASIYSFSAPLPADGDGGCGNCKQQQKEGVRSVAQVPAT
                     FAVDKFANEDAGHPKDNVWFVVVDSLGQQVDLKRLGSPIEATLHRAEKATFLHEVDDN
                     SPTDYEKIGDGKQVVYGEATTSFR"
     gene            complement(<294203..>296296)
                     /locus_tag="ACHE_40107A"
                     /db_xref="GeneID:66981902"
     mRNA            complement(join(<294203..294427,294480..294813,
                     294880..295010,295062..295455,295504..295624,
                     295671..295768,295828..295910,295962..296098,
                     296149..>296296))
                     /locus_tag="ACHE_40107A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278269.1"
                     /db_xref="GeneID:66981902"
     CDS             complement(join(294203..294427,294480..294813,
                     294880..295010,295062..295455,295504..295624,
                     295671..295768,295828..295910,295962..296098,
                     296149..296296))
                     /locus_tag="ACHE_40107A"
                     /note="COG:G;
                     EggNog:ENOG410PWM6;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     SMCOG1005:Drug resistance transporter, EmrB/QacA;
                     TransMembrane:12
                     (o42-68i80-99o111-130i137-158o198-221i242-264o276-299i311-
                     333o345-368i380-397o403-425i531-550o);
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136065.1"
                     /db_xref="GeneID:66981902"
                     /translation="MSPTERGPDMPPDEGSPLLQSRGPTYSGTSDPPVKTKHPDLFII
                     YATFFGVFIASIDESLVLSTFSTIASQFHLLSQGSWLLVAYNFGYCISLPVYGALSDS
                     YGRKNVLLVSYILFTLGCFACGASASLTQLVLARVLAGLSGAGMVTLVSIIIMDLVPP
                     SEVAVYRSYENVINVIGRSVGAPLGGLLSDTIGWRWSFLGQIPLIIFCTLVAVYGLPA
                     SLNHTEDKNKQPSGKPRRSRLREIDFAGIITLSATIILLLFVLQTLGTREEDQLVPTW
                     GLVVAFVVSFMVFVLAEVFYATRPLIPMHLLIRELGAYCLMQCLLFSGRTAFVSNVVP
                     YFTRVEGESDFAASMMYVQVAAGVSLGGVVSGYVIKRMRRYKTMSIISLGITVLSFLL
                     IFLTWRDGCNIWESFFLFVVGFAPGILFSTMFIGMSYSSPKECLSVCIGTYYLCQQLG
                     TIIGPACGAALAQRLFKNNLVQHIVDIPDKKTIIKGILNDLRFAESLSEPLQQIVRSS
                     YLKAFQFLPGKSICSLNRNCSNIVSVFALASSATVLPLLVFLKEERVD"
     gene            <297367..>298587
                     /locus_tag="ACHE_40108S"
                     /db_xref="GeneID:66981903"
     mRNA            join(<297367..297403,297454..297638,297688..297844,
                     297899..298070,298122..298291,298343..>298587)
                     /locus_tag="ACHE_40108S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278270.1"
                     /db_xref="GeneID:66981903"
     CDS             join(297367..297403,297454..297638,297688..297844,
                     297899..298070,298122..298291,298343..298587)
                     /locus_tag="ACHE_40108S"
                     /note="COG:I;
                     EggNog:ENOG410PKCT;
                     InterPro:IPR015815,IPR036291,IPR006115,IPR008927,
                     IPR013328;
                     PFAM:PF03446;
                     SMCOG1100:3-hydroxyisobutyrate dehydrogenase;
                     antiSMASH:Cluster_4.1;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136066.1"
                     /db_xref="GeneID:66981903"
                     /translation="MANQRIPQLGWVGLGKMGNAMAKNMQKHLADKGQSPLYFWNRTA
                     SKGEQLKRLGGVECESIAAVVNSSDIIFISTSDDAALKVIVDEILAAGNIDLKIIVDT
                     TTVHPTTSQEVSEKVAQKNATFISAPVFGSSPMAEDGKILIVLAGDLSGIKKLASYLK
                     GVIARETITVSDKSEKAALLKIMGNFIISGFTEIVGEAHVLAEKSEMGNEALENLLEL
                     QFGLLPGMISKRLTRGNYMPPRGENPWSNLSLGLKDVGHSIDCADTAGTRLKVAEVAM
                     DHLKRANTYSEKEGRPLDSSAMYGIIRQDAGLDFENDFVKKRDAQ"
     gene            <302357..>303762
                     /locus_tag="ACHE_40109S"
                     /db_xref="GeneID:66981904"
     mRNA            join(<302357..302470,302518..>303762)
                     /locus_tag="ACHE_40109S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278271.1"
                     /db_xref="GeneID:66981904"
     CDS             join(302357..302470,302518..303762)
                     /locus_tag="ACHE_40109S"
                     /note="COG:S;
                     EggNog:ENOG410PHYF;
                     InterPro:IPR036188;
                     PFAM:PF01593,PF13450;
                     TransMembrane:2 (o6-23i132-154o);
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136067.1"
                     /db_xref="GeneID:66981904"
                     /translation="MADKQTVAVVGSGMAGLVTAFLLQQDKKGRYDVQLFETQDHLSL
                     DSASYTITKDHGHNSTPYRIDLPMRAFGDNCHNNLKRMYDYFGIQYGRKKFIYPLTTL
                     SEKKALHFIYSSANHQIPPIRPPTSSYASWIIKTAYLGLCYFWLMLCCFFVQSKEATA
                     QHEEESLRQYLERIWLPHYFVRTYICPMFTSITTCSHEEFLDFPAKDFVEFAKKIYRR
                     PQYYVTGGVHHVQATIANGLSVKLRTTVTSVEHTGTKTRVTWVEGEKEGSAMFDHVVM
                     AVTPNVVGAIYQPLRDAMNSIPVVPVQSIIHRDADVIPECGEEVRVQATKQGNQRDVL
                     HICSDDNATETHHEHPSSVYVTTFPISSIDPSKIIHHVQFSRTLRSVKSRWIVNQLMG
                     NGIPIGQGEKEQIWRNGDGNVWLAGSWCYDGMVLLEGCMESAMTVAERLGVEVPWVDK
                     SD"
     gene            complement(<303919..>304936)
                     /locus_tag="ACHE_40110A"
                     /db_xref="GeneID:66981905"
     mRNA            complement(join(<303919..304253,304314..304826,
                     304882..>304936))
                     /locus_tag="ACHE_40110A"
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /transcript_id="XM_043278272.1"
                     /db_xref="GeneID:66981905"
     CDS             complement(join(303919..304253,304314..304826,
                     304882..304936))
                     /locus_tag="ACHE_40110A"
                     /note="COG:Q;
                     EggNog:ENOG410PMJ3;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     SMCOG1001:short-chain dehydrogenase/reductase SDR;
                     antiSMASH:Cluster_4.1;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /protein_id="XP_043136068.1"
                     /db_xref="GeneID:66981905"
                     /translation="MNPVNTQPYTLPPDAIWLITGCSSGIGQSIATLLASKPNQRLIA
                     TARNPSALSYLPDTPNILKLALDVTSPSSVDAAFVAAAQHFGDAFHLDVVVNNAGYSL
                     SGDTEAATEEEAHLEMETLFFGTARVTTRALPIMRKEVGGRKGGVVFNISSLAGLCGF
                     PGHAYYHAGKFAVEGWSESVAREVHPDWNVNICIVEPSGVKTNFDGHSKARIQAHPDY
                     AGEDMPARQLEKYVNMGIKSGIGMMEPSAVAETLWSVASRGEKVPLRLPLGATCWKMA
                     KARCEGFLRELEGIKEVSTFGEGV"
     gene            complement(<305355..>306394)
                     /locus_tag="ACHE_40111A"
                     /db_xref="GeneID:66981906"
     mRNA            complement(join(<305355..306194,306242..>306394))
                     /locus_tag="ACHE_40111A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278273.1"
                     /db_xref="GeneID:66981906"
     CDS             complement(join(305355..306194,306242..306394))
                     /locus_tag="ACHE_40111A"
                     /note="COG:S;
                     EggNog:ENOG410PP6V;
                     InterPro:IPR029063;
                     antiSMASH:Cluster_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136069.1"
                     /db_xref="GeneID:66981906"
                     /translation="MGFLSTFLSFIERLIRLFIGANEEKLYGLDHAILNVEAPPRSMW
                     MNMGYWKDTKSFPEACEALLEFILITAGLLNEDKTVAGASSAIKLIDVGIGCGDQSLY
                     LTRKLSIAGQAEKRRSLVGSYVGVTFARSQADFARERLLNRTSDSDTLTWTPDVRIFA
                     ADAAKPSSWEPGLKTAISINHDHDKTQTWLLALDTLYHYKPSRTPLLTHACRDLQASF
                     MAFDLLLDSSASFTNKLLVQLMCLLSGIPYTNFLTTKQYEDILVQAGYDRDMIQMRDI
                     SEHVFPGISAYIRQKDSELKRFGMGMGKFKVPGWLFGWWGRSGVIRGVVVVARR"
     gene            <309112..>309354
                     /locus_tag="ACHE_40112S"
                     /db_xref="GeneID:66981907"
     mRNA            <309112..>309354
                     /locus_tag="ACHE_40112S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278274.1"
                     /db_xref="GeneID:66981907"
     CDS             309112..309354
                     /locus_tag="ACHE_40112S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136070.1"
                     /db_xref="GeneID:66981907"
                     /translation="MKWPHLKENFTTTFENTVTLVNGSEITVTDGKAPALEPGETGMV
                     ISMQFAVTGNIDDEDEVVLQDFLNKLLQGPKQLMRN"
     gene            <310124..>310660
                     /locus_tag="ACHE_40113S"
                     /db_xref="GeneID:66981908"
     mRNA            <310124..>310660
                     /locus_tag="ACHE_40113S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278276.1"
                     /db_xref="GeneID:66981908"
     CDS             310124..310660
                     /locus_tag="ACHE_40113S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136071.1"
                     /db_xref="GeneID:66981908"
                     /translation="MHSTKTTSFTTTFKHGKNNLHQLAKAIQPWGQSKKERARAAASA
                     AIMEFHERPPWSRFTFPEAGIEDDKKSWYKGDEKKFMTRGEILSDTDADGNQQSWYEG
                     DEKFFDTKDSDEEKDWDDNASWHTGDDRELKVPVKIERTDINEIYQEVIRQHELDVKQ
                     WDAEVDGVLELIYGSCCV"
     gene            <311050..>311334
                     /locus_tag="ACHE_40114S"
                     /db_xref="GeneID:66981909"
     mRNA            <311050..>311334
                     /locus_tag="ACHE_40114S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278277.1"
                     /db_xref="GeneID:66981909"
     CDS             311050..311334
                     /locus_tag="ACHE_40114S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136072.1"
                     /db_xref="GeneID:66981909"
                     /translation="MTIAERQAPKHFTLPRPLNNNRDSVLEVLHSHSRLAKCALPDIN
                     LQVITKTDDTTVFIDEPHGPEDHTGQRTPRSHEIRRPGCGARRQSLFQAR"
     gene            <311658..>312282
                     /locus_tag="ACHE_40115S"
                     /db_xref="GeneID:66981910"
     mRNA            join(<311658..311691,311741..>312282)
                     /locus_tag="ACHE_40115S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278278.1"
                     /db_xref="GeneID:66981910"
     CDS             join(311658..311691,311741..312282)
                     /locus_tag="ACHE_40115S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136073.1"
                     /db_xref="GeneID:66981910"
                     /translation="MISAIIAEMAWIFTKSSERIPKLVPLPPLFNDTPEIAISILHTH
                     HRTLAEAIYPHTSIESTDAKSNSTVFVIHAPGYPQRITVTLKNFMDGLSILEEGSFGP
                     GMRMAMRWKLADGGAEFLPGTQCLEESGHLSCYRLLTPIPESFTHEYHFKTIILWTLL
                     HQMSIGERVKARSAGVALTWGKSGDRKEKSE"
     gene            <313992..>314689
                     /locus_tag="ACHE_40116S"
                     /db_xref="GeneID:66981911"
     mRNA            join(<313992..314473,314674..>314689)
                     /locus_tag="ACHE_40116S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278279.1"
                     /db_xref="GeneID:66981911"
     CDS             join(313992..314473,314674..314689)
                     /locus_tag="ACHE_40116S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136074.1"
                     /db_xref="GeneID:66981911"
                     /translation="MACKSSFCKDRRCANNHCTSNQDCDSQTICSHGSTCIIGCLPDD
                     HECERNEQCRSGNCNDRQCAAGTRYPGAECSDNREFPQGLICWNMEFIAQDRKKCLKP
                     DEPGTKGRLGNPCSGNEDCGKELECKDERQGVEKIQDIFKAFPPGAPENHLVCVEKKA
                     KMSDV"
     gene            complement(<315163..>315528)
                     /locus_tag="ACHE_40117A"
                     /db_xref="GeneID:66981912"
     mRNA            complement(<315163..>315528)
                     /locus_tag="ACHE_40117A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278280.1"
                     /db_xref="GeneID:66981912"
     CDS             complement(315163..315528)
                     /locus_tag="ACHE_40117A"
                     /note="TransMembrane:1 (o32-55i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136075.1"
                     /db_xref="GeneID:66981912"
                     /translation="MSVSVSFGSTPSTFDRQRERTPPQRNSSSATYLPQTLVLGMFLI
                     IFGAQIAVNIAQVRRVQSRRLREGVRRTIVVNGPESGHQGGEMVVGEGRDRGEGASRE
                     PGEVPGGRAGERLETGDAG"
     gene            complement(<315631..>317361)
                     /locus_tag="ACHE_40118A"
                     /db_xref="GeneID:66981913"
     mRNA            complement(join(<315631..315664,315713..>317361))
                     /locus_tag="ACHE_40118A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278281.1"
                     /db_xref="GeneID:66981913"
     CDS             complement(join(315631..315664,315713..317361))
                     /locus_tag="ACHE_40118A"
                     /note="COG:O;
                     EggNog:ENOG410PKXY;
                     InterPro:IPR001841,IPR017907,IPR015947,IPR003111,
                     IPR013083;
                     PFAM:PF13923,PF14634,PF13920,PF00097,PF13445,
                     PF13639,PF02190;
                     TransMembrane:1 (o317-336i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136076.1"
                     /db_xref="GeneID:66981913"
                     /translation="MNEHPSPHSPHDSEFPTAMNEDERDAQAYNPFNPSSQSQASYIS
                     PALPAHTILRRIQCARCSCPLRTPLRLPCGNALCRECLPPVQPRVGITYPAGEGRKYR
                     FNCPWEKNESCVGEHCVADCGVDVLLTRLVEVIEEALSGNTSGAGYGDGDSVLDLTWA
                     NPNDLEETWKTATLDGGALRGVYGLIKEGRLDYDASDVVYQRRDGVVETSIDAVLLTR
                     LKQAIRDELDCQVCYSLISDPLTTPCGHTFCRKCVGLVLNHSDLCPVCRRKLNMPSTI
                     QAEPINARVAGLMECLFPDQVSARRESIAHDEASLDDEQTIPLFMSSVAFPTMPIFLH
                     IFEPRYRIMIRRVMDSREHKFGMVAYNRARRRQGGLGRTQFMQYGTLMLVDRYEPLPD
                     GRSLVIATGVSRFKVTKADMLDGYHVGQIERLGDVPITVEESNEAAETAVFAETLPPS
                     SQEPQQQTQQPLESMSTQKLLDMALDFVRAQHRVGAPWLHPRALMAYGNEPTDPSRFP
                     WWFASILHVSEEEKYGLLCATSVRERLKISARWVKKLESRERSNRPLIMSVL"
     gene            complement(<318987..>320786)
                     /locus_tag="ACHE_40119A"
                     /db_xref="GeneID:66981914"
     mRNA            complement(join(<318987..320400,320455..>320786))
                     /locus_tag="ACHE_40119A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278282.1"
                     /db_xref="GeneID:66981914"
     CDS             complement(join(318987..320400,320455..320786))
                     /locus_tag="ACHE_40119A"
                     /note="COG:J;
                     EggNog:ENOG410PMTS;
                     InterPro:IPR000649,IPR042529,IPR037171;
                     PFAM:PF01008;
                     go_process: GO:0044237 - cellular metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136077.1"
                     /db_xref="GeneID:66981914"
                     /translation="MEYVDEPPSLMDFLTRPGPRCENKKSSLRLLGSIKRTKPTRKAP
                     GFVTRISGKGRERSASQTKSKSRDALRFLASAPSRLLQEKDTETREDTPCRLVLCFMV
                     EADATAANCSAPVVGVTEDSDSTPMEAAWKMITNQTNFPEISLNVTRCGKPFIFEDPF
                     LIGRECVFHPFAFCVKDNTRENNRAECVNRIDKSLVNISYINQGLRNTFFDSELGPAS
                     GTILATGLQQLQQDHESGARKLAAVALSILRATLESLEDSISLDGPWWRKACLAAWHL
                     WKNGRPSMDAAIVSFLLLALGEVSTALSREENEGKVCKRLCVQNALDSVQQMIRSYTP
                     RISQNLASYLLSKNGSSESKRNIFTILTLSSSSTIRECIIQSALASGAPLVNIHVLES
                     RPLFEGVSMAASIISGFEALSIPRPQVRVTIFTDASVAQAAMGVDLFLLGADRIAADG
                     SVSNKTGSLPAALMVRHMAPAAETIVVSEIHKVATESSNEHNVENNEASEVMNAWERN
                     DKTKGLDVVQGHFESDGFGQGRPTVNVQNVYFEWVPPSLINTYICEDGSKTPEDFQRQ
                     AQWVSEQCEMYFGIC"
     gene            complement(<322743..>326876)
                     /locus_tag="ACHE_40120A"
                     /db_xref="GeneID:66981915"
     mRNA            complement(join(<322743..322947,322998..323164,
                     323213..325051,325101..>326876))
                     /locus_tag="ACHE_40120A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278283.1"
                     /db_xref="GeneID:66981915"
     CDS             complement(join(322743..322947,322998..323164,
                     323213..325051,325101..326876))
                     /locus_tag="ACHE_40120A"
                     /note="BUSCO:EOG09260FPA;
                     COG:D;
                     EggNog:ENOG410PI0P;
                     InterPro:IPR016024,IPR011072,IPR028268,IPR029452,
                     IPR029453,IPR029451,IPR036274,IPR028267;
                     PFAM:PF14664,PF14663,PF02185,PF14666,PF14668;
                     go_component: GO:0031932 - TORC2 complex [Evidence IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0031929 - TOR signaling [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136078.1"
                     /db_xref="GeneID:66981915"
                     /translation="MASGYYNSASSTTSTQHRALTDTHGRSLSSLDDGSADGSWADAS
                     SRVGRNARSESGGSASIYSRGAGGSLAPGPGSFSSELKSMNTSRSVTPRPPDSGGGSG
                     TGPGIFSARRASGTVDPSDGFSNTEERQAVIRDKIAKEMKIKTGTENMLEALLAKNPK
                     HTKEQRIRVESELSSSNRKLVELHHELEEEVLRAQAPSTTPPRSRISTLFRGSPMRPS
                     SREHETAEEGLSEDVEGEMESPTYVLTETLQALEIEGMSPDFYVERANSLVELFNRHP
                     TLKYDLAWPVFGLRVQSMLLSDNKEIVAAGYRLTRYAIADRKSLQIIRSLHTDELVIL
                     SLVKESKANLEREQALKFVRAFLDVKDGVCELSRAVVRTIVAVAEHADDRLRNISIMT
                     LAEILVKDPAMIGYAGGFAILHDALAEGTFGASESLISSFLHVLDTPHSRKHLRGGSE
                     LESVLAPFTDSLADSVRNGRLKSSARAISAMLKTWPGLVVLARDGAKPLHSLLESLHY
                     PDPQARDLIMELLFDALRIKPPSWSSSFLAGRRLTTYGRVANLRSEPDQKQFGAPYED
                     SSNQFDLTEHFSTLILATLVDAGLSRALCDLIEEETDLSVRRKATLLLTEVLKLAHHS
                     LPSETSAQLQVLPHLLPPAVKFDVDNHDISTSTIYQIDSINRTLARSRGYSNGAGRYS
                     VNMDVSASILSGDQAKDKLSPAMDETQFRNSILETNVLNTVNFLKWKWDLIHRIVEGP
                     LTNPKRLDEAIKGSKFVKRLVGFYRPFKYRFAMVPNTKPNQRYVRTGCALMRTLVQSP
                     EGTKYLAENKFLRQVAECLAQVDRMSGLTSSSPLFSREQMSNTLSGGYFAMLGTLSAD
                     TNGLAMMERWHMLNMFYHIIELRDRNDLIQTLLGNLDYSQESHLRVMLSKALTTGSKE
                     IRIFATKLLRKYAVRNVSLSQRVGVGYAEWVLKLLVTQLYDPDVSVCQVAVKILEEAC
                     NQRDYLEFVVKCRPSLDHLGEIGAPLLLRFLSTSVGYHYLDGLDYITQEMDDWFLGRN
                     DAYVGLVEAALSRAYVDTPRRGSIVPEDLVDMQDIGLVPPHFYRELARTAEGCRLLEQ
                     SGHFNEFAWTIRDFRLDEEEHEALLKVKGCLWAVGNVGSMEFGAPFLEKDLVWHIVGI
                     AESAEVLTMRGTAFFVLGLISRSRHGLSVLREVGWDSAVDQKGESLGFSLPNNFRKLF
                     LIDFPTYSRDPELKRISREKFKAAATDADPANQKILNLIVDMGNTVLSKRAASDLHSI
                     KAKYPEHFHQAQLFRKTLDILESHHFRLPARRFALDLFDKSVMRRIVLEEDSDTESDV
                     SSSQGSAD"
     gene            <330036..>331349
                     /locus_tag="ACHE_40121S"
                     /db_xref="GeneID:66981916"
     mRNA            <330036..>331349
                     /locus_tag="ACHE_40121S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278284.1"
                     /db_xref="GeneID:66981916"
     CDS             330036..331349
                     /locus_tag="ACHE_40121S"
                     /note="COG:E;
                     EggNog:ENOG410PM4V;
                     InterPro:IPR014746,IPR008146;
                     PFAM:PF00120;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004356 - glutamate-ammonia ligase
                     activity [Evidence IEA];
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136079.1"
                     /db_xref="GeneID:66981916"
                     /translation="MPLNQDQTTIRTLQLKNPSLRFIRFQWQDYSGILRSRTVPIHHC
                     LRLAKEKKSIEVPPTTFESILDNTLIPNHSPTGADYLFPYWDSARTSAQSIISEDPYA
                     TVICEVVRIRPASLDPQLDLCPRRALAKVMHKAMDGHGLSFLVGFEVEFEVMKVSLDG
                     NEIIPYSTNPERLAIAGQDPCFMHVEECICELQHAGVDIEGFQPKGRGGQYQISLHPQ
                     PPLQAVDELILVHDRIKRVFTKHGYIATMCPNPVAARQQATSQRTHISITPPQAESFF
                     LAGILKHLQALCAFSLPYDLPYKHEQLNSEIVAWGSQNWEAPIRKINTGHWDIRCVDA
                     TTNMYLTLAAFLGAGLSGIQNQEPLVWPDISTPEPSNAVKANSTAYLPSSLEDALCFL
                     EAEADEMEEVMESKIVHRYVALKRFESLRMRQDLEDARRLHVEVF"
     gene            complement(<333185..>334513)
                     /locus_tag="ACHE_40122A"
                     /db_xref="GeneID:66981917"
     mRNA            complement(<333185..>334513)
                     /locus_tag="ACHE_40122A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278285.1"
                     /db_xref="GeneID:66981917"
     CDS             complement(333185..334513)
                     /locus_tag="ACHE_40122A"
                     /note="COG:A;
                     EggNog:ENOG410PPQ9;
                     InterPro:IPR038514,IPR038516,IPR033648,IPR007946,
                     IPR033647;
                     PFAM:PF05282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136080.1"
                     /db_xref="GeneID:66981917"
                     /translation="MTSIHPTPTILIPHLPPKTFVGIDLVTFTSTANFHGIRDLPPGW
                     HFLYSGTTETLSLRSGGWFYVHDDEDSGAVATTGRTPEIFIWKWDAETETLVPLKGDS
                     DAERQEALRFKANLGMVWQAGKLFRYRSRVTAQGVPKNQVVDEEDEEIEEEGRRDWTG
                     LTDRLSVDVFSRIVGDPEVDADGRPRWMVTSASTAKRDTDDIPGLASAEPDGLGVDGR
                     GRQEVEFSFLPIELRKTWREGAVGRERTEAAQDRSWALGDLIKQYTPTDSTDDSEGES
                     QILGELQFTFLMALTLLNFSCLQQWKRLLELILTCRTAIAEREPFMCDVLRLLLLQLQ
                     RCDDLEGGFFAIDADEGGEYLRKWLVRFVRSFEEVTLIGAGSIVKGELDKLQAWVRSE
                     YEWDLHPEGVLRRGMLQLEDGEEVEMEMADDEDEETGEYAPTVVELGGGF"
     gene            complement(<335055..>335618)
                     /gene="RPS14"
                     /locus_tag="ACHE_40123A"
                     /db_xref="GeneID:66981918"
     mRNA            complement(join(<335055..335367,335418..335490,
                     335549..>335618))
                     /gene="RPS14"
                     /locus_tag="ACHE_40123A"
                     /product="ribosomal protein S14, S11"
                     /transcript_id="XM_043278287.1"
                     /db_xref="GeneID:66981918"
     CDS             complement(join(335055..335367,335418..335490,
                     335549..335618))
                     /gene="RPS14"
                     /locus_tag="ACHE_40123A"
                     /note="COG:J;
                     EggNog:ENOG410PP1Z;
                     InterPro:IPR036967,IPR001971,IPR018102;
                     PFAM:PF00411;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal protein S14, S11"
                     /protein_id="XP_043136081.1"
                     /db_xref="GeneID:66981918"
                     /translation="MPPKKTPGAAAKENVTLGPLAGDGKLVFGVARIFASFNDTFVHV
                     TDLSGRETISRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGINALHVKIRATGG
                     TGTKTPGPGAQSALRALARSGMRIGRIEDVTPIPSDSTRRKGGRRGRRL"
     gene            <336813..>337868
                     /gene="TYR1"
                     /locus_tag="ACHE_40124S"
                     /db_xref="GeneID:66981919"
     mRNA            join(<336813..337478,337536..337667,337722..>337868)
                     /gene="TYR1"
                     /locus_tag="ACHE_40124S"
                     /product="prephenate dehydrogenase (NADP(+))"
                     /transcript_id="XM_043278288.1"
                     /db_xref="GeneID:66981919"
     CDS             join(336813..337478,337536..337667,337722..337868)
                     /gene="TYR1"
                     /locus_tag="ACHE_40124S"
                     /note="COG:E;
                     EggNog:ENOG410PGS8;
                     InterPro:IPR008927,IPR003099;
                     go_function: GO:0004665 - prephenate dehydrogenase (NADP+)
                     activity [Evidence IEA];
                     go_function: GO:0008977 - prephenate dehydrogenase (NAD+)
                     activity [Evidence IEA];
                     go_process: GO:0006571 - tyrosine biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="prephenate dehydrogenase (NADP(+))"
                     /protein_id="XP_043136082.1"
                     /db_xref="GeneID:66981919"
                     /translation="MASHWYVFPGDADVGLRLMQQQVLIQHRASDESLHFVENALSCF
                     GSKYVYLSGEMHDRITADTQAVTHAAFLSMGTAWQANNQFPWEMSRWVGGIENVKINI
                     TLRIYSNKWHVYAGLAILNPAAKAQIRQYAESVTELYKLMIEGQRDELKRRVKAAGEY
                     VFRAGTEGQDLLLKDEVLDRFSLSNRHREESPPNNHLSLLAIVDCWWKLGIVPYDHMI
                     CSTPLFRLWLGVTEYLFRNPELLDEALDTACDDSTFRSDDLEFTFAARAWSDCVSFGD
                     FESYRDRFERIQSYFAPRFPEASRLGNEMMKTILEKTK"
     gene            <338679..>340105
                     /locus_tag="ACHE_40125S"
                     /db_xref="GeneID:66981920"
     mRNA            join(<338679..338718,338766..>340105)
                     /locus_tag="ACHE_40125S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278289.1"
                     /db_xref="GeneID:66981920"
     CDS             join(338679..338718,338766..340105)
                     /locus_tag="ACHE_40125S"
                     /note="COG:S;
                     EggNog:ENOG410PN1X;
                     InterPro:IPR038697,IPR015920;
                     PFAM:PF16010;
                     SECRETED:SignalP(1-19);
                     TransMembrane:5
                     (n3-14c19/20o219-243i255-275o287-306i326-347o359-378i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136083.1"
                     /db_xref="GeneID:66981920"
                     /translation="MKIPSFLATALAYVTPVLGQIISYTPSEGSGISYSVNIPQRTAV
                     NGSGPIFFQLTAPPPIQWIALGQGARMTDGNLFIVYAGLGGNITLSTRRANDHVEPKY
                     NSSVDAFLLDGSGFHHGNMTANIQCNNCMRLFDGRSILGPHSDWIWAMAHGEPILSSN
                     VTHPIPQHDWHGIFTLNLTEGVGGETENPFLISSHTVIDHTFKSPQQQISDARLHKKR
                     IAHGVITSVAFVLLFPNFALTLYILPSRWTVPAIHAPLQIFAVALALAGYAIGFSVAH
                     DLQEGNDYHPLLGHIAVLGVAVLMPVLGIVQHLRFRKYGLKTIWGVMHRYLGRFLTAL
                     GIINGGVGFHYAIGKNPNIPPASPIAYGIICASVGMIYVSVIYWRRSKTKAKNAAVQA
                     KEQAQAQNGSEDTLAENKTTPVQERAVEATSVSTAVSASGSGSVSTSTLNNPSATGVS
                     GTREKPLDP"
     gene            <340818..>342119
                     /locus_tag="ACHE_40126S"
                     /db_xref="GeneID:66981921"
     mRNA            join(<340818..341238,341301..341884,341943..>342119)
                     /locus_tag="ACHE_40126S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278290.1"
                     /db_xref="GeneID:66981921"
     CDS             join(340818..341238,341301..341884,341943..342119)
                     /locus_tag="ACHE_40126S"
                     /note="COG:E;
                     EggNog:ENOG410PF7Z;
                     InterPro:IPR036038,IPR018300,IPR001544,IPR043131,
                     IPR043132,IPR005786;
                     PFAM:PF01063;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004084 - branched-chain-amino-acid
                     transaminase activity [Evidence IEA];
                     go_process: GO:0009081 - branched-chain amino acid
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136084.1"
                     /db_xref="GeneID:66981921"
                     /translation="MGSLAPTSTPAALDASTINFTRSTTLRPVPEIGSPEEKSHSYCT
                     DHMLTVRWTVETGWQTPEIRPFENLSIPPTASCLHYATECFEGMKAYRGYDGKLRLFR
                     PDCNGERLANSAVRTSLPGFGAGEVKKLVGRLLQIDGPRWLPKDQPGRFLYIRPTVIG
                     NGTQLGVQAPKEALLFIIAVPWPDMSSNPSGLKLLASSPDTIRAWPGGFGYAKLGANY
                     GPSLAAHGVATGQGFDQVLWLFGEERQVTEAGASNFFIVWENKQGKRELVTASLENQL
                     ILPGVTRRSVLELARERLASASATGLAPVDVVERPLTIAEVEEAWKEGRIVEAFVSGT
                     AYFIAPVQIIRNGDVDMNMLEAGVERAGYATQIKAWLGAIMYGKEEHEWGYVIENEDG
                     R"
     gene            complement(<342597..>345265)
                     /locus_tag="ACHE_40127A"
                     /db_xref="GeneID:66981922"
     mRNA            complement(join(<342597..344537,344584..344659,
                     344707..344891,345227..>345265))
                     /locus_tag="ACHE_40127A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278291.1"
                     /db_xref="GeneID:66981922"
     CDS             complement(join(342597..344537,344584..344659,
                     344707..344891,345227..345265))
                     /locus_tag="ACHE_40127A"
                     /note="COG:U;
                     EggNog:ENOG410PHH5;
                     InterPro:IPR016024,IPR016342,IPR026739,IPR011989,
                     IPR002553;
                     PFAM:PF01602,PF12717;
                     go_component: GO:0030117 - membrane coat [Evidence IEA];
                     go_function: GO:0030276 - clathrin binding [Evidence IEA];
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     go_process: GO:0015031 - protein transport [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136085.1"
                     /db_xref="GeneID:66981922"
                     /translation="MSSSGGDAKLFARGKVAELRQELSSGGKKDKNHSAKKIALKKIV
                     ANMTMSNNDMIALFPDVIGCMNLPSLEIKKMCFLFLVNYSRMKPDVAMKALPILVDDM
                     EDSNPLVRALALRTISYVHVREFVEATIQPVKRLMSDMDPYVRKTAAFCVAKLYEHDR
                     KMVESSDLIDRLNRMLKDENPTVVSSVLASLTDIWGRSETISLTIDYTSASKLVSILP
                     DCSEWGQSYILEALMSYVPQDSAEALLLAERIAPRLSHSNSAVVLTSIRVILYLINYI
                     ADERHVNSLCKKLSPPLVTLLSKPPEVQYLALRNAILILQKRPEVLRNDIRVFFCNYN
                     DPIYVKVTKLELIFMLTTQENISVVLAELREYATEIDVHFVRKAVRAIGKLAIKIESA
                     ARECIDTLLELVNAKIPYIVQEATVVIRNIFRKYPNQYENIIGNVIQNIDDLDEPEAK
                     AAIIWIIGQYADRIENSDGLLQDYLATFHDETVEVQLALLTATVKFFIQRPTKGQELV
                     PQILKWCTEETDDPDLRDRGYMYWRLLSTDPAAARNIVMGQKPPISAESEKLDNRTLE
                     ELCLNIGTLATVYLKPITQVFRNARSRRLQYSPALQKPRDQNGNSNPMLQFNPAPINT
                     TPLASNPTGTANITTTTASTHLNTFFPNPTDPSVIAPSPITGLGPDAADMNAAVSAAD
                     VYFNGVGNQQMAAMDLGGRSGDDGDGVAGGGGAMGTQYVVNQNQQSVYQPQLAGGAAT
                     GELLLL"
     gene            <345795..>346479
                     /locus_tag="ACHE_40128S"
                     /db_xref="GeneID:66981923"
     mRNA            join(<345795..345935,345995..346353,346404..>346479)
                     /locus_tag="ACHE_40128S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278292.1"
                     /db_xref="GeneID:66981923"
     CDS             join(345795..345935,345995..346353,346404..346479)
                     /locus_tag="ACHE_40128S"
                     /note="BUSCO:EOG09264KSI;
                     COG:S;
                     EggNog:ENOG410PNJT;
                     InterPro:IPR009445;
                     PFAM:PF06417;
                     TransMembrane:2 (o91-112i138-158o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136086.1"
                     /db_xref="GeneID:66981923"
                     /translation="MADKTSQPGFDPPPPPRWVVSLNTPLPRPSKAAANIPDPPGFSR
                     AKPQTQKQQQQQQQPTPSKPIETDALKVKKAWEIALAPSKQLPMNAIMMYMSGNSLQI
                     FSIMMVFMLFKGPIQGLINTNTVFAKFDTEGTHKKLLGVKAVYVLMQFGLLALGVWKV
                     NAMGLLPTTRSDWLAWESERQPLERAYFAFS"
     gene            <346694..>346996
                     /locus_tag="ACHE_40129S"
                     /db_xref="GeneID:66981924"
     mRNA            <346694..>346996
                     /locus_tag="ACHE_40129S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278293.1"
                     /db_xref="GeneID:66981924"
     CDS             346694..346996
                     /locus_tag="ACHE_40129S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136087.1"
                     /db_xref="GeneID:66981924"
                     /translation="MESIITGEGDFVEVAHVFPFCLNQWPSNKLESIMWERLRMFWDK
                     AKANDWQRKLTGDRGTEICENHVPLQERACVLGWARFSLKPIETAEDGSSLIVQFH"
     gene            complement(<348317..>349879)
                     /gene="BNA5_3"
                     /locus_tag="ACHE_40130A"
                     /db_xref="GeneID:66981925"
     mRNA            complement(join(<348317..348762,348813..349293,
                     349347..349687,349735..>349879))
                     /gene="BNA5_3"
                     /locus_tag="ACHE_40130A"
                     /product="kynureninase (L-kynurenine hydrolase)"
                     /transcript_id="XM_043278294.1"
                     /db_xref="GeneID:66981925"
     CDS             complement(join(348317..348762,348813..349293,
                     349347..349687,349735..349879))
                     /gene="BNA5_3"
                     /locus_tag="ACHE_40130A"
                     /note="COG:E;
                     EggNog:ENOG410PH7Q;
                     InterPro:IPR000192,IPR015424,IPR015422,IPR010111,
                     IPR015421;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_function: GO:0030429 - kynureninase activity [Evidence
                     IEA];
                     go_process: GO:0006569 - tryptophan catabolic process
                     [Evidence IEA];
                     go_process: GO:0009435 - NAD biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="kynureninase (L-kynurenine hydrolase)"
                     /protein_id="XP_043136088.1"
                     /db_xref="GeneID:66981925"
                     /translation="MATQIPQSGVYSRQEAESRDAQDPLRSFREEFIIPSRKDLQRRT
                     LAVEDQDTSEPCIYLCGNSLGLQPRNTQKYIEYYLRTWATKGVTGHFTPHDDQLLPPF
                     VDVDEAGSKLMAPVVGALQSEVAVMGSLTANIHVLLGSFYRPTEERFKVIMEGKAFPS
                     DHYAIESQIQLHGFNPDDAMVLIEPEDREFPTLSTEQILRVIDEHASSTALLFLSAIQ
                     FYTGQYFEIEKITAYARSKGILVGWDCAHAAGNVDLRLHDWNVDFAAWCNYKYLNSGP
                     GGMAAIFVHEKHGQVNADKVGTEEGFRPRLAGWWGDDKGRRFLMENKFVPQPGAAGYQ
                     LSNPSVLDMNAVVASLELFNRTTMANIRERSLALTGYLEHLLLTYPINSLAERPFSII
                     TPSNPAERGAQLSLRLKPGLLDSVLQSLEEHAIVVDERKPDVIRVAPAPLYNTYVEIW
                     EFCQVFLNACVKAVSPVSLR"
     gene            <350085..>351093
                     /locus_tag="ACHE_40132S"
                     /db_xref="GeneID:66981927"
     mRNA            join(<350085..350426,350734..>351093)
                     /locus_tag="ACHE_40132S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278295.1"
                     /db_xref="GeneID:66981927"
     CDS             join(350085..350426,350734..351093)
                     /locus_tag="ACHE_40132S"
                     /note="BUSCO:EOG09265G5K;
                     COG:C,U;
                     EggNog:ENOG410PPRV;
                     InterPro:IPR016092,IPR000361,IPR035903;
                     PFAM:PF01521;
                     go_function: GO:0005198 - structural molecule activity
                     [Evidence IEA];
                     go_function: GO:0051536 - iron-sulfur cluster binding
                     [Evidence IEA];
                     go_process: GO:0097428 - protein maturation by iron-sulfur
                     cluster transfer [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136089.1"
                     /db_xref="GeneID:66981927"
                     /translation="MSRLALSSATRRLQQSTTHCQRPFSTTRFFSALSKPSISGSSSI
                     YNPDANSFSASRTRSNQYTLRRVNFSSLGVLRHRAFLSSTVRPSAKVVQNARNDEEGK
                     PLLVGISERAAERLREITDPTTSPTTTKAENPYHHLRITVTSGGCHGFQYMMSLEAAS
                     KIDAEEDTVFEAEASVGPESGEALVVMDGPSLELLSGSTVDYTTELIGSQFKIVDNPR
                     ATSNCGCGTSFDVNV"
     gene            complement(<351690..>353430)
                     /locus_tag="ACHE_40131A"
                     /db_xref="GeneID:66981926"
     mRNA            complement(join(<351690..352811,352927..>353430))
                     /locus_tag="ACHE_40131A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278296.1"
                     /db_xref="GeneID:66981926"
     CDS             complement(join(351690..352811,352927..353430))
                     /locus_tag="ACHE_40131A"
                     /note="COG:J;
                     EggNog:ENOG410PFZ7;
                     InterPro:IPR019382,IPR000717;
                     PFAM:PF10255;
                     TransMembrane:2 (i260-282o294-317i);
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_component: GO:0005852 - eukaryotic translation
                     initiation factor 3 complex [Evidence IEA];
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136090.1"
                     /db_xref="GeneID:66981926"
                     /translation="MRPSENPQNSNSAGTIEIPLTPKTPSTVHLHRRSTTINTPQEEP
                     VLSNDPTTYLFYLSPPPAKANMSYEERANAHPNLGDESDVEEEALVNDYREQVNFDDD
                     MSDLDRTTSIDAGSQAQDLQAQLAAAATPLEYQATLETKFASYDNYCNLFHYILNSEG
                     PVDLEVPSYYWAWDVIDEFIYQFESFCRYRNRVARSGSNEEEAQLLRENPNTWGCYSV
                     LNVLYSLIQRSQINEQLAAIKRGEDPLAFAGEYGSRPLYKMLGYFSIIGLLRVHCLLG
                     DFSLALKTLDDIEMNKKAMFARVMAAHFTTYYYVGFSYMMMRRYGDAIRMFSHILIYV
                     SRTKNFQKGGNSYDAIAKKNDQMYALIAICVALHPTRLDDTIHSALREKYGDQLTRLQ
                     HGGPEALPLFEELFRSACPKFISPTPPDFDNPSINIDPVDHHTSIFMDEVKNTLFNPT
                     IRSYLKLYTTMDLKKLAGFLEVEPEKLRSWLLVNKQRSRQIRWVEGGLLEGEIVSAND
                     LDYALENDLIHVSETKAGRRLVDWYLRNLARVY"
     gene            complement(<354575..>356261)
                     /locus_tag="ACHE_40133A"
                     /db_xref="GeneID:66981928"
     mRNA            complement(join(<354575..354977,355038..355391,
                     355441..355617,355673..355824,355875..>356261))
                     /locus_tag="ACHE_40133A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278299.1"
                     /db_xref="GeneID:66981928"
     CDS             complement(join(354575..354977,355038..355391,
                     355441..355617,355673..355824,355875..356261))
                     /locus_tag="ACHE_40133A"
                     /note="COG:K;
                     EggNog:ENOG410Q1CV;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136091.1"
                     /db_xref="GeneID:66981928"
                     /translation="MGRIATVLADTSISLDDFSSVNLNNHQSVESAIQSLLPPPDPCS
                     TNTCSRITLESLVDIPLFQVPAKPWTNVTDDDNLVSHLISLYFTWDHPCWQLVDQKVF
                     LLHMKTGDLGSQYCTPFLVNSILAIASVYSDAPDVFAIPGNADSCGSHFYIEAERLWR
                     AEEGTISLANIQGLVIMCHVLKCQGKNGVSWLMLRQAVQLAQDFGMFRAPTLHANWEE
                     MDADMQRIHAIAAWGIFIMNLDMSMELHKDANLESPACRPYMSGDLNDDIAWTPYPRS
                     NEIEYANKPGLLRYVASELSNLTEVTAAIQQLFFMNACHMDVNDLWTRTNEIYSRLQQ
                     WRRNMPDVLKTDNYPVPQVLFLHLKFHKEVLSLFNAFLGHKGPDNPSHPTWFQQIKTI
                     RLQSAKDIARCFGILRLSYGYKRIPSHMLEAAGASLLVVMGDLTNEESGNAFFELCRI
                     VVVFGKRLKQAKYMIAKVISVAQQSGIILPAEAMLILESG"
     gene            complement(<358964..>360915)
                     /locus_tag="ACHE_40134A"
                     /db_xref="GeneID:66981929"
     mRNA            complement(join(<358964..359908,359967..360390,
                     360452..>360915))
                     /locus_tag="ACHE_40134A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278300.1"
                     /db_xref="GeneID:66981929"
     CDS             complement(join(358964..359908,359967..360390,
                     360452..360915))
                     /locus_tag="ACHE_40134A"
                     /note="COG:S;
                     EggNog:ENOG410PHP9;
                     InterPro:IPR026749;
                     TransMembrane:7
                     (o25-45i166-182o268-289i422-441o456-479i491-517o537-556i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136092.1"
                     /db_xref="GeneID:66981929"
                     /translation="MLSNCRGSAVPNSVPLHSPFNSRTYIQHTSFFSFPSSLILVLFP
                     IKMPTPDPTPADPDPTMSVDPVVDVDPALRALLRLSLSSQEYKLLHERAPAGIKKNAP
                     SPARFEAIVQPKDRFNEAAIRESLRVFLGSGLLLKLVEVVSRRMKGGAGAVASKKRSI
                     IHSPNFRLPLALALVLFFHRRLHRLFARIRASLRTDKAQPFRDRNPRLTKALTSRYAP
                     AVGGSLAGFALGVAPQAQLRLTTAIYMSTRTLEFLYNVMEEKGWLKNKPWWFGSWLLM
                     PVSCAQLFHAFVFDRETTPKWFGKVVMHSPSYIQSRPALLPAEIPWPENEEVVDSLAT
                     IANLRWPYVKTIPMNFYEILIYAFRPFTSPILHPSNPNTLPSAIKSIAPITGPAHPSI
                     SSLSCALLHPAVPSCNTAFLHHILLSVPRIARFMTTVMLAVSILKYKAFTTNPLASFQ
                     NLVKRILTLTAILSTSIGSAWGSICLWNTLLSRSALPTKRFFLSGALGGLPFAFLGNN
                     SRGAFMSIFRSAVDSAWKSGVKRGLWKGWTGGELWLIVASWAVMGAILERRPGAVQAG
                     GLRKGLAWLRGDGFVDPVEVLERKRARRAARREERELGEEKGRA"
     gene            complement(<361288..>367723)
                     /gene="TOR1_2"
                     /locus_tag="ACHE_40135A"
                     /db_xref="GeneID:66981930"
     mRNA            complement(join(<361288..361680,361733..>367723))
                     /gene="TOR1_2"
                     /locus_tag="ACHE_40135A"
                     /product="phosphatidylinositol kinase-related protein
                     kinase Tor1"
                     /transcript_id="XM_043278301.1"
                     /db_xref="GeneID:66981930"
     CDS             complement(join(361288..361680,361733..367723))
                     /gene="TOR1_2"
                     /locus_tag="ACHE_40135A"
                     /note="COG:L;
                     EggNog:ENOG410PGA0;
                     InterPro:IPR016024,IPR011989,IPR036738,IPR003152,
                     IPR003151,IPR036940,IPR018936,IPR009076,IPR021133,
                     IPR024585,IPR011009,IPR026683,IPR014009,IPR000403;
                     PFAM:PF11865,PF00454,PF02260,PF08771,PF02259;
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016301 - kinase activity [Evidence IEA];
                     go_function: GO:0044877 - protein-containing complex
                     binding [Evidence IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol kinase-related protein
                     kinase Tor1"
                     /protein_id="XP_043136093.1"
                     /db_xref="GeneID:66981930"
                     /translation="MFMNEHYRNACEIVLRLKDHRDPKIRTQVVLTIPILASYAPLDF
                     TEIYLHRFMIYLQAQLKRDKERNSAFIAIGKIANAVGGAMAQYLDGIIIYIREGLAMK
                     ARSRSSVNEAPMFECISMLSLAVGQTLSKYMEALLDPIFACGLSESLTQALVDMAHYI
                     PPIKPTIQEKLLDMLSIILYGTPFRPLGCPENRLPPMPSFAKDFSPQELHSDAEIALA
                     LHTLGSFDFSGHILNEFVRDVAINYVENDNPEIRKASALTCCQLFVHDPIINQTSSHS
                     IQVVSEVIDKLLTVGIGDPDPEIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFS
                     VREAAICIIGRLSSVNPAYVFPPLRKLLVNLLTGLGFASTARQKEESALLISLFVSNA
                     TKLIKSYVDPMVTTLLPKATDANPGVASTTLKAVGELANVGGGEMTHYLPRLMPIILD
                     ALQDLSSHAKRESALRTLGQLAGNSGYVIDPYLEYPHLLAVLINIIKTEQTGSLRKET
                     IKLLGILGALDPYKYQQISEDAPDIHHINEVQPVTDVALIMQGLTPSNEEYYPTVVIN
                     TLMQNILRENSLAQYHSAVIDAIVTIFKTLGLKCVPFLGQIIPGFIAVIRGSPPSRLE
                     SYFNQMAILVNIVRQHIRAFLPGIIEVIRDFWDVSYQVQATILSLMEAIALSLEGEFK
                     KYLAGLIPPMLETLDNDTTARRQPSERILHSFLIFGASGEEYMHLIVPSIVRLFDRTQ
                     NPPSIRKSAIESLTKLSRQVNVSDFASLMVHSLARVVGGTERSLRLPAMDCICALIFQ
                     LGQDFSHYIHLLSKVLKNNQVTHVNYQILVTKLQKGDPLPQDLNPDENYAALADDANY
                     AEIGQKKMVVNQQHLKNAWDASQKSTREDWQEWIRRFSVELLKESPSPALRACASLAG
                     IYQPLARDLFNAAFVSCWTELYDQYQEELVRSIEKALTSPNIPPEILQILLNLAEFME
                     HDDKALPIDIRTLGKYAAKCHAFAKALHYKELEFEQDQNSGAVEALITINNQLQQSDA
                     AIGILRKAQAYRDVELKETWFEKLQRWEEALAAYKRRERIDPDSFGVTMGKMRCLHAL
                     GEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWGRGQWELMDSYLGVMKEQSPDRSF
                     FGAILAIHRNQFDEATMYIEKARNGLDTELSALLGESYNRAYNVVVRVQMLAELEEII
                     TYKQNIGDPEKQDAMRQTWNKRLLGCQQNVEVWQRMLKVRALVTSPRENLDMWIKFAN
                     LCRKSNRMGLAERSLGSLETVVSDNNGTRSVAPPEVTYARLKFNWASGAQRESLGMLK
                     EFNATLTEDFTRFNALIMSQTDHVINGVNGVVDANHADIAGLRERVGDVGKLRRLLAK
                     SYLRQGEWQTALQRGDWNPELVREVLNAYAAATRYNRDSYKAWHSWALANFEVVTTIA
                     SQANREGQPPVMVPQHIVTEHVIPAIRGFLRSIALSSTSSLQDTLRLLTLWFTHGGDQ
                     DVNGVVTEGFTAVNIDTWLAVTPQLIARINQPNYRVRTSVHRLLAEVGRAHPQALVYP
                     LTVAMKSNVTRRSQSASNIMDNMRQHSARLVEQADLVSHELIRVAVLWHELWHEGLEE
                     ASRLYFGDHNVEGMFATLAPLHDMLDQGAETLREVSFAQAFGRDLAEAKHYCMLYRET
                     EEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPKLKDCSDLDLAVPGTYQSGRP
                     IIRIVSFDPILHVLQTKKRPRRMTLKGSDGSSYMYALKGHEDIRQDERVMQLFGLVNT
                     LLDNDGESFKRHLSVQRFPAIPLSQSSGLLGWVSNSDTLHALIKEYRESRRILLNIEH
                     RIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRS
                     LGVMSMVGYILGLGDRHPSNLLLDRVTGKIVHIDFGDCFEVAMHREKYPERVPFRLTR
                     MLTFAMEVSNIEGSYRITCEAVMRVLRENKDSLMAVLEAFIHDPLINWRLGVRESPPE
                     RMSFVAERRQSVAPNLNADNGAQPSTYTRPRRPSILEGGILDAQEGVPNEARELQNAR
                     ALQVLGRVREKLTGRDFRPYEELNISDQVDKLLAQATNVENICQHWIGWCSFW"
     gene            <369621..>370856
                     /gene="GRE2_3"
                     /locus_tag="ACHE_40136S"
                     /db_xref="GeneID:66981931"
     mRNA            join(<369621..369642,369700..369751,369815..369947,
                     370007..370297,370350..>370856)
                     /gene="GRE2_3"
                     /locus_tag="ACHE_40136S"
                     /product="methylglyoxal reductase (NADPH-dependent) gre2"
                     /transcript_id="XM_043278302.1"
                     /db_xref="GeneID:66981931"
     CDS             join(369621..369642,369700..369751,369815..369947,
                     370007..370297,370350..370856)
                     /gene="GRE2_3"
                     /locus_tag="ACHE_40136S"
                     /note="COG:V;
                     EggNog:ENOG410PJT2;
                     InterPro:IPR001509,IPR036291;
                     PFAM:PF01073,PF16363,PF07993,PF01370;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="methylglyoxal reductase (NADPH-dependent) gre2"
                     /protein_id="XP_043136094.1"
                     /db_xref="GeneID:66981931"
                     /translation="MPKVLLTGGSGFIAAHIVDILLQHGFDTVVTVRSDEKGQKILGS
                     HPNIPKEKLSYVIVKDVAENGAFDEAVKSNPPFDYVLHTASPFHFNVQDPVKDFLDPA
                     IKGTTGILKAIKAYSPTVKRVVVTSSFASIVNSDKHPPVYSEEHWNPVTWEQALDHSK
                     VYRASKTFAEKAAWDFVEKEKPNFDIATVNPPLVFGPIVNYLNSLDAINTSNKRFKDF
                     VQGNLKNETPSTDTFLWVDVRDVALAHVKAIEVAEAGGKRFFVTNGFFSNNDIADAIR
                     ESHPKLESKLPPKNAPSNPPSYAYGYDNTRSREVLGISYLPLKKTVADTVESLLAVGA
                     "
     gene            <371082..>372488
                     /locus_tag="ACHE_40137S"
                     /db_xref="GeneID:66981932"
     mRNA            <371082..>372488
                     /locus_tag="ACHE_40137S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278303.1"
                     /db_xref="GeneID:66981932"
     CDS             371082..372488
                     /locus_tag="ACHE_40137S"
                     /note="COG:S;
                     EggNog:ENOG410PG7D;
                     InterPro:IPR016712;
                     PFAM:PF11709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136095.1"
                     /db_xref="GeneID:66981932"
                     /translation="MTSARLSPTANLLRKSRVFALPQALKPPQEPPTSKTVFESDTAT
                     LPYPTRAAIVTPGTSLKRGDWGLKRPIPSKSTSQKSARPVIRVNAHDTFEHVTDFESA
                     QDHTVTLSKFQELNLPMSLPSKVNYSSSFLPGHQSPFESDFDNTQTSKDLARPYAKQF
                     RQSGPWLAGQTEAEFQNYLKKVRRDKPEILQRLRDMYVAKRTVEQRKAIQDKGEDLEN
                     LQPIEFDEKEFHAYIKSLRADPTALGPVIFDLLDLPSPPPVPNMRIAGKHFHAPGTKL
                     SATEYAVSGPPKTHPSAGLSYTRSHALLYNHPEYGPQAYQRPVQARILRPKSKLKGKN
                     NRAIAGIGGIASEDVNSITFYDHRTPPGLAYFDASIEGGGKYWATPIRASITSDGRID
                     LASFKASISAKAPYGIEDAPEADAANRAAEVTRGTSRQVPKLDARAPRFRQFDERKHV
                     QMESREDTARSLLETLKY"
     gene            <372840..>373379
                     /gene="RPS17"
                     /locus_tag="ACHE_40138S"
                     /db_xref="GeneID:66981933"
     mRNA            join(<372840..372860,372927..373052,373107..>373379)
                     /gene="RPS17"
                     /locus_tag="ACHE_40138S"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_043278304.1"
                     /db_xref="GeneID:66981933"
     CDS             join(372840..372860,372927..373052,373107..373379)
                     /gene="RPS17"
                     /locus_tag="ACHE_40138S"
                     /note="COG:J;
                     EggNog:ENOG410PMV6;
                     InterPro:IPR036401,IPR018273,IPR001210;
                     PFAM:PF00833;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_043136096.1"
                     /db_xref="GeneID:66981933"
                     /translation="MGRVRTKTVKRSAKVMIERYYPKLTLDFETNKRLCDEIAIIASK
                     RLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDVSQTESGQLD
                     VDADTKDLLKSLGFDNLKVNVVNVTQAQQPERRRFRS"
     gene            complement(<373717..>374652)
                     /locus_tag="ACHE_40139A"
                     /db_xref="GeneID:66981934"
     mRNA            complement(<373717..>374652)
                     /locus_tag="ACHE_40139A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278305.1"
                     /db_xref="GeneID:66981934"
     CDS             complement(373717..374652)
                     /locus_tag="ACHE_40139A"
                     /note="COG:S;
                     EggNog:ENOG410PPSI;
                     InterPro:IPR007308,IPR038534,IPR039693;
                     PFAM:PF04181;
                     go_function: GO:0008420 - RNA polymerase II CTD
                     heptapeptide repeat phosphatase activity [Evidence IEA];
                     go_function: GO:0043175 - RNA polymerase core enzyme
                     binding [Evidence IEA];
                     go_process: GO:0070940 - dephosphorylation of RNA
                     polymerase II C-terminal domain [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136097.1"
                     /db_xref="GeneID:66981934"
                     /translation="MPVNQPPLRTSLPTTHAAASDSSRRQQKKPQDQSNSGVDPRHMA
                     IALHHAHRIQAQKDTESLILDRILDLVAFPHSPTADPSSPSPEDARLFKNALFPFQPT
                     DYDNLIQERNIEGLCGYGLCPREHRREEGGGMFRIRYGAKGSGPGGRGREMNIVPKEK
                     LEMWCSDECAERAMYIRVQLAQEPVWERRGDDTRNKDLVLLEEGREQQGRGLKSGGNT
                     ATVGQVAGQLENMHMHGPEARDMAAQMQELSLRSQELALERGDSSTGAFQQGGRVGVQ
                     IMENENISHAVAPPQMRPEDIQGGSIEGYFPKPQM"
     gene            <375479..>379230
                     /locus_tag="ACHE_40140S"
                     /db_xref="GeneID:66981935"
     mRNA            join(<375479..377198,377258..377353,377414..>379230)
                     /locus_tag="ACHE_40140S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278306.1"
                     /db_xref="GeneID:66981935"
     CDS             join(375479..377198,377258..377353,377414..379230)
                     /locus_tag="ACHE_40140S"
                     /note="COG:Z;
                     EggNog:ENOG410PIH1;
                     InterPro:IPR030506,IPR036028,IPR035552,IPR001452;
                     PFAM:PF00018,PF07653;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136098.1"
                     /db_xref="GeneID:66981935"
                     /translation="MSNPPFTVKAIFEYASDHEDDLAFPIGQIVTVTGIEDDEWYSGE
                     YTDESGAKQEGIFPKNFVEKYEPPAPPRPSRPNRSKKEPEAVAPPPPEPAAPADPSPV
                     ESNDQAAPEFDDTPAATSAAMREVPAPQPLPAPQPPQSPPPQTATSPVAEAPTSPKPT
                     QAAAPTPPAAADPASKPAAKPAAPAAAPKPTSSSFKDRIAAFNKAAEPPLAPIKPGGL
                     SSGSNSNTFVKKPFVAAPPSRHAYVPPPPPREPPPKIYRREEDPEFQEQMAREPPVSE
                     SRPPPPPPATESPEQEGEEQPKPTSLKERIALLQQRQVEQAARHAEAAQKKEKPKKPA
                     EPAEQGAPVEEGESAEADTQKASPAIAQDPTSDANDADYSAAADTEEAEETSTSKEDY
                     EDAPARPLSRREPPAEQEEEKEKEDTADDEAEGEQEEAQEEEVDPEVKRRMELRERMA
                     KMSGGMGMMGLFGPPGGMPMPGAAPRKPKPSADTEKKPAPEPEATSPVSAPAPPVPVM
                     ALPGMNANKPAPAPPTDVEKEEETPHPPPVTEQHAAEEVPDVEEVVHEEPSQTISTQR
                     PPPPLPHEGAAPPLPPLATKPVPPPVPQEQPASPSSTTAARSIPPVPKSPPTSADAGN
                     ESDDELSVHTRNLSLNAVAADRPAPPPPAGAPPLPDHLDSRRPSTYDSSPMSPLGAEK
                     RLSRPPPPIPTSPPLSPPRQTRAPPPPPPTDLRRRSTADSRTTTASGPRQAGEGDGET
                     TEYDGDYDTDIASGDKHKDALKGHEADSSMDEGLVDDYSIQSPQSPRGAPPPPPTAPK
                     AVPPPPPSQPPKSAGRSSVDIPRGPPPPPPAAPPAAPEDDEYDPFRYSNPQHGLASPT
                     MPPVPAGRPQPPAPSQPEPTADEQDELYDASPVTTSSERPFSPSREKRMSGVPPLPPP
                     HETPVGPPPSSSRSNRTSLDVPRSSHGVRRSIDGPRPSFDQGFMAMDVDLAEHTLWWT
                     QPNTPPPAIQGRKDVLFEIEESTSTKRGGKTTVTKDVYVLYADYSQTVITVTYDARNP
                     SDVSLEQRQEHPPVQPRQDQLENAHIQNGSRINDAVTSIQNTTVADGTPHGLVQHLLQ
                     PLSSALLPVGTRAYGALVYANLANASVQQFDEIRAGDIVSFRNARFQGHRGTMHQKYN
                     AEVGKPDHVGVVVDWDGTKKKIRAWEQGRESKKIKMESFKLNDLRSGECKVWRVMPRS
                     WVGWES"
     gene            <379666..>381112
                     /gene="CWC25"
                     /locus_tag="ACHE_40141S"
                     /db_xref="GeneID:66981936"
     mRNA            join(<379666..379694,379792..>381112)
                     /gene="CWC25"
                     /locus_tag="ACHE_40141S"
                     /product="RNA-splicing factor"
                     /transcript_id="XM_043278307.1"
                     /db_xref="GeneID:66981936"
     CDS             join(379666..379694,379792..381112)
                     /gene="CWC25"
                     /locus_tag="ACHE_40141S"
                     /note="COG:S;
                     EggNog:ENOG410PJH6;
                     InterPro:IPR019339,IPR022209;
                     PFAM:PF10197,PF12542"
                     /codon_start=1
                     /product="RNA-splicing factor"
                     /protein_id="XP_043136099.1"
                     /db_xref="GeneID:66981936"
                     /translation="MGGGDLNLKKSWHPSLLRNQERVWSEEKKALEERKRIDQLRRER
                     DEERQIQDLQRLQEDSGQVRQTQRVDWMYQAPSGATGHVAEEMEGYLLGKRRIDSVLL
                     KGEETKKLERGADFVPVAGAGTGDAGAGVGAPVNSRDMMTKVMADPLFEVKKREQAAY
                     EAAVKESARRGKRVVDGVNGGDRQPEKERERERNRDRSHRHRSRRYSDEDSHRHRSRR
                     HRSRSSSPDYRRSHRSRRDDRDYRDDRNWRGRDRRDRNRREDRGRGRSRDGHDRKDHD
                     RRASSRHRDCDDRYYDRPRRDSYSRRSSSPRRDRRPSPDRRGAESNGYRKPRDYDNRP
                     RDSYRRDRDHSHPQSEAPNGHANGHANNTKSKEQQEEERQRKLAEMQSNASDLEATRR
                     KRIDEVTAMEERQREEDERNRTEKGRFVGQLHRQLQEDSLDQRIQRSRGGLVVDKEE"
     gene            <382435..>382830
                     /locus_tag="ACHE_40142S"
                     /db_xref="GeneID:66981937"
     mRNA            join(<382435..382529,382581..382754,382800..>382830)
                     /locus_tag="ACHE_40142S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278308.1"
                     /db_xref="GeneID:66981937"
     CDS             join(382435..382529,382581..382754,382800..382830)
                     /locus_tag="ACHE_40142S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136100.1"
                     /db_xref="GeneID:66981937"
                     /translation="MHFYNEAKRLLNGQEVKPSITNLQGLGVVYTCACVCGKDRLGFI
                     LLGQMAEQVRHMMKFPDSIVAKADNQTENTARAVFLTIIGISSLLPEPPALPYKE"
     gene            <383057..>383722
                     /locus_tag="ACHE_40143S"
                     /db_xref="GeneID:66981938"
     mRNA            join(<383057..383124,383170..>383722)
                     /locus_tag="ACHE_40143S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278310.1"
                     /db_xref="GeneID:66981938"
     CDS             join(383057..383124,383170..383722)
                     /locus_tag="ACHE_40143S"
                     /note="COG:K;
                     EggNog:ENOG410Q1WU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136101.1"
                     /db_xref="GeneID:66981938"
                     /translation="MDQGDSRMHELEEVPTPSVLDMHLWYHSNIMTIFGFMQNPLTFG
                     KSSPAHELHKLIDIRRTRWPMEYIPLPSSQFSIVALFTLLEDLNNPSSASTFADTAIS
                     LFSIAKRLQLAKSMFRLVQGTGLQKELGLAPEIHSIFRDFNEVLWAKEDKEKFSSLYS
                     NFAITVNKETVGEVDLDDFLEQWDSLALERVILLIGNDCMGSMFGT"
     gene            complement(<387905..>389830)
                     /gene="SIT2_3"
                     /locus_tag="ACHE_40144A"
                     /db_xref="GeneID:66981939"
     mRNA            complement(join(<387905..388845,388892..389505,
                     389559..>389830))
                     /gene="SIT2_3"
                     /locus_tag="ACHE_40144A"
                     /product="siderochrome iron transporter 2"
                     /transcript_id="XM_043278311.1"
                     /db_xref="GeneID:66981939"
     CDS             complement(join(387905..388845,388892..389505,
                     389559..389830))
                     /gene="SIT2_3"
                     /locus_tag="ACHE_40144A"
                     /note="COG:G;
                     EggNog:ENOG410QE3G;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:14
                     (i84-103o123-141i153-170o182-200i209-229o241-261i294-
                     315o327-345i365-387o407-425i432-451o463-485i497-521o573-
                     593i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="siderochrome iron transporter 2"
                     /protein_id="XP_043136102.1"
                     /db_xref="GeneID:66981939"
                     /translation="MGVFDVIRGRKDSQVVEDLGYSESHEPKSLGGVPEAPPMESNER
                     LSLEERNERNIQLHPDEVTKDAHLGVQKAEATAMVWSKPALFSTYAWIWVCFFMLAFH
                     SSINSNVINKAYSSFSSAPQISTSNILYSIIGGVLKLPIAKTINIWGRAEGYLVFIGV
                     YVLGLIILAACNNPDSYAAGYVLYWIGYDAIYLILQIFVADTSGLRNRAFAFAFASTP
                     FICTAFVGPRAAESYINMTSWRWAYGSFAIIQPFVFAPLAFVFKYYEKKAEKLGLYKH
                     EPSGRTISQSIVHYIHEFDIVGAFLLMAAWVLLLLPFGLQQYGRSTYSSPTFIAMIVV
                     GFCLMFVFAAWEKWCARVHFVQYELLKKRTVLGACCLSAVTYFSFYCWDLYYYNFCLV
                     VYNLSVTLAGYMGQIYNVGSCFWGVVFGIWVRYTKTFKHTCLFFGLPLLILGAGLMIH
                     FRGQGDHSDIGYVIMSQIFIAFGGGTLVIGADMAVMASADREGVPMMLALLGLFNSLG
                     GSVGYAVAAAIYANTFPDALLSHLPESTKSKFNDLYTTGYTEQMKYPPGDPTREAANI
                     AWSTSQYYGAIAATAFLSLAIPCIAVWKNYRVDKKQNKGVVM"
     gene            complement(<392457..>395984)
                     /gene="FAP1"
                     /locus_tag="ACHE_40145A"
                     /db_xref="GeneID:66981940"
     mRNA            complement(<392457..>395984)
                     /gene="FAP1"
                     /locus_tag="ACHE_40145A"
                     /product="FKBP12-associated protein"
                     /transcript_id="XM_043278312.1"
                     /db_xref="GeneID:66981940"
     CDS             complement(392457..395984)
                     /gene="FAP1"
                     /locus_tag="ACHE_40145A"
                     /note="BUSCO:EOG09261727;
                     COG:K;
                     EggNog:ENOG410PGHN;
                     InterPro:IPR001374,IPR036867,IPR034077,IPR000967,
                     IPR034078,IPR019786;
                     PFAM:PF01422,PF01424;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="FKBP12-associated protein"
                     /protein_id="XP_043136103.1"
                     /db_xref="GeneID:66981940"
                     /translation="MSTAQPIDRLTLETMSGPPDANANTNANANSGTGNNNSRPRHRR
                     GRGNRGHRHNNQTQAQAPSAPAPDTQAQASQTPPVSSGDNSTANNLDAAPRQRRGPRG
                     GGRGAGRGGPRSDGGGGSGRRRHGRGRGDAGHGPRRVGIGGRTFEGRLTRPEGENAED
                     ADNANDQGLGADAPTFVPGGPPSGEGSSSAATSSKDREPKGKSKAKSNPPLPRPKVTT
                     KSAAPDIATRIHEDILHNLYECPICTSELGRRSRIWSCGLCWTVFHLSCVKKWSKNEG
                     SAAQDAVRRQQEESTGETSTPRAWRCPGCNLAQEVFPSSYTCWCEKEVDPRSLPGLPP
                     HSCGQTCSRARKGCPHPCDSICHAGPCAPCTAMGPTQDCFCGRNSSTKRCQDTDYENG
                     WSCGEICGDLLPCGEHTCSRPCHEGLCGACDVKVEARCYCGNVQTEMLCSARDEEMES
                     EKLRDDSGEVESWEGCFSCGELCNRPFDCGVHFCQKSCHPQDSQPAHCPRSPDVVLDC
                     PCGKTPLKDIPGYSPRTSCEDPIPHCLEACGKTLPCGHPCEKLCHTGPCGACMLRVPI
                     SCRCGRNTMITVCHQGTMEQPQCFRQCKAGLHCGRHSCAERCCPGEQKALERQAMRRK
                     LRSHLRPSDEDVEAEHICTRVCGRTLKCGRHTCPEICHKGACNTCREAIFEEIPCNCG
                     RSILHPPLPCGTQPPSCSFPCERPKPCGHPQTQHNCHTDDENCPKCPFLTEKMCLCGK
                     RTMKNQPCWLVDVRCGQICNEPLKCGSHSCQKNCHRPGDCEDSTRPCQQACGKRKTLC
                     GHPCTDACHAPFACPEKTPCSATITVTCGCGRLRQERRCNAAKAVASKGQVQQPQRLP
                     ALTPLSCDEECSRLERNRSLASALGIEINQSTTLAQNGGAALPYSSETLDMYIQLSSS
                     APLATLQNYESTLHSLAASVSPTDRSVRFQPAKPSLRAFTHSLAADWGFATESFDPEP
                     HRHVFVLKPASWNPPIFGLGNGSVIGIGGMSVGECVKLRERQRLKEREAQRVAAAEAK
                     ASREAAKAQAQGNVDGGGWAQVAASRKSNASGSPSTLPQKTTFSSGSYAALAGGDFGV
                     GADARAGGGAKKERLVLRSGVGTGKQLQSKVQEPVADSWEEEEEKEEEQERKLEDPDG
                     VGHADGTQKQETEVDAEREDNEVEVAASK"
     gene            complement(<396377..>398206)
                     /locus_tag="ACHE_40146A"
                     /db_xref="GeneID:66981941"
     mRNA            complement(join(<396377..397714,397981..398103,
                     398186..>398206))
                     /locus_tag="ACHE_40146A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278313.1"
                     /db_xref="GeneID:66981941"
     CDS             complement(join(396377..397714,397981..398103,
                     398186..398206))
                     /locus_tag="ACHE_40146A"
                     /note="COG:D;
                     EggNog:ENOG410PMMZ;
                     InterPro:IPR036236,IPR014898,IPR039999;
                     PFAM:PF08790;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136104.1"
                     /db_xref="GeneID:66981941"
                     /translation="MVSFSCENCGDILTKKKLDPHRNQCRGASFTCIDCMVHFQGTEY
                     RSHTSCMTEAQKYEGALYKEKPTKNGRKGKNEPKLNGMQHRAPYVEDVTDVDSPRANG
                     RAPSAHEQKPTAANEHTNKTDSGKPVNVFDFLQPKTPNSTSKVSLAEPKGQMRMVDHA
                     PLIFETNKTHAHLDTPGNDKSYEQNGYSYGADPIPQSQYPNQGANPSLEFVTPVPKKK
                     KDRSRKDNGVLTSEKKRKRRTDDVDMDDVMPLVDSPMIDAPSSIRNNPGTPMIKHSGL
                     TGGLDRMLRSTSVEGEEQPRRRYEEPVSPIKRSKKEKEPKKTRAERLVSSMFGGSVVS
                     SSSADSQPKTIVRHRRRSSSDDGEVPDIKSKKAPKVRNVSDSQVVAPEPKSKRKTSAQ
                     TVEGDHPSRQVSGPGAGEMLLYPQANVPTDQQRDMAAHFLSLVTKGPESSRGFSINKI
                     LKRFHNDEEGQRPDREQRQEEEKELWRALRLKRNERGEIVVFF"
     gene            complement(<399734..>400581)
                     /locus_tag="ACHE_40147A"
                     /db_xref="GeneID:66981942"
     mRNA            complement(join(<399734..399749,399811..400128,
                     400184..400312,400367..>400581))
                     /locus_tag="ACHE_40147A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278314.1"
                     /db_xref="GeneID:66981942"
     CDS             complement(join(399734..399749,399811..400128,
                     400184..400312,400367..400581))
                     /locus_tag="ACHE_40147A"
                     /note="COG:O;
                     EggNog:ENOG410PQ4I;
                     InterPro:IPR036774,IPR017905,IPR039799;
                     PFAM:PF04777;
                     go_function: GO:0016971 - flavin-linked sulfhydryl oxidase
                     activity [Evidence IEA];
                     go_function: GO:0016972 - thiol oxidase activity [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136105.1"
                     /db_xref="GeneID:66981942"
                     /translation="MASRQITRRVLISAAIALFIVFILFIQPQGPPSPAIRAPGHIDK
                     SAPASGLAKDDLLKGEVVMSRLGNETVKAELGRATWKYFHTMLARYPEHPTQEQRETL
                     HSFIYLFSRLYPCGECASHFQQHLQKYPPQVSSRNAAAGWGCFIHNEVNAMLEKPLFD
                     CNNIGDFYDCGCAEDDEEAAGASGEKHSETGGSKGQSESAHQQTGYHDEGGMPPVEIS
                     KEETTRG"
     gene            <400944..>402055
                     /locus_tag="ACHE_40148S"
                     /db_xref="GeneID:66981943"
     mRNA            join(<400944..401119,401179..>402055)
                     /locus_tag="ACHE_40148S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278315.1"
                     /db_xref="GeneID:66981943"
     CDS             join(400944..401119,401179..402055)
                     /locus_tag="ACHE_40148S"
                     /note="BUSCO:EOG09264BIX;
                     COG:O;
                     EggNog:ENOG410PN42;
                     InterPro:IPR010591;
                     PFAM:PF06644;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_process: GO:0065003 - protein-containing complex
                     assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136106.1"
                     /db_xref="GeneID:66981943"
                     /translation="MPSLRIRPFQSLLRGKAPLPRFPQRRWAQVHDVRYLATHHDPSQ
                     VLDRYREKLDQKAKQEGHESVDSLKDAYKDKIEDLRRKASTVATPEPDTPSASPSSPS
                     PSAVRPTPRPQQPASETKKSESSGIKPLDSFIDVQKFLDLPPKEIEGIWRLRHASNPG
                     SICAVIPLEAYRRISAAARQNPQFILPLPRNNVEQEEPVKNEKGEETGETQTTTKAGA
                     DIHFLQWAFHPPASPPPETATPAQLANAHTSTIIFTSLAAYKLHGAYAQPHTTITNYL
                     DLAESKGLVLMLGQVMPDAGVSTSEASWLVSCVQRFYDFGGQANERKGELVRSFTRGD
                     TEVFKVEHLMEEAEKL"
     gene            complement(<405984..>406469)
                     /locus_tag="ACHE_40149A"
                     /db_xref="GeneID:66981944"
     mRNA            complement(<405984..>406469)
                     /locus_tag="ACHE_40149A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278316.1"
                     /db_xref="GeneID:66981944"
     CDS             complement(405984..406469)
                     /locus_tag="ACHE_40149A"
                     /note="COG:C,H;
                     EggNog:ENOG410PKRV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136107.1"
                     /db_xref="GeneID:66981944"
                     /translation="MNQIYSSVSAAIAIETGDTAPDFTQVNDTRVVKVSTYPGYHLPH
                     LWLVANSQSSQVSTLDLCGQGHFTLLTGIGGGPWVTAAENLSRTSEGVQIRAYTIGFG
                     CQYLDCYGDWFKVRGVSEAGAVLVRPDHFVAWRCQGLVEEPATKLCEVMRAVLGGKGS
                     S"
     gene            complement(<406506..>407639)
                     /locus_tag="ACHE_40150A"
                     /db_xref="GeneID:66981945"
     mRNA            complement(join(<406506..407506,407576..>407639))
                     /locus_tag="ACHE_40150A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278317.1"
                     /db_xref="GeneID:66981945"
     CDS             complement(join(406506..407506,407576..407639))
                     /locus_tag="ACHE_40150A"
                     /note="COG:C,H;
                     EggNog:ENOG410PKRV;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136108.1"
                     /db_xref="GeneID:66981945"
                     /translation="MEVLRDAGIEHRLKAVATPGSVIQHSTWSDKLAGEEYARIYAWG
                     NHPMQKGDYELASPCSMCDLPQSSLEPVLVEEAQNLGAGFRFSTELVSFHQDTDHVLV
                     TVRNRVSGETYTVSTQYLIGADGARSVVLEALNIPVIGCQHGEALNVHIKADLSKYIA
                     HRPGSLTWALNTDGPTGLVAGAFRMVKPWNEFVVIIHSAIKPTEETLRAYLYQLIGDD
                     SIGIDILSSFPWTINEQCAERWQDRRVLCIGDATHRHPPAYGLGSNTCISDAFNLSWK
                     LAYVLKGWASPSLLETLTSERKPVGDEVVQRANEGIHAHQRLWSLLGSDSESRKKIND
                     SLRSDGAEGDQKRSELRVTI"
     gene            <408946..>409431
                     /locus_tag="ACHE_40151S"
                     /db_xref="GeneID:66981946"
     mRNA            <408946..>409431
                     /locus_tag="ACHE_40151S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278318.1"
                     /db_xref="GeneID:66981946"
     CDS             408946..409431
                     /locus_tag="ACHE_40151S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136109.1"
                     /db_xref="GeneID:66981946"
                     /translation="MLLCGLVERPLSAIPFGMFVELDFQTLSRASSWLFSSGSDGLLQ
                     AMDICQVISKSHLILERLLAHEVNTGIHLHYSEMFFDVISELIASFPVPHTLRRLSGL
                     VTQAEGAMARPNERMAISDDFAPSGRGARQMNATMALSLAEGIELKALVAVLHFPILA
                     T"
     gene            <411183..>411695
                     /locus_tag="ACHE_40152S"
                     /db_xref="GeneID:66981947"
     mRNA            <411183..>411695
                     /locus_tag="ACHE_40152S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278319.1"
                     /db_xref="GeneID:66981947"
     CDS             411183..411695
                     /locus_tag="ACHE_40152S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136110.1"
                     /db_xref="GeneID:66981947"
                     /translation="MLRASLQAAVSSRSQRSLHDSALELANWQQYTPMATGDGPVPPS
                     RQQEIAPALHQMSLIPQEGFQIPSRPGGISVSPIARGTYHPGLCTMNPLQTTGLSQSL
                     CGFLQFPTAQPYGQLPLSRLQAGAGRMPTRVEPVQTTDRPQAARYIWLPPLSTVSYQQ
                     TGNQTKESMD"
     gene            complement(<412237..>414523)
                     /locus_tag="ACHE_40153A"
                     /db_xref="GeneID:66981948"
     mRNA            complement(join(<412237..412346,412404..412840,
                     412890..413197,413299..414050,414112..>414523))
                     /locus_tag="ACHE_40153A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278321.1"
                     /db_xref="GeneID:66981948"
     CDS             complement(join(412237..412346,412404..412840,
                     412890..413197,413299..414050,414112..414523))
                     /locus_tag="ACHE_40153A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136111.1"
                     /db_xref="GeneID:66981948"
                     /translation="MAAAITSWVLNPIQSLTMSRRRTRKLWCALSDDLQQSFSIECFA
                     DQDDIETLKKKIWEDIKEEIKDTTARNLKLYCPVVQLNYEEEFDVKNGEFLHPRRMIT
                     TSPLFPESKDPNVDIVVVVSGDTTTRKRKRSESQGVDLSPKRLITEDPHVCPRERTVS
                     ELAAILDDVNIVHVRGTPASGKTYLSELLRQHYRKGGRRVSLIKKWEGLDFKNPWDSL
                     VKLVEKWNEELEGAPTTSFTTTSSESKHDLSWVLTSNTVILVDEAQMTYSDDVLWNTI
                     LKGRQSSLFGYNFRLCLFCSYGSPETGPDQTFFTPVRLSNQQCISLTPQSQQYSPPIG
                     LFYDKEEFRDVVSRSIPVEYQETFTFDEGAQDYIFALSNGHPGAVESILSTLFQTYRH
                     KIKHRHIKTLTEDHVIWFLEDTGTVFQKLSTQPVNRSFPDISRATNGICNTLCKITEE
                     GSIPFDINNASIKFCYQKGWIHRVALDGGDIAVLPSRLHEKYIEYWIGKMSIPLPARF
                     DSLPKLCKEVLREFSITILRHSAEGKKISTASQPRPVESQYQDEFHRGFVHVAGLGVP
                     ISSEWSRTKDGRVDFYIPEKKWAIELLRDHNRVDEHISRFKDGGKYHPWLKENMIKDW
                     IIIDCATSLPTREFSEPRLWHAVFINDYSELQLYNHQKAPIMSVHLHI"
     gene            complement(<418343..>419002)
                     /locus_tag="ACHE_40154A"
                     /db_xref="GeneID:66981949"
     mRNA            complement(join(<418343..418554,418621..>419002))
                     /locus_tag="ACHE_40154A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278322.1"
                     /db_xref="GeneID:66981949"
     CDS             complement(join(418343..418554,418621..419002))
                     /locus_tag="ACHE_40154A"
                     /note="COG:S;
                     EggNog:ENOG410PS59;
                     InterPro:IPR022085;
                     PFAM:PF12311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136112.1"
                     /db_xref="GeneID:66981949"
                     /translation="MEEYDSDLVPTQEFKILHNLVTDPDASAADAVQQVLDLTTTEIL
                     SKNDTPGTNFDSDVAWNICILMIDIAANTAPTRQTKLLDFVTRIQKVTVADPRTGEKV
                     GCGNFGYLWTDLHSFGMHVADMCNSFIHHHSHTQKELEKWENSTAFIAQSTAAAAITR
                     NDEPTHRMDFSIYGLYACRDAFEEENQYKSAVRTACL"
     gene            complement(<421050..>421961)
                     /locus_tag="ACHE_40155A"
                     /db_xref="GeneID:66981950"
     mRNA            complement(<421050..>421961)
                     /locus_tag="ACHE_40155A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278323.1"
                     /db_xref="GeneID:66981950"
     CDS             complement(421050..421961)
                     /locus_tag="ACHE_40155A"
                     /note="COG:S;
                     EggNog:ENOG410Q29X;
                     InterPro:IPR032567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136113.1"
                     /db_xref="GeneID:66981950"
                     /translation="MMTLEEFLQYASEEPEWLYEKLQATHQQYDDSLDDYKARLAEEE
                     LRGQVKDGDIALLRRETEEMKGQLQDIKKQLTDVTAERDAFGSQIARLVMDSASGRQA
                     SPMPINSKSTKIPDPPMLTDGKEPRFEDWLLLMSQKLAANADHFDTSQLRIAYVASRC
                     DGKARKHITPRMRDDALNPYTDSKNMLNHLKTIYDDPNRVTTAKHQFRQLYMKNSDKF
                     HDFFSEFLYLAAEAGIAEDDWKDELYTKLTTKLQELCISSSISDGTFQEFSSAASQTV
                     GRLEVTKHWIQKNQMFAPYKDTSKGSS"
     gene            complement(<433202..>434302)
                     /locus_tag="ACHE_40156A"
                     /db_xref="GeneID:66981951"
     mRNA            complement(join(<433202..433361,433411..433536,
                     433585..434097,434163..>434302))
                     /locus_tag="ACHE_40156A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278324.1"
                     /db_xref="GeneID:66981951"
     CDS             complement(join(433202..433361,433411..433536,
                     433585..434097,434163..434302))
                     /locus_tag="ACHE_40156A"
                     /note="COG:S;
                     EggNog:ENOG410PJEQ;
                     InterPro:IPR022742,IPR029058;
                     MEROPS:MER0017239;
                     PFAM:PF03959,PF12146;
                     TransMembrane:1 (o20-44i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136114.1"
                     /db_xref="GeneID:66981951"
                     /translation="MSDSPPPSTSWSIASMANNAVQFLRLPVLASSGLAVVASGLLYF
                     KQNELIYPRNVPVDARTNVPNPRQFGITDYEDLQIPTPDGESLHALFIRPSNKRLARD
                     VTVLMFHGNAGNIGHRIPIAKIMQEVVGCNVLMLEYRGYGLSTGVPDETGLKVDAQTG
                     LDYIRQRAETMHTKIVIYGQSLGGAVAINLVADNQENGDIAGLILENTFLSIRKLIPT
                     VFPPARYLARLCHQHWTSEEVLPKVTDVPILFLSGLKDELVPPSNMTQLYAICNSNRK
                     IWRTLPNGGHNDSVAEPGYFEHILEFITEEVTTGKK"
     gene            <434774..>435697
                     /gene="PRE3"
                     /locus_tag="ACHE_40157S"
                     /db_xref="GeneID:66981952"
     mRNA            join(<434774..434810,434872..434917,434982..434996,
                     435048..435323,435370..>435697)
                     /gene="PRE3"
                     /locus_tag="ACHE_40157S"
                     /product="proteasome subunit beta type-1"
                     /transcript_id="XM_043278325.1"
                     /db_xref="GeneID:66981952"
     CDS             join(434774..434810,434872..434917,434982..434996,
                     435048..435323,435370..435697)
                     /gene="PRE3"
                     /locus_tag="ACHE_40157S"
                     /note="COG:O;
                     EggNog:ENOG410PFUB;
                     InterPro:IPR029055,IPR001353,IPR023333,IPR000243,
                     IPR037559,IPR016050;
                     MEROPS:MER0001645;
                     PFAM:PF00227;
                     go_component: GO:0005839 - proteasome core complex
                     [Evidence IEA];
                     go_function: GO:0004298 - threonine-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IEA];
                     go_process: GO:0051603 - proteolysis involved in cellular
                     protein catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome subunit beta type-1"
                     /protein_id="XP_043136115.1"
                     /db_xref="GeneID:66981952"
                     /translation="MIGHGATGMLGEDGIHVDMNHLKSGEVNLGTSIMAINFKDGVIL
                     GADSRTTTGAYIANRVTDKLTQVHDTIWCCRSGSAADTQAVADIVAYHLNMYGITNNE
                     PPSTQVAASLFQELCYENKDMLSAGIIIAGYDPRHGGQVYSIPLGGSLHKQPFSIGGS
                     GSTYIYGYCDANWKEDMTEEEGIKFVRGALQEAIKWDGSSGGVIRLVVLTSKGAVRHL
                     YLPDTGYTGPGATQS"
     gene            <436556..>438247
                     /locus_tag="ACHE_40158S"
                     /db_xref="GeneID:66981953"
     mRNA            join(<436556..437968,438017..>438247)
                     /locus_tag="ACHE_40158S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278326.1"
                     /db_xref="GeneID:66981953"
     CDS             join(436556..437968,438017..438247)
                     /locus_tag="ACHE_40158S"
                     /note="BUSCO:EOG09263L00;
                     COG:S;
                     EggNog:ENOG410PIDM;
                     InterPro:IPR013922;
                     PFAM:PF08613;
                     go_function: GO:0019901 - protein kinase binding [Evidence
                     IEA];
                     go_process: GO:0000079 - regulation of cyclin-dependent
                     protein serine/threonine kinase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136116.1"
                     /db_xref="GeneID:66981953"
                     /translation="MLGSTVNQNPSQQSVHSPSSRHPNPPSAEAVAAASSSSQLESGS
                     SRSTSTSTPASFSDTTNTPTSFAAPLLTSAAAAAAARGSARPSSHLPQRHDVPPYISH
                     QSHDSSTTSSPSVQQASTTATRYFPSSPSTNTPAAAGPRPSTSSMNPSSSVTSSASSA
                     AFSHGPPTTYPSSNINHTSASRSGSYSSPASSRLQPTSRPLRSSTGSEASSPNRIRVR
                     DLSHVQSFAYEEYHAQSQRNSQVPGQWEQKRQYEISSMPVTDIIEMVAGLLTKITTTN
                     DVHHEHMHRHLPSPDGTANLTPQATSVLAFHGKNVPGISILSYLTRIHKYCPTTYEVF
                     LSLLVYFDRMTEMVNKGHLDRVRHRCGDYSGTEAENNNDANSHNIISPSETESGTRTT
                     QPMHTSPIVTPPSSTGMVAQDPTSPSSISPSLRPQGAGDPFSHSFVVDSFNIHRLVIA
                     GVTCASKFFSDVFYTNSRYAKVGGLPLVELNHLELQFLLLNDFRLSIPVEELESYGTM
                     LVEFYAREVVSQQQAQARSMNPSLASVRQPEVRQTPTPP"
     gene            complement(<444902..>446041)
                     /locus_tag="ACHE_40159A"
                     /db_xref="GeneID:66981954"
     mRNA            complement(join(<444902..444956,445008..445559,
                     445633..445652,445708..445757,445806..445820,
                     445874..445901,445982..>446041))
                     /locus_tag="ACHE_40159A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278327.1"
                     /db_xref="GeneID:66981954"
     CDS             complement(join(444902..444956,445008..445559,
                     445633..445652,445708..445757,445806..445820,
                     445874..445901,445982..446041))
                     /locus_tag="ACHE_40159A"
                     /note="COG:O;
                     EggNog:ENOG410PHBA;
                     InterPro:IPR003653,IPR038765;
                     MEROPS:MER0064210;
                     PFAM:PF02902;
                     go_function: GO:0008234 - cysteine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136117.1"
                     /db_xref="GeneID:66981954"
                     /translation="MREGGLGRLQKRMRGRFGDMLSPDDAYLSYHDIRLTREDMQTLK
                     NDWLTDNIISFWEEYLEREFLVQYNTSNIVLLRPSMSFMILQTPNPLSLREALPDFTH
                     TTHVFLPINDCRNVTEAEGGTHWSLLLISIVDGVAFHYDSLPPGNHWEANTATRKFSI
                     LLNRPFQFVALRDSPIQENGSDCGVFVCLNMRHLLLKRLLLANATEKVSMSLGGKKVD
                     ARAGRKEIAKIIEGFRKEGERRRSLSLSPLGKKSQSPPRID"
     gene            complement(<446829..>452694)
                     /locus_tag="ACHE_40160A"
                     /db_xref="GeneID:66981955"
     mRNA            complement(join(<446829..447983,448036..>452694))
                     /locus_tag="ACHE_40160A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278328.1"
                     /db_xref="GeneID:66981955"
     CDS             complement(join(446829..447983,448036..452694))
                     /locus_tag="ACHE_40160A"
                     /note="COG:T;
                     EggNog:ENOG410PH75;
                     InterPro:IPR000219,IPR004148,IPR027267,IPR035899,
                     IPR001331;
                     PFAM:PF03114,PF00621;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0035556 - intracellular signal transduction
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136118.1"
                     /db_xref="GeneID:66981955"
                     /translation="MPGNDVDHVSRPPDHSGPRHFRRKSSQSSNDLIYDASLNQSINA
                     SLADSISSPPRGPLRTVTFPLRDLPGPHQESGRASPDPHEFYRQYPRPDIDTGKQQQA
                     RDSASSKTRPTPFQRIASLPTYDTLDSSRTNGGAQNRSVSDTSYRALDNTEATSKNPI
                     TATRSRQVSFKDLINKFEKTNDQVLPMPPRFQDRSASASPAGSPTSTKFSSGDRWNTN
                     KASTQNVDGDIVAPIGMVSETNGKAQVSVDSRPSIPRRPLMVGEHLSVDTSVHNSAAG
                     IPPHMRRGSEGSVPSPNPATLDQLDPSSGRSPLTPTAWYLGKTPFLEAVDPSADASRS
                     HRRVRSDLPGITSAGFAASKSAWSSPHLAAGAAPLQQSQPQQPPSVSTSLESPHSKSR
                     IPISSRHLNSAFVSDASPPRATPSTTFSSRSAAQIALPPKGISRLPKPSSPPDSLPGM
                     SDYDSPESFATGSTGTVHGRVRQQQSGRNPLLQAYIAPPPPQKTAPPLRSSRPRKPVS
                     NATSPTGTGSKVVERVSSLQRQINRDRELRASRRERKLPELGHVDFATRRQRIQQAFN
                     RTVQENERKEEEAAELRRQVEPREEVNADDRYPPSHGQLQQQNQFDILPTSTAEDGAT
                     VIDDQDETCHVGRQPQPTEHQHLTSNNNHNHPSISEPEPSRFLPSLHIDTRLPPLPEL
                     PSATTAMDSPTLGLPMVSDRGATIPRSEPKSSHLQPMSAVTLESTDTHVTTLDPEPQS
                     GLDHPDTSHRTLLSQIMQFRESSPSDESSCDEPDYSLSDNDEKESIPIMLRDAACFEE
                     SVNGNGTDDQETCDASDNSQDQTGDEPPSNRWSASSWSSSLRQHFAEARFENGSGEDL
                     SHAAGSADDSEVTTQSCSASSSTPPSVIGHQFTVTPPQPSVGASDSKGEQASTQNTLG
                     RSSAPSLARLGGWDSKRVTQLYFEELARGRGPNLSVPGAGSSPEPRRSDLTDQRSDGR
                     TDSLTDDPVLVSSLGDVPGTEQPRNSATLLFRDDWEHASPSIADWMQVAADSDSSEGE
                     RIVRARKRNDDLARQEKSKTESSGAHEAEKNLGLAINVQGRQEHNSSGNSSEPQGAQS
                     TVQSETTPKETTTKQPPPLPNQPQASSDAPSRQVQQRPSHVPTQSGNYTPLGLVQSTG
                     SSESSSLQYIETTSSLRAHAVDSSVTSLVPSQSEPTSVDLKRPSPSPEQRRLKKRRHV
                     IKELIDTEYTFCRDMKVVDDIYKGTSSSCLDLSTDDVKILFGNSDQVVQFSTAFQDTL
                     KRSAKSVYVMPKSQRWSSKRVRNRQLNGSSEEQSFMPGTEASDLEKDQATFVGQAFMA
                     HMAQMEKVYADYLKNHDAANKKLQILQKNPKVTIWLQECRDWASDLTSAWDLDSLLVK
                     PVQRILKYPLLLSELLDSTPAEHPDHASLVNALEEVTNISVRINEMKKRADLVGQVVG
                     RKRNQSDVRAGLSKAFGRRSDKLRQQVGNVADMFEDKEYNSLSQRFGDSYFQMQVVMR
                     DVESYTQEAQGSMNRFNEFVLAIESYVDVAQSSWPDLEQRWRQLKTVLHDIMTVALPE
                     HLDVVRKSVIDPMISLLKLYDGPQRVMRKRDKRLLEYVRFTAVKDRGDKPDKKCAEQA
                     EQFVALNETLKDELPKLYSMTARLMEACLKNFVQIQTTWQNILQKRLTPLVDSFPDDV
                     EKIFNEWASDFTFSDAQVLSLGICNGSLLVDTIGQPNYSTPSTGPKSRRPSTVNSAST
                     RVGSNMEDSPKVSHEFNTSNPSFQSPAMDNQSFVSAGRRRADSAVSGRGVSARSVRAA
                     SPEPAQNVTSAPTSNPNPGPVPSLPQLSLDSPFLGDIINTTSGDNQPATPAGSRYSGF
                     FSSAMPMSDNPEDNEPAPPVDHPKEPKVLFLAASIYEFNIDRARREAGYQYLTYVAGE
                     IFDVIAEKGELWLARNQDDPTHQVGWIWNKHFAKLSG"
     gene            <454499..>458276
                     /locus_tag="ACHE_40161S"
                     /db_xref="GeneID:66981956"
     mRNA            join(<454499..454909,454958..455264,455314..455544,
                     455589..455908,455955..>458276)
                     /locus_tag="ACHE_40161S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278329.1"
                     /db_xref="GeneID:66981956"
     CDS             join(454499..454909,454958..455264,455314..455544,
                     455589..455908,455955..458276)
                     /locus_tag="ACHE_40161S"
                     /note="COG:B,L;
                     EggNog:ENOG410PIET;
                     InterPro:IPR003545,IPR000477,IPR021891,IPR043502;
                     PFAM:PF12009;
                     TransMembrane:1 (i588-607o);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003721 - telomerase RNA reverse
                     transcriptase activity [Evidence IEA];
                     go_function: GO:0003964 - RNA-directed DNA polymerase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136119.1"
                     /db_xref="GeneID:66981956"
                     /translation="MAKKRKRPSRHPPITNKPLSPNPRTTANNNPTHPVISLYYSHVL
                     TLRQYLLRQLPVSSKLRRRRIASLSVATAAKDEDHRWSSHLPDLVHLLDTTLVGVLHE
                     SSPIISQERRRDLAVFTESQSQSGSQLGSTSAQSEIVEYVIATLFNRNGYQRPQHLLA
                     HGFQRFMGSRANEPQTMTNIPGIMVQYPNKNVQILQQVPWTDVLDLLGSNGEEVMLKL
                     LLDCGIFPCIDHRKGIYYQISGLPLPVLEPLDKIGPGSDQSLFKYNPPPFPKPGNKNQ
                     DTHKELQVKPNSIIFLRRRALYARPNLNAKGQVRFGLKHDHALNRFLSADSLVQTVRL
                     MQHIFPRQFGLTNVFTSTDTREQAQSFNHSFGHHPIQNKYLGQSEDGQDEVRKIPKRL
                     RGEPVELVQQLQNRHKHCSYAELLRYYCSSEATGPWKLGPASSQSDSDISHKSISQPL
                     VTQEQVPQSSSGSFDELPREETDCKTPSLPQPSVTLTDYATPASSVSAFCRAVLRKLI
                     PPQFFGTGQHGPSNQRVMFKQIDRFILMRRFESLNLHEVCQGIKITSIPWLEPPKLTS
                     EPSRCKLSQSDLQKRTELLHEFIYYLFDSILIPLIRAHFYVTESQTHRNRLFFFRHDV
                     WRRLTEQPLTTLKSSVFEELKPEMAQKVLGRRSLGYSFLRLLPKSTGVRPIMNLRRRA
                     WVKCNWPGKQGSYLGPSINSTVTPIHNMLNYEKARGPGALGSALLSVGDLHPKLKNFK
                     DDLLKQHGASLPTLYFVKVDIQSCFDTIPQQKLIRLIEELVSEEAYHITKHVELRPSD
                     EFGGVWPSEEPTRSNKPQRKYVGRAAPASKPQSVPDAFTSGVTSRRRNTVFVDTLAQR
                     EHHSEDLLDLLDEHVRNNLIRIGKKYFRQRNGIPQGSMLSSLLCNYFYAELEREVLGF
                     LHPHQALLLRLVDDFLLITSDVDMAMRFLQVLVRGQPSYGVSVHPAKSLVNFAAAVDG
                     IQIPRLMGSTRFPYCGNLIDTHTLEIYRDQDRVLEGGDTAAETLSNALTVESARAPGR
                     SLHRKVLAGFKLQMHPMYLDAQHNSRNAVLLNLYTNFVTSAMKMYRYLKCLQGRAHPS
                     APVIIRTIQDLTQLAQRLARSRRGEQSEPLSTNTQWAAPISDVPPSQVQYLAASAFRF
                     VMGRKQTRYAVVLRWLESVCKSARPKADGTAVRIGQVIRQGNSTFGEWRF"
     gene            <459446..>461692
                     /locus_tag="ACHE_40162S"
                     /db_xref="GeneID:66981957"
     mRNA            <459446..>461692
                     /locus_tag="ACHE_40162S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278330.1"
                     /db_xref="GeneID:66981957"
     CDS             459446..461692
                     /locus_tag="ACHE_40162S"
                     /note="COG:T;
                     EggNog:ENOG410PGK1;
                     InterPro:IPR035969,IPR000195;
                     PFAM:PF00566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136120.1"
                     /db_xref="GeneID:66981957"
                     /translation="MTTICTTTPNSPPELSGSKSSKSSSFRSSSQLSGPDGIFTDISN
                     FEEIGLEDDAELSYLNDSAATPYGRNRSSTARLQGKGAVTSTTRDLTSTPKRNQYPPL
                     QSNVNGSLSATPTPSSKLRAGGTQKRHSTTAQNQRARSISPFRPHSTLGASPSTQSLA
                     LSPGTPRPLSRNNSWQPNRKSVKDLEAEYHDSDEELPEDASLWNVPISPRPMQERNPS
                     RSASPDGRSAAPRPLPLSHSVSELSVAKSPATSPGASRNRQTIRSSSAGPERGQISPR
                     NPRVYSYNSMMSDLSEEAKIITEALEHHADEKAHRRGENLHSGQSSLRSSTDSKNGSK
                     TPIELPPLQKSNIMIDPLPISKEKERVLSRTRPSWLPPKDQKEEKKHLKQYKQMMAYS
                     READKRRAAKAASAQCEKDNTRETLKNIWDEYVYPNWDRVIAQPRTRELWWRGIPSRN
                     RGATWQRAIGNELSLTEETYHRALQRAKDVRSKSDDDTGESNKRMREWFDAIDEDVSK
                     AFPDLKLFQEGGPLRETLIDVLQTYSMYRSDVGYIYGLNTIAALLVLQFPSPASAFLA
                     MANVLNRPLPVAFLTLDRGAVERTYTLASATLRYKFPRLSSHLYETLKLSHEEIWEPI
                     FRSLLSNGLDLERLSRVWDCWVFEGDRIMIRAAVAVLGCLQTQLFGFTAPNDESRIAV
                     RNILGWGPRHMGAKPKDRNSAPAAPATGFGGGQLAHTSDGDYWILSSAGDEDGFVNEV
                     REAGKVRN"
     gene            <466385..>467508
                     /locus_tag="ACHE_40163S"
                     /db_xref="GeneID:66981958"
     mRNA            join(<466385..467221,467275..>467508)
                     /locus_tag="ACHE_40163S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278332.1"
                     /db_xref="GeneID:66981958"
     CDS             join(466385..467221,467275..467508)
                     /locus_tag="ACHE_40163S"
                     /note="COG:S;
                     EggNog:ENOG410PH0U;
                     InterPro:IPR041694,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF13602,PF16884;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136121.1"
                     /db_xref="GeneID:66981958"
                     /translation="MSLSNRQIIYANTPSPAINPSLDNGTFKLNTTSLPNGRNESIPE
                     DKVLVRVHYLSLDPAMRQWLTAKRSYIAPVERGSVMRGQSIAQVVAVGADLTSQYAAG
                     DWVVAYSGWQEYALLGAKEAQKVTVPAGGRPTDAMSVLGMTGLTAYFGMLEVGQPQPG
                     NTVVVSGAAGATGMVAGQIAKIKGAKRVVGLAGSADKCDFLVKELGFDAAVNYKDADW
                     KKQLKEATPEYIDVFFDNVGGEILDACLARAARDARFAICGAISQYNAAKPQGPSSFM
                     TVISQRVTMKGFIVFDYAKKYSTALNDLATWLSQGKLKRREHIVPGGLEAAPQALVNL
                     YEGANTGKMMVEVAPVEEKARL"
     gene            <472149..>472964
                     /locus_tag="ACHE_40164S"
                     /db_xref="GeneID:66981959"
     mRNA            <472149..>472964
                     /locus_tag="ACHE_40164S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278333.1"
                     /db_xref="GeneID:66981959"
     CDS             472149..472964
                     /locus_tag="ACHE_40164S"
                     /note="COG:S;
                     EggNog:ENOG410Q19I;
                     InterPro:IPR011009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136122.1"
                     /db_xref="GeneID:66981959"
                     /translation="MSMPISEKSTNPSIRQCFVAMALFASQDPTFIEPPDFIAEQLSI
                     SADVFCQASTHPSPFRNQIAAKQNTPDENIGSQSILFEADNSLATTLVNCKRLIHGSK
                     HKAVYEVTWDGQPAIAKCWSPSYYQSYAHEAMTYENIYAKRPQGYSFFAMMLTHGTIS
                     CSSLFPKGNILIMTKVPGKTLNELWDTISGLEKEHIRSEILKAVLILRSFSVLSVDTG
                     KHNILYHPETHSVTMIDFEIMQACEDTLSPDMPEMYTIFGEMPVPTQVHHYGG"
     gene            <474968..>475375
                     /locus_tag="ACHE_40165S"
                     /db_xref="GeneID:66981960"
     mRNA            <474968..>475375
                     /locus_tag="ACHE_40165S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278334.1"
                     /db_xref="GeneID:66981960"
     CDS             474968..475375
                     /locus_tag="ACHE_40165S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136123.1"
                     /db_xref="GeneID:66981960"
                     /translation="MDKELQKKAMFNLSTLKQGNKTINELLATFDRYLMEAGQQNQPD
                     NMKIFRLENTLNDDIFNWPVNAPTCNTFSEYCVQLQGIYDRHQKYQQRSAEHRRPPNR
                     RATTPMFPPPAASPTATPTQGEPMDWEPTISRA"
     gene            <479775..>480030
                     /locus_tag="ACHE_40166S"
                     /db_xref="GeneID:66981961"
     mRNA            join(<479775..479825,479902..>480030)
                     /locus_tag="ACHE_40166S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278335.1"
                     /db_xref="GeneID:66981961"
     CDS             join(479775..479825,479902..480030)
                     /locus_tag="ACHE_40166S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136124.1"
                     /db_xref="GeneID:66981961"
                     /translation="MSNQMTKSDASRIQSSQSRSGHNTGAGSFAARSQSAGDRNSNTS
                     TNSQSNKGQQSKTGK"
     gene            <480714..>481563
                     /locus_tag="ACHE_40167S"
                     /db_xref="GeneID:66981962"
     mRNA            join(<480714..480801,480851..>481563)
                     /locus_tag="ACHE_40167S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278336.1"
                     /db_xref="GeneID:66981962"
     CDS             join(480714..480801,480851..481563)
                     /locus_tag="ACHE_40167S"
                     /note="COG:S;
                     EggNog:ENOG410PRMH;
                     InterPro:IPR040632,IPR027417;
                     PFAM:PF17784;
                     TransMembrane:1 (i244-264o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136125.1"
                     /db_xref="GeneID:66981962"
                     /translation="MSRLIDKEPNTRVKPMRVLCMGMARTGTNSMTIALRKLGLNPYH
                     GSECFKTPPRDFNLWIEALQCNFFNPGDKKPYAREEFDRLLGPYDACLDVPACMFWAD
                     LHRAYPDAKIILTTRDVESWVKSANKTVFKFVQMPFFRFWQYVDSTCIGPLYRTSDLV
                     WSIFCNGDFREEVTKQKYLEHYEKIRNAVPKEQLLEFEIGKDGWEELCAFLGTEVPDE
                     PWPNAYSTAEFQEHIDIAHREALWTIARWLGMGVVGAMGTLGWLYYRG"
     gene            complement(<481806..>482558)
                     /locus_tag="ACHE_40168A"
                     /db_xref="GeneID:66981963"
     mRNA            complement(<481806..>482558)
                     /locus_tag="ACHE_40168A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278337.1"
                     /db_xref="GeneID:66981963"
     CDS             complement(481806..482558)
                     /locus_tag="ACHE_40168A"
                     /note="COG:S;
                     EggNog:ENOG410PTH7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136126.1"
                     /db_xref="GeneID:66981963"
                     /translation="MVKEAQIVHINDADMSPSKMHPRSSPIEHLHILEDEIGLEAVGV
                     FVQSCRTPRTFNYTYGNFDVSEGRFRPLEAVRLLLGCHRDALEELTMLYNDDCIKQLW
                     YDLSAREWYMGTELRHFTNLKTLRSGMHSLLGLPQPHSEANEQYRAASDMVTPDLIDV
                     LPGSLERLAIRYADERIVPHLQRVAEVRARQFPNLKNVAVGFCQEAVKSNMVLQMEGM
                     ELIMLYQSKLKRVAHAYDREGSSWLGSPVFRY"
     gene            complement(<482706..>482984)
                     /locus_tag="ACHE_40169A"
                     /db_xref="GeneID:66981964"
     mRNA            complement(<482706..>482984)
                     /locus_tag="ACHE_40169A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278338.1"
                     /db_xref="GeneID:66981964"
     CDS             complement(482706..482984)
                     /locus_tag="ACHE_40169A"
                     /note="COG:S;
                     EggNog:ENOG410PTH7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136127.1"
                     /db_xref="GeneID:66981964"
                     /translation="MAYNSFLRAVLTNPKLAEHIEEVNMLDVSQYDPHEISQEDVQLF
                     QKAVADSPLPVQLKDSLKNGIKEGMACCHACAFAMQPAEPEDCVHVKA"
     gene            <483589..>484529
                     /locus_tag="ACHE_40170S"
                     /db_xref="GeneID:66981965"
     mRNA            join(<483589..484338,484395..>484529)
                     /locus_tag="ACHE_40170S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278339.1"
                     /db_xref="GeneID:66981965"
     CDS             join(483589..484338,484395..484529)
                     /locus_tag="ACHE_40170S"
                     /note="COG:S;
                     EggNog:ENOG410PZ53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136128.1"
                     /db_xref="GeneID:66981965"
                     /translation="MASTQPPYYTSSFGNPNQDLNSTTPTGTYLGETGTGTAANTTDP
                     RTGPAPSTAGPHRTDMGNAADPRVDSDLNNRAQYAPGTTTSGTVHPGTNQGMSNPENT
                     RNSGPHRSSILNKLDPRVDSQTGNTTTKSTNMTGSGARRSSTYADTTPDAAAGSIAGG
                     GSSTGGAGGAPGVKDTRSHYDPRTTGYNPATGSGYQTGHSGGSYDPNSQDYRAEYASS
                     TANKSAGTEDSKAGRAGDEFGKGIQNAYAGIHGAGESLRGALNAAVDRTFGSPEGVEK
                     NQGIARKGEEEIRSGLSR"
     gene            <485335..>488397
                     /locus_tag="ACHE_40171S"
                     /db_xref="GeneID:66981966"
     mRNA            <485335..>488397
                     /locus_tag="ACHE_40171S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278340.1"
                     /db_xref="GeneID:66981966"
     CDS             485335..488397
                     /locus_tag="ACHE_40171S"
                     /note="COG:S;
                     EggNog:ENOG410PJEV;
                     InterPro:IPR029058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136129.1"
                     /db_xref="GeneID:66981966"
                     /translation="MPLPAADDQNPLRNHYKHLPVNGVKTPRPRPSSPSPAAAAEANA
                     NNNAAATSSDSDEPAPQAAEDEAGDVVGVSMSRVQTRMKARSTPAEEKNRIMERDGGY
                     FAVPNLVHSDGLYLSDITAEPESVEEKSPSRSSTTIPDRSPQQQQQQQQQPRHRKQDS
                     EPVQAVQSQGKEVTYSDDTRLPKDNGGSRTSFTRSILGNLPKRPRALSGDAIANLNFR
                     KFLPDLGSLTRRSSLSFRSNSSAQNTRPRSQIIAAKPPPSVGLAPQQRLTELPPPEAI
                     VSQRRKSESNMNGGVDSAGDEPISDLQSLRNSTAAKHSFTRRPSAGGPGAPPLLRRTS
                     SDHSLYLRASSTVSSLDHRPQFEHIHTQVNSRFKAIKDSLQDSSSRLLSMPSFNLHDI
                     RADWGYKPFFQDVSYRKGHEYSVEADSSSFAHEEHARQQRANSQYNTYPALTEAMKEL
                     TGDVVVMGGYRGSILRSAKPPHRQLWVPMKVGLNLRKVDLEVGFNPEDEETMEERVIP
                     SGILSHVGPVDICRRLIKRLQKCDNSLKGDLRVQDFGYDWRLSPHLLSQKLIKHLEGL
                     PCNAPDVPRENRGAYVIAHSLGGLIARHAVNQRPELFAGVVYAGVPQHCVNILGPLRN
                     GDEVLLSSRVLTAQVNFSFRTSFALLPEDGHCFIDKRTKEEYPVDFFSPQAWDEYRLS
                     PCINFALPPTGRNLMDNLPLLAKRLSMRNGSFPEEPDSAQEYQSDMSSSTDMLQQQQS
                     QQLSQPQQPQPQPQSQQQQPHSRPPSQAYETHQPDLTPSIHHHPPRYAAANPQHDHQN
                     KPSAIKPALGGLVGPTAHPRGAAQPKTAATTNIPRGLAMSYLERTLADVRRFKEELVY
                     KESHQTENRYPPFSVIFGKSVPTVYGARVESREQIKRQDAYDDLAFAAGDGVCLASAA
                     MLPPGYRVIKDGMVKTDRGHVGLMGDLEGMGQCLLALVRGRKMGVGLGVPESKEKVEG
                     TYMPNDSNTTPVPAAEAGTEHGSKGEAEHEHKTTEGTAKADHVHPIPV"
     gene            complement(<489258..>489862)
                     /gene="RPS28A"
                     /locus_tag="ACHE_40172A"
                     /db_xref="GeneID:66981967"
     mRNA            complement(join(<489258..489319,489650..489733,
                     489799..>489862))
                     /gene="RPS28A"
                     /locus_tag="ACHE_40172A"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_043278341.1"
                     /db_xref="GeneID:66981967"
     CDS             complement(join(489258..489319,489650..489733,
                     489799..489862))
                     /gene="RPS28A"
                     /locus_tag="ACHE_40172A"
                     /note="COG:J;
                     EggNog:ENOG410PQTH;
                     InterPro:IPR012340,IPR000289,IPR028626;
                     PFAM:PF01200;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_043136130.1"
                     /db_xref="GeneID:66981967"
                     /translation="MDAASKQPTKLVKVTRVLGRTGSRGGVTQVRVEFMDDTSRSIIR
                     NVKGPVKVDDILCLLESEREARRLR"
     gene            <490431..>491508
                     /gene="HIS1"
                     /locus_tag="ACHE_40173S"
                     /db_xref="GeneID:66981968"
     mRNA            join(<490431..490447,490499..490533,490586..>491508)
                     /gene="HIS1"
                     /locus_tag="ACHE_40173S"
                     /product="ATP phosphoribosyltransferase (ATP-PRTase)
                     (ATP-PRT)"
                     /transcript_id="XM_043278343.1"
                     /db_xref="GeneID:66981968"
     CDS             join(490431..490447,490499..490533,490586..491508)
                     /gene="HIS1"
                     /locus_tag="ACHE_40173S"
                     /note="BUSCO:EOG09263LP3;
                     COG:E;
                     EggNog:ENOG410PI50;
                     InterPro:IPR001348,IPR013115,IPR013820,IPR015867,
                     IPR011322;
                     PFAM:PF01634,PF08029;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0003879 - ATP phosphoribosyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0000105 - histidine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ATP phosphoribosyltransferase (ATP-PRTase)
                     (ATP-PRT)"
                     /protein_id="XP_043136131.1"
                     /db_xref="GeneID:66981968"
                     /translation="MDLVNHLEGRLLFAVPKKGRLQQATLDLLAGCDVQFRRETRLDI
                     ALVKNLPIALIFLPAADIPTFVGEGRVDIGITGRDQVAEHDAQLPPGQVSSVEEIMDL
                     GFGGCKLQVQVPVKGSFESAKDLIGRNVVTSFTALAGQFFAGLEGESDAPKKTSIKYV
                     GGSVEAACALGVADGIVDLVGAFPSPSELMNFFKNGLTNAESGETMKAAGLKAIDTVV
                     TSTAVLVKSKNATNPLVDLLTSRVRGVITAQKYVLCQYNIPRAELATASGITPGKRAP
                     TITALEEEGWVAVSSMVEKKNIATVMDELSKVGASDILVLNIANSRTG"
     gene            complement(<491743..>495243)
                     /gene="MSH3"
                     /locus_tag="ACHE_40174A"
                     /db_xref="GeneID:66981969"
     mRNA            complement(join(<491743..493221,493276..494369,
                     494439..>495243))
                     /gene="MSH3"
                     /locus_tag="ACHE_40174A"
                     /product="mismatch repair protein Msh3"
                     /transcript_id="XM_043278344.1"
                     /db_xref="GeneID:66981969"
     CDS             complement(join(491743..493221,493276..494369,
                     494439..495243))
                     /gene="MSH3"
                     /locus_tag="ACHE_40174A"
                     /note="BUSCO:EOG09260LI6;
                     COG:L;
                     EggNog:ENOG410PGVC;
                     InterPro:IPR027417,IPR036678,IPR036187,IPR017261,
                     IPR016151,IPR000432,IPR007695,IPR007696,IPR007860;
                     PFAM:PF05188,PF05192,PF00488,PF01624;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0030983 - mismatched DNA binding [Evidence
                     IEA];
                     go_process: GO:0006298 - mismatch repair [Evidence IEA]"
                     /codon_start=1
                     /product="mismatch repair protein Msh3"
                     /protein_id="XP_043136132.1"
                     /db_xref="GeneID:66981969"
                     /translation="MPQSSSQGAASSPPDLKRKQPTIASFFGKKPSQQSPSGAGSQPQ
                     PKSKEREDSQGDKENKNQVVEEKEDEDEDEDNDEEVVAPAPKRARVNGSQDFGRKTSA
                     AAAEKQDLAVADASQRTDLSKFTSSPAVDIAAEKTQDTDTDDPEAKRRQKEKEKLHQK
                     FVKRLGGPDCLIGIGSDGVNDAGGTEDVAEAEDDEEPAKPAPKGKATKKGGSKLTPLE
                     KQVIDIKRKHMDTILVVEVGYKFRFFGEDARVAAKELSIVCIPGKLRYDEHPSEAHID
                     RFASASIPVHRLHVHVKRLITAGYKVGVVRQIETAALKAAGDNRNAPFGRKLTNLYTK
                     GTYIDDVEGMEGPAPAASEGSPATGYLLCITETNAKGWGNDEKVHVGIVAVQPATGDV
                     IYDDFEDGFMRSEIETRLLHIAPCELLIVGELSKATEKLVQHLSGSKLNVFGDKVRVE
                     RTEKKKTAAAESHSHVSSFYAEKMKSSNAADDAQASSLLQKVLGLPEQVTICLSAMIS
                     HMTDYGLEHVFELTKYFQHFSARSHMLLNGNTLVSLEIYQNQTDHSAKGSLFWTLDRT
                     HTRFGQRMLRKWVGRPLLDKEKLEERINAVEELMSSERTVSVERVKGLLGKIKSDLER
                     SLIRIYYGKCTRPELLTVLQTMQMIAQEFSDIKSPADTGFKSSVVSEALAPLPTILED
                     VVFFLNKINMHAAKSDDKYAFFRESEETEEISEEKLGIASVEHDLSEHRTVAGETIGK
                     KKVDYAAVAGIEYLIEVENSSSTIKRVPASWVKVSGTKKVSRFHTPEVIQLLRQRDQH
                     KEALAAACDKAYVFLLAEISTHYQSFRDSVQALATLDCLISLATIANQPGYSKPEYTD
                     ETCIRVEQGRHPMVEQLLLDTYVPNDIDMASDQTRALLVTGPNMGGKSSYVRQIALIA
                     IMGQIGSYVPAQSAKLGMLDAVYTRMGAFDNMLAGESTFMVELSETADILKQATPRSL
                     VILDELGRGTSTHDGVAIAQAVLDYMVRSLRSLTLFITHYQHLSNMVHSFRDHELRNV
                     HMRFTESGTNTEEEQITFLYEVGEGVAHRSYGLNVARLANLPAPLLDLAKKKSAELEE
                     KIRRRRLGGLVAAVGGVLAGDESDGLIERLVGSAEQL"
     gene            complement(<496039..>497820)
                     /locus_tag="ACHE_40175A"
                     /db_xref="GeneID:66981970"
     mRNA            complement(<496039..>497820)
                     /locus_tag="ACHE_40175A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278345.1"
                     /db_xref="GeneID:66981970"
     CDS             complement(496039..497820)
                     /locus_tag="ACHE_40175A"
                     /note="COG:S;
                     EggNog:ENOG410PR3X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136133.1"
                     /db_xref="GeneID:66981970"
                     /translation="MDADALLCNICPKRPSFSDVSHLLTHVSSKAHLSSYFKLQIRSQ
                     QEPQAAELLDDYDLWYKANNLPKLLSDRMALKEARKKKPQGKNGTGNVAKKTAKAQAT
                     ASPKNPDPPARPSLRTVSDTRPPGTFMTMGNAAANENNVIYTSYPRPATPSNRVSHAH
                     PLPVTPSRPIPTPWKQECESEPDDDSGVFMQSIPAWDSRFHRSMDTNFSLLRRSVSYD
                     PFVEDDDSFDSPRTADAERERADEITRLKGVLWPGMDIFDSATEQMRRKRNQKKDESV
                     LRRMEKTSMGVQPTELVFSPTGILRKQRVISGDVDDGSPLPGETPIPRRVPRPKRVLS
                     EADPNTHRVQTRKRSKKSTSTASSKNLRVQPRRSARIVRPSAPRFLMFRGVDHRPSRR
                     AADDDDDFELTLRRQGPKPRRGFSVFLDEPSNHDIGVREPDQPVPEPEISVSRGNDLL
                     SDSLQSTTSAHGTSLMQAPASTTTDKNIEPFLDVPESLDSPFDWDSPDSNQHYTSDAA
                     FPPQYFFGDEPRAGLGLFDDHDRTPTLLTASLPKMPDEDHIYSMGTHPSNYREPSVFR
                     DLSPDATISDMEEEEFEQFCLNGCPSS"
     gene            complement(<498469..>499712)
                     /locus_tag="ACHE_40176A"
                     /db_xref="GeneID:66981971"
     mRNA            complement(join(<498469..498511,498563..498687,
                     498740..499191,499266..499551,499614..>499712))
                     /locus_tag="ACHE_40176A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278346.1"
                     /db_xref="GeneID:66981971"
     CDS             complement(join(498469..498511,498563..498687,
                     498740..499191,499266..499551,499614..499712))
                     /locus_tag="ACHE_40176A"
                     /note="BUSCO:EOG09263G3M;
                     COG:O;
                     EggNog:ENOG410PGTA;
                     InterPro:IPR001330,IPR026873,IPR008930;
                     PFAM:PF00432;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004663 - Rab geranylgeranyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0018344 - protein geranylgeranylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136134.1"
                     /db_xref="GeneID:66981971"
                     /translation="MALVSGPGRAAGRQSDLQLYADKHVVYVKNLDTRRDELEYWLTE
                     HLRLNGVYWGLTALHLLDHPEALPREETINFVLSCLRDNGGFGAAPGHDAHMLYTVSA
                     VQVLVMLDAVDELDERGLGGKQKVASFIAGLQDKETGCFMGDEWGELDTRFLYGAFNA
                     LSLLGLLHMVDVPKAVAYVHGCQNFDGAYGIRPGAESHAGQVFTCVGALAIAGELDAI
                     DVDRLAGWLSERQLENGGLNGRPEKLEDSCYSWWVMSSLAMIGRLHWVDGSKLAAFIL
                     RCQDPEAGGFADRPGDMVDVFHTCFGVAGLSLLRFEGTKEVDPVYCMPKAVTSKCLAK
                     "
     gene            <503354..>505471
                     /locus_tag="ACHE_40177S"
                     /db_xref="GeneID:66981972"
     mRNA            join(<503354..503882,503941..504601,504653..504747,
                     504798..>505471)
                     /locus_tag="ACHE_40177S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278347.1"
                     /db_xref="GeneID:66981972"
     CDS             join(503354..503882,503941..504601,504653..504747,
                     504798..505471)
                     /locus_tag="ACHE_40177S"
                     /note="COG:T;
                     EggNog:ENOG410QDGC;
                     InterPro:IPR000198,IPR008936;
                     PFAM:PF00620;
                     TransMembrane:1 (o494-513i);
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136135.1"
                     /db_xref="GeneID:66981972"
                     /translation="MPSRHSAVPNLDLSSFSLQTNLKISSPLSPGGQSSEGPSPLTPR
                     SPKSSSSSPFFKGTTIRPVTQDSNTKSTSPTIPHSPSSYTAEPPATPGVTAIPQYPPS
                     PKDTPRHNRDQSRSFFANLKAPKSSHRAQRSDSSNTSSDKPKSRGSSTDRKTPISSKQ
                     SESSPDLLGAVAQPEENTDNSDDKNSQLGIKKVGSTTEPGVKKNKPRFANLLSRSRSI
                     RLDDSSANRLANRRPSTSFMRLEDTAKREFQEPPRSATFRPERPVKTTGNQMARNYTA
                     QSPVDFGNSAARNKNLGGAMVPSASLSQVSGASAALFNNIKQSSTGAADRIGKAGKGF
                     FGKITRSGSTNERELINDDNYVCSVINMPIIEQARRTRISKRLEDCKDKTEFWMPALP
                     YRCVDYLNFKGCEEEGLYRVPGSGKEVKHWQRRFDTELDIDLFEEPDLYDINTIGSLF
                     KAWLRELPDELFPKETQAMIAEKCEGATTAPQLLKDELSKLPPYNYYLLFAITCHLNL
                     LHSYVDQNKMDYRNLCICFQPCMKIDAYCFHFLVCDWKNCWQGCWTEKEYLQIEKEMD
                     EKEQAAAQAEAESESQHPNERAISSSGSSQPAAEEESQRPPSRPETSRGRKQRPKDIN
                     TGASATSSHTRSISQLPELGPPLSPIRI"
     gene            complement(<506348..>507067)
                     /gene="RRS1"
                     /locus_tag="ACHE_40178A"
                     /db_xref="GeneID:66981973"
     mRNA            complement(join(<506348..506948,507006..>507067))
                     /gene="RRS1"
                     /locus_tag="ACHE_40178A"
                     /product="rhodanese domain-containing sulfurtransferases"
                     /transcript_id="XM_043278348.1"
                     /db_xref="GeneID:66981973"
     CDS             complement(join(506348..506948,507006..507067))
                     /gene="RRS1"
                     /locus_tag="ACHE_40178A"
                     /note="COG:J;
                     EggNog:ENOG410PNYS;
                     InterPro:IPR007023;
                     PFAM:PF04939;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="rhodanese domain-containing sulfurtransferases"
                     /protein_id="XP_043136136.1"
                     /db_xref="GeneID:66981973"
                     /translation="MTEVEMANTPTAGADSKPERLPVTVSKPTPYTFDLGHLLANDPN
                     PLELPRDQPLNTSLKSIARDGVQSLLNQLITTCPITSSPQQGVLLTLPPPATALPRHK
                     PLPTPKPPTKWELFARKKGIGKYSTKPGAALADKERRKKLVYDEEKGEWVPRWGYKGK
                     NKNDDDWLVEVDEKDWKKEEDAAAKGSSVRGMSRAERKDRIRRNERKMRSNEKKARKG
                     GN"
     gene            <507384..>508938
                     /gene="RSM23"
                     /locus_tag="ACHE_40179S"
                     /db_xref="GeneID:66981974"
     mRNA            join(<507384..508035,508085..>508938)
                     /gene="RSM23"
                     /locus_tag="ACHE_40179S"
                     /product="37S ribosomal protein S23 mitochondrial"
                     /transcript_id="XM_043278349.1"
                     /db_xref="GeneID:66981974"
     CDS             join(507384..508035,508085..508938)
                     /gene="RSM23"
                     /locus_tag="ACHE_40179S"
                     /note="BUSCO:EOG092625U6;
                     COG:J;
                     EggNog:ENOG410PHXU;
                     InterPro:IPR019368;
                     PFAM:PF10236"
                     /codon_start=1
                     /product="37S ribosomal protein S23 mitochondrial"
                     /protein_id="XP_043136137.1"
                     /db_xref="GeneID:66981974"
                     /translation="MASAFCRGCLSRLPRASFLPPPPTVPRTTTTATAAAATAGFHTS
                     AVHYANPTKKSNSMDSGPKYRQAKSAKMKRKKPVERTRPPPIGERKALRNRIVLGNPN
                     ALEPADMQNLSVENMGDPRVRGTVVGLPVSMLEQLRSVHAFKKSQRWGLFRRPATFMR
                     KEALEMGRLFEKISGEEHGKVVKKVITGKVGSGKSVFLTQAMAMGFLKNWVVLTVPET
                     QELVNAHTGYAPLNDTNPGLYVQNQATSQLLQRTFKANEKVLSGLKVSQQHPALKSLV
                     KPGMTLAQLTGLGIKDQAVAWPVFQALWAELTSTSAPRPPILVTVDGLSHWMQNSEYR
                     TADFKPIHAHDLVFVRHFLSLLKPGANGKSTLPNGGLLLYATSGSNSPRIYSFDVALK
                     QLEATTLGVNPKSPEFPQADAYQNPDLRVIEAFAAPQPASDKEGKLELQPLSGLTRED
                     TVGYMEFWAKSGLIRQVMDFQWVSQLWTKSSGGIIGELLRLGSRLRVPQRT"
     gene            <509440..>510352
                     /locus_tag="ACHE_40180S"
                     /db_xref="GeneID:66981975"
     mRNA            join(<509440..509684,509748..510018,510086..>510352)
                     /locus_tag="ACHE_40180S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278350.1"
                     /db_xref="GeneID:66981975"
     CDS             join(509440..509684,509748..510018,510086..510352)
                     /locus_tag="ACHE_40180S"
                     /note="COG:S;
                     EggNog:ENOG410PX83;
                     TransMembrane:7
                     (o6-25i32-51o57-75i96-116o136-158i165-189o209-230i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136138.1"
                     /db_xref="GeneID:66981975"
                     /translation="MADSLSIATCAIYAVLFFPVLYLLVRHARFGLAGWLLLLIFCII
                     RIVGGALEISHTGTAAGIISSVGLSPLLLATNGILHESRIYHIRTVGWKVPAIFEFLV
                     HGLVAAGVVLTAIGSSKLQSLDGSIDSAEKMVKVGIALLTAAWGILVVLAGLSFAASR
                     TNYDAIVRAGTILLYSACLALIFSGIRVLYTLVVLCTQKGSFILDYDTLALRVVLSFL
                     PEVIAVIIYICAGIMTQSAASKLANYEPEDLSGRRHFTTSRA"
     gene            complement(<512518..>516156)
                     /locus_tag="ACHE_40181A"
                     /db_xref="GeneID:66981976"
     mRNA            complement(<512518..>516156)
                     /locus_tag="ACHE_40181A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278351.1"
                     /db_xref="GeneID:66981976"
     CDS             complement(512518..516156)
                     /locus_tag="ACHE_40181A"
                     /note="COG:B;
                     EggNog:ENOG410PV8E;
                     InterPro:IPR001214,IPR036361;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136139.1"
                     /db_xref="GeneID:66981976"
                     /translation="MSNNPSKANIFYSLPPDKIIKPPEFPPRPDLFDEVQWAPYISPE
                     NAKLARQLWELPDSILGSVTSRNGRFHPRPATAMDALAYNVYEHLMQQHMIPPSQDDW
                     EQRWRDTTLHNKTWSVEEIFNPAKGLHAQYSDGPILVQGHGVLSAPYWTVARLKAELH
                     SRGLDASGRSADLRRRLHDHERRSRGHTFLPKSDLSHWGVNRNDNFTFKLSVTNALKP
                     LDMYTWAIMLSPYNPAYWLSRAYCYYLQAFFDLAIGDAYRAQLLCEVLNDVRQRNRQP
                     GLYLRIWNAIEQHILADARNDNDSTKWETETLRGVNGINSFVATIRRALHNIISLSLA
                     ALGSWKDYKVMEHYLPERVIFKNDRDASVFERRKRVLKDTAIEYRDKRSKERLFYHEE
                     NAGNVNGGKEYPYEANDKDRTTNVSLELINNNAFRDYPKCKVRASDEDDSLFVVATED
                     IEQKTLIFAEEPSIRAHLGVTRLAEDQVPYESKPRCENCRRPINAAVLARYDSESLAI
                     KNGTHPEACPCHLLEAKEHMYFCPADPQQGTTCLQIAQKLYHYRACGKNWDWLHDAMR
                     ARITPWKLFHHYPGLDDYLKQHLNNYLDFFTHTNEKHGTALSLLLREVFDITLMRRMQ
                     TGDANLMAHEIDELAMLEDPKSWSNSWFPFTFAANIRVPFDILLQLGVDIFSDLTFDT
                     WVIQTVLRKLIINAVPWDEKWRGTAERVKREGLDKHGELPSTAEQRAMIEQKKSFDVF
                     DSDFQTLYVFSGFSLFNHACNYRGHNANWGYDKEVPNRILVWAAEDIPKGTEIRIPYK
                     FRPMSSMSARRILGKDCQCPRCCDGYDSSEEDDDSDDEHYDQNNGQNYSQNYAQDYDE
                     DYDQNYTMDYALNCARHYAHNYNHHNDSPPYGPPEEREGDTESLLTEELEHLERSNTS
                     ARILREGSGPNGPPSVNQLLSNPYEPERPRSSQISPITEQAQQAENIQFVESSPRQQS
                     SESQSSQQSSPSGPSDSARAMFPPPRPRAQLRQTHPRPLPPGLKTKITCPNRLSQEWQ
                     AAYYASMSKSASGIRAKNSNILTRSNMRNLMANTPSSPRVSSSLSRSGSDSNPDPYRY
                     PPHDPSRDHNRDRDSDPHADHGQGQGQHQDRYTEYQYQDQSQDYGQDQGRDQDQNQSQ
                     NQDQDQSQSQNQGQKRGENQSQTESQSQDQDRNQAVTQTQDHRETQSRKRKDPSVINR
                     FAKLLRRY"
     gene            <517403..>521040
                     /locus_tag="ACHE_40182S"
                     /db_xref="GeneID:66981977"
     mRNA            join(<517403..517696,517762..>521040)
                     /locus_tag="ACHE_40182S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278352.1"
                     /db_xref="GeneID:66981977"
     CDS             join(517403..517696,517762..521040)
                     /locus_tag="ACHE_40182S"
                     /note="COG:S;
                     EggNog:ENOG410PPGJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136140.1"
                     /db_xref="GeneID:66981977"
                     /translation="MFSNSGPPQPEWRLPPRPPTTATGTTTATTATSTPSTSPVPPPP
                     PPAPSAPVLPSYNPNVFGPMPGAPPVATGIDTTAWGVKFNHQHHHQAHSPPPLPPRPP
                     IATDHVPARIQSPRVSSPVSNKPLPSVPPYGGQIAPGQYSYGPAQALGPVPPPPPPVP
                     PGYQSQLQQQAHPPAPVASDQSGVINYTTSSPLERPLPQPTLAVSTDFGPFTNTGNGP
                     PPVPPKTSSNVFTTSSSMGPFSPSDWEHLGPTPGYIDDTEVFSSKKTTPVPPVEPSQS
                     HATSMHSPASNPYIPTSTPPQNASPAFQVPHADDQVGMQKPSTESPVSTSSAQEPPRP
                     SGPSRVNTAETTQSSATGTTEKIDGVIEAWARPISPDVRKSADGSRQSPISRPADKTI
                     QRKPSPIDPIDIPSSRSGSRTPAEEGQQLSTPGGSMANAEGVASRLTVVDPYEDLDPW
                     FKSSLTRYVAMLRKEAVADSDEERYKIFTAFTAKETKLREILYGIEQEPKSTRAEDVN
                     SRQPTPSPQQSAEKEKEGPPTPQPSAPVESGLIPVESEQDVLESTYTTEDFEDGEYSP
                     GGRPIIPRLYTPNNLERPATQPPGHQASKLTDTGSQYGVQDQFSRSSSVPPSMNSGIH
                     TQTFAPLTTNPPQPIYTPFRYIEGPQRGSDNLALDKPAYQAYSDLRQASAESGRVMAN
                     APDSDTKTGVNTRVSSPAQNEHSETFIGLIREKSVTYKKRRPRRASSPPPLPPSLRQG
                     RPDPVNDLRSMVSSPLAKQSESSWHVTTRKSLEQYSDDFTYIQEAFSTWETTAKIRRQ
                     NLDKERMQRQEESEAHVDSLFNGKEIGYADINVLEEEFRQAEARVQLDEERQELDDFI
                     RIVFNPVDERLGREIAALLNHYESALSQLSHENSKIKDSTDRHNLSHTMNIVNDIYRN
                     LEMRYQKRLNIAFDRERRRKKAERRPLVFMGDSGALRKLDNEFDQMEKRNIFEAAKDR
                     DERANRLMDAFDDAIMHGLGENQSLLDDVAAKVKKVDASHLQSTSLPESEVEQILKSV
                     ATMVDSLRRDSESILHNFGIADATLNNADYRLSVAEARYTNADHDVFRRLNAEKQKED
                     AKIQKDLESKLESVRDGPAEITHKISELLKALGKDPVAEPEASSDVTASTSHPVDSLM
                     PGPRPATAGLPSNEDSEHQRRIRRALEAAKKRNAAKAHGTMALQ"
     gene            <523208..>524774
                     /locus_tag="ACHE_40183S"
                     /db_xref="GeneID:66981978"
     mRNA            join(<523208..523684,523785..>524774)
                     /locus_tag="ACHE_40183S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278354.1"
                     /db_xref="GeneID:66981978"
     CDS             join(523208..523684,523785..524774)
                     /locus_tag="ACHE_40183S"
                     /note="COG:S;
                     EggNog:ENOG410PUE0;
                     InterPro:IPR007527;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136141.1"
                     /db_xref="GeneID:66981978"
                     /translation="MSAPTKQFHKLSIGGNMPDRRTQAERRAAGAGSHRPSDDDGDDD
                     NEPMQVSGESEQADEEVDEEEVEDEEEDVTESSQSSTVQARSGITYDLAHLDPDSEAR
                     ALLGLTGRFDEIHCESTQTGYDFRLSERPQVHIGSGTYTCTCSAYQSRPDVACQHIFW
                     ILDQLHGCFMPQPPSSDVPLLSNGHSPQFPRIEHLLDGKLEMVAEQLNWQFSRSKVEE
                     GMGRPQKVRDIMSAFSTVILPEDFRLDLVEETTQLRTPEQCVVQGDFEATMFRLAVHN
                     DEVYASLCKAMPPGACAAIYFDKVQEKMRKLLADFDRYCLTGQLPAADGTGTSLDVDA
                     VVNDLQRNVDRVQDNIIARAPHGTEGAAKTLITILEDICNRDKDALDGNRWGRASFNG
                     EDEDQRNLYHRLVGKADETGEYFVLDALEHIPATDLHQFGDKMSAILHRNEVNRGPKS
                     YILKLNALVRLAVESVSSGSGQKRPATATTGGNSKRTR"
     gene            525836..525907
                     /locus_tag="ACHE_t40001S"
                     /db_xref="GeneID:66987392"
     tRNA            525836..525907
                     /locus_tag="ACHE_t40001S"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:66987392"
     gene            complement(<526015..>527244)
                     /locus_tag="ACHE_40184A"
                     /db_xref="GeneID:66981979"
     mRNA            complement(join(<526015..526941,526991..527039,
                     527120..>527244))
                     /locus_tag="ACHE_40184A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278355.1"
                     /db_xref="GeneID:66981979"
     CDS             complement(join(526015..526941,526991..527039,
                     527120..527244))
                     /locus_tag="ACHE_40184A"
                     /note="COG:Q;
                     EggNog:ENOG410PGFN;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136142.1"
                     /db_xref="GeneID:66981979"
                     /translation="MAVSEIPKKQKAAIYDEPGSVSTKVVELDVPEPSTGEVLINLTH
                     TGVCHSDYGIMTNTWKALPFPTQPGQVGGHEGVGKIVKLGPGTESSGLKLGDRVGVKW
                     ISSACSNCLPCQAGSDGLCFNQRISGYYTPGTFQQYTLGPANYVTPIPDELESEQAAP
                     MLCAGVTVYSALKRSNARPGQWVVISGAGGGLGHLAVQLASRGMGLRVIGVDHGSKAE
                     LVKESGAEHFVDVTQFPADDKGEAIAKHVKSLADGFGAHAVIVCTSANAAYAQSMGFL
                     RFNGTMVCVGVPEGEPQPIATAFPGKMIIGHQTITGSAVGNRTDAIETLNFAARGVIK
                     AHYRTEKMDALTSVFEEMGQGKVQGRVVLDLS"
     gene            <528186..>529326
                     /locus_tag="ACHE_40185S"
                     /db_xref="GeneID:66981980"
     mRNA            join(<528186..528843,528890..>529326)
                     /locus_tag="ACHE_40185S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278356.1"
                     /db_xref="GeneID:66981980"
     CDS             join(528186..528843,528890..529326)
                     /locus_tag="ACHE_40185S"
                     /note="COG:S;
                     EggNog:ENOG410PM07;
                     InterPro:IPR006680,IPR032466;
                     PFAM:PF04909;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136143.1"
                     /db_xref="GeneID:66981980"
                     /translation="MPIPIVDSHIHLFPDSHLPSLAWYGPNSPLGSQHCVDEYRQATS
                     STPIISDSTKPLYLRGFIFIETDRLSSVEESGHGWKHVLDEVALLARVVRGEPIDGDQ
                     HRYVDRPPCLGIVPWAPVPGGAVVLERYVKKVKQAAETDDVWRKIRGVRYLVQDKPSG
                     VMLQPEFIDGLKWLGRKQLTFDLGVDARQSGLWQLREAVEMMERVYEGVDEKDQVVMV
                     INHLCKPNLRLPFASPESTTTHPDFLEWKTLVTAMARYPTAYMKLSGGFSELPPLSPA
                     PEPDIKFLVERLHSWTDAVFDAFGPDRVMFGSDWPVCNLGGGGNDATWRRWRTVVEGV
                     LERRGLSEEQRKGVWGKVALKAYGIEIEGL"
     gene            complement(<529370..>530279)
                     /gene="DHG2"
                     /locus_tag="ACHE_40186A"
                     /db_xref="GeneID:66981981"
     mRNA            complement(join(<529370..529838,529892..530157,
                     530211..>530279))
                     /gene="DHG2"
                     /locus_tag="ACHE_40186A"
                     /product="L-rhamnose-1-dehydrogenase"
                     /transcript_id="XM_043278357.1"
                     /db_xref="GeneID:66981981"
     CDS             complement(join(529370..529838,529892..530157,
                     530211..530279))
                     /gene="DHG2"
                     /locus_tag="ACHE_40186A"
                     /note="COG:Q;
                     EggNog:ENOG410PJ9Z;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="L-rhamnose-1-dehydrogenase"
                     /protein_id="XP_043136144.1"
                     /db_xref="GeneID:66981981"
                     /translation="MPLPQLLVGKVAAITGGLTGIGRAIALEYLRHGAKVAINHLGGP
                     NEEAFLESIHKDAVEITGLQEKRFLTVAGDVTQPETGKEFIAKTVAEFGRLDVFVSNA
                     GVCKFAEFLDVDPPLLGHTVSTNLSGAFYATQAAGRQMALVQSPPGGSIIGISSISAL
                     VGGGQQTHYTPTKAGVLSLMQSTAVALGKYNIRCNALLPGTIRTQLNDEDMSDPVKRE
                     YMEGRIPLGRLGQSPDLAGPAVFLACEELSGYVTGAQLLVDGGLFVNLQ"
     gene            complement(<533192..>534620)
                     /locus_tag="ACHE_40187A"
                     /db_xref="GeneID:66981982"
     mRNA            complement(join(<533192..534159,534238..534460,
                     534528..>534620))
                     /locus_tag="ACHE_40187A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278358.1"
                     /db_xref="GeneID:66981982"
     CDS             complement(join(533192..534159,534238..534460,
                     534528..534620))
                     /locus_tag="ACHE_40187A"
                     /note="COG:M;
                     EggNog:ENOG410PJ5V;
                     InterPro:IPR023444,IPR029065,IPR036849,IPR013342,
                     IPR013341,IPR029017;
                     PFAM:PF13378,PF02746;
                     go_function: GO:0050032 - L-rhamnonate dehydratase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136145.1"
                     /db_xref="GeneID:66981982"
                     /translation="MGSTAASSFPRIKEVRTFLIDGVGSGGDYHNVKGGHWLIDSNIS
                     TPMTRWAQYRGSRTSWGINVLGSFCVEVEATDGTKGFATGFGGPPACWLVQQHFERFL
                     LGADPRDTNDLFEKMYRGSMFYGRKGLPVAVISVIDLAIWDLLGKIRNEPVYKLIGGA
                     TRSRLDFYCTGPQPAAAKDMGFSGAKVALPHGPDEGTEGLLKNIDYLRKQRESVGPDF
                     PLRVDCYMSLNVPYTIELVKRCEKEGINIDWWEECLTPDDFDGHALLKRAHPTVKFTT
                     GEHEFSRYGFRKLVEGRNLDILQPDVMWVGGMTELLKVSALAAAYDLPVVPHASGPYS
                     YHFVVSQPNTPFQEYLANSADGRSVEPVFGNLFVNEPIPSNGFLDVSILDKPGFGLEL
                     NPAAPLIPAASILTPTPQKSLAPPADEQNANGNGN"
     gene            <535223..>537813
                     /locus_tag="ACHE_40188S"
                     /db_xref="GeneID:66981983"
     mRNA            join(<535223..535371,535427..535461,535522..535638,
                     535700..536966,537021..>537813)
                     /locus_tag="ACHE_40188S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278359.1"
                     /db_xref="GeneID:66981983"
     CDS             join(535223..535371,535427..535461,535522..535638,
                     535700..536966,537021..537813)
                     /locus_tag="ACHE_40188S"
                     /note="COG:K;
                     EggNog:ENOG410PHUR;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136146.1"
                     /db_xref="GeneID:66981983"
                     /translation="MPNARASVQNSGDQDLSADELWSGAESETNNRPARNGSNGLKRK
                     RPLIVSCELCKLRKVKCDRAQPSCGWCTRNGQLCEYKERKKPGLRAGYGKELEQRLDR
                     LEKTIQSQGRLIETHILQNPRLLPDLPQAGSFPYSSPSEPSAAHNPSPRNDLFKEPSS
                     VPAHPSQDTPILGQHDYTDNDSSLNVPVNLFSNQARSFADPELELPPYDLLYALVDLY
                     FEHVNPWCPILHRRTTLDNFFGLSPLAEEDRMVLYAIVATTLRFSTDARLNEQNRKQY
                     HDSSKQKVLLYGLENSSVKALQALVILALDLVGSSNGPPGWKLLALITRSVVQLGLAV
                     EPKSRLVSPVYPSIYTLRAVVLPEPDSWIEEEGRRRLFWMVYLLDRYSTIATAFDFAL
                     DDKDIDRKLPCKDEYFVKNQPVETRWFRHFNNRTDYMNRAENVGFLGLYVEILGILSR
                     IHRFLKRPVDIGSLSDVEEWQATYRKLDSELTSWEFNLPAEYAYENSSRLFSGSKHAR
                     ALQCDWVQLHAAYQTAVIRLHSSAAYPTTRSPIFTPSYSASQRCLLAVDNILSVTRLV
                     VNNKLLDKLGPPFAFTLWVSARLLLVHGSTIAHTVSPDFTFFVDTLAQMGMHWKVAER
                     YSSILHRVLDEYGEYQQSGAMDSERATPSTVKILADMRRCAFDLDFLISRQPRSSPAS
                     SSQPPMSSAAGPLRNLAPNELEYLDVFGFFNVPRVPPTRALDIASLDVEGTGSNNPSP
                     MHGLTGGATDPADAVVDGHSSNMNDLNITNYLIPTPETDWLFRQTR"
     gene            complement(<538175..>540599)
                     /gene="SPS1"
                     /locus_tag="ACHE_40189A"
                     /db_xref="GeneID:66981984"
     mRNA            complement(join(<538175..540012,540062..540378,
                     540452..540482,540548..>540599))
                     /gene="SPS1"
                     /locus_tag="ACHE_40189A"
                     /product="putative protein serine/threonine kinase"
                     /transcript_id="XM_043278360.1"
                     /db_xref="GeneID:66981984"
     CDS             complement(join(538175..540012,540062..540378,
                     540452..540482,540548..540599))
                     /gene="SPS1"
                     /locus_tag="ACHE_40189A"
                     /note="COG:T;
                     EggNog:ENOG410PF80;
                     InterPro:IPR000719,IPR011009,IPR017441;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative protein serine/threonine kinase"
                     /protein_id="XP_043136147.1"
                     /db_xref="GeneID:66981984"
                     /translation="MEGPVDPETIYTKQSCIGGGSFGRVYKGVDNRSGKPVAIKVVDV
                     EDAEDDVEDIISEIAILSELNSPHVTRYYGSFLKGSHLWIVMEFCSGGSCSDLLRPGK
                     ISEDYIMIILRELLRGLEYLHNDQKLHRDIKAANILLTADGQVKLADFGVSGQLSATM
                     TKKNTFVGTPFWMAPEVIKQSGYDYKADIWSLGITAIELACGEPPYSDIHPMKVLFLI
                     PKNHPPTLQGDEFSRYFKNFVELCLRRDPRERPSARELLEHPFIKRAKRTTYLTELIE
                     RHERWQIEKANEKNKDNGEAQTPDLSYQSFHDAPTQQAARQEVEDDDLWDFGTVRPGV
                     RGAGLKPMKDADTNTRNQGHMEWDLSDQPQRDQRIPSGPQLAAPHRKPSGPQPMSPQR
                     GSFQAIPNPSPTKVPLPPSPVKPIPIQNVPQTPTHLQGPTVFPQKESPGTSEYDRELQ
                     QSLVQDLGFLQLDRPTDVRLPSRELKVESTEPLSQQPLAQPVKPSPRQGHIPSPPPHK
                     SPKIPSQGFMPAPEVRPQQPAFAQSHVRPPPTPKHRSPPSQPPSQPQTPTRNPQSPKS
                     PTTSTFNNANYLRGGARASSHEMNRPSQPQQQPLTPTRNPQFPTTFNNANPRGGPGAS
                     SHEANRPSSSSNEITALNSVLVPALKAAIRRRSRRMERLRRNVGNERSSEVIDLHERR
                     EYAHDMIESLVSDISGMFTRIERLDQEAPIGMGADVSSFLEGFLEEVLVRIEPADEEP
                     SPGKR"
     gene            complement(<541572..>543203)
                     /locus_tag="ACHE_40190A"
                     /db_xref="GeneID:66981985"
     mRNA            complement(join(<541572..542662,542720..>543203))
                     /locus_tag="ACHE_40190A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278361.1"
                     /db_xref="GeneID:66981985"
     CDS             complement(join(541572..542662,542720..543203))
                     /locus_tag="ACHE_40190A"
                     /note="COG:O;
                     EggNog:ENOG410PIWE;
                     InterPro:IPR029071,IPR036249,IPR001012,IPR006577,
                     IPR009060;
                     PFAM:PF14555,PF00789,PF13899;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136148.1"
                     /db_xref="GeneID:66981985"
                     /translation="MNDDVVAQFTEITGSSPELASQYLQLADFNIEQGVSLYFENGGA
                     PLTDEPSMSGPQRASGRQDESGVVHIDSDDDVTVDETRSAPRGRPAPAAAFEDDEAMA
                     RRLQEEIYGGGGGGGARGEDDVRAPMARTTETLVGPEDDFDDDMQASILARMRSRGQR
                     SNRPGIFNQRDTSSIWVEDSDQANRERLAAATGGASETSNKSSMLAEMYRPPFEIMSR
                     LPWDAAREEGRDNEKWILINIQDSSIFDCQVLNRDLWKDPTVQETIKEHFIFLQYSKD
                     DPRATPYLQYYFQAHDVGDNYPHIAIVDPRTGEQMKVLSSGPPVVKPADFLIQLHEFL
                     DRYSLKVNVRNPVAKRKPEKKEKTVDAMTEEEMLEMAMRNSLGEGATQAPKLEDPDEL
                     TRSVEDVKGKGKVPEAEDISMGGVKEEELDPETSLFVSIPADQPHTEPPADPTTTTRI
                     QFRHPSGRVIRRFALSDPVRRIYEWLKADPPLEDKKGVTFELNAMGRNLINQLDESVA
                     DAGLKNGTVMIGYHED"
     gene            <546657..>548693
                     /locus_tag="ACHE_40191S"
                     /db_xref="GeneID:66981986"
     mRNA            <546657..>548693
                     /locus_tag="ACHE_40191S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278362.1"
                     /db_xref="GeneID:66981986"
     CDS             546657..548693
                     /locus_tag="ACHE_40191S"
                     /note="COG:S;
                     EggNog:ENOG410QDZF;
                     InterPro:IPR036397,IPR043502,IPR013103;
                     PFAM:PF07727;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136149.1"
                     /db_xref="GeneID:66981986"
                     /translation="MEDNQRDAPNTHSEEAESPPQPSTREVDDSMNEERLQPESTTEV
                     DDSQGVNESSLEGENDSPENRDGLVNELESSNREGSVNKHQTERRSARTHQPSNALIE
                     SRESEEIYSRKRKAEGEQDDDRPAQRMRAQLARLAIATELLIGDREYEVAHKAREKAG
                     IRIPKSYSEAINDPIYGAKWKEAIHKELSTLMSFGTWKVIPRKQADGNISTCRWVFDV
                     KLGLDGRIDRFKARLVARGNEQSDDDFDETFAPVFRLDSLRILCAIAARYGLIAHVMD
                     ALSAFAGSRLDKPNCMEIPEGLQDFDPDAKEGMVLKLLMSLYGLRQSAYLWHRKISRF
                     LKSIGFDPITADPSIFINKRGLIIALYVDDIVIFGRGEGEIDAVKRKLKEFHPMTDGG
                     LVKKLLGIRFMWRRDGSIRLDQESYARQILEEFGMGDCNPAYVPISPSVKLNSEDTPQ
                     LGRSEHKLFRRLIGRLIFMVVATRPDIAFAVNQLSQYLAEPRRIHLGAAKHILRYVKS
                     TMAHGLTFSAKGREGLTVYADSAYANSAKSRSTTGFILMIDDAPITWTSRKQSVTAQS
                     TTEAEYMAVSEAAKQVIWTRHFLYAIGKASIYGSTPTTIYEDNRGAINLADNPIDHPK
                     TKHIAVRYHAIRDHIGNGEVRLEHLPTDQMIADALTKASHRDAHKRFIKRLSMI"
     gene            <549239..>551305
                     /gene="CDC6"
                     /locus_tag="ACHE_40192S"
                     /db_xref="GeneID:66981987"
     mRNA            join(<549239..549290,549359..549634,549699..>551305)
                     /gene="CDC6"
                     /locus_tag="ACHE_40192S"
                     /product="AAA ATPase"
                     /transcript_id="XM_043278363.1"
                     /db_xref="GeneID:66981987"
     CDS             join(549239..549290,549359..549634,549699..551305)
                     /gene="CDC6"
                     /locus_tag="ACHE_40192S"
                     /note="COG:L;
                     EggNog:ENOG410PHC7;
                     InterPro:IPR003959,IPR036388,IPR027417,IPR036390,
                     IPR015163,IPR016314;
                     PFAM:PF09079,PF00004,PF13401;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0006270 - DNA replication initiation
                     [Evidence IEA];
                     go_process: GO:0051301 - cell division [Evidence IEA]"
                     /codon_start=1
                     /product="AAA ATPase"
                     /protein_id="XP_043136150.1"
                     /db_xref="GeneID:66981987"
                     /translation="MTATVLGKRSRGALRTEAPALPVRTSSKRRSRTPRILQAEDKSS
                     VSSPRQLRSRGRKNSSIAEEKDQENDTAEKSAPAAETRRFKHTIQPTTSPVKVHSHLQ
                     TTIKPANDENADPIGIKTPSKSRYQDVLESPPITPKHRVQVGAKSLTPRTPRHVSTPT
                     TTTTTTTTQTVYTQARQLFARGANSGRLIGRETEREKLRSFIEDGVESQRGGCLYVSG
                     PPGTGKSAMIDEVCQEMDFSAVKTAHVNCASMRGPRDVYSKLVEEFCDDSEIFKKSEA
                     DRLKAMFIPDKSEDGLFFVTLDEIDHLLTSDAGVLQSLFEWALHSKSKLMLIGIANAL
                     DLTDRSLPQLKAKNLKPRLLPFLPYNANQIANVITNRLRSLLPSDQNAEPNFVPFVQP
                     AAIQLCAKKVASQTGDLRKAFELVKRAVDLIEQETLKKLEKQNDDPQTPSKTILIENK
                     NLSTPAKTPQPNDSISVYTALNAPRASIAHVARITSSAFGQGTVQRLQNINLQQKAVI
                     CSLIALDRKRREDGITSTPSKTKISAPTVKQIFDTYCALCRNDNILHPLTATEFKDVL
                     SNLETMGLVGEFQGRGRGGTVAGGSDLRRTPSRSSTSTPVKGSDEQGLVCFVSQREIE
                     GQIAGPGEGILRRLLSGQGL"
     gene            complement(<556734..>559522)
                     /locus_tag="ACHE_40193A"
                     /db_xref="GeneID:66981988"
     mRNA            complement(join(<556734..557917,557972..559217,
                     559295..>559522))
                     /locus_tag="ACHE_40193A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278365.1"
                     /db_xref="GeneID:66981988"
     CDS             complement(join(556734..557917,557972..559217,
                     559295..559522))
                     /locus_tag="ACHE_40193A"
                     /note="BUSCO:EOG09261C0G;
                     COG:T;
                     EggNog:ENOG410PGKQ;
                     InterPro:IPR001060,IPR027267,IPR036388,IPR008936,
                     IPR000591,IPR000198,IPR031160,IPR036390;
                     PFAM:PF00611,PF00610,PF00620;
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0035556 - intracellular signal transduction
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136151.1"
                     /db_xref="GeneID:66981988"
                     /translation="MPGFADSFWTPDYASGLGVLYGKLQQGVVENKQILTVASLRADA
                     EEQYGLKLGDIAPSVDRMPNGFGKDDGASVRKAYEGVRTEMVEAAKNHQKIASNIREL
                     VVSPFRRWCGQHEARIQLSHDDLQTRIKEHTKQVEVVKKLRSHYFNKCRVVEDLEEEN
                     KLAFQAPQHSPQSKNTPRLVLPEKQPEEEEPVEIGDRIYPPEEVKKLLVHMLENIKVG
                     DVKVPIMGTYQNTSTGADIVEYTQKYMNATSLTYAEAIGQDLVDNGFLRLVGNMGNTF
                     ANSSKMNYQWRTKVFQVTGIPEKKRPLMRVTSAASSEDGGNDSPIASVSEMIAGWNPL
                     NNPYPNETPTEKLHREAREADERYKAAVRKLDQIRCKLEEEIVANLRFMEQCELDRLK
                     AIKSVVLDFSGAISNVIPNLQSTVDHMMLYQETIQPLGDLRYLLENYRTGGFVPRVQA
                     YENYYGSVEDQNFGVDLEARSRADRKRVPILLTTILTYLDDRYPELEGDEARRAIWLH
                     DVPLEATHRLRNALNNSKVDYQEVLEQSDIPVVVSVLKLYLLELPDSLVSSQVYEIVK
                     TIYSTTAHETTEEGRIKVLQSTLGQLRLNNIATLDAIMTHLTRLIDLTSADETFVSTL
                     AQSLSQCVLRPRWESSLTMDERHSYRLIRDLFAHKDVIFGELKRQSSANGLGRTNSRP
                     RAISTDESNRRAAMEARNRAIVDRSRGHSPAPPRKHRRDRSSGASETRRFPINVTSPT
                     EKRTTTRSSLDVPSNNNSPTGTEQMTNVNIHAAESATNDTPDDSPVSAAASISTSGTS
                     SPPPPPAAATDDSPTPTPTPAPMQTSTPSDADKRTSISRSSLKFTRKPGLGSVSSFPT
                     SVGTNSNRNSIAESEPNRITLEDKPMDDD"
     gene            complement(<560411..>562380)
                     /gene="GAP1_3"
                     /locus_tag="ACHE_40194A"
                     /db_xref="GeneID:66981989"
     mRNA            complement(join(<560411..561473,561532..561728,
                     561824..562044,562107..>562380))
                     /gene="GAP1_3"
                     /locus_tag="ACHE_40194A"
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /transcript_id="XM_043278366.1"
                     /db_xref="GeneID:66981989"
     CDS             complement(join(560411..561473,561532..561728,
                     561824..562044,562107..562380))
                     /gene="GAP1_3"
                     /locus_tag="ACHE_40194A"
                     /note="COG:E;
                     EggNog:ENOG410PJCY;
                     InterPro:IPR004840,IPR004841,IPR004762;
                     PFAM:PF13520,PF00324;
                     TransMembrane:12
                     (i84-103o109-126i133-150o162-184i191-211o217-237i304-
                     325o345-371i406-424o430-456i477-498o518-537i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0006865 - amino acid transport [Evidence
                     IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /protein_id="XP_043136152.1"
                     /db_xref="GeneID:66981989"
                     /translation="MEKDAIEPKTIRTGSGDPPPGYGETELIRGNIGRRFLDSFKRNP
                     NAQITHQPPADGSNVDPEIAAQNTANSPLERRLKGRHMQMIALGGSIGTGLFVGSGNV
                     LSTGGPASVLIAYGLIGVMLYCTVHALGEMAVVFPVAGSFASYSTRFIDPAWGFAMGW
                     NYSLQWLIVLPLEIVAASITIDYWDSNISNAAWVAIFWVMIVVINMFGVKGYGEAEFV
                     FSLIKVIAVIGFIILGIILNCGGGPRGGYIGGRYWHDPGAFHNGFKGLCSVFVNAAFA
                     FAGTELVGLAAAEAANPRKSLPTAIKQVFWRILLFYLVSLTLVGLLVPYNESQLTSGS
                     SSADARASPFVIAIKNAGISGLDSVMNVVIMIAVLSVGNSSVYGSSRTLAALAEQGQA
                     PKILAYIDRKGRPLVAQGVASVLGLLAFLAASDKQEDAFNWMLAISGLSSIFTWGSIC
                     LAHIRFRRGWKAQGHSLDELPYRSQPGVVGSWVGFIFNCLVLVAQFWVGFAPVDYGTM
                     TASGRVESFFESYLAAPVVIAFYIPYKIYTRSPFMRAKDMDLQTGRRDLDIQHLIDEE
                     RAEQAAWPWWKKAYKFFC"
     gene            complement(<563918..>564451)
                     /gene="LSM5"
                     /locus_tag="ACHE_40195A"
                     /db_xref="GeneID:66981990"
     mRNA            complement(join(<563918..563950,564005..564068,
                     564130..564157,564213..564251,564317..564373,
                     564427..>564451))
                     /gene="LSM5"
                     /locus_tag="ACHE_40195A"
                     /product="RNA-binding protein lsm5"
                     /transcript_id="XM_043278367.1"
                     /db_xref="GeneID:66981990"
     CDS             complement(join(563918..563950,564005..564068,
                     564130..564157,564213..564251,564317..564373,
                     564427..564451))
                     /gene="LSM5"
                     /locus_tag="ACHE_40195A"
                     /note="COG:A;
                     EggNog:ENOG410PQY0;
                     InterPro:IPR010920,IPR033871,IPR001163;
                     PFAM:PF01423"
                     /codon_start=1
                     /product="RNA-binding protein lsm5"
                     /protein_id="XP_043136153.1"
                     /db_xref="GeneID:66981990"
                     /translation="MASQLLPLELIDKCVGSRIWVVMKGDKEFSGTLLGFDDYVNMVL
                     EDVTEFDYAGGKSQLPKILLNGNNICMLIPGGEGPGA"
     gene            <564958..>566199
                     /locus_tag="ACHE_40196S"
                     /db_xref="GeneID:66981991"
     mRNA            <564958..>566199
                     /locus_tag="ACHE_40196S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278368.1"
                     /db_xref="GeneID:66981991"
     CDS             564958..566199
                     /locus_tag="ACHE_40196S"
                     /note="COG:S;
                     EggNog:ENOG410PJ2P;
                     InterPro:IPR036397,IPR012337,IPR002562;
                     PFAM:PF01612;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008408 - 3'-5' exonuclease activity
                     [Evidence IEA];
                     go_process: GO:0006139 - nucleobase-containing compound
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136154.1"
                     /db_xref="GeneID:66981991"
                     /translation="MRFCRSVDVMKPWNGRILFNASRIQNANLIASRRPYSISTLGST
                     CRKFAVLDRDPVGGRQSHVTTHVFYCPSNISIATNGEDTSIFHIISRSYSTGSAAYSV
                     VEHGNGPPSESFETHRVTQTTSYRSQTQQNVTTGTVARQRVARNPIPPKPPATKYWSH
                     HLHKAPDGNPIIIHYCRSLRTMEDVAQYFLDDEVIGFDMEWKASATYADGIRDNVSMI
                     QLASEKRVALFHVASFIGTDPKHFVAPSLRKILESPDITKVGVSIKADCTRLRKFLGV
                     NTRGIFELSHLHRLIKYSQSQPKLVNKRLVNLNDQVEEHFGLPLLKETEVRCSDWTRP
                     LNYDQVQYAANDPYACICLFKTMDGKRQAMIPMPPRPAHAELDLPIRLVEEAQKATVA
                     EENAAAELGGTANSNVDGKAI"
     gene            complement(<566534..>567667)
                     /gene="PEX10"
                     /locus_tag="ACHE_40197A"
                     /db_xref="GeneID:66981992"
     mRNA            complement(<566534..>567667)
                     /gene="PEX10"
                     /locus_tag="ACHE_40197A"
                     /product="peroxisome biogenesis factor 10"
                     /transcript_id="XM_043278369.1"
                     /db_xref="GeneID:66981992"
     CDS             complement(566534..567667)
                     /gene="PEX10"
                     /locus_tag="ACHE_40197A"
                     /note="BUSCO:EOG092635ST;
                     COG:O;
                     EggNog:ENOG410PJ4X;
                     InterPro:IPR001841,IPR017907,IPR006845,IPR013083;
                     PFAM:PF13923,PF14634,PF04757,PF13920,PF00097,
                     PF13445,PF13639;
                     TransMembrane:2 (o195-213i234-253o)"
                     /codon_start=1
                     /product="peroxisome biogenesis factor 10"
                     /protein_id="XP_043136155.1"
                     /db_xref="GeneID:66981992"
                     /translation="MADHDPHLSTIPTSHSAHFYPFATSPDIIRSHEKDGFITGSLIN
                     QAQNIARSLRGARFAHAHSDAIKHLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTLQ
                     LPSTIRRAGYILSSIVVPWVLQRILPAFRRRLRAKLERNIARQQFKAQQAAAQQPVLP
                     GKEKGKQEKRPLITKLKVQKYILEHLDSITSLSPVYALSIATFYFTGSYYHLSKRFWN
                     LRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGISHVRKVTASLKQQQENPEMESELL
                     ESTEKRDDSIVASIENPPLLPNLPASMPRYDLGEDADAVPWIPPGQQSRCTLCLELFK
                     DPSVTTCGHVFCWTCVRDWVREKPECPLCRQDVILSKVLPLRG"
     gene            <568140..>569663
                     /gene="ERD1"
                     /locus_tag="ACHE_40198S"
                     /db_xref="GeneID:66981993"
     mRNA            join(<568140..568224,568298..568347,568432..569114,
                     569164..569480,569590..>569663)
                     /gene="ERD1"
                     /locus_tag="ACHE_40198S"
                     /product="protein-ER retention protein"
                     /transcript_id="XM_043278370.1"
                     /db_xref="GeneID:66981993"
     CDS             join(568140..568224,568298..568347,568432..569114,
                     569164..569480,569590..569663)
                     /gene="ERD1"
                     /locus_tag="ACHE_40198S"
                     /note="COG:U;
                     EggNog:ENOG410PIWD;
                     InterPro:IPR004342;
                     PFAM:PF03124;
                     TransMembrane:5 (o12-33i71-90o102-119i322-342o354-372i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="protein-ER retention protein"
                     /protein_id="XP_043136156.1"
                     /db_xref="GeneID:66981993"
                     /translation="MGPDQHAQLDDFSLFLPFPYRVAVILVAGFWGWGVNLQYLRKAN
                     IDVPALIRYPARQSPQQPPHHSSAYRLARLLTLPLVITLLIFWVATHGSAHLVELLDF
                     IPQAYIVVFFVIIALPFNRVCKAGRRHFLLALRRVSIGGLADAQDGKVGDILLADALT
                     SYAKVLADLYVTFCMFFTRGISSTSKPNRTCGHDYIVPIIIAIPSIIRFRQCLIEYIR
                     VRRAGATRENTGFQHLANALKYATAFPVIYLSAKLRNYSPLVFYGYSEMDLARLLLIC
                     TIINSAYSFWWDVTKDWDLTLLTRSRDTSEYPYGLRRHRYFSSDRLYHSAILIDLVLR
                     FSWASKFVPGLLWLTERESGLFVLMFLEVARRWMWVFFRVEAEWVRSHRGPAPDDILL
                     GEFTGKLDAD"
     gene            complement(<570130..>571215)
                     /locus_tag="ACHE_40199A"
                     /db_xref="GeneID:66981994"
     mRNA            complement(<570130..>571215)
                     /locus_tag="ACHE_40199A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278371.1"
                     /db_xref="GeneID:66981994"
     CDS             complement(570130..571215)
                     /locus_tag="ACHE_40199A"
                     /note="COG:S;
                     EggNog:ENOG410PMZW;
                     SECRETED:SignalP(1-33);
                     TransMembrane:1 (n17-28c33/34o112-132i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136157.1"
                     /db_xref="GeneID:66981994"
                     /translation="MRLSTAGRRTAHRPSRALLLFLAIALLARLSIAQDTTDANDATT
                     TDDATATATSAETTDIGTSTTDSSMSSSTDSSTTSLSSSSTSSSSYPIVTVPPTAGAP
                     YMQTSSTPEGAVFIAVGAVLGFLGLAVLAWRGLVAWSVNRSVRQQAAAMQSSEKRGLL
                     RSRRRSARSKSRSRSRTRSMSRGQFGPTGNLDNAPTGNASGGGYDRHNHRRRSRSGSR
                     GPPRMREVPGSSNPLFFSPTAGASMHSGKRSSQHHSGYGYGYGHSTASTSTPRASTGP
                     IPKNASVSASKRYQPPYKGKHAYPPPPPRARNIPIVSPPVSPNLRPMGAGVPNQASPP
                     QGKAPSEYLEDLFDGHARPGMGDWDCR"
     gene            complement(<571783..>572862)
                     /locus_tag="ACHE_40200A"
                     /db_xref="GeneID:66981995"
     mRNA            complement(join(<571783..571922,571973..572191,
                     572241..572345,572397..572695,572768..>572862))
                     /locus_tag="ACHE_40200A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278372.1"
                     /db_xref="GeneID:66981995"
     CDS             complement(join(571783..571922,571973..572191,
                     572241..572345,572397..572695,572768..572862))
                     /locus_tag="ACHE_40200A"
                     /note="COG:S;
                     EggNog:ENOG410PQNX;
                     InterPro:IPR037654;
                     SECRETED:SignalP(1-18);
                     TransMembrane:1 (n5-13c18/19o236-259i);
                     go_process: GO:0006078 - (1->6)-beta-D-glucan biosynthetic
                     process [Evidence IEA];
                     go_process: GO:0009272 - fungal-type cell wall biogenesis
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136158.1"
                     /db_xref="GeneID:66981995"
                     /translation="MHLNGLGLLALGAATASAFRDTSPFFLASTSEILLPSSNIALST
                     SLLNDIGSHLNSCPSDYYVVAYQPGVHSTDFATRKSAPRLGAKMTGKDETIRSTSSIH
                     EVSGVVDAKEVQNMIGNACGAETTVIDASTGSYPSSFGDAPRVIAVDFPMLSLGSDRA
                     QQLSDNDGFLSDIIDRIPSSKKYTLLYVTSPRETEGTIYKPNEEAYQEPLRMELKRDY
                     SDYTKQDSNKSLFQEYQYFTPGMFMGFFAAFVCIMILYVGIQALLSLEVPYAAFEKDT
                     FSAVQKKQQ"
     gene            <573081..>573806
                     /locus_tag="ACHE_40201S"
                     /db_xref="GeneID:66981996"
     mRNA            join(<573081..573257,573324..>573806)
                     /locus_tag="ACHE_40201S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278373.1"
                     /db_xref="GeneID:66981996"
     CDS             join(573081..573257,573324..573806)
                     /locus_tag="ACHE_40201S"
                     /note="COG:S;
                     EggNog:ENOG410PQWB;
                     InterPro:IPR019186;
                     PFAM:PF09805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136159.1"
                     /db_xref="GeneID:66981996"
                     /translation="MGPNKKRKLANQPEEINFDPDARQQFLTGFRKRKLQRVKHAQEV
                     AEKRAREERIEYRKRIREERKAEYEQAFEEHRRQLKMLTENSENESNDSGNESNEGED
                     EEWEGFAEPPAVDYEAEYIDEDKYTTVTVEEMDPSREGLLKYGQQEQSDDKSDQEEGG
                     KAQQTPEDANSKAPKRLQTDKPKKKKKKFRYESKEERKLNQAKQRYSKARKARARRGE
                     E"
     gene            complement(<574189..>574988)
                     /locus_tag="ACHE_40202A"
                     /db_xref="GeneID:66981997"
     mRNA            complement(join(<574189..574351,574463..574767,
                     574971..>574988))
                     /locus_tag="ACHE_40202A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278374.1"
                     /db_xref="GeneID:66981997"
     CDS             complement(join(574189..574351,574463..574767,
                     574971..574988))
                     /locus_tag="ACHE_40202A"
                     /note="BUSCO:EOG09264XUV;
                     COG:Z;
                     EggNog:ENOG410PNPX;
                     InterPro:IPR000533;
                     PFAM:PF12718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136160.1"
                     /db_xref="GeneID:66981997"
                     /translation="MDKIKERMNTLRLEAEDAQEKVEELKAKVRTLEQENLAKEQEIT
                     SLNHRNQLLEGEVEKMETTLKEAKDAANQSAQHDTQNEALQRRLQILEEEAEEADRNL
                     RETNEKLRQTDVKAGHYERKVQALEASRDQWESKYEEMAKKHAELQKDLHDLEVSISN
                     V"
     gene            <575666..>577025
                     /locus_tag="ACHE_40203S"
                     /db_xref="GeneID:66981998"
     mRNA            join(<575666..575900,575956..576180,576241..>577025)
                     /locus_tag="ACHE_40203S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278376.1"
                     /db_xref="GeneID:66981998"
     CDS             join(575666..575900,575956..576180,576241..577025)
                     /locus_tag="ACHE_40203S"
                     /note="COG:S;
                     EggNog:ENOG410PQ8N"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136161.1"
                     /db_xref="GeneID:66981998"
                     /translation="MLAVRDQENLVHAHQTVAAGKPLNQGTKTPGARAPKTPFKVPLN
                     DENGPLAFGKKTVKATGRGNENLKPAKDAFVTPLPENRQRAPLGMKTTNAKAKTPAPI
                     GTNKPERTNRRTSTQKVKKIAPLVQQSEPETAAKSVQDDVPDIEYMPPKPKELPDLPD
                     DIIYDTTFPQFRPENLARGLESTYGDNEIGSDGLTKRERKYKEASIAQDKMMDEMILK
                     QIESIGFEEANETDQSRQSTLKEASKRRLEPRRVKVPTPKVKYTSNVSTLRARDAAAA
                     LSASETSAPPTRAASRPRISSSIHTTRKPRAPANPSSMRHSAAVANSKTTVGYAKGRE
                     VSTRLHGKPSTIAKQPAPKNILSPDTYMQLYGTPPFGSEMWLRCKAAGCFDDEQNQPE
                     IIPETLPTFDEDDEALNFQLAL"
     gene            complement(<577642..>578326)
                     /locus_tag="ACHE_40204A"
                     /db_xref="GeneID:66981999"
     mRNA            complement(join(<577642..577833,577931..578233,
                     578285..>578326))
                     /locus_tag="ACHE_40204A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278377.1"
                     /db_xref="GeneID:66981999"
     CDS             complement(join(577642..577833,577931..578233,
                     578285..578326))
                     /locus_tag="ACHE_40204A"
                     /note="COG:U;
                     EggNog:ENOG410PQJE;
                     InterPro:IPR011012,IPR006722;
                     PFAM:PF04628;
                     go_process: GO:0006888 - endoplasmic reticulum to Golgi
                     vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136162.1"
                     /db_xref="GeneID:66981999"
                     /translation="MTAKIACIGVIGKADNPLHISLFPPYTDSTIEFNFLLNSCLDIF
                     DIHQKQTAISQDLGLLHAVDERLAAYGWLTTTGVKFLVVVDLMGQQVPIGAEKPKSAG
                     AAISGLRDGNLKPVFHALQTAYIQLLQNPFYSPDDHLPLAKNAAVPTSTSQEITNKKF
                     ISEVKRIGDSWAPGMAAV"
     gene            <578592..>580412
                     /gene="MT2"
                     /locus_tag="ACHE_40205S"
                     /db_xref="GeneID:66982000"
     mRNA            join(<578592..578702,578862..579348,579399..580150,
                     580200..>580412)
                     /gene="MT2"
                     /locus_tag="ACHE_40205S"
                     /product="sphingolipid C9-methyltransferase 2"
                     /transcript_id="XM_043278378.1"
                     /db_xref="GeneID:66982000"
     CDS             join(578592..578702,578862..579348,579399..580150,
                     580200..580412)
                     /gene="MT2"
                     /locus_tag="ACHE_40205S"
                     /note="COG:M;
                     EggNog:ENOG410PFZI;
                     InterPro:IPR029063;
                     PFAM:PF02353,PF08241,PF13649,PF13489;
                     TransMembrane:2 (o55-73i80-102o)"
                     /codon_start=1
                     /product="sphingolipid C9-methyltransferase 2"
                     /protein_id="XP_043136163.1"
                     /db_xref="GeneID:66982000"
                     /translation="MTTEKIHPESPEEFEFIETPPASCITPAEPCGVRTTSYPAIKNA
                     PVPADSPGSDGFSNILLFSLLVLIPWYLARQVGGGFYTTIFFAIFTTIPILMAFWTIA
                     SSVSPRKNEKAKYAGRPVEHYLQFHSEHDRAAYRGKSKIPMEVFYEKYFNGEVDFKGD
                     ALECLEFRHDWANFRFTMGLYKHFLFGFIPELLIHSRSQDEEQVRDHYDRGDDFYAWF
                     LGPRMIYTSGLIGDVNREETLEELQDNKLAVVCEKIGLKPGDTVLDLGCGWGTLAKYA
                     SVHYGAHVTGITLGRNQTAWGNNGLRKAGIEDSQSRIHCLDYRDAPRVSGGYKKITCL
                     EMAEHVGVRHFSSFLSQVYDMLDDDGVFFLQIAGLRKSWQYEDLIWGLFMNKYIFPGA
                     DASTPLGFVIDKLEGSGFEIKGVDTIGVHYSATLWRWYRNWMGNREKVEAKYGKRWFR
                     IWEYFLAASTITSRQGGATCWQITLVKNINSTHRVEGINSQYGLTGARQASIDNVGNG
                     SVPSAHVPTVTK"
     gene            complement(<580763..>582982)
                     /locus_tag="ACHE_40206A"
                     /db_xref="GeneID:66982001"
     mRNA            complement(join(<580763..580986,581069..581980,
                     582040..582619,582671..>582982))
                     /locus_tag="ACHE_40206A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278379.1"
                     /db_xref="GeneID:66982001"
     CDS             complement(join(580763..580986,581069..581980,
                     582040..582619,582671..582982))
                     /locus_tag="ACHE_40206A"
                     /note="COG:Q;
                     EggNog:ENOG410PF88;
                     InterPro:IPR000269,IPR015798,IPR016182,IPR036460;
                     PFAM:PF01179;
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0008131 - primary amine oxidase activity
                     [Evidence IEA];
                     go_function: GO:0048038 - quinone binding [Evidence IEA];
                     go_process: GO:0009308 - amine metabolic process [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136164.1"
                     /db_xref="GeneID:66982001"
                     /translation="MSSTSLHPFDPITPGEIQLAVRVLQAAFSGVPLRYKKIDLQEPI
                     KADVVPYIEAERLRQPLPSRPARILLAYFNRLDNGSFYKALLNADTRSIIYAKEMPKE
                     VQAPVDIDELADIEDLCMRHPAVQAEIERLKLPPGITVCNDPWMYGTDDANETRRLFQ
                     CFMYIVEVDHPQNNHYSLPCKFSPVFDGTTHELVRMDYLPGGANTVAVETQPWKPVKA
                     VQYAHELLDEPLRQDLKPYIAQQPEGPSFNVDGNLVSWQKWRFRVGFNSREGLVIHNV
                     TYDNRNLFYRLSVSEMTVPYGDPRAPYHRKQAFDVGDVGFGLNANQLSLGCDCLGHIK
                     YFDGYRADSKGNPVLMQNVVCMHEQDNGLQHKHTNYRTGAATVVRNRQLVLQIICTVA
                     NYEYIFAYIFDQAANVELEVRATGILSTVPFDNQNGETVPWGTNVGPGVMAPFHQHMF
                     SLRIDPAIDGHKNTIYYEDSIPLPEDDETNPYGVGYTTQQTTLRTSGTAETDVSRHRV
                     FKIRNDSITNPITYKPVAYKLMTAPSQMMLASKKSLGWQRAVFASKPIWVTKYRDEEL
                     FAAGEFTNQSRRAEGVETWVARNDETENEDVVLWHTFGLTHNPRVEDFPVMPMEKISV
                     MLRPDGFFTKNPALDVPQSSQGFNKSTLHQEASPAACCSGGSRAKLFKRVE"
     gene            <583725..>585490
                     /locus_tag="ACHE_40207S"
                     /db_xref="GeneID:66982002"
     mRNA            join(<583725..583867,583945..584706,584757..584954,
                     585004..>585490)
                     /locus_tag="ACHE_40207S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278380.1"
                     /db_xref="GeneID:66982002"
     CDS             join(583725..583867,583945..584706,584757..584954,
                     585004..585490)
                     /locus_tag="ACHE_40207S"
                     /note="COG:K;
                     EggNog:ENOG410PSGR;
                     InterPro:IPR036864,IPR021858,IPR001138;
                     PFAM:PF00172,PF11951;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136165.1"
                     /db_xref="GeneID:66982002"
                     /translation="MNRTSTTTSAPDHAATRKRYRREGGRWSRSGCLTCKKRRKRCDE
                     AKPSCHNCTRLGKTCEGYGSMWAEPLDPFAQVFQPEGQKRRKISSSSPCSSDGFSEGS
                     LALSTISPAPVDFDDGLSIDSYSKSEVNDQSEYTIPYASLQPSLYLTHLTPLETHYLQ
                     YHIEQGSKLLVNLETTENPLRSLIIPRALSSPLLMKAMCALSAMHFSNRSFDSFGVSI
                     DAQTAATKYYIQTMKGIRMALAEDSGGGVSDEVVLAVGLLCKYEIVRGSVRQWAVHLG
                     ALQRLVISRGGYASLDRDTAEFLCGFFTYAHHVAKLTNRRHITGVMPEVDSVRIRKLD
                     IYIGYTEDILKLCARTSDLPSLDPLSLQTEVNDIDTSLQTWSPTTPTNQYIIPQGMTP
                     SVLLRLQMVAECFRDAAYIYLHSILERIPSCQPSLYPISTSKQEALQRCLSRIETFHL
                     DPEYCEYSALTFPLFIAGCECQTIVERDIVMEALGALERNFGIGNVRRAKEILNVLWS
                     ENGEGHWLDTLERLKWDVILG"
     gene            complement(<587066..>589139)
                     /gene="PEX30"
                     /locus_tag="ACHE_40208A"
                     /db_xref="GeneID:66982003"
     mRNA            complement(join(<587066..587692,587748..588970,
                     589127..>589139))
                     /gene="PEX30"
                     /locus_tag="ACHE_40208A"
                     /product="peroxisome-related protein"
                     /transcript_id="XM_043278381.1"
                     /db_xref="GeneID:66982003"
     CDS             complement(join(587066..587692,587748..588970,
                     589127..589139))
                     /gene="PEX30"
                     /locus_tag="ACHE_40208A"
                     /note="COG:S;
                     EggNog:ENOG410PJ9U;
                     InterPro:IPR010482,IPR006614;
                     PFAM:PF06398;
                     TransMembrane:3 (i90-112o118-137i220-241o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="peroxisome-related protein"
                     /protein_id="XP_043136166.1"
                     /db_xref="GeneID:66982003"
                     /translation="MAALDDFPWIDSMASSSYAQDHGVQLDSQQPTVAAFSPTTIAGS
                     SLTSRQRSSVIVHRKSPLLVATPPAVTRALAYSHPFILPLNKLAGLLTWTSGDPWESF
                     LLVAAFWAVVMYGDAVIHWAGPILVVIGLILGMYWRRYSPLSSRSWFDQKPKSTDYQK
                     AAADGGTARHHTSLDEIVETLRTFTTRCNILLEPLLDLTDFLSTQRTATSATTKPALT
                     ALFFRILFVTPIWILLTLPPFYLLTTRRVVMLVGTSFLTYHCRPARVARVILWRSLFV
                     RRVCSMITGLQFSSEVDKSQSIKSLTRGRTKDMTTKRNPESSGIRFTFVIYENQRRWL
                     GIGWTYSLFPSERTAWTDEHLNSVPPRDEFELPDVHSGNAEWRWVESSEWRIEGAEES
                     SDKADSKSSDGGGWIYYDNKWNEGRRGQDGWDRYTRRRKWYRDAELVEIPSPEEMTES
                     TSTLTQALQNEQNGTTDYEDAKSTSQSTSSKARRRRWFGSSKSVSDNSSNSTPTGAAS
                     SSTSISTTNPSSVTNQKITSATNHSPSGSRPINIKSSSSSRPHKPSSYSSHSSSLGRE
                     GSTHGSISDTRSVRDREIVDAQDRLDRWGARATGGTERVERELGLSDEMNMGLS"
     gene            <589620..>590091
                     /gene="PAM16"
                     /locus_tag="ACHE_40209S"
                     /db_xref="GeneID:66982004"
     mRNA            join(<589620..589622,589675..>590091)
                     /gene="PAM16"
                     /locus_tag="ACHE_40209S"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /transcript_id="XM_043278382.1"
                     /db_xref="GeneID:66982004"
     CDS             join(589620..589622,589675..590091)
                     /gene="PAM16"
                     /locus_tag="ACHE_40209S"
                     /note="BUSCO:EOG09265M8S;
                     COG:U;
                     EggNog:ENOG410PQ6Q;
                     InterPro:IPR036869,IPR005341;
                     PFAM:PF03656;
                     go_component: GO:0005744 - TIM23 mitochondrial import
                     inner membrane translocase complex [Evidence IEA];
                     go_process: GO:0030150 - protein import into mitochondrial
                     matrix [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /protein_id="XP_043136167.1"
                     /db_xref="GeneID:66982004"
                     /translation="MAHRIVGQVLVTGARVFGRAFAEAYKQAQASSKYAAQASKGNMG
                     AANTFASGGLSLDEACRILNTKPPQAGKADLEQVMERFKKLFDMNNPEKGGSFYLQSK
                     ILRARERIEMEVRQAERQAAHEKELKEGWKPKVYKDR"
     gene            <590788..>591996
                     /locus_tag="ACHE_40210S"
                     /db_xref="GeneID:66982005"
     mRNA            <590788..>591996
                     /locus_tag="ACHE_40210S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278383.1"
                     /db_xref="GeneID:66982005"
     CDS             590788..591996
                     /locus_tag="ACHE_40210S"
                     /note="COG:C;
                     EggNog:ENOG410PKGN;
                     InterPro:IPR023210,IPR036812;
                     PFAM:PF00248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136168.1"
                     /db_xref="GeneID:66982005"
                     /translation="MGRPAGPLSAHLPPLVMGTATFNTQFNPDPYALPTTELVHRALA
                     SGVSAFDTSPYYGPAEELLGRALATDYVRANHPRESYRILTKVGREHASSFDYSPEWV
                     RVSIKRSLQRLHTEYLDLVYCHDVEFVSPAEVLQAVRELRRIRDEEGTIRYVGISGYP
                     IDVLCELAEMVLRETGEPLDAVMSYAHFTLQNTSLLTRALPRLLEAGVDVVPNASPLG
                     MGLLRRQGVPIGSQGDFHPSPAGLRGAIQKAAEWADSQGERIEVVAIRYALERWLREA
                     TEAGASGPPPLVPSAGIEKVSSNRENKPVHGRLGVSVMGVSNVGELNETLRVWHSILD
                     GLDTAPASASDDANWSRTRRQQILTIAQGIQSILGSEWVDYAWESPGPGFVNSLPESH
                     LEAKAKAGSG"
     gene            complement(<593807..>595420)
                     /locus_tag="ACHE_40211A"
                     /db_xref="GeneID:66982006"
     mRNA            complement(join(<593807..594507,594556..594569,
                     594626..595178,595234..>595420))
                     /locus_tag="ACHE_40211A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278384.1"
                     /db_xref="GeneID:66982006"
     CDS             complement(join(593807..594507,594556..594569,
                     594626..595178,595234..595420))
                     /locus_tag="ACHE_40211A"
                     /note="COG:V;
                     EggNog:ENOG410PVIH;
                     InterPro:IPR020464,IPR007822,IPR012341;
                     PFAM:PF05147;
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136169.1"
                     /db_xref="GeneID:66982006"
                     /translation="MPSSQLQYYKNTLQPLQTNQSTLQQTLQELQRAVVQGTKVLQVG
                     SPAPVSPSDHSSIYDGTAGIALAFLRLNRQKDVLGETKPPDFARLANERIISAGDVKL
                     PPLGYISPVGSSLGPLVVRILAALEHSGQSVSQSDIKLLNTAVQRSLSHGHVVSSSSG
                     DHIRGVDEVLYGRAGLLWAVVNIRHHAFGNKDIEGDIGALFDAIPKLAEAIIDGGRRG
                     ARDYVENYGGKGALPLMWVYKDERYSLGAVHGIAGILTILLSCEFEELNRYLMLIAET
                     ITGLCRISIANNGHLPSSIPSRSRSRGSPLVQICHGAPGLLTLLATARKNNHLRTYWK
                     SEWDEAIHLSAERVWQEGLLSKGGSLCHGLTGNAWSLLALHESFELDSHAEGNDKSDY
                     FLSRALALLLLARETPPYSTALDISSGYDFRMPDRPYSLYEGLSGELCAWAEACVVVQ
                     ARLCNEVGQTEGQQAKEKALGIPCLGGNGVSGVM"
     gene            complement(<596177..>598323)
                     /locus_tag="ACHE_40212A"
                     /db_xref="GeneID:66982007"
     mRNA            complement(join(<596177..596788,596839..>598323))
                     /locus_tag="ACHE_40212A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278385.1"
                     /db_xref="GeneID:66982007"
     CDS             complement(join(596177..596788,596839..598323))
                     /locus_tag="ACHE_40212A"
                     /note="COG:L;
                     EggNog:ENOG410PJHK;
                     InterPro:IPR002058,IPR043519,IPR002934;
                     PFAM:PF03828,PF01909;
                     go_function: GO:0016779 - nucleotidyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136170.1"
                     /db_xref="GeneID:66982007"
                     /translation="MPPAYEFRGNRGGDRRNNPRHEFTFRYARPHISERPLLRSTRET
                     TPEPLVPAGQTREQKPAMKFAPIADLSDSEEEDMDVSDDEESHPRKKRAVENGDTAPA
                     PAPAPPAPKWSNPDPYTALPPPDDSQTKKVDVVKLIRKSRAAASAADTQATQADTAVT
                     TNEDFISLGDLPGGDDDDDEEDDDNEVGNPNAPDNAPRGPRAGDSAFGRKRTYDDELK
                     GHSKKTGKPMSRYYPDASVLDEWRVHHSQLGTPWVTLMPPTLHPGTRLHNEIVSFFHW
                     VKPNSFEQVVREDLVARLQSAFSRRYYGVQVRAFGSFASGMYLPTADIDLVLLSSNFM
                     RTGVKTFGERKGQIYAYSAFLRSTEIAVPGSIETIAHARVPILKFVDKLTGLRVDLSF
                     DNDSGLIANRTFQQWKSEYPAMLPIVSIIKQFLLLRGLNEVATGGLGGLSITCLVTSL
                     LQHLPHGHLEPNLGSVLMDFFDFYGNHLDYEKVGIRLNPPGYFNKRVYNDNRRLTIED
                     PNNASNDVSGGTREIALIFQSFSDAYRKLKERMISISMGQSTRTSILETIIAANYDEY
                     AEQRWQLRQVFDNDPRFERFQSLTPPPPPPPPGPPPTDPAPPPPPPSRPSDNSKSSQP
                     PPPPPPSEKPTKAQRRHNAGKDRATRLRRLRPDIRSIPDSISNDQAMKLGGYKSQSGM
                     DRDLMIREKALNLRES"
     gene            complement(<598696..>599229)
                     /locus_tag="ACHE_40213A"
                     /db_xref="GeneID:66982008"
     mRNA            complement(join(<598696..598827,598913..599083,
                     599149..>599229))
                     /locus_tag="ACHE_40213A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278387.1"
                     /db_xref="GeneID:66982008"
     CDS             complement(join(598696..598827,598913..599083,
                     599149..599229))
                     /locus_tag="ACHE_40213A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136171.1"
                     /db_xref="GeneID:66982008"
                     /translation="MDRWKLMKRIKKNLNDAGQMRHLYPSQYFDTLNRSTSLLACLSY
                     TDFIVPALDVECPMTVHHMYLVPLELDMSKTGNFDSSDEHDGQSYKSNHWFPESRMYC
                     SCNSTDNKRDNPGHVEGESSILVLD"
     gene            complement(<601451..>603258)
                     /locus_tag="ACHE_40214A"
                     /db_xref="GeneID:66982009"
     mRNA            complement(join(<601451..602100,602149..603090,
                     603150..>603258))
                     /locus_tag="ACHE_40214A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278388.1"
                     /db_xref="GeneID:66982009"
     CDS             complement(join(601451..602100,602149..603090,
                     603150..603258))
                     /locus_tag="ACHE_40214A"
                     /note="BUSCO:EOG0926195C;
                     COG:O;
                     EggNog:ENOG410PG93;
                     InterPro:IPR026874,IPR036607,IPR028146,IPR039794,
                     IPR009011;
                     PFAM:PF13015,PF07915;
                     SECRETED:SignalP(1-22);
                     go_process: GO:0006491 - N-glycan processing [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136172.1"
                     /db_xref="GeneID:66982009"
                     /translation="MIFSQSSLFLAASLAASTVVTASKDGSSRPRGVAPEFSKFYKDP
                     ETFTCISHPALQVPFSAVNDDYCDCPDGSDEPGTSACSYLSPHSPLSVADRPGANDLD
                     LTSALPGFYCKNKGHRPWYIPFQRVNDGICDYDFCCDGSDEWARVGGTKCEDRCKELG
                     KEWRKKEDKRQKSMTAALRKKRDLLVDAGRQQKEIEDDVQRLETEIEAHEVKVKNLEA
                     DLEEVQKQEQSKLVKGRKKGRVNVLAEVAKGRVEELRESLIEVRKERDETRSRVKELE
                     AILSKFKEEHNSNSDDESVKRAVSSWEDYAAKGYSDGNQARERDFDEISKPDDEKSGV
                     NWEHWENEEGSCEMDAVYQLAAYLPPSLVSFLEGQFIAFRGFLEKNGFLSKKTEESGP
                     ESQAVKDAREALKAEEKNLGEIRKQLRNRREDLEINYGPTSIFRALKGVCISRDAGEY
                     TYEQCFLDQTKQNSKKGGGSMRMGNFQRIGSTTIEEVNEAGEIVTVERMTLEYARGQT
                     CWNGPARSTKVVLECGENNEILKVSEDERCVYSMIITTPAVCAGGEEEGGAPRVKDEL
                     "
     gene            <603466..>604527
                     /locus_tag="ACHE_40215S"
                     /db_xref="GeneID:66982010"
     mRNA            join(<603466..603485,603536..604025,604081..>604527)
                     /locus_tag="ACHE_40215S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278389.1"
                     /db_xref="GeneID:66982010"
     CDS             join(603466..603485,603536..604025,604081..604527)
                     /locus_tag="ACHE_40215S"
                     /note="COG:S;
                     EggNog:ENOG410PN59;
                     InterPro:IPR006735,IPR027799;
                     PFAM:PF04641;
                     go_process: GO:1902979 - mitotic DNA replication
                     termination [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136173.1"
                     /db_xref="GeneID:66982010"
                     /translation="MGNDGGSIPTRRELVREAAKSPSTAQVKEAQREVQSHFWTTCPL
                     SHSPLVRPIVSDCTGNLYNKDAVLKFLLPGDDTEGISSKADCEEILCGRVKSLRDVVE
                     LKFEVDTERGEEHRRETGTGKGEKREGWICPITAKVLGPGVKSVYLVPCGHVFSEEAV
                     RQLKGDKCLQCNESYTEDNIISILPSQETDKQRLIARGQRLAEQGLTHSLKKAPGSKK
                     RKKNANGDSTNEPEAAGAGKTTNSRSGTSTPTTNTGIKNAATASLTAKVLEEENERKK
                     RKKLMGGNENLNSLFTKEPKDGKKGGSDFMTRGFTIPAEAKR"
     gene            complement(<604729..>605995)
                     /locus_tag="ACHE_40216A"
                     /db_xref="GeneID:66982011"
     mRNA            complement(join(<604729..605001,605054..605513,
                     605565..>605995))
                     /locus_tag="ACHE_40216A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278390.1"
                     /db_xref="GeneID:66982011"
     CDS             complement(join(604729..605001,605054..605513,
                     605565..605995))
                     /locus_tag="ACHE_40216A"
                     /note="COG:S;
                     EggNog:ENOG410PT3P;
                     InterPro:IPR018305;
                     PFAM:PF10501;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136174.1"
                     /db_xref="GeneID:66982011"
                     /translation="MRPSARLLSLEVSGSRTLYVCSSCRQEARPRPVLARQFLRNTSS
                     GSTPLTEKVRRKLWGTENPPGLKDPYGGPGALEKKLRGNQNVQEEGAAEVESAEPAEV
                     AETAGREDPDYTPATSWDGIEKIGHLGGWQNYPASQADEYSSFMLKQKLTKREHLYLA
                     AHQTAVELCLLNALNKPLSSIYAVAEHDKSVFKMIWKCKIQPGANGQWDGVLTYPNKQ
                     TEAALVYIFEQIGGQPEAAIAEAAGETGQAEAEAETPAEELDEDTYVSETPGLPFFGY
                     QDVRDKGFLSLALNDPAAKFAFLKRFSQLSGHFPDPTLHSISNVKEAVDLVLKTLNPR
                     PTKLADQLFNKTGLQKRSNVKIFAKKQKASDRDEEMGRKKVIEAELRARGLIA"
     gene            complement(<606406..>607647)
                     /locus_tag="ACHE_40217A"
                     /db_xref="GeneID:66982012"
     mRNA            complement(<606406..>607647)
                     /locus_tag="ACHE_40217A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278391.1"
                     /db_xref="GeneID:66982012"
     CDS             complement(606406..607647)
                     /locus_tag="ACHE_40217A"
                     /note="COG:I;
                     EggNog:ENOG410PHTR;
                     InterPro:IPR016039,IPR020613,IPR020610,IPR020617,
                     IPR020616,IPR020615,IPR002155;
                     PFAM:PF00108,PF02803;
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136175.1"
                     /db_xref="GeneID:66982012"
                     /translation="MASPIPRGLRQVLQKSPNDIVILSSLRTPVTRAKKGGFKDAYPE
                     ELLANVLRATLEANPKLDPALIEDVAIGSVLQELGGAKAGRMAQIHAGFPSTVPFHTI
                     NRQCSSGLAAITTVANGIRAGAINVGIGGGMESMTRNYGSRAIPTVLWPELKQSHSKD
                     SRDCIMPMGVTSENVATRYGVTRADQDAFAAESHKKATAAQNAGLFDSEIVPVKTLSF
                     DLENPEAPPKEIEVTNDDGIRHNISVEKMASLKPAFSATGTSTAGNSSQVSDGAAATL
                     LMRRSTATELGLSSSIKARWVGSSVAGCAPDEMGVGPAVAIPKLLETLGVGVSDVGIW
                     EINEAFASQALYCTRKLGIDEAKVNPKGGAIAIGHPLGATGARQLATLLPEMERSGQE
                     VGVVSMCIGTGMGMAGMFVRE"
     gene            complement(<608342..>609347)
                     /locus_tag="ACHE_40218A"
                     /db_xref="GeneID:66982013"
     mRNA            complement(join(<608342..609169,609267..>609347))
                     /locus_tag="ACHE_40218A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278392.1"
                     /db_xref="GeneID:66982013"
     CDS             complement(join(608342..609169,609267..609347))
                     /locus_tag="ACHE_40218A"
                     /note="COG:S;
                     EggNog:ENOG410PTN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136176.1"
                     /db_xref="GeneID:66982013"
                     /translation="MFTYSTKRQRTPDGSIDSEEIAIREKKRLRPLTLRTPPDTCQST
                     FCEANQLLPQFHLSTLTPIEPSDDDSDDQHRIDNVAHPTTSLHRPLPGPSSDSSMDID
                     SLPPSISYDDLSASSMGTQYSHGSVQPSPISHNLISQSLNMDGGHPVATNQILFANSD
                     TNVAMNEDFVSEAEVSGLYPGAARNHESVWWTLPGVPSPISEDEGVCVTGTGTPASEA
                     EMPSSTSYPASANSYGVHDQALWNTDMQAPSTNHTISREETKSSIPAANRASNKKKLN
                     IFMGYRADCEKCRQKVPGHYSHIIHA"
     gene            <611337..>612639
                     /gene="ARO4"
                     /locus_tag="ACHE_40219S"
                     /db_xref="GeneID:66982014"
     mRNA            join(<611337..611379,611436..611491,611632..>612639)
                     /gene="ARO4"
                     /locus_tag="ACHE_40219S"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_043278393.1"
                     /db_xref="GeneID:66982014"
     CDS             join(611337..611379,611436..611491,611632..612639)
                     /gene="ARO4"
                     /locus_tag="ACHE_40219S"
                     /note="COG:E;
                     EggNog:ENOG410PG9I;
                     InterPro:IPR006219,IPR013785,IPR006218;
                     PFAM:PF00793;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003849 - 3-deoxy-7-phosphoheptulonate
                     synthase activity [Evidence IEA];
                     go_process: GO:0009058 - biosynthetic process [Evidence
                     IEA];
                     go_process: GO:0009073 - aromatic amino acid family
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_043136177.1"
                     /db_xref="GeneID:66982014"
                     /translation="MPLVSTTEVNEDTRVLGYDPLLSPQFLQSEIPGPSEAIAAVRAG
                     RNQAVEIIEQRDDRLLVVVGPCSIHDPATAIEYARRLKGLSEKLAADLCIIMRAYLEK
                     PRTTVGWKGLINDPDLDESYNINKGLRVSRKLYADLTSTGMPIASEMLDTISPQYLAD
                     LISLGAIGARTTESQLHRELASGLSFPIGYKNGTDGNLTVAIDAIGAAAHPHRFLGVT
                     KQGLAAITKTSGNEHGFVILRGGSKGTNYDRANIKAAREALRAKNQREVVMVDCSHGN
                     SNKNHRNQPLVAQELAEQMREGEDAIVGVMIESNINEGNQKMPAEGPSGLKQGVSITD
                     ACISWEQTVDTLENLAEAVRARRAVKASKANGAH"
     gene            complement(<613298..>614138)
                     /locus_tag="ACHE_40220A"
                     /db_xref="GeneID:66982015"
     mRNA            complement(join(<613298..613770,613826..>614138))
                     /locus_tag="ACHE_40220A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278394.1"
                     /db_xref="GeneID:66982015"
     CDS             complement(join(613298..613770,613826..614138))
                     /locus_tag="ACHE_40220A"
                     /note="COG:S;
                     EggNog:ENOG410PRFB;
                     InterPro:IPR029208;
                     PFAM:PF14880;
                     TransMembrane:1 (i95-116o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136178.1"
                     /db_xref="GeneID:66982015"
                     /translation="MSRSAADATRFTATGPYASSKPGGPAYKLPGFMSNSGSNSNAGP
                     SQGPGGQPETPKQKVERLRAQAKAARMAQSSSGLDRFIGAGRELANKAHKVTVYSLIA
                     ASGVCGVLTVYSIISLTLYNRRQKALWVENELKRLEEAKRAHASGTATPEQAEIVKNE
                     MIGEIYKRKKDEEREQRPWNQVKRYLFGGLKADEAAAAPESAAAVDGQNKPEVLDALN
                     AKAAEDAKLKGEQLPGQLDVLAENAENAAKQTSRSWTSWLIGR"
     gene            <614575..>615536
                     /locus_tag="ACHE_40221S"
                     /db_xref="GeneID:66982016"
     mRNA            join(<614575..615056,615178..615220,615276..>615536)
                     /locus_tag="ACHE_40221S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278395.1"
                     /db_xref="GeneID:66982016"
     CDS             join(614575..615056,615178..615220,615276..615536)
                     /locus_tag="ACHE_40221S"
                     /note="COG:S;
                     EggNog:ENOG410PRC2;
                     InterPro:IPR018858;
                     PFAM:PF10454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136179.1"
                     /db_xref="GeneID:66982016"
                     /translation="MAEYNSSDLTSILNTLSALSKPVPTPGTQNPSTQQPYSSSPRIQ
                     PSHDDDDDAYEPPDIPPAPAPSTSKPQPHLHPQQLHPPKPAPTDPTPSTDPSTITTWP
                     SALRHVMRTVSQNEVLQRRIRRLIQSQHDHEEQWWQGREALCKKQKARGEKKKELDEV
                     LRSVGVPVDSSKGVSTAEEDETELKNYDAKIYAASNQMAQALTLELRGLGIPFFSIKR
                     DLVSDNHKNNDDHDKQHKDKLPRDELSALQLRMLDLLQDLCKE"
     gene            complement(<615835..>617478)
                     /locus_tag="ACHE_40222A"
                     /db_xref="GeneID:66982017"
     mRNA            complement(<615835..>617478)
                     /locus_tag="ACHE_40222A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278396.1"
                     /db_xref="GeneID:66982017"
     CDS             complement(615835..617478)
                     /locus_tag="ACHE_40222A"
                     /note="COG:G;
                     EggNog:ENOG410PIP7;
                     InterPro:IPR001312,IPR022673,IPR022672,IPR043129;
                     PFAM:PF00349,PF03727;
                     TransMembrane:1 (o15-33i);
                     go_function: GO:0004396 - hexokinase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0005536 - glucose binding [Evidence IEA];
                     go_function: GO:0016773 - phosphotransferase activity,
                     alcohol group as acceptor [Evidence IEA];
                     go_process: GO:0001678 - cellular glucose homeostasis
                     [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136180.1"
                     /db_xref="GeneID:66982017"
                     /translation="MTTPLVRVLHRLQELFSNVVSALETMILFPSLFRESSQRRQKGF
                     LGVRWRHRTLDDFAEEVDRLFTAPLSMRNMIVMSEKIRDQFRSCLQSSPVCMLPSYNH
                     ALPSGAEEGTYLALDVGGSTFRVALIELHGKGNIKVLRESSAYIDNNVKLLEGILFFD
                     WMAERIESMLQEVGSSYGRGESPLSMGLSWSFPIEQTSISSGLVIHMGKGFLCSNGTV
                     GQELGDLIVQSCRARNLNVQVDAIVNDSSATLLSRAYVDPQTRMSLILGTGTNVAIHF
                     PVHEIGLTKFGTRPPGWFDYAKHVIINSEMSMFGGGVLPMTRWDDILNRTHMRPDYQP
                     LEYMITGRYLGEVVRLIIVEAVETANLFGGELPHSMQEPYSLDTSIVAFLEADTSPSL
                     TSSAALFQKQHTFPVTPSSEDLHFLRRVCQTVSRRAAGYLATAIHSMWCLRNDAEFHT
                     STTIIKKASGVTVVESEPESRSLSIACDGSVINKYPGFRDSCQTYLNQLTEQTSGTTK
                     SSISLDLAPESAIVGAAVAVAVAVAVADKDSKICMMFRA"
     gene            <618900..>619241
                     /locus_tag="ACHE_40223S"
                     /db_xref="GeneID:66982018"
     mRNA            <618900..>619241
                     /locus_tag="ACHE_40223S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278398.1"
                     /db_xref="GeneID:66982018"
     CDS             618900..619241
                     /locus_tag="ACHE_40223S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136181.1"
                     /db_xref="GeneID:66982018"
                     /translation="MQPLDGSTCWRLESLQTIGRMRKYNLGFREYSPRSPRSYLIDHI
                     IGSFMVPNRREQCIFEEKRICLPQPWLSPIHVADRRLRHIPIDGMAVRSSVVDVNNPE
                     PRMLGHLYDML"
     gene            <619705..>620051
                     /locus_tag="ACHE_40224S"
                     /db_xref="GeneID:66982019"
     mRNA            join(<619705..619800,619855..619917,619974..>620051)
                     /locus_tag="ACHE_40224S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278399.1"
                     /db_xref="GeneID:66982019"
     CDS             join(619705..619800,619855..619917,619974..620051)
                     /locus_tag="ACHE_40224S"
                     /note="COG:S;
                     EggNog:ENOG410PSPJ;
                     InterPro:IPR021331;
                     PFAM:PF11160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136182.1"
                     /db_xref="GeneID:66982019"
                     /translation="MSAEGVKDKNGETIYEDDFVFTRYRGGSHQGKVEKIVMDAAGAR
                     EEGVANPPKVIYTDQHGHRVAHNPSTLDKSATSD"
     gene            <620716..>622047
                     /locus_tag="ACHE_40225S"
                     /db_xref="GeneID:66982020"
     mRNA            <620716..>622047
                     /locus_tag="ACHE_40225S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278400.1"
                     /db_xref="GeneID:66982020"
     CDS             620716..622047
                     /locus_tag="ACHE_40225S"
                     /note="COG:S;
                     EggNog:ENOG410PJCV;
                     InterPro:IPR029058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136183.1"
                     /db_xref="GeneID:66982020"
                     /translation="MIVPRSTNSSTNSNSSLLSVLSQAAGDPSIGQRTSDTASSILPL
                     LHDGTNQSNSAADVGSVQDAHGKISQVYSSVDKDSDLLDFVKSLAEGGLIPLNLVNLL
                     DGYINIGLNSIYNNNPAPPSKQDIYPKKRPGDATYSIPEESLRAAIYIPDSFAYGKNR
                     RKPVILVPGTAIPAGMTYHFSFSQLGKALPEADVVWVNIPRASLNDAQTNGEYVAYAI
                     NYISAISSDSNVAAISWSQGGLDVQWALKYWPSTRDVVEDFIAISPDFHGTDLRFFVC
                     PLLDPLACTPSIWQQGPETEFIHTLRADGGDSAYVPTTIVYSSFDEIVQPMSGPNASA
                     ILSDIRDIGVTNNHIQTICPNEPAGGIYLHEGVLYNSLAWALAVDALTHDGPGDPSRI
                     DIDTVCSQILAPQLQLDDMLGTEGLLLIALVEVLTYEPKVGREPSITGYAS"
     gene            <623653..>625529
                     /locus_tag="ACHE_40226S"
                     /db_xref="GeneID:66982021"
     mRNA            join(<623653..623736,623784..>625529)
                     /locus_tag="ACHE_40226S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278401.1"
                     /db_xref="GeneID:66982021"
     CDS             join(623653..623736,623784..625529)
                     /locus_tag="ACHE_40226S"
                     /note="COG:S;
                     EggNog:ENOG410Q2VP;
                     InterPro:IPR039535,IPR036322,IPR011045;
                     PFAM:PF14269,PF05935;
                     SECRETED:SignalP(1-16);
                     TransMembrane:1 (n2-11c16/17o566-590i);
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136184.1"
                     /db_xref="GeneID:66982021"
                     /translation="MLWWCLLLPFLGFANAKTDDDDLMSFVTLPEVRALKLDIAYYDR
                     ESTSPGYWFVAPYGVIDPEAPTKQWKPCQVGPYIYDADGVLVWAGSCMFDNRNIFDFK
                     VVDNIDDQPHLSFILQHGYQDTQDKGTGYILDQHYEPEYAVQVTNDLSAFNMHEFNVL
                     PGGKTALACAYRSEYLSLGDLGRPDEYGWVQPGGFVEVDTTTGKVLFEWSSFGHIPLH
                     ESVKVNPWDAPAVQPGWDFLHVNSIDKNEDGDYLLSARFTNTIYLISGDDGHIIWRLG
                     GKYSDFVQDFTFSKQHHAHFIQSDSNRTVISFLNNASDELEAEEDTSAALFVEIDTTT
                     TPMNAREIRRHNRPDGSLTRLRGSVQHLPNDNVFVGWSERGYMSEHSPEGKTLMQASF
                     ASTRFSSYRSYKYPFVGRPSTPPDMVASVYGTSEDDFMTMLYVSWNGATDIATWNFYA
                     RSEAYGIPVLVGNTTKTDFETLYIVNGYLDYVTAEAVDAEGNVLGTSEVHRTATPENW
                     RLSGFQGESKPVAADPSIMYGHQKAAEEDVEEPVDDEVLAAEKAAKAMGRAFEMIKGV
                     GGLLIFILVTGSGVGLVVGVVWYLRRRRMLAYHEIPSQGEGEE"
     gene            complement(<625670..>627054)
                     /locus_tag="ACHE_40227A"
                     /db_xref="GeneID:66982022"
     mRNA            complement(join(<625670..626647,626695..626760,
                     626810..626890,626938..>627054))
                     /locus_tag="ACHE_40227A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278402.1"
                     /db_xref="GeneID:66982022"
     CDS             complement(join(625670..626647,626695..626760,
                     626810..626890,626938..627054))
                     /locus_tag="ACHE_40227A"
                     /note="COG:S;
                     EggNog:ENOG410PZE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136185.1"
                     /db_xref="GeneID:66982022"
                     /translation="MPSQNQESPRGSRGGCARGRGRGRGRGGHGRGNGQANTTNQENT
                     TAAPGATAAPEVNPNQNQRGQKTSRNGQRFSRGRGEPSQRQVMMPQSESRQNQAGESQ
                     KASTEKKKKSNKKKEPAPRPSDATQNPTKHKTPNKKENKPTPPPRKIKPSLITLPPEL
                     RWKIYNYIFQPTYRVAISRQKPKWTPSPTDTRKRLYHTRLPYRNPKTQLNPHDSKHSQ
                     VVRRQNPLPISLIFSCKAIYHETILHLYANTQFVFNSTRALDRFLHTTSAQTQEVIQH
                     IELNHVMYNEPRLLGFRVFKHRSDLAWYCACEDLAVACKSLEVLHINMKIWDWPIHLE
                     LGERWSWPLLVFERFGNEVGFASVSLQMCKFEEEKLKEMSREVEKRLMTSEAWQVRED
                     ERMAREINGKIKANRVLRVVF"
     gene            <627801..>628448
                     /locus_tag="ACHE_40228S"
                     /db_xref="GeneID:66982023"
     mRNA            <627801..>628448
                     /locus_tag="ACHE_40228S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278403.1"
                     /db_xref="GeneID:66982023"
     CDS             627801..628448
                     /locus_tag="ACHE_40228S"
                     /note="BUSCO:EOG09264O6J;
                     COG:F;
                     EggNog:ENOG410PG3G;
                     InterPro:IPR000850,IPR027417,IPR033690,IPR006266;
                     PFAM:PF02223,PF00406,PF13238,PF13207;
                     go_function: GO:0004127 - cytidylate kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0009041 - uridylate kinase activity
                     [Evidence IEA];
                     go_function: GO:0019205 - nucleobase-containing compound
                     kinase activity [Evidence IEA];
                     go_process: GO:0006139 - nucleobase-containing compound
                     metabolic process [Evidence IEA];
                     go_process: GO:0006207 - 'de novo' pyrimidine nucleobase
                     biosynthetic process [Evidence IEA];
                     go_process: GO:0006221 - pyrimidine nucleotide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136186.1"
                     /db_xref="GeneID:66982023"
                     /translation="MSETKQPRFSPQDITVVFLLGGPGSGKGTQSNNLVRDYAFTHLS
                     AGDLLRAEQVREGSQYGDLIRSYIKEGKIVPMEITVALLSNAMAEALANKPKTGKDGK
                     ARFLIDGFPRKLDQAVFFEQTVCPSEMTLFLNCPEEVMEKRLLKRGETSGRDDDNAES
                     IRKRFRVFVETSMPVVTAFEEQDKVVSVEATGGVDEVYQRIKEGVAHKGLLPVDN"
     gene            complement(<628617..>630048)
                     /locus_tag="ACHE_40229A"
                     /db_xref="GeneID:66982024"
     mRNA            complement(join(<628617..629746,629805..>630048))
                     /locus_tag="ACHE_40229A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278404.1"
                     /db_xref="GeneID:66982024"
     CDS             complement(join(628617..629746,629805..630048))
                     /locus_tag="ACHE_40229A"
                     /note="COG:J;
                     EggNog:ENOG410PFV2;
                     InterPro:IPR016024,IPR027528,IPR000717,IPR040750;
                     PFAM:PF18005,PF01399;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_component: GO:0005852 - eukaryotic translation
                     initiation factor 3 complex [Evidence IEA];
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136187.1"
                     /db_xref="GeneID:66982024"
                     /translation="MPAPTTTLLIEGSFSELAEEFAQYLDALRKEESSLQSEVAPLLE
                     PLRQQEQNEQEPDVKQRDEVLKKLVAAATVLNSAPEKEITPAYNLLLHLIHQASDSSV
                     FLSRVCTYLAKPITSSPQYGPSLAISILSTVFNTLAPSDTSRYHVLLALIAVIRQSSS
                     IYTFEALKPQLTNQLPNWLAAWELSDEDAQKLHLAVAETAQAAGDNELAQTHVLEALQ
                     TIPADKASSKEARELAIRALTAALKHPAIFDFTSLTASDAVQALRSSDSTLFELLEIF
                     TSDTLDAYEAFVAATPLSSISGGVLADAGDALQDKLRLLTLTSLAASTPSRSLPYATI
                     ASALRVPAEDVEKWVIDTIRAGLVEGKLSQLRQEFLVHRATYRVFGEKQWAEVQGRLM
                     VWRRSLEGVLGVIRNERERFVRESMQQAAAAAAAAEGEGKGDKGGKRRNQQQQQQPAQ
                     APVEVAE"
     gene            complement(<630447..>631154)
                     /locus_tag="ACHE_40230A"
                     /db_xref="GeneID:66982025"
     mRNA            complement(join(<630447..630869,630920..630996,
                     631049..>631154))
                     /locus_tag="ACHE_40230A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278405.1"
                     /db_xref="GeneID:66982025"
     CDS             complement(join(630447..630869,630920..630996,
                     631049..631154))
                     /locus_tag="ACHE_40230A"
                     /note="COG:S;
                     EggNog:ENOG410PS2K;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136188.1"
                     /db_xref="GeneID:66982025"
                     /translation="MLPLAVLLSLVAASAAQNYSFPKGFDVKSVELATRSSWCTAQRS
                     TCPKICNGKTDENSCEPENLTFSCKCDNGIADLEDYKLTVPFFVCQENFGNCIAAHPD
                     DADGQDQCKKDNQCGTRNATETASKSDSESSSSSSDSSSPSSSSTATLTSSHQTDNSD
                     SSAASSSPSTTANAAAALRMAQGHSTGVFATALLVVMGLAL"
     gene            <631895..>632584
                     /locus_tag="ACHE_40231S"
                     /db_xref="GeneID:66982026"
     mRNA            <631895..>632584
                     /locus_tag="ACHE_40231S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278406.1"
                     /db_xref="GeneID:66982026"
     CDS             631895..632584
                     /locus_tag="ACHE_40231S"
                     /note="COG:S;
                     EggNog:ENOG410PX6T;
                     InterPro:IPR029069,IPR006683;
                     PFAM:PF03061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136189.1"
                     /db_xref="GeneID:66982026"
                     /translation="MTDPLPSSLSHFHSLQNNWIASLLNTTLTTNDYTAIPTFSRIPK
                     PSGEDHYFASSLATPTTIPHVLTLRRRELPTLPTEVPDWPAPTAAPSSAPAISPPDVI
                     MLMDLSAPGICGHPETVHGGVVATLLDEAMSLAVAAHSGGDSSTDNPRGKIYTAQLDV
                     RYKRPLLVPTVAMVRAKVVARLGRKYWVRAQIVQEEKVEDPKQMHLEWSRRKVVTTDA
                     MAFWLQTKSNL"
     gene            complement(<632648..>633659)
                     /locus_tag="ACHE_40232A"
                     /db_xref="GeneID:66982027"
     mRNA            complement(join(<632648..633504,633560..>633659))
                     /locus_tag="ACHE_40232A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278407.1"
                     /db_xref="GeneID:66982027"
     CDS             complement(join(632648..633504,633560..633659))
                     /locus_tag="ACHE_40232A"
                     /note="COG:S;
                     EggNog:ENOG410PY40;
                     InterPro:IPR029069,IPR042171;
                     PFAM:PF13622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136190.1"
                     /db_xref="GeneID:66982027"
                     /translation="MPQNAAFEQAIKITPLGSHRYSAVLQDDWCIGTVPHGGYTTALL
                     YRLATTHFAHTHPTHYKDTATPISIQLAFLRRTSVGPATLTVEDSKLGARTSTIHITL
                     QQPSEKTGKDEVKVTGYITVSPASVEVGISARTNWELYPPAPGVDLLVLGKTGESGIW
                     KRFRPPFTEFRKASRHLELHYPKESKTEGGKPGVVDQLARFCPGGDSQGRWTNEALVY
                     LVDMFPKALERFDQMASSGTPGIAGKSWYPTVTLNVDLKKRLPAEGVEWLYSRVTNKV
                     MRDGRMDIEVVAMDASGEVVAVATQVGLVMSASRNIGRRQKL"
     gene            complement(<635326..>638256)
                     /locus_tag="ACHE_40233A"
                     /db_xref="GeneID:66982028"
     mRNA            complement(join(<635326..636756,636804..638181,
                     638234..>638256))
                     /locus_tag="ACHE_40233A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278410.1"
                     /db_xref="GeneID:66982028"
     CDS             complement(join(635326..636756,636804..638181,
                     638234..638256))
                     /locus_tag="ACHE_40233A"
                     /note="CAZy:GT20;
                     COG:G;
                     EggNog:ENOG410PH2A;
                     InterPro:IPR001830,IPR003337,IPR006379,IPR036412,
                     IPR023214;
                     PFAM:PF00982,PF02358;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0005992 - trehalose biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136191.1"
                     /db_xref="GeneID:66982028"
                     /translation="MTIFIASLFLPYTINFHVNKSRSRRASRAPSPPPPKPTPEDIPP
                     ASTTSAPLSLFDQQHGAKKVGLTPGATTEHERIFSSDLNKAEIKPQEYPFPGSVNEKD
                     VLTGSEAHSPAWGATTSLNQPRPQAAFAASPSILKHQDALLPVREEQEITKAKVPAVY
                     ATRAEHGRAESFSKAEWTIETAEQGNGGLRNAVRSATDAGQLEDKIWVGTLGMPTDAL
                     VQQTKSTIAHTLEKEHGSLTVFVSDADFDGHYTHFCKTILWPVFHYQIPDNPKSKAYE
                     DHSWIYYVKINQAFAERIARNWKKGDSIWVQDYHLLLVPAMLRKLLPDAQIGFFLHIA
                     FPSSEVFRCLAPRKELLEGMLGANLIGFQTDEYCRHFLQTCSRILSVEATNEGLQMED
                     RFVNVATFPIGIDPTSWDKRRQAGDVEQWIRTISERYQGKRLIVSRDKIDQVRGIRQK
                     LLSYELFLNSYPEWREQVVLIQVATSTTEQPELEAMVSDIAMRINSTHSTLAHQPLVF
                     LKQDLAFPQYLALISVADALMITSLREGMNLTSHEFVYCQDGKYHGSGNKKYGSLILS
                     EFTGSASVFGNHALLVNPWDYRQCAEAIHEALSRGEEERQQVWTKLHQAVLHNSTANW
                     VKSFSETLTRVWHEQSSREFIYVPRLPMDQLEERYQRAPRRLFIVDYEGTLASWGSPK
                     SIIVTTPQRAITTLTELTEDPRNMVYVMSARMPEEMERLFSRVPGVGLIAENGCFVRE
                     PHEEEWLKLTNQERTTAWKDGVSHILAYYQERADGSWIERRHCSLVFHYGSAEDQHAA
                     ARLASECAGHINDACANQGIHAILVEGALVVEPADKNKASAAEAAWQGIVRAAPPDES
                     QERPSFLLVIGDGRDDECVFRWANKLEQKGGIEYAMTVALGSRSTEAKATLTQGVTGE
                     FSLVLRYGKTWLTRVGVLSCLERLAASNS"
     gene            <638805..>640011
                     /locus_tag="ACHE_40234S"
                     /db_xref="GeneID:66982029"
     mRNA            join(<638805..639360,639410..>640011)
                     /locus_tag="ACHE_40234S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278411.1"
                     /db_xref="GeneID:66982029"
     CDS             join(638805..639360,639410..640011)
                     /locus_tag="ACHE_40234S"
                     /note="COG:S;
                     EggNog:ENOG410PPJB;
                     InterPro:IPR018865;
                     PFAM:PF10494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136192.1"
                     /db_xref="GeneID:66982029"
                     /translation="MPLRLTSAPVSGIKKRKSTSTTTRARSSPFAAHPRTKLRSNTDD
                     TAKDATPLEDEDFDLPDLGLSQHILSTTSATTVLEAIHHIRNTMFDDLPATRTGMNST
                     RIAEVLNFRRSLPPLVSVAHVHTLLDAPTRTEREIVELVTAGKVRRLIVPGRGNDAAG
                     LGDCLVLREEWEGLLRGSSLEEGLKEKFLSVLNHIGTSSAIAPGVFTPNEYQALVRAG
                     FLVSSSSLANGSLSVASLPDLPSSTFIPASRADQPQPQSHPQSQPNNNSNNRFHTATL
                     FLSLPNTGPYLRLLSTSRTHLLTLLKKSAHREAPLYLLRDRWDGAVETDKSFHAAKRA
                     RGEFAGILPGRTRKWKELYGMRFRWVLEQAVGAGLVEVFETGSVGPGVRCL"
     gene            complement(<640580..>642538)
                     /locus_tag="ACHE_40235A"
                     /db_xref="GeneID:66982030"
     mRNA            complement(<640580..>642538)
                     /locus_tag="ACHE_40235A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278412.1"
                     /db_xref="GeneID:66982030"
     CDS             complement(640580..642538)
                     /locus_tag="ACHE_40235A"
                     /note="COG:K;
                     EggNog:ENOG410PIHY;
                     InterPro:IPR036236,IPR013087;
                     PFAM:PF00096,PF13912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136193.1"
                     /db_xref="GeneID:66982030"
                     /translation="MTTKIAPPLCFRSPSLPGGHHHPLSMAALMQSNNEPVAISNPLS
                     GPSNTIISSPQDSVAFLKQSTKPESNLSSIASAGLHVSRSRDQPSSASNMATATTPTM
                     EHREQQDKGPEQNSSQVAREALGASEKSHSINDSMPIPSDHMQVDSHTAPNDAYGSSA
                     DNNAPSLLNAPTTVASPGPMEDSASQDGDRPRHRDEAGIIEEASNKAFSYPMPTGNFN
                     DSRRGLSLPNSGFSRGQRSPGAKKHRCPYCSTEFTRHHNLKSHLLTHSQEKPYVCQTC
                     QSRFRRLHDLKRHTKLHTGERPHICPKCGRRFARGDALARHNKGQGGCAGRRSSMGSF
                     APDEEYGDGAAHGSAEDAMEGLVYAEPERMDEEEERRLMPSIRRHDASVDSASRSNTG
                     TFQSRQPSTYPPIAAGRPSPGSLFPPPASHGGGSSTSPSPISQPGNLTFPPAGQPSGT
                     SVFQPNNTTTPTTANNNITESPKPLSPNALSSQNQTNHGPDGHHRAHSPSVAQQPFQQ
                     QPFSRPPPQTAVPTTHAASSLGLPPPQPGAPQLPPPPGLNASDSRFALHGPAATAAKH
                     TPSHSHSSNHSGGPLATAKSGTELYPDPNTVDPSREDKLWAYIRSVQEEVTSLRTEVA
                     ALRAQLAVSNGNTHPPLNEANHANAGPR"
     gene            <645444..>647050
                     /locus_tag="ACHE_40236S"
                     /db_xref="GeneID:66982031"
     mRNA            join(<645444..645833,645890..>647050)
                     /locus_tag="ACHE_40236S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278413.1"
                     /db_xref="GeneID:66982031"
     CDS             join(645444..645833,645890..647050)
                     /locus_tag="ACHE_40236S"
                     /note="COG:S;
                     EggNog:ENOG410PIM8;
                     TransMembrane:4 (i141-167o187-211i223-247o288-315i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136194.1"
                     /db_xref="GeneID:66982031"
                     /translation="MADPRHHDRSSSDSPVSSLNSPRTTRFVEATTVHSPIDANESRR
                     SPFADPPNQQTTPPDVSDVGFGYVAASDPAQHASHHQPPPGSPLKSAMKVPGTPGRTL
                     NPLSPTFREEFFVEKHEQLADKENARDVKIKLRVRIAKIFLRFINFGCSLIVLAILAT
                     TLTVFNATKSLPSRNDLPAWAEGTNPWAQYLLLVVACISLFACIMVFWGYFRGGHKRA
                     EKMALYGTLFSIGFFFFSMIMWIVSAAIYQSSKANGGGQDMWGWSCNQNLREKLFHNE
                     IDYALLCRLQDWGLVCAIIEIVIEVLVILIYAVVFYRFITKRRLAKSMDRRDKARSQL
                     HLAQHFQSAPNTPGFGPGTPYFPQTPKSPWVSSQAQDPYSAAENGEHGTSAHDDRTIQ
                     YATPRSPTRPQPTFQLQPPPIRVQHATPKTNQSEWPAAPSAAPAPMSAGFAPPTPFAP
                     PTPGFAPGQGQEQIYLPVPIPAPPGNIHHLTHQFMGPAPGEAPVDSVPIPKPYGNPIR
                     GMDFSGSN"
     gene            complement(<647607..>650287)
                     /locus_tag="ACHE_40237A"
                     /db_xref="GeneID:66982032"
     mRNA            complement(join(<647607..649514,649575..650139,
                     650211..>650287))
                     /locus_tag="ACHE_40237A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278414.1"
                     /db_xref="GeneID:66982032"
     CDS             complement(join(647607..649514,649575..650139,
                     650211..650287))
                     /locus_tag="ACHE_40237A"
                     /note="BUSCO:EOG09260WU6;
                     COG:L;
                     EggNog:ENOG410PFHS;
                     InterPro:IPR022816;
                     PFAM:PF05786;
                     go_component: GO:0000796 - condensin complex [Evidence
                     IEA];
                     go_process: GO:0007076 - mitotic chromosome condensation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136195.1"
                     /db_xref="GeneID:66982032"
                     /translation="MPRVSNPKVRRSHGGASTPHKNTPVKIPLNDDMGEKAARMEARQ
                     ALHDRQMNQIKAAVKTPMPPRRRQSYEPGSTSPTTPRHTGRGRESDVYGQRAVTPMKR
                     VPILANFEEWMKMATDNKINANNSWNFALIDYFHDMSLLKEGDGVNFQKASCTLDGCV
                     KIYTSRVDSVATETGKLLSGLADGRDKRGREADADGDEEEEEGEDGTTRKSRKKAQRT
                     HEATLAPSFASLQLKKFELEFSVDPLFKKASADFDEGGAKGLLLNHLAIDGQGRIVFD
                     SSDDADEESGKDVEEQDGVKEESTEPEQPGSPSPKQSQDDAFENMEIDIAPLASRFFP
                     NLDRLDEQDICPSLKNFDLGDPSGSLDIPLLKASEDWRNEKSFHEEGRHANDPSGIML
                     DDDNAVGFDDDDGTLAGFDLSDDAGFGDGGEVWAREAALEPMLKVHRVDQEGDGNNDG
                     DEVDQDAYTISLAHQPGSRDHENILSYFDNALQKNWAGPEHWKIRRIKDNAVASTTNA
                     APKQRKEKEPFEIDFAAPLDQAVAETIYTPASSSSTISLPKTQWKTKGRNLLPDDKHF
                     NSRQLLRLFLKPKARMGSKRLTGPRNFNNRRQDQTAGNGEMDEAFWANHKTEEENPAD
                     EDGARGAYDADFFADDDGLAFSNGLGLPDDDDDNLPFADAREMLSPAPDAGTGGQSGL
                     AALLNGGGGFGSQLVTQGGRRARPDYVAYARVAKKVDVRRLKTEMWRGMGEQLIESTH
                     FSSPPQPTPAESSENEPEGPPTPTQENPQPTPGTDSQDGGLRFTQIMNSLKSSYAPET
                     LRDISTSYGFICLLHLANEQGLILNNNDPSGALEEIFVARDPNAVIEEGAM"
     gene            <650997..>654051
                     /locus_tag="ACHE_40238S"
                     /db_xref="GeneID:66982033"
     mRNA            join(<650997..651206,651268..>654051)
                     /locus_tag="ACHE_40238S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278415.1"
                     /db_xref="GeneID:66982033"
     CDS             join(650997..651206,651268..654051)
                     /locus_tag="ACHE_40238S"
                     /note="COG:P;
                     EggNog:ENOG410PHZ1;
                     InterPro:IPR004837;
                     PFAM:PF01699;
                     TransMembrane:14
                     (i27-47o112-131i143-162o182-203i215-234o240-263i650-
                     669o765-786i795-817o829-848i855-877o897-924i945-969o975-
                     993i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136196.1"
                     /db_xref="GeneID:66982033"
                     /translation="MFPRYSPSMNWPSVRPKRCRFSVNPSLYWTFLAFTVFATVSWAF
                     GVWRGDEYVAQDATNALLFRRNTEPECRLVRKVKDKCAFVRTNCPDHEDGLFSYLQFY
                     YCTLADAKPLAFILLILWMCLLFNTIGIAASDFLCIDLSTLASILGLSESLTGVTFLA
                     FGNGSPDVFSTFAAMKSNSGSLAIGELIGAATFITSVVAGSMALVRPFKVARRSFVRD
                     VGYFIIAVSFSMVFLADGRLHIWESTVMVALYCFYVAMVVSWHWYFVRQRRRYERDVA
                     ARSHFHIPDNQELDIDEPAEDDDPGVGSESRNLLRAGSTEDFDALERSDRPAWTEEDR
                     DEDDETRNRYLAEIRENMHIYRPNSRRRNTAALNPIRPSLVGALEFQSVLSSLQNSRN
                     AHQTFGIDLDRYSDHPEARPSQDFDNRSVASHSQVYRTPSQLSPHEGSARTRAVSAND
                     AAGLKIDTGVFDQNTNSPVHVTVSRPSGEGLHTAENRPVSRDALSPSDAGDYFSRSPS
                     PGVADAPRTPDLLAPSDAFRSPNYQTNASRPRSPLHSPRGTHVSPDTSPAEPATESPL
                     SPFPPFTDHPESLSSRASSIRPRGGSSPTERLQIRDGVSENGDNRPPARIKWWPYWML
                     PGPQSLFSTLFPTLCDWKVKSIWERLLGVVAAPTVLFLTVTIPVIEPAPSDTITDPIP
                     VVITTADDGNDLTTTRVRLPDDSPIIRALEHQSSEEQERGTGDDGKSQRQPSQGRERF
                     NSEVPAVQQLPEDAATSVPKEWNQWLVSIQLFVGPFFIALITWTVIDSECRPRYLLLP
                     ALIALLFSVLCFTLLRISTRLSHNSQPPKPWRSFLALLGFLVAICWIATIAEEVVNLL
                     KAIGVIMNISDSLLGLTVFAVGNSLGDLVADITVARLGYPVMALSACFGGPMMNILLG
                     IGLGGMYMTVNAKPNAVAAATGLYEIAISKVLVISAITLLIILAGVLIVVPLNGWRMD
                     RKIGWGLVVLWCVSTLGNVIAEAVS"
     gene            complement(<654651..>659238)
                     /gene="PAN1"
                     /locus_tag="ACHE_40239A"
                     /db_xref="GeneID:66982034"
     mRNA            complement(join(<654651..655764,655819..656343,
                     656396..658456,658521..658584,658647..>659238))
                     /gene="PAN1"
                     /locus_tag="ACHE_40239A"
                     /product="actin organization and endocytosis protein"
                     /transcript_id="XM_043278416.1"
                     /db_xref="GeneID:66982034"
     CDS             complement(join(654651..655764,655819..656343,
                     656396..658456,658521..658584,658647..659238))
                     /gene="PAN1"
                     /locus_tag="ACHE_40239A"
                     /note="BUSCO:EOG0926248W;
                     COG:Z;
                     EggNog:ENOG410Q4IW;
                     InterPro:IPR011992,IPR013182,IPR002048,IPR003124,
                     IPR000261;
                     PFAM:PF02205,PF08226,PF12763;
                     go_function: GO:0003779 - actin binding [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="actin organization and endocytosis protein"
                     /protein_id="XP_043136197.1"
                     /db_xref="GeneID:66982034"
                     /translation="MFSGSNTFLGGANSARPGTAPYLQQPYSQFPGQQQPQPQQPQPT
                     GFVPQPTGYAPQYTGLGGSQLQPQPTGFAGAGQLQPQFTGFPPQQQQPQPQPQSFQLS
                     PQPPQLTGYPPQSQSQPQPPQLQVAQPTGLPLRAAKTSNEIADSFNDGRPQPPPKTSS
                     GGGNKIPSIRLSFITAQDQAKFEQLFKSAVGENQTMDGEKAKELLLRSRLPGGDLSRI
                     WILSDTTKSGQLFFPEFALAMYLCNLKITGRDLPAVLPETIQNEVSSMVDIISFTVPD
                     TQPEQPLLQNKAEPPAPQQPRPQQPSNSQLLSQLTAQPTGFIAQPTGLQPNPTGFPGQ
                     GLAPQATGFPGQGLAPQATGFPGPSQQFLQPQPTGLMNNPQPTGYSGPRPPIPPIPTG
                     FGSNLSPAQTGGTAALTAQPTGIPGQWGFVNAPATGLPNIEALKQQLMPQPGREGGFS
                     TAGLSGNATIPWAITKEEKKIYDDLFRVWDGFRKGFIGGETAIEIMGQSGLEQKDLER
                     IWTLADPHNRGRLNMDEFAVAMHLIYRRLNGYPVPNRLPPELVPPSTRNLNDSIGTVK
                     SMLSQDAESRKASGAFLQPQKTGVSYLKDHSFRGGGSPGFGRKDATMFKNNDEAAAGY
                     RSSARRRVGNNTTRTPSPVASQASEDELSVEQLKKKIRETKVMLDAVDFQDENRAEEN
                     EALDRRDRREAESLMERIRRVQDDIDTHPNATFRNLDSGAERRLLRRQLQGYEDQVPQ
                     VASDVRRLEREISEAKLELFRLKDAKAHPGTASNIVGTGPGGTVTEADRIKARARARM
                     QARAAELAGRPAPASEDDDGSAARRLEAESANVKADRERNDTMTRDVEESVKEFARSL
                     EDSLKDGGESSTREHERRRWEDALGVEDVIRDFIYDLQRNARTAHIRKQEESRPSPAR
                     YDVLSPEGPAAARPSPPSTSPGPLPGNTHEDRVAAARERAQRRIAERMAAAGLKPHDA
                     GESLAQRQEREKREREDRLKRAEEEDSQREQERQRRIADEQKPAEKPATKPMGKKPPP
                     APPSRKHGGDGAAQADAKKAAEEAAQAEQAAQEQAIKEEQQAQEAERMRLEDESRRQD
                     DEMQKEKEAQEARLRALEEQVKQGKIKKQEEKRRKEEAARSAKEQEDRAAAQRAELEM
                     ARERERQLQLELEGLGEESSDDEGPEYVTPQDSTPTQSQILPPEAAPAPEPADEWELD
                     SEPPHEPEPEPQPEPEQPTSPEVASPAPHINIEPSSNNPYFNKIPQPAAPSPEVQSTN
                     PFHRLAQQEIAKPAFTGARPLEQKSRARPEDDDWSAAGSDFDDSDDEDENPGGGSAKQ
                     LASILFGTMAPPRPLSAMDNKSPSQSATPVQDASPKPAETEEPAAPSAIPPPPPPPPA
                     PAPAGDSGIPPPPPPAPPAAPPGVPPPPPAAAPPAPAGGADRGALLASIQAGKGLRKV
                     QTSDRSTSSSAGRVL"
     gene            complement(<659691..>660668)
                     /gene="RPB11"
                     /locus_tag="ACHE_40240A"
                     /db_xref="GeneID:66982035"
     mRNA            complement(join(<659691..659891,659960..660069,
                     660130..660188,660652..>660668))
                     /gene="RPB11"
                     /locus_tag="ACHE_40240A"
                     /product="DNA-directed RNA polymerase II core subunit"
                     /transcript_id="XM_043278417.1"
                     /db_xref="GeneID:66982035"
     CDS             complement(join(659691..659891,659960..660069,
                     660130..660188,660652..660668))
                     /gene="RPB11"
                     /locus_tag="ACHE_40240A"
                     /note="BUSCO:EOG0926591L;
                     COG:K;
                     EggNog:ENOG410PQZG;
                     InterPro:IPR036603,IPR037685,IPR009025,IPR008193;
                     PFAM:PF01193,PF13656;
                     go_component: GO:0005665 - RNA polymerase II, core complex
                     [Evidence IEA];
                     go_function: GO:0001055 - RNA polymerase II activity
                     [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003899 - DNA-directed 5'-3' RNA
                     polymerase activity [Evidence IEA];
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006366 - transcription by RNA polymerase
                     II [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II core subunit"
                     /protein_id="XP_043136198.1"
                     /db_xref="GeneID:66982035"
                     /translation="MNAPDRYESFVLAPGENKVDFEIDTRIPSSAIFTFNKEDHTLGN
                     LLRSRLLQSSHVLFAGYKVPHPLLPKFELRVQTDGEITPKDAVIAACHDLVKDLGILS
                     REFTKEYELRKMVGSTQQQQNGIDGQ"
     gene            <661213..>662298
                     /locus_tag="ACHE_40241S"
                     /db_xref="GeneID:66982036"
     mRNA            <661213..>662298
                     /locus_tag="ACHE_40241S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278418.1"
                     /db_xref="GeneID:66982036"
     CDS             661213..662298
                     /locus_tag="ACHE_40241S"
                     /note="COG:C;
                     EggNog:ENOG410PN2Y;
                     InterPro:IPR004136,IPR013785;
                     PFAM:PF03060;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0018580 - nitronate monooxygenase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136199.1"
                     /db_xref="GeneID:66982036"
                     /translation="MTASNSVFQSTYPWTKAPLIASAPMLNIALPPLAISVSEAGGLG
                     FLAGGFDVSNLERNLEEITRLVRESKNTEIRNFHAETGILPTGVGFINWGADLETAVA
                     AIEKYKPCAVWFFAPRSQPDDLRAWAERVRAATDGRTKIWVQIGTVIEAVDVAEALRP
                     DVLVVQGSDAGGHGLARSASVITLVPEVRDALHVNHATKDALPVILAAGGIVDGRGMA
                     ASLSLGSSGVVMGTRFLASSEATVARGYQAEVLRASDGGRNTIRSTVYDRVRGIGGWP
                     ERYDGRGMINESYVDSVERGMDDEENRRLYQEEAKKGDDGWGPMGRMTTYAGTGVGLI
                     KEALPVATILERVRCEATGIIRNLAGI"
     gene            complement(<662624..>665583)
                     /locus_tag="ACHE_40242A"
                     /db_xref="GeneID:66982037"
     mRNA            complement(join(<662624..664789,664858..665272,
                     665336..>665583))
                     /locus_tag="ACHE_40242A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278419.1"
                     /db_xref="GeneID:66982037"
     CDS             complement(join(662624..664789,664858..665272,
                     665336..665583))
                     /locus_tag="ACHE_40242A"
                     /note="COG:S;
                     EggNog:ENOG410PGAT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136200.1"
                     /db_xref="GeneID:66982037"
                     /translation="MPIKIPKGFARRKSSGNVLEEPENPPQSSFRVIERPSMDARSLS
                     EGNLLAPKSAMTARRSSQPLEAPDNNLFTNSSRSFNKNRDSGGTDTSAVTAGTYESSS
                     SLRFSSSSTSRPSNEAPAPENIQSSQSRGFHDIPPLTGALRAAGRTLSFGGRFYKNST
                     PQQQPPQPDSSKTRTMIATTPPKILETDLKLNLGKESDFQSMLKDFGSPKEASFGDKL
                     ADPEPQSSSSVSQTAGKASRPPPINTDRSKEVEPSPYSWDSRHSEEGLLSTFDSGRRD
                     SLAAQVSAMSISGGRKSDPPTTTPPPATTSHRALDRPRAGADKGLRRSVIYSQKRDSA
                     PVEDEDARLIMQALYSGKSNTHETENEPLFGHANNTAADIHGPTPLRVRRSPALSEYN
                     DPSIAHHARLAAQYENRIPKSTSPANKVMTPSQFEHYKQQQELRRANSDASKSEYSSE
                     SEFDEDDEAEKNREAERQRRKQEAHLSVYRQQMMKVTGQQQSSTPSLRPEPDYSSNSD
                     PNLTVRSSIPGNPSASGKSSDGGDDDDEEIPLGILVAHGFPSKNRPPTRLSTPRSIPN
                     LRSSFQLPRSSASSAHGDQGTANRASLPAFAKNLPRDPYYGASIVNPTNRESLALGGG
                     MSAQANLSSSALPPGGLVGVIATEERARANRRGSPNTQAMYEHAALGGSTPHLAGGIP
                     RPYSMMGINLPSASSPQPPVSAAEQAQIQLSQQMSQMMQLQMQWMQQMMQMQGGQSSL
                     QPPPQMPMAGPLPSINVNSNGRPMSMPAAEPLNPATTGSQGGQRALSMLNPQSSRVNT
                     GPPMSYATGGLRPGTPAGQGYASSIAPSEHSNIGARPRYRPMSAVQPEQGPSLVPPMS
                     KPWNDENQRSSISLVKSSAPSVTARPVSSAGFSISASKRRQAAAADDDDDDDEGWAEM
                     MKKRENKKNNWKTKRETSNLGDLLNVVH"
     gene            complement(<667174..>669224)
                     /locus_tag="ACHE_40243A"
                     /db_xref="GeneID:66982038"
     mRNA            complement(join(<667174..668192,668242..668407,
                     668459..669034,669093..669120,669181..>669224))
                     /locus_tag="ACHE_40243A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278421.1"
                     /db_xref="GeneID:66982038"
     CDS             complement(join(667174..668192,668242..668407,
                     668459..669034,669093..669120,669181..669224))
                     /locus_tag="ACHE_40243A"
                     /note="BUSCO:EOG092621X3;
                     COG:L;
                     EggNog:ENOG410PM3S;
                     InterPro:IPR032675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136201.1"
                     /db_xref="GeneID:66982038"
                     /translation="MANHFYRRRNRIRGPQSALTDFLASNNISAHQIHQDYQRRVREA
                     EQREAAEQETPEQEDSQHESDDDYQEAHAGESPEQKKKRKRKEATTLAKIKQSKEFAR
                     RKSQRLMDVAGDDRDEEHDDMLAKEMIDEKPRPMPGQLENCEKCGKRFTVTPYSKTGP
                     NGGLLCAKCSKEVADDARKTTPRKRGPRSGRRQVQSNLLDGIIQYGAMSLAEMCTKKV
                     AENIDDVEEFGDLPSPLLHRLSQILSKRRVLTPKTLNLFLRPELHSIDIYDCAKLETD
                     DFQKIFAYMPSLTQVNLRYAGQLKDRILEYMMDRNSQIKDLQFDAVNLVTDACWRRVF
                     QKYGSQLESVKLSNLDYSFNDETVEDMCKHCTGLRRLKLTQCWKTGDRSLRAIAGLKS
                     LEHLSLNFVEETGKEELGGIILNVGSNLQTLSLDGFHHADDHVLGLIHSKCHSLVKFR
                     LSDNAVCTDQAYAQLFTGWQNPPLEYVDLSSTRDVDNSNPDGPEEPIGLASQGFVALM
                     DHSGSKIQKLNIASCRHVSREAFEEVFSEGKKYPHLTELDVSFHMVMDDFLIGSIFRC
                     CPAIKKLVAFACFNVRDVQVPAGVALIGGLRAQDPIVVEGGFQK"
     gene            <669791..>673060
                     /gene="RAD16"
                     /locus_tag="ACHE_40244S"
                     /db_xref="GeneID:66982039"
     mRNA            join(<669791..669824,669900..670669,670727..671056,
                     671110..671218,671275..671349,671406..671685,
                     671744..671790,671836..671962,672018..672770,
                     672829..>673060)
                     /gene="RAD16"
                     /locus_tag="ACHE_40244S"
                     /product="DNA repair protein rad16"
                     /transcript_id="XM_043278422.1"
                     /db_xref="GeneID:66982039"
     CDS             join(669791..669824,669900..670669,670727..671056,
                     671110..671218,671275..671349,671406..671685,
                     671744..671790,671836..671962,672018..672770,
                     672829..673060)
                     /gene="RAD16"
                     /locus_tag="ACHE_40244S"
                     /note="BUSCO:EOG09260NNR;
                     COG:L;
                     EggNog:ENOG410PHZD;
                     InterPro:IPR001841,IPR027417,IPR017907,IPR000330,
                     IPR038718,IPR018957,IPR001650,IPR014001,IPR013083;
                     PFAM:PF00176,PF00097,PF00271,PF04851;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA repair protein rad16"
                     /protein_id="XP_043136202.1"
                     /db_xref="GeneID:66982039"
                     /translation="MGRRAAVVVRTDPALLNDTSSNNSAPARRTSARLALSRANADAN
                     NAQATGRNRSRQSLQVAVPVKNLSASHTSSSRSSVENGSRSTPATSVAITPVESDGNR
                     PNKRVSASARVAELRSSTMSLGTQRGRKRAPLNFTKEDIDEALARALQAEEYRAINPK
                     RQKISPGEDMSDEDDITEYGASGFESLDSEYEKVRSRDKNGKTTYSGPRIVLGPDSED
                     DMLDSDDESMFMEEEATPPPPARKLNARNPRSRKGTRVSTIGKPFWMSNRAWRERKKL
                     EGQHPSIKTMWDELKKTPPITPVPAKQPPGISRTLKSFQLEGLNWMMQQEKSEYKGGL
                     LGDEMGMGKTIQAVSLLMSDYPVGKPSLVVVPPVALMQWQSEIQEYTSGQLKVLVYHN
                     SNSKIKSLKKKDLMKYDVIMISYSGLESIHRKELKGWARADGIVKEDSVIHSIEYHRL
                     ILDEAHSIKQRTTSVARACFALKAAYKWCLSGTPVQNRIGEFFSLLRFLEVQPFACYF
                     CKACDCRSLHWSQDRDKKCTSCTHRGFDHVSVFNQEILNPITERNSNDARKEALDKLR
                     LITDRIMLRRVKRDHTAAMELPPKRVILHNEFFGEIERDFSQSIMTNSTRRFDTYVSQ
                     GVMLNNYANIFGLIMQMRQVANHPDLILKKHAQTGQNVLVCCICDEPAEEAIRSRCRH
                     DFCRRCAKDYIKSFDSDTIVDCPRCHIPLSIDFEQPDIEQEEEHVKKNSIVNRIRMED
                     WTSSTKIEILVYELYKLRSKKQTQKSIVFSQFTSMLQLVEWRLRRAGFNTVMLDGSMT
                     PAQRQSSIDYFMKNVDVEVFLVSLKAGGVALNLTEASRVFIVDPWWNPAAEWQSADRC
                     HRIGQRRPCVITRLCIEDSVESRIVLLQEKKANLINGTINKDQGDALEKLTPEDMQFL
                     FRGS"
     gene            <673650..>675556
                     /locus_tag="ACHE_40245S"
                     /db_xref="GeneID:66982040"
     mRNA            join(<673650..674491,674548..>675556)
                     /locus_tag="ACHE_40245S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278423.1"
                     /db_xref="GeneID:66982040"
     CDS             join(673650..674491,674548..675556)
                     /locus_tag="ACHE_40245S"
                     /note="COG:S;
                     EggNog:ENOG410PJA6;
                     InterPro:IPR000008,IPR035892;
                     PFAM:PF00168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136203.1"
                     /db_xref="GeneID:66982040"
                     /translation="MEEDATTHPQVRPRHQGDKIAPKLVDHADKLHDQAVAMKKNSSP
                     PGDESGTGSAADTSGSDHQPAGGFDNTPIPHAPPGYTLRFTFHRGDNLPFADFGSFSS
                     DPYIVAHLSVNLPQRHKQDPGLTFRTPTVRKNLNPAWDSEWVVANVPASGFELKCVVF
                     DEDAADHDDKLGNAYVQVNSINENWPGIQEQKFKVKKRMGSKRVYIFGNLAAFTSRRN
                     DPGSYVIISVECLGKTPGNEGGQVYTQGPNYWFKHFSPLIGRLAGTKDEVQGQDGKKP
                     ISRYNFQAIQIQFRGPAPWQLYHRYVEFRPFVAGMFTSQSLRGRILNRALHHQHERVY
                     NFDRTTQNGQFSSPCYEMTQKFLEFAHYGQGGRIFTYVLTLDGQFRFTETGKEFGIDL
                     LSKHTMHSNVSIYIAYSGEFFLRRRKHRHHRHRSRDEENEIPVEEAQEDAPMEVSTDP
                     ADYELFIDNDSGTYRPNAKLLHLLKGFLSANLPGLHITTLDCQEDAERMGTMKNEQRE
                     FKKQQGQQITFLQQSSTSSLSISSSEEEELDELSGVRAKQRGEFKQRMHEMRDVKGQV
                     MKWAQAEGDPHDHDNHRRHHLKHPKHRPGTSRNPATTGQLGTSEIRPGTS"
     gene            <676809..>680575
                     /locus_tag="ACHE_40246S"
                     /db_xref="GeneID:66982041"
     mRNA            join(<676809..676872,677011..677144,677242..678979,
                     679036..679126,679192..>680575)
                     /locus_tag="ACHE_40246S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278424.1"
                     /db_xref="GeneID:66982041"
     CDS             join(676809..676872,677011..677144,677242..678979,
                     679036..679126,679192..680575)
                     /locus_tag="ACHE_40246S"
                     /note="COG:T;
                     EggNog:ENOG410PGGG;
                     InterPro:IPR001164,IPR027267,IPR038508,IPR011993,
                     IPR001849,IPR037278;
                     PFAM:PF01412,PF00169,PF16746;
                     go_function: GO:0005096 - GTPase activator activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136204.1"
                     /db_xref="GeneID:66982041"
                     /translation="MGNVGSRLDDTGSLFFKDQSRFTVSHVSVVNSKNRVLLNLAPNA
                     FPATRYTAKRDLGDDTPIEYVQDPDLPPTAPVPSFILRLSNEDELQFNFTFIMRQTQI
                     GNVANSTVNGVSTSLPEVTDTVLTGLTFAHASNSKELDNLITREFHANPNLQNNSNVQ
                     FVGDYSTGGSPSVQFEWSWKWKPPKTVEDRGGGWRNSCSFLDYDSRANRLNTLAHFSF
                     WVQNNVRLLPSPQLLSPNLDLHFPIRNRMPSSHSVRSHGSDADTTASAHMPLPTPSEN
                     GDTNANSNANDNSNTNNNSNSNYPPHPQGPPPPPPVKLDLPTSRPGEDMSAVDDGPLF
                     RATMKALEQKTGNMRTKIKKVLKKAEAAQQAQVACNEAVSGFLGALNEASTSNANAIQ
                     PALDHYYEKSARQILRYEQVNTIQLQKLVIEPLVKLYNNDIKQAEAKKKEFEEESRDY
                     YAYVSRYLGQRQDSLKEKKRVESDSKYQAKRRNFELKRFDYSSFMQDLHGGRKEQEVL
                     SHLTKYADTQAKNFLAAAHKVEVMVPQLDALVHEVTQADKEFQFLRTEREEKRRALEK
                     NSNTYLEPESFPNSGAPATLSATANGAQTQSTETELGRADSTGSQVRNVISNTSTMSS
                     QTNQTVLGTSGGASVSPTDASAQHRKEGLLWALSRPGSHIDPKGINKQAWHKFWIVLD
                     QGKLSEYSNWKQKLDLHMDPIDLRMASVREARNAERRFCFEVITPQYKRIYQATSEED
                     MANWIRAINNALQSAVEGRVAPPPSAVSSKNDGTGRDIGSVLTGKSSSYSGHHSNSTG
                     SNTVNRRTTVGARPGYVRTDSNSYDEDPAKLLQAVRNADQGNNWCADCGSTSKVEWVS
                     INLGIVLCIECSGIHRSLGTHISKVRSLTLDVHSFSNDIVEILLQVGNRVSNMVWEAT
                     LDQSLKPNASSTREQRLKFISTKYSERAYVQPLPSPRSRFTTPDESLLASIKKHDIQG
                     VLYGIALRANVNVTDRSRNTHAVFLALAAADPASPGSTPTSSASSRPSTATSIKTIPF
                     PVAELLVQNGAEIPLQPPPIPLSPAAQLYLSQRTSRMPPPIGVGTGRTTADTLGSLPT
                     IRNDYPGSSSHTPSSSLDNSSKDREKLSKRGSAGARFAGKVASLGIDR"
     gene            <683638..>685985
                     /locus_tag="ACHE_40247S"
                     /db_xref="GeneID:66982042"
     mRNA            join(<683638..683740,683879..684586,684671..685221,
                     685290..>685985)
                     /locus_tag="ACHE_40247S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278425.1"
                     /db_xref="GeneID:66982042"
     CDS             join(683638..683740,683879..684586,684671..685221,
                     685290..685985)
                     /locus_tag="ACHE_40247S"
                     /note="COG:A;
                     EggNog:ENOG410QE4I;
                     InterPro:IPR000504,IPR007275,IPR035979,IPR012677;
                     PFAM:PF04146,PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136205.1"
                     /db_xref="GeneID:66982042"
                     /translation="MTDSDSGDNNKPSSQPFNETPSSTRPSSRESLKCDTTACHEPAP
                     PDNVARRPSQLNPYMAPSHGPSLSAHPPSALNMESMGAALPGYQSNVIPFDQYQHMQP
                     QFAVQYPGVHYQMHPAPSFRGGERTTDGRPPAYSMTYPVVYPHYYPQPHQQPSYPSFP
                     TYMHSPPPHPCVNGPMFSQTPGYGSSYYPSPYPMVLGHGPGPPPRPQMPPRPGSQHSN
                     PRRPVSSGPGPTLHIERPRRPIPKRAAVSDYPKTIVDGSNSAKSTRSNSRVCEIISPS
                     TSTAIRAATPGGPRRMPKQSGPALWVGNLPHGISIVDVKEYFSQGAADQIESVFLISR
                     SHCAFLNYKTEAACSAAQEKFHDSRFQGCRLVCRLRPNARPGEYRQNSGDIASIAAAK
                     NEENDKAAIASMDFPIPSPDEKVPNRYFIVKSMTVEDLENSRQSGIWATQAHNEVNLN
                     LAYETADNVYLIFSANKSGEYYGYARMVSPIQEDEKLALEMPQRPNHIATEAEEPSVT
                     LTQASSTARSGRIIDDPVRGTIFWEADTSSEDDGEKEGDGEKEDADAALAGVTGAALN
                     ELAEVDADTDAKGNKNVDGPAAVAEDAAMAETTTTAATTTAATTAGSQTIGRPFRIQW
                     LSTVKVPFYRTRGLRNPWNANRGVKIARDGTEIEPRVGAQLVELFHLPSSGATTSSYR
                     LPN"
     gene            <687428..>688089
                     /locus_tag="ACHE_40248S"
                     /db_xref="GeneID:66982043"
     mRNA            join(<687428..687803,687857..>688089)
                     /locus_tag="ACHE_40248S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278426.1"
                     /db_xref="GeneID:66982043"
     CDS             join(687428..687803,687857..688089)
                     /locus_tag="ACHE_40248S"
                     /note="COG:S;
                     EggNog:ENOG410PPBN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136206.1"
                     /db_xref="GeneID:66982043"
                     /translation="MSNDRATSPISVPSSHQRRASLASFSFGSPPAANAANASTAPQQ
                     RRLSITTLGLAGSPTQTSPFNGRHFRGGSVSSSVGSNPTSSEDSINEENELSGAAPTS
                     PFARRVSYGAQALRDVRRGSVNNDERFNWSEALRTRAERAPSLSAMQQNQNAASVNRQ
                     REQERAVQIATMEQPVREIPRQPKRNKPDFFQEKILRGDFMD"
     gene            complement(<690524..>692797)
                     /locus_tag="ACHE_40249A"
                     /db_xref="GeneID:66982044"
     mRNA            complement(join(<690524..690771,690835..691250,
                     691299..692289,692349..692591,692644..>692797))
                     /locus_tag="ACHE_40249A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278427.1"
                     /db_xref="GeneID:66982044"
     CDS             complement(join(690524..690771,690835..691250,
                     691299..692289,692349..692591,692644..692797))
                     /locus_tag="ACHE_40249A"
                     /note="COG:S;
                     EggNog:ENOG410Q23W;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136207.1"
                     /db_xref="GeneID:66982044"
                     /translation="MTGNSSDAQDSESRNSNAAFIEPISWGLPGTRNTPSESVEQQGQ
                     STEYQSAGDGSLLDAYDPLQDFEYFSHSLGLTSDWALPSEFDISRIMVREPIYHLLPT
                     SSVSHERQEYSASSQQNHPLTQFPVERDAVGEFGVLTFPVLKITEEHRSRLLQSLVQF
                     QTTVTNFVMPSPHSLTRFVNAFFDGFYPHAALVHIPTFKLDNCDPEIILAMAALGAQY
                     RHEYRKGTLLFYAAKAILQDKALEMERKITNRNLSSRTTEPLTDSRHDSYNELMREAR
                     CALYLIFFATWHREPDIVREAFNLQSFLARCVRESRLYEDDEALQNATTDWHVWVEQE
                     SQRRIKLFSFAFLNLQSIAFNVPPVILSDEINLRLPCSCMEWLAPSYERWATIRGPGH
                     QEQMRFQDALAQLARISQDPSSIDSQPVPSTLANYILLHALIQRILLMYQAFHFNSDG
                     QHPLLLSQKDEIRNSLRAWTSQWQRAPESSLDPRNPNGPVPFTSTVLLGLAYIRLAFN
                     IGSYGTLRSRDPEQIANKLLDLPRLPGGPHLLPAILHATHALSIPVKLGISFVSRGHT
                     YVSSIQHSLCGMEFAVFISKWLHCISECRTRRSLDEHEIRLINWISDIVEEGRTSGDE
                     DLCPGPVSPSDCLHLAYAAVKLWARLIKGNEQWAILRIIGESLDIYADLCKEKYTPIL
                     S"
     gene            complement(<693835..>700302)
                     /gene="STT4"
                     /locus_tag="ACHE_40250A"
                     /db_xref="GeneID:66982045"
     mRNA            complement(join(<693835..695109,695177..695464,
                     695518..695721,695786..696041,696098..696469,
                     696532..696889,696947..697084,697143..697251,
                     697309..700017,700064..700238,700295..>700302))
                     /gene="STT4"
                     /locus_tag="ACHE_40250A"
                     /product="phosphatidylinositol-4-kinase"
                     /transcript_id="XM_043278428.1"
                     /db_xref="GeneID:66982045"
     CDS             complement(join(693835..695109,695177..695464,
                     695518..695721,695786..696041,696098..696469,
                     696532..696889,696947..697084,697143..697251,
                     697309..700017,700064..700238,700295..700302))
                     /gene="STT4"
                     /locus_tag="ACHE_40250A"
                     /note="COG:T;
                     EggNog:ENOG410PHQ4;
                     InterPro:IPR001263,IPR015433,IPR016024,IPR036940,
                     IPR018936,IPR042236,IPR011009,IPR000403;
                     PFAM:PF00454,PF00613;
                     go_function: GO:0016301 - kinase activity [Evidence IEA];
                     go_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IEA];
                     go_process: GO:0048015 - phosphatidylinositol-mediated
                     signaling [Evidence IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol-4-kinase"
                     /protein_id="XP_043136208.1"
                     /db_xref="GeneID:66982045"
                     /translation="MDDFPTNIRHSALEKLANLAVQESAADEDSDITRLTEQCQRRSN
                     EQPNGLQNRTPTSRVPMGIRELDVLFCLCKASSSVKELNHASRLVAQLSQYLPESHSQ
                     VFRASPFLQNVKPSPWESLTYNLATALLSLGANYPSLRDTVFYAVNEYLCSCAEAVDA
                     AAAVQSRDSATYNHGAAHGSVNILSIVVSLVGFLEASAVHTSFWTASEQLQIVEHLRL
                     MLSERLMVNVETASSIVRNASATDPLFREWRKYSRRYAAHGRPLGAILLQEGLMRFVK
                     SCALSLIGPQESSEDELLDEYMNGVGIARSHGDAEISLIECVTKVASDEIHLLEDGFD
                     YLQLGSPWQQRLTFSVKALALTAFLNCVVVGRNVASSDTLLSWLEDTLTDPNQMSCVE
                     LGTAALRSVAIIARMSPNSASAGTRSLLRFIVQGGVPTGPIIAVAARCLAQVLSILSQ
                     DAVITTLYSLGNVLSAGSNTDRSYQNPTVVDAPGQTAPLVPFPQPGDPSVISLSVNGE
                     EDNVPHRNVIHAIVTIANSCNDEKISALAQSMLLQKMGKVNAAVDACLIQETAALAPS
                     TGQAEFQLLLKFYARVYREGVARGGSNVAEAVQSAMSYLSITLSRNSPLYRIYLIHLL
                     ESIVNKGDATDLENERQREFMLTPGDIVPLLRPLALLVSSKRKAVADSSESEDYDEDV
                     SSMFRDVWFNLAVHGISANSTVARDHMTELRLLAKHSPPLVPESRMEMLESDVELNTI
                     LRRGMGPQRILEQKKMLITEIANHEPEIKRLDYPRVIFLNASLLLESLRASSGNCTKF
                     LSYFRDPALATIEMASCMNAIAENVVSCYLTMTLSGKHEEFSVPFLSKQLADFFVACC
                     HRIERVQNVAVLSANKIIRECPSALCEKHSLFALLELLTVMWSSCLEEDLDEFEWKSS
                     FTSPRGIVKVDLPDNYGFRRGTLEMFHERAKAWVATVMDIAPLDVKGLLQTYLSESED
                     DGGYGHISLGRSFALDMGSFIPQSDRRLGSIENYGINRINVASEFVAQYSSRQKYRYP
                     VMPALESPGFNFAGDNNKHAAIDSSGPVENVESLLSRLYEQANTGKNVSFIEVRDVLR
                     QAAAILCSEKDARPSIVHYFVALPFQIFSKESMSLGVSLWLGTMNENPEIESRIMVEV
                     MEGWEETIRRRRGLFNPSFDYVDPLYAKIELLPTDKELLLKKQQKAQNILSPHSHVLQ
                     FFESHFSAVRLGKPQSRRLFCRLIGTTTVGLLETHGHPLAREIHFRITLFGLKVLKHF
                     NSQDQVASWKLKDQILSAALSWFKHPPRWSFGGNRLQLKAEDKILDDVASALKNVAGI
                     AGQTHGPYKSLHAKQELLQMFIENERSRLKVWLYPLEPERKHFMGPASGGKNLAEEAA
                     SLLWLAWEENPGLAIQLATRLSSAKLRSDIRWLLLNFSEKALDEANGLEIMFGSSLPP
                     DVSSQLKYLLYWAPVNPTEALTYFLPAYGNHPFILQYAMKALESHPVDVRFYFVPQLV
                     QALRYDTLGYVERYILETAKQSQLFAHQVIWNMKANSYKDEDAQVPDPLKPTLDKFME
                     ALISSFSDEEREFYEREFSFFNDITGISGKLRPYIKKSKPEKKEKIEEELRKIKVEVG
                     VYLPSNPDGAVVGIDRKSGKPLQSHAKAPYMATFRIQKTRVRYDGPGTPDASGAPGLN
                     QQQLAGAQDSTSDSNLETYDVWQSAIFKVGDDCRQDMLALQMIAAFRSIFSSVGLDVW
                     VFPYRVTSTAPGCGVIDVLPNSISRDMLGREAVNGLYDYFVSKYGGEDSIRFQEARTN
                     FVKSMAAYSLITYLLQFKDRHNGNIMVDDAGHIIHIDFGFCFDIAPGGVRFERAPFKL
                     TSEMIAVMGGIPQTHANAAGTGSHHITNTQPYRWFESLVVKAFLASRPYCTKLTHIVS
                     LMLDSGLPCFKPDTLKNFRDRFVLEKSEREAAEFMRELIRKSYMNISTKGYDQFQLLT
                     NGIPY"
     gene            <701086..>703293
                     /locus_tag="ACHE_40251S"
                     /db_xref="GeneID:66982046"
     mRNA            join(<701086..701127,701196..701685,701737..702329,
                     702386..702516,702571..702587,702647..>703293)
                     /locus_tag="ACHE_40251S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278429.1"
                     /db_xref="GeneID:66982046"
     CDS             join(701086..701127,701196..701685,701737..702329,
                     702386..702516,702571..702587,702647..703293)
                     /locus_tag="ACHE_40251S"
                     /note="COG:D;
                     EggNog:ENOG410PFKJ;
                     InterPro:IPR017441,IPR008271,IPR008984,IPR000253,
                     IPR000719,IPR011009;
                     PFAM:PF00498,PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136209.1"
                     /db_xref="GeneID:66982046"
                     /translation="MAPQSEQSSLKRGRASVDQDSQDQKKPRRSERLSRIQPRNTPVE
                     QEYLPTPVTRQSSTVTDARNETTATPMDEVSQGRDQTPISSEPPEDTQPEDTQAFSQF
                     VYPPRAFADEVEDEKAEGVWGYLIPLDDAVQSALPLTKRDSCEGPRNKGDKGQGRNGK
                     KGICRPGGYLIGRHPECDVLLETPTISNRHFLLFSENKKGDVVAILQDLSTNGTFVND
                     AIVGQNKHRELEDGDEISILNEARFVFRYPKSRDTNGFRQQYRILQQLGKGHFATVYL
                     CANRDTGTQYAVKVFEKRPGDSQKSQADALQKEIALLMSVNHENLLCLKDTFDESDGM
                     YLVMEVASEGELFNLIVSKQNLSEDETRHVFKQLFDGLKYLHDRGIVHRDIKPENILL
                     SDKKLSVKLGDFGLAKIIGEDSFTTTLCGTPSYVAPEILQDTHHRRYTKAVDIWSLGV
                     VLYICLCGFPPFSDELFTRQNPYTMAQQIKMGRFDYPSPYWDSVGDPALDLIDRMLTV
                     NADQRITVEGCLEHPWLLEKSPSLTDSTDGLTGALGNLDFSKRKVERERTLLSTMNDV
                     RFSERAEEGGAPVKIFHKNEAGKRVSNQPSQVLVHQSQQEAHPDENSAPQDFANLGER
                     GDPLLFEEEPTSRYP"
     gene            <704527..>706280
                     /gene="ERG11_1"
                     /locus_tag="ACHE_40252S"
                     /db_xref="GeneID:66982047"
     mRNA            join(<704527..704772,704836..705033,705089..706147,
                     706209..>706280)
                     /gene="ERG11_1"
                     /locus_tag="ACHE_40252S"
                     /product="lanosterol 14-alpha-demethylase"
                     /transcript_id="XM_043278430.1"
                     /db_xref="GeneID:66982047"
     CDS             join(704527..704772,704836..705033,705089..706147,
                     706209..706280)
                     /gene="ERG11_1"
                     /locus_tag="ACHE_40252S"
                     /note="COG:Q;
                     EggNog:ENOG410PFY8;
                     InterPro:IPR001128,IPR002403,IPR017972,IPR036396;
                     PFAM:PF00067;
                     TransMembrane:1 (o20-41i);
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="lanosterol 14-alpha-demethylase"
                     /protein_id="XP_043136210.1"
                     /db_xref="GeneID:66982047"
                     /translation="MGFLAVVLEKLSELHSTQSLWVLTSVGLLALFSVSVIVNVLRQI
                     LFKNPHEPPVVFHWFPFVGSTISYGMEPYKFFFDCRAKYGDIFTFVLLGKKTTVYLGT
                     KGNEFILNGKLRDVCAEEVYSPLTTPVFGRNVVYDCPNSKLMEQKKFVKFGLTSEALR
                     SYVPLITAEVESFVEESPVFQEPKGIFDVCKTIAEITIYTASRALQGKEVRDRFNSTF
                     AEMYHDLDMGFAPINFMLPWAPLPHNRKRDAAQKKLTETYMEIINDRRKAGGKKDSED
                     MVWNLMSCTYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWILLRLATRPDIAEELY
                     QEQLRVLGSDLPDLTFENLQKLDLHSKVIKETLRIHAPIHSIIRAVKNPMPVDDTPYV
                     IPTSHNVLSSPGVSARDEQFFPKPLVWNPHRWDEVAQPSTEDEEKIDYGYGLVSKGTN
                     SPYLPFGAGRHRCIGEQFAYVQLGTILAALVRIFKFRNMPGVEDIPETDYSSLFSKPL
                     GQSFVQYEKRESATKA"
     gene            complement(<706792..>707535)
                     /locus_tag="ACHE_40253A"
                     /db_xref="GeneID:66982048"
     mRNA            complement(<706792..>707535)
                     /locus_tag="ACHE_40253A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278432.1"
                     /db_xref="GeneID:66982048"
     CDS             complement(706792..707535)
                     /locus_tag="ACHE_40253A"
                     /note="COG:S;
                     EggNog:ENOG410PT9D;
                     InterPro:IPR019083,IPR039603;
                     PFAM:PF09597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136211.1"
                     /db_xref="GeneID:66982048"
                     /translation="MAMRGSRLGLFSARLMKPFSVTRQCIRCLHQNREAPRVPSPTPF
                     VPNVETFLSLIGRGMSKHASKLPSWDKLFTLSSAELRDLGIEPARQRRYLLRKREKFR
                     NGQYGVGGDLENVVDGVAQLRVVEVPYESTTSSTQATELTSLSSSATSTPGMRKVIVN
                     TSPDATDYKHDSSKPLKKFEHMKIHNGSIIKGPFVQLIKGTNGSAALIKVQEGMWEDK
                     QGHKVDGGERRRAEVRAKKRIEERRKGPA"
     gene            <708050..>709345
                     /gene="KIN28"
                     /locus_tag="ACHE_40254S"
                     /db_xref="GeneID:66982049"
     mRNA            join(<708050..708239,708330..>709345)
                     /gene="KIN28"
                     /locus_tag="ACHE_40254S"
                     /product="TFIIH complex serine/threonine-protein kinase
                     subunit kin28"
                     /transcript_id="XM_043278433.1"
                     /db_xref="GeneID:66982049"
     CDS             join(708050..708239,708330..709345)
                     /gene="KIN28"
                     /locus_tag="ACHE_40254S"
                     /note="COG:D;
                     EggNog:ENOG410PFPZ;
                     InterPro:IPR017441,IPR008271,IPR037770,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_component: GO:0005675 - transcription factor TFIIH holo
                     complex [Evidence IEA];
                     go_component: GO:0070985 - transcription factor TFIIK
                     complex [Evidence IEA];
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0008353 - RNA polymerase II CTD
                     heptapeptide repeat kinase activity [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="TFIIH complex serine/threonine-protein kinase
                     subunit kin28"
                     /protein_id="XP_043136212.1"
                     /db_xref="GeneID:66982049"
                     /translation="MAVSPLVSHSPSAASSSPAKLRAANVRGSAMKPESVSSHQPSQN
                     TDRELTEQLNDEVRQKYVKDKRLGEGTYAVVFLGRLRTDPSSFVAIKKIKVNAEYKDG
                     LSMDAIREVKYLQELSHPNIIALHDVFSSKDQNLNLVLEYLPLGDLEMLIKDGNVHYG
                     AADVKAWMGMLARGVWFCHENFILHRDIKPNNLLIASDGEVKLADFGLARSFADPYLN
                     MTHQVITRWYRPPELLYGARQYSGVVDIWSMGMVFAELLLRVPFVAGNTDLDQISKIC
                     EAFGTPTEENWPGVSKLPNYIAPDRNHLVPTQGRDFFLRQFPNAGPVGADLLMSMCTL
                     DPRKRKTACEVLQHNWWTSEPRPTDKHDLPRKSGGSRKMGDDLTRRGGEIDENAFKNA
                     ARKLDFSAM"
     gene            <711973..>714893
                     /locus_tag="ACHE_40255S"
                     /db_xref="GeneID:66982050"
     mRNA            join(<711973..712753,712834..>714893)
                     /locus_tag="ACHE_40255S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278434.1"
                     /db_xref="GeneID:66982050"
     CDS             join(711973..712753,712834..714893)
                     /locus_tag="ACHE_40255S"
                     /note="BUSCO:EOG092631IR;
                     COG:Z;
                     EggNog:ENOG410PGWU;
                     InterPro:IPR019821,IPR036961,IPR027417,IPR027640,
                     IPR001752;
                     PFAM:PF16796,PF00225;
                     go_function: GO:0003777 - microtubule motor activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0008017 - microtubule binding [Evidence
                     IEA];
                     go_process: GO:0007018 - microtubule-based movement
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136213.1"
                     /db_xref="GeneID:66982050"
                     /translation="MASTMPQPSRPTATSPAAPVPPLPVPKTRKGLPVPSDTSRAPSP
                     SQSPSKLRAPSSPRPTLSKSPLSNSTTNVSAPRSASSNGRPPSSPDKSLRRTISIAAF
                     PQPPKTGSRPGTASSNMPGVSSSGSINARKGSRLSSGTTSSYRSSKTPSLLNGNGDGK
                     SILSADARDPDASPSQSRSSSAQESYSTSATTYEDGDDTASGAAKTGSKSKESKGNVI
                     VSVRVRPDAGGNDASRSSGEWQLEGRKGLISHRGKEAGDFYYDNVFTAHEHNAKVYDA
                     AAKRLVRRVMEGYHGTVFAYGMTGTGKTFSMQGTATSPGVIPLAITDIFSFIRETPHR
                     EFLLRVSYLEIYNEKIHDLLSAPAAGAQQEEIKLREDSKRGVYATPLKEEIVQSPTQL
                     LRVIARGDHARRTGSTQFNARSSRSHAVVQIVVESRERAPAGTPQDKRSGIIPGGVRV
                     STLSLIDLAGSERAADDKERRTEGAHINKSLLTLGTIISRLSENKDKGNNPTDKEGRH
                     LPYRDSKLTRLLQPALSGNSLVSILCTVALIASGSSAAANSHSGETLNTLKFAARAKN
                     SIVSHAKKAEEALGGGGGDSGSRVLLERYRMEIQALRSQLDSHTKAQAEKEMKLEDEQ
                     FEKEAQTRHEEQMLEIQLARTALKERIEHLNRLILCSKSTGVNTQGNFSALGRFSRMS
                     INDSGSRSLRSSVSQSTLGAWGYSIRPTSFMSINSNDFSPNLAFSNGSIGNEDDDDTI
                     GEFADGKASLQRHVSALQADLGDKNRYIATLERRLLQARRSSHSRMSAGMKGGNTGTE
                     NTDTAAIIREKDMEINELRSQLDDKDRMLAALRSATRHRDVARVATDPVQSPNSDTNS
                     GSRSPDTLNSPRLSLVESEKEKKRKSVDEVSKMLDEMIQDRVESGHIIKGSRGSVRVA
                     ADSRRTSTQMTGVPSLNAALDSVDSAKSGATE"
     gene            complement(<715542..>716936)
                     /gene="DGA1"
                     /locus_tag="ACHE_40256A"
                     /db_xref="GeneID:66982051"
     mRNA            complement(join(<715542..716568,716629..>716936))
                     /gene="DGA1"
                     /locus_tag="ACHE_40256A"
                     /product="diacylglycerol O-acyltransferase 1"
                     /transcript_id="XM_043278435.1"
                     /db_xref="GeneID:66982051"
     CDS             complement(join(715542..716568,716629..716936))
                     /gene="DGA1"
                     /locus_tag="ACHE_40256A"
                     /note="BUSCO:EOG09261G92;
                     COG:I;
                     EggNog:ENOG410PF9N;
                     InterPro:IPR007130;
                     PFAM:PF03982;
                     TransMembrane:2 (i120-146o152-169i);
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="diacylglycerol O-acyltransferase 1"
                     /protein_id="XP_043136214.1"
                     /db_xref="GeneID:66982051"
                     /translation="MSTSSIVKEPVARALGESLARQDATAVGQGMPLRSNKANLAARD
                     SRSQSHRKSHPADDTESESFEHRNWKGENPKHNHNASQLRGASGNTRPNKLGNREKRG
                     GIHWAPLNIGLERRLQTFVVLCHTLTIAIFLTCFFFTCAIPLFWPILIPYLVYISLFS
                     TTATSGTLGRRSEFLRSLRAWSIYVSYFPAQLHRSEPLLPTRKYIFGYHPHGIISHGA
                     FAAFATEALGFSRLFPEITNTLLTLDSNFRIPFYREYALAMGLASVSRESCENLLTKG
                     GADGEGMGRAITIVIGGARESLDALPHSIRLVLKRRKGFIKLAIRTGADLVPVLAFGE
                     NDLYEQVRSDHHPLIHKFQMLIKHTMGFTIPLFHARGVFNYDVGLMPYRCPLNIVVGR
                     PIQVIQQHERDKIDDNYVNELHARYVSELRRLWDQWKDTFAKDRVSELEIIS"
     gene            complement(<717477..>718595)
                     /gene="PXR1"
                     /locus_tag="ACHE_40257A"
                     /db_xref="GeneID:66982052"
     mRNA            complement(join(<717477..717497,717553..718465,
                     718573..>718595))
                     /gene="PXR1"
                     /locus_tag="ACHE_40257A"
                     /product="telomerase inhibitor"
                     /transcript_id="XM_043278436.1"
                     /db_xref="GeneID:66982052"
     CDS             complement(join(717477..717497,717553..718465,
                     718573..718595))
                     /gene="PXR1"
                     /locus_tag="ACHE_40257A"
                     /note="COG:A;
                     EggNog:ENOG410PPE4;
                     InterPro:IPR000467;
                     PFAM:PF01585;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="telomerase inhibitor"
                     /protein_id="XP_043136215.1"
                     /db_xref="GeneID:66982052"
                     /translation="MGLAAPRKRTKLSHDPNNVNWSRSTSGFGHKILSSQGWTPGSLL
                     GARNAAHADMLTPASASHIRVTVKDDTLGLGARPKLLDEPTGLDAFKGLLGRLNGKSD
                     VELEKEQRRRDDIKLARYAATKWQAVRFVRGGLLVQEKTDAATTKSPENGDRELNCSE
                     ESTNEKGNGTNNDASASVPNRGLKSNEKEKEEKKEKKEKKEKKEKKRKEKKDKKEKEN
                     SQVDEKDKSQRKRDKKAKKRKHSEDSEDLDSGTTTRDAVMMEANVAAGGMEASSVTAP
                     TSTSKKGRVPLGRNVTRARHIAQKKRALLDDKSLNEIFMVKS"
     gene            <719133..>723037
                     /gene="INP52"
                     /locus_tag="ACHE_40258S"
                     /db_xref="GeneID:66982053"
     mRNA            join(<719133..719457,719524..719719,719770..721418,
                     721469..721764,721817..721926,721984..722315,
                     722430..>723037)
                     /gene="INP52"
                     /locus_tag="ACHE_40258S"
                     /product="inositol polyphosphate 5-phosphatase"
                     /transcript_id="XM_043278437.1"
                     /db_xref="GeneID:66982053"
     CDS             join(719133..719457,719524..719719,719770..721418,
                     721469..721764,721817..721926,721984..722315,
                     722430..723037)
                     /gene="INP52"
                     /locus_tag="ACHE_40258S"
                     /note="COG:I;
                     EggNog:ENOG410PGU5;
                     InterPro:IPR002013,IPR005135,IPR000300,IPR036691;
                     PFAM:PF03372,PF02383;
                     go_function: GO:0042578 - phosphoric ester hydrolase
                     activity [Evidence IEA];
                     go_process: GO:0046856 - phosphatidylinositol
                     dephosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="inositol polyphosphate 5-phosphatase"
                     /protein_id="XP_043136216.1"
                     /db_xref="GeneID:66982053"
                     /translation="MSMSSLRIFCQDYPQRTIALVTPEHALIFYCSTDIVPNSQREPP
                     RCLVEFSSLSSVDLKGYRVLGNGYGTLGLVTLNEDVFLCVVTGSSKAATVRPGETILR
                     IDNVDFFCLNRPDYDGLDYEAEFATDEYNHATAPGVEDREFDYPFLALKKLLSDGSFY
                     YSRDFNLTDRLQDRAEKSAAFDIGTLDEDMLWNSYMISSLLLFRSHLPPPERERLDSS
                     KILTCVIRGFANTLTIPASVPILPPAQTNLPSTLTIISRQASRRAGTRFNSRGIDDDG
                     NVANFVETETILWMPSGITFSYVQVRGSVPIFWEQATGFLPGQQKIEITRSTEATQHA
                     FNKHFEHLELEYGAVHVVNLLSGLKSGETELSAKFRSHIMRRLEQKEDVGILSDHALL
                     RVTEFDFHAETRGPLGYGASSQIRHEVMNSLQGFAYFLSEDSEYTATSVVGSSDSQKS
                     SPIVLQQEGVFRTNCLDCLDRTNLVQTILSSMALELFLSQQGAALSTEVQMRHSTLWA
                     DNGDSLSKIYAGTGALKSSFTRHGKMSLAGALADARKTATRLYVNNFSDKARQKTIEL
                     LLGRLTNQMPVRLYDPLNDMVSQELSQRASEYSFARSIRVWAGTFNVNGSGLGPDVDL
                     APWLFPVLDQQGDEPTIFAVGFQEIVALSPQQIMSTDPTTRKVWENAVKSCLNSHSKS
                     RGLGKYVLLRSGQLVGAALMVFVKEDVLKEIKNVEGSVKKAGLSGISGNKGGCAIRFE
                     YSDTRICFVTAHLAAGFANYDDRNRDYETIESGLRFQKNRSIRDHDTIIWLGDFNYRI
                     GQTNQNVRELLLRGDYQRLYDHDQLNLQMLAGRAFHFYSEGPVCFPPTYKYDTGRNEY
                     DTSEKARVPAWCDRVLWKGSNLYQIYYNAADLRFSDHRPVCAKFICTINVIDESLKAQ
                     LRQALYDERQHGMHDSLAKGTMQVDIIDREAIQAAEITPALPAASSDNYKWWLDDGAP
                     ARSTMRPPANDFAVNVNRDSNPFFSNNEPDWVRISGPSELGTNMNSNTNTGQASPRSS
                     ECELLGVSPTQPEAADQQSIVTWGTQGSRRVTQDVKTAPPIPRKPISLSLRERSHDVK
                     PGQTLLMRDEDTTRSESHLRPMKDLRSLEIAKPGSTSRDSGSNSSHAHRHNRQEAQQY
                     TNTGRDTNDLLGDINDGSITWKPLL"
     gene            complement(<723752..>725932)
                     /locus_tag="ACHE_40259A"
                     /db_xref="GeneID:66982054"
     mRNA            complement(join(<723752..723861,724009..724396,
                     724450..725860,725928..>725932))
                     /locus_tag="ACHE_40259A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278438.1"
                     /db_xref="GeneID:66982054"
     CDS             complement(join(723752..723861,724009..724396,
                     724450..725860,725928..725932))
                     /locus_tag="ACHE_40259A"
                     /note="COG:S;
                     EggNog:ENOG410PQ4V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136217.1"
                     /db_xref="GeneID:66982054"
                     /translation="MPFNITIGSDHSSISDEEDSSGIRGSPLSDSGSHVYQDPYDEWA
                     HLPYPDELKPSDSASRPRTTGRTRMRAMDRMPASGSMRRHAPRRHYVQDREPLPRRSR
                     RPPSPESPESEDSGEEYTAPYDRPSQDRRFWPPVSQGPAYAHNSSPGPSYTYPHETVP
                     HGPFGHPNGAHPPSDQLVRVGHHSGMNQQSPYGHPLYPYSNQFHHHPPGAPISPFFVQ
                     DSPGHFGRHAHHPQVAHTRSSVQSPPPQALSHPIPSNGPHFYGGAPLNSHDLVPYGQN
                     GYYPFREPYPMAPGMIQPYYGNYPRVPSPSREESSPSPPPAPPADAAKDEAIARLEKL
                     ILEERSEREAREAREAARQAEIEKEAAEQAAREERAAHEKQIAEEAAAAARAEAEQKA
                     AEEAAKAKQEAEEAAAAAAAEAASAATEAANAAAAEAIAAAQAEAANQQPPPEDKKKP
                     IKFKDAIGRKFSFPFELCCTWQGMEELIRQAFLHIEVIGPHVADGHYDLVGPNGDIIL
                     PQIWDTVIEPDWSITMHMWPIPEKPKTPEPPPAPEAPADPEPAPEPPAAPEPDPEPAP
                     ETAPEPEPEPAPEPEPPAAPEVEEAVPASEEPKKIGAKKQRQKDPGAFAMWVVGGHRM
                     KSNKGWKVVRKAE"
     gene            complement(<727097..>728288)
                     /locus_tag="ACHE_40260A"
                     /db_xref="GeneID:66982055"
     mRNA            complement(join(<727097..727306,727363..727515,
                     727575..727781,727914..>728288))
                     /locus_tag="ACHE_40260A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278439.1"
                     /db_xref="GeneID:66982055"
     CDS             complement(join(727097..727306,727363..727515,
                     727575..727781,727914..728288))
                     /locus_tag="ACHE_40260A"
                     /note="BUSCO:EOG09263R62;
                     COG:S;
                     EggNog:ENOG410PM7U;
                     InterPro:IPR011990,IPR019734,IPR013026,IPR039856;
                     PFAM:PF13181;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136218.1"
                     /db_xref="GeneID:66982055"
                     /translation="MSNTKNEPIHSSDLLATLQYSQQAPILLGRQSKSNMAPLSLITS
                     AAGQPEEYAMIERLFFACLQTGDDKSALICLDKLTKFFGRSNERIMGLHGLYEEAIAG
                     DNSALEKCLREYDDILQQNPVNLPVLKRRIALLRSLSRPADAISSLIKLLEATPTDTE
                     AWCELADLYRSQGMSSQAIFCLEEALLITPNAWNVHACLAELLYVCATSPDNGDPSKL
                     LRRSMRHYCRSIELCDDYLRGFYGLALVTSLLLETEESCIMEEVSLKKTLPKLNAFAF
                     QKLEAIVKSRFMDYQGQKCCQSELIAARELLNRFGKSS"
     gene            <728720..>731889
                     /gene="APL5"
                     /locus_tag="ACHE_40261S"
                     /db_xref="GeneID:66982056"
     mRNA            join(<728720..728721,728777..728895,728951..729147,
                     729212..729595,729644..729872,729926..>731889)
                     /gene="APL5"
                     /locus_tag="ACHE_40261S"
                     /product="AP-3 complex subunit delta"
                     /transcript_id="XM_043278440.1"
                     /db_xref="GeneID:66982056"
     CDS             join(728720..728721,728777..728895,728951..729147,
                     729212..729595,729644..729872,729926..731889)
                     /gene="APL5"
                     /locus_tag="ACHE_40261S"
                     /note="BUSCO:EOG09260T4S;
                     COG:U;
                     EggNog:ENOG410PF8I;
                     InterPro:IPR016024,IPR002553,IPR017105;
                     PFAM:PF01602;
                     go_component: GO:0030117 - membrane coat [Evidence IEA];
                     go_component: GO:0030123 - AP-3 adaptor complex [Evidence
                     IEA];
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     go_process: GO:0015031 - protein transport [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="AP-3 complex subunit delta"
                     /protein_id="XP_043136219.1"
                     /db_xref="GeneID:66982056"
                     /translation="MFEKSLYDLIKGLRSHKGAEEDYIHSSLRECKAEIKSQDMDRKA
                     TALLKIIYLEMFGYDMSWASFHVLEVMSSTKYLQKRVGYLGAMQSFRSDTEVLMLATN
                     LLKKDIGSSNIPNMSLPMVTLPHVITPSLSMSLLPDILSRLSHSHVMVRKKAVVCLYR
                     LALVYPEALKLAWPKIKERLMDDQEDGSVTTAVINVVCELGWRRPHDFLPLAPRLFDL
                     LVEGGNNWMAIKIIKLFATLTPLEPRLIRKLLRPLTNLIQTTTAMSLLYECINGVIQG
                     GILGGDEGFREKDEIASLCVGKLRGMIVTDADPNLKYVALLAFNRIVTTHPVLVSMQQ
                     DVILECLEDADVSIRLQALELATGMVSSETLQPIVSRLVKQLNDAFVSLSEQSPREGQ
                     LIMRDKNGISEQSTGSYSHCLSPEYKIEVLHRIVDMCSYNNYSGLPDFEWYIDILVQL
                     VKHVPPEDIGGYYRYTTNPVSEIACRLGSEIRNIAVRVRDVRMEATRAAESLVLIHND
                     KSTSLGRTTASDGIMSSLAWVFGEYAEHLLYPGQTLQSLIDTTNALLPARTLSVYLQA
                     IPKLLVHLTSNGNSWDDSQKSETSLLLARIIDFLETLASHPDLDVQERAIEFLEILRL
                     AAEAVNSEVHPSHEPPYILSAVIPSLFSGLELNPVAIGAQKKVPLPEKLVLDQPFNER
                     LLSLFDDTNDVSLGLEAQDLSRDFYYTIDISTLSRRFTALAHSDMLSNTSLPKVTGKS
                     MDAAGKPKQRSERRDRNKDDPFYIDTEENSSGTSTPFHRVFNASNGDGMDVDSIPIID
                     LKINNEAIHGLALSRDYEKQKRTNPHARKYDVIADENFGHDESMGTQNSDEPGKVERS
                     LLQVDTSGLGHFSLEELTPGPDFTQRRTQQDEDEVEMAKAMQKVEKVRLEMQRASERI
                     HPKDVPAEGTLVKKKKKTNRKTRHDSHGTGPSVRKKKKQSGDNGLAFDDQ"
     gene            complement(<732099..>732437)
                     /locus_tag="ACHE_40262A"
                     /db_xref="GeneID:66982057"
     mRNA            complement(join(<732099..732196,732254..732383,
                     732435..>732437))
                     /locus_tag="ACHE_40262A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278441.1"
                     /db_xref="GeneID:66982057"
     CDS             complement(join(732099..732196,732254..732383,
                     732435..732437))
                     /locus_tag="ACHE_40262A"
                     /note="COG:S;
                     EggNog:ENOG410PTK3;
                     InterPro:IPR010580;
                     PFAM:PF06624;
                     TransMembrane:1 (o42-63i);
                     go_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136220.1"
                     /db_xref="GeneID:66982057"
                     /translation="MTQTPKQRKANEKYAKNEAAKRGKGQLPVKQKPSAKSSLPTGWL
                     AVLIFVICGGLAFELLGVIPKLWSATFGRFMD"
     gene            <758924..>760853
                     /locus_tag="ACHE_40263S"
                     /db_xref="GeneID:66982058"
     mRNA            join(<758924..759183,759236..>760853)
                     /locus_tag="ACHE_40263S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278443.1"
                     /db_xref="GeneID:66982058"
     CDS             join(758924..759183,759236..760853)
                     /locus_tag="ACHE_40263S"
                     /note="COG:S;
                     EggNog:ENOG410PJYT;
                     InterPro:IPR029060,IPR039436,IPR026832;
                     PFAM:PF12813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136221.1"
                     /db_xref="GeneID:66982058"
                     /translation="MGIPHLTRHLLPYAKEVLLAGEKQREGDDSIQLVVIDGPSLVYH
                     VFHRLLSNSNTKLEVLDAQPTCDEVSLGVMVYLLQLKLLGVKVTKICFDGALPIAKRK
                     IRLCRLEKSRKKLEQFHSQNRLGFAKPDDSIRSTVDPTKVLQSRAIPIRYNGLPENPF
                     MVSTVFEDLRKRWNKANILMAVQHAFYFNHCEIGEQDFPWAAITVMVPGEADAECARM
                     SRLTGAAVLTNDSDLLLHDLGSYGSVLFLDSVELSEWNPSRPSDSKVKARRLCPASLS
                     RRLGIRSVRYFAYELNQNPQFGLSELIRRSRENCDFLDLAPDYQHFLEDYDYEPNSRA
                     IAQHPQDLDPRISEILLQYDTGNARFTGSSPHIYLAILSEDHSRRCAWEEGRSYRALG
                     YSVFNLCRPFTERYHFVEEYVRRGGRIAIDRIAMGNEGWITSEMHSFHTSLSSAQVAF
                     GKKLSSSCFWRLFAMCELFKDETNHTAPDVNRLCRFLRFGYMGEAVSWADVHLCAQIH
                     AVLYSLRILKQLLGLVTMTEEPVLRLKSEIAALPPLHVMMRPIREMTREYPEDSSVEK
                     ALQRFFLLSGQHVQTDDEMQPPYFSPEGSALQHQGSPKSNCVKHVHRSKSNLYEILSP
                     E"
     gene            complement(<760999..>764328)
                     /locus_tag="ACHE_40264A"
                     /db_xref="GeneID:66982059"
     mRNA            complement(join(<760999..761568,761618..762256,
                     762318..762584,762650..764137,764197..>764328))
                     /locus_tag="ACHE_40264A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278444.1"
                     /db_xref="GeneID:66982059"
     CDS             complement(join(760999..761568,761618..762256,
                     762318..762584,762650..764137,764197..764328))
                     /locus_tag="ACHE_40264A"
                     /note="BUSCO:EOG09260SJV;
                     COG:S;
                     EggNog:ENOG410PI1Y;
                     InterPro:IPR015943,IPR019775,IPR007319,IPR011047,
                     IPR001680,IPR017986;
                     PFAM:PF04192,PF00400;
                     go_component: GO:0032040 - small-subunit processome
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006364 - rRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136222.1"
                     /db_xref="GeneID:66982059"
                     /translation="MFREMPSLDIDQFGQPLAKRQRLSSDNVANKSRTSASKIFSPFR
                     TLGLVSPTAVPLACVRLGKSTFQITTSVGYSLQTYDVRRGLNLVFVSRPQTPGMITAT
                     FSWQDKVFAAWGNFQPGSPGGIWVFRRGKKIASLEVPANLRGPIERILVFGSWIVGSN
                     SQGIEVWKSSSYEHYASLSPQRQAGSTSEHIYTSQLCNMPTYLNKIFIGRHDGAVDIW
                     NIRTGKILYSILPAFKDAGAVTALQPTPVLSLVAIAYKSGALSIQDVETDKVVLPLRT
                     PLSKVSPITSITFRTDGLGAGDDGRRSGVMATTSTDNGDITMWDLNNGGRVTGILRRA
                     HMVSLNETGSGTTHIEFLDGQPVLVSSGRDNALRTWIFDEVPFSPVPRPLHQRSGHYA
                     AVSTLHFLPSSSDGSEFGGKWLLSASKDSSLWGFSVRKDSQNTEISQGAIGHKTNKIG
                     SMQTGSYNDLKAPEITCIACALNRDGGMGVTTSGPVWANPKVTDTNASSTTGWESIVT
                     GHRGDKYARTWFWGKKKAGRWTFETGDGTEVKSVAISQCGTFALVGSSGGDIKMFNLQ
                     SGRHRQNFPATFASRRHVQANSRGSSGVSATERTGRHTKTVTGIVVDGLNQTVISCGL
                     DGKIKFWDFESGRLVDELDWHPMTAITGLRYSSASELVAFSCDDLSIRVVDIETRKVV
                     REFWGCVGQVNDFTFSNNGRWVIAASMDSIVRVWDLPTGHLIDAFRVPNTCTALTMSS
                     TDEYLATAHADGVGINLWTNRSLFMPVSTKNVNEDYIADIQAPTASGESGVSLIEAAF
                     SETDEQDEIEGPVLSTEQLSKEMVTLSVIPKSKWQTLLHLDVIKERNKAKDPPKAPEK
                     APFFLPSLPDGSAGEDADSKFSVESTAAERSRIARIQHSQDSKVLGSPFTTLLRAGRL
                     SGNLDPFIEHIKGLSPTKIDLEIRSLSPQVKDGQSELSDFVFALASRLKLKRDFELVN
                     VWMAVFLRIHADIVGSNDETGQLRKALADWSRLQEQERERLAGLVGYCHGVVGFLRSS
                     R"
     gene            <765075..>768788
                     /locus_tag="ACHE_40265S"
                     /db_xref="GeneID:66982060"
     mRNA            join(<765075..767418,767476..>768788)
                     /locus_tag="ACHE_40265S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278445.1"
                     /db_xref="GeneID:66982060"
     CDS             join(765075..767418,767476..768788)
                     /locus_tag="ACHE_40265S"
                     /note="BUSCO:EOG09260FMW;
                     COG:Z;
                     EggNog:ENOG410PF91;
                     InterPro:IPR000560,IPR037446,IPR040557,IPR013651,
                     IPR029033;
                     PFAM:PF00328,PF18086,PF08443;
                     go_function: GO:0000829 - inositol heptakisphosphate
                     kinase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136223.1"
                     /db_xref="GeneID:66982060"
                     /translation="MSYSSIPGLSEDSDFKDTSHKTSSVPSSNANSNRMDQSSLSQLH
                     GSTSTVLSKGGSDSPLEAHNESRHACSSKGFSGSASASSINEMEYTSSPLGKIGVCAL
                     DVKARSKPSQNILTRLQSKGDFEVIVFGDKVILDEAVENWPVCDFLIAFFSDGFPLDK
                     AIAYAKLRKPFCVNDLPMQKVLWDRRLCLKILDHMGVPTPKRMEVNRDGGPTLESVEL
                     AQHVYRLTGVKLEGPDDGTGGGAPRTQSVSLSEDGETLVIDGKALKKPFVEKPVNGED
                     HNIHIYFPNDQQYGGGGRRLFRKVGNKSSEYDPSLVVPRSIAETGTSYLYEQFLRVDN
                     SEDVKAYTVGPDFCHAETRKSPVVDGLVRRNTHGKELRYITKLSKEEAGIASKISNGF
                     GQRICGFDMLRVGERSYVIDVNGWSFVKDNNDYYDRCAQILRDMFLNERQRCEEALGS
                     LEPPSPDLSQSKKSASHRHTLKTLLKSPSVSKIHGNQQSHDGNETVPMELITAEAFPP
                     SSDAGGTDHAHIHVNQNAKERVTSSSNTISPAVSMRFPTDGVPPPPPASKHSWKLKGM
                     VAVIRHADRTPKQKFKFTFHSQPFVDLLKGHQEEVVIKGEVALASVSDAVRVAMREGL
                     EDMDKLKLLRTSLDKKGGWPGTKVQIKPMFRKRKPEEVSGQALPTDLTPSRAEGPHEE
                     PISPVAKEASPANENPNRSQARSDSISGATFSRFSAVENDLILDKLQLVIKWGGEPTH
                     AARYQSQDLGLNMRDDLKLMNKEALSNVRIFTSSERRVSTSAQIWASSFLDQKELPED
                     FIRVRKDLLDDSNAAKDLMDKVKKKLKLLLREGSAPSQFAWPKDNIPEPSVVLATLVE
                     LMKFHRSIMRHNFQRLDSFSRQTSADSSHGPENPTALDQFDSHTDNAALASIQGRWCA
                     GEDPMLFKERWEKLFAEFCDTEKVDPSKLSELYDSMKFDALHNRQFLEWVFMPPDDCD
                     EEGKDCGDKRPAQEGDHLENIGEPSESSTFAHRFGLKKRARAFESMPHLRALDETYDH
                     YFKLYPGSSPVKAKLDGRLSKLRELYKLAKVLFDYVTPQEYGITDSEKLEIGLLTSLP
                     LLQEIVRDLEEVQASQDAKSFFYFTKESHIYTLLNCILEGGIQTKIARSAIPELDYLS
                     QICFELYEARDSESSTNSYSIRISISPGCHAFDPLDVQLDSRHAIGCAPRRSLTAHQD
                     WKEVIETLKAKFDT"
     gene            <769292..>770683
                     /locus_tag="ACHE_40266S"
                     /db_xref="GeneID:66982061"
     mRNA            <769292..>770683
                     /locus_tag="ACHE_40266S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278446.1"
                     /db_xref="GeneID:66982061"
     CDS             769292..770683
                     /locus_tag="ACHE_40266S"
                     /note="COG:S;
                     EggNog:ENOG410PJ1H;
                     InterPro:IPR017438,IPR001206,IPR016064;
                     PFAM:PF00781;
                     go_function: GO:0003951 - NAD+ kinase activity [Evidence
                     IEA];
                     go_function: GO:0016301 - kinase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136224.1"
                     /db_xref="GeneID:66982061"
                     /translation="MRASTDTVPGTFICRLQGDYLQCNKEQSQEEKSIAINDIVCILP
                     SSMERQETTYSVLYLERHSGSSDANTVDDRVRLIRISTGSLPSTLLSQYFYKELPRHL
                     SLLSRIHVVISTGSGAGKAKGLYQDVLQPFLSYLGLTTCEVHETQSSQTITELAHLKF
                     IPCAQTGIDQTIILLSGDGGLVDIVDAFYNSSKRMIVPPCIGLMPTGTGNAMANSIGL
                     HCPTMGLMTLLRGKPRRIPVFAASFSPKSQYIIEEGRGRAPICSDQTAETEDHKVYGA
                     VVASWGIHAALVADSDTLAYRKFGVDRFKLAAKELLWPSDGLPTHSYHAMITLAKKSK
                     GANNQQMEAMDQNEHMYVLATLVSRLEKGFVISPDTSPLDGCLRFVHFGPMPPDVAMQ
                     LMSKAYQGGLHVHEKAVTYKEIEGFRIDFREEDERWRRVCIDGKIIAVERGGWMEVRR
                     EPRCLLNLIADFP"
     gene            <771009..>774337
                     /locus_tag="ACHE_40267S"
                     /db_xref="GeneID:66982062"
     mRNA            join(<771009..771199,771262..772128,772216..>774337)
                     /locus_tag="ACHE_40267S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278447.1"
                     /db_xref="GeneID:66982062"
     CDS             join(771009..771199,771262..772128,772216..774337)
                     /locus_tag="ACHE_40267S"
                     /note="COG:O;
                     EggNog:ENOG410QDRJ;
                     InterPro:IPR007751,IPR016445,IPR029058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136225.1"
                     /db_xref="GeneID:66982062"
                     /translation="MLVTTRTYSTAQLLHQKHSSPTDKHRSRFHSLTGWHSGLVNIER
                     AVKMLLSYQAGSVRVGEVVRYTLSYTPATDPIYPPPEELYVRVRNTSAIPLRAAYLHG
                     PYTLYAACYPSTFDPNVAYSRKNTEGVPQFEPYLKAGGSWDATITIPQSIRQTPTELA
                     SADPGSHQSVTWVIEIVSQVIFSATAAVNFEVIVGRDEKSVQLLSAGGVSGGGLPRPG
                     QLHDHWSPKTRGQQVLAATGIYSNSITLRIDNTASLWNSPPFPPFEDDAKSKLQNSQA
                     ATETSNTQHQTTAQKEEPKKEKKKKIHLVVITHGLHSNLGADMLYLKESIDIAAKRAR
                     EQAKQDRQKKSNTNSDTTRPGSDFADDTDGDDEQVIVRGFFGNAVRTERGIQYLGKRL
                     AKYVLLMTYPDQPYFPLKTSKAKPFPNPLAALKTTEEQSASGASVSGVHEQGSDQEDH
                     AYQFTSISFIGHSLGGLIQTYAIAYIQKYSPQFFDHIRPINFIALATPFLGLSNENPV
                     YVRFALDLGLVGRTGQDLGLSWTAPKVRSGWGAIIGGRGESVKPQEHSDPGSKPLLRI
                     LPCGPAHEVLAKFQHRTVYSNVVNDGIVPLRTSSLLFLDWKGLDRVEKARRDNGLVGT
                     MAEWGWAELTGANSKSSRPTRPTLSTTHANATENTPSAALSQEQNEHGKVPTETLQAS
                     EPYQTLRQQESEQHHLESGDVRLDSTPKVDPSQNLFSPLNGLLSLFRSKDSPKTAAGH
                     KQTKIYKRSQTVHTDDQPIETQSSTGSHRPEAPPHRMSHEEDGLYTPPKTTFFESASD
                     LLMPPLPPVEFILDPASRPRTIFHDRIYHPEDIPAPLPVKRRTLPFSSHQTRSSNAQH
                     PSSLESHHSSHQGKDESESGLRVEEKIARAYHRGLSWRKVLVRLEPDAHNNIIVRRMF
                     TNAYGWPVVKHLVDTHFAYTSAAQSNDVLEGGMDRAKPPTIKTTNSGNEVQGQTDRPF
                     QKSVPPGSSGGLYEVPNSSTINDPSRSLDYYHAHRERTGAGPMSEYFNGTSSTSIAPR
                     PDSATDDDDEDDPEFRDSIKATRQHPGEI"
     gene            complement(<774482..>775560)
                     /locus_tag="ACHE_40268A"
                     /db_xref="GeneID:66982063"
     mRNA            complement(join(<774482..775160,775266..775347,
                     775416..>775560))
                     /locus_tag="ACHE_40268A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278448.1"
                     /db_xref="GeneID:66982063"
     CDS             complement(join(774482..775160,775266..775347,
                     775416..775560))
                     /locus_tag="ACHE_40268A"
                     /note="COG:G;
                     EggNog:ENOG410PH2U;
                     InterPro:IPR000760,IPR020583,IPR020550,IPR033942;
                     PFAM:PF00459;
                     go_function: GO:0008934 - inositol monophosphate
                     1-phosphatase activity [Evidence IEA];
                     go_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IEA];
                     go_process: GO:0046855 - inositol phosphate
                     dephosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136226.1"
                     /db_xref="GeneID:66982063"
                     /translation="MATNSNFVESSSLDLDDIHETLIEIAYKAGEIITGALPATNGAG
                     SKKNSADLVTEYDRAVEKMISTTLAQKYPHYKFHGEETYDPAHPLTDDPTFVVDPIDG
                     TVNFVHGFPCACVSLGFAVKRVPVVGVVFNPFNQTLYSAVRGRGAFMNRTTRLPLKGD
                     GLEPLSGLSNALISVEWGSERSGQNWDTKVRTFARLGQTKDNGGAMVRSMRSMGSAAL
                     NLCAVAAGTIDLYWEGGCWAWDVCAGWVILTEAGGIIADGNPGSWQATLEGRRYLAAR
                     ASPGAIGQKDLVEEFWGHIQGRLEY"
     gene            <776006..>777355
                     /locus_tag="ACHE_40269S"
                     /db_xref="GeneID:66982064"
     mRNA            join(<776006..776026,776095..776140,776214..776317,
                     776394..776507,776558..>777355)
                     /locus_tag="ACHE_40269S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278449.1"
                     /db_xref="GeneID:66982064"
     CDS             join(776006..776026,776095..776140,776214..776317,
                     776394..776507,776558..777355)
                     /locus_tag="ACHE_40269S"
                     /note="COG:O;
                     EggNog:ENOG410PICV;
                     InterPro:IPR016024,IPR011989,IPR039717,IPR007206,
                     IPR007205;
                     PFAM:PF04063,PF04064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136227.1"
                     /db_xref="GeneID:66982064"
                     /translation="MPTELEELVEFLHHGNTQIRQIACENLVGFSTAQPDLFKRHQLL
                     PVRDLKLLARDYTPIAKNALTILINLSADEEVLDHLVKDDAFIETLLTKLTNVKEPNA
                     DEVSMLLANLTKSDDLKKIITLKRKKPDLVSTSSNAIDQLMDCFVKGAEGSLNKSANY
                     DYLSYFFADLSKTEEGRAYFTTRQEYDGVVPVTKLTVFTEHKSTIRRRGVASTIKNVA
                     FDIPFHPTLFSEDEANLLPYILLPLMGPEEFPEEESMEMLPDLQLLPPDKQRDSDNSI
                     ITTHLETLLLLTTTREGRDKMREIKVYPIIRECHLHVDDEGVRETCDRLVQVLMRGEE
                     GEENPDLAQSEAAQKQDEDEKVVELF"
     gene            complement(<777777..>780371)
                     /locus_tag="ACHE_40270A"
                     /db_xref="GeneID:66982065"
     mRNA            complement(<777777..>780371)
                     /locus_tag="ACHE_40270A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278450.1"
                     /db_xref="GeneID:66982065"
     CDS             complement(777777..780371)
                     /locus_tag="ACHE_40270A"
                     /note="COG:D;
                     EggNog:ENOG410PJJC;
                     InterPro:IPR002058,IPR043519;
                     PFAM:PF03828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136228.1"
                     /db_xref="GeneID:66982065"
                     /translation="MAGLSDRYSSTKGSRHQSSHASNLFEPATSTTDTGVSEIGRLPF
                     HVHEMLSHASAQLISHNQKALEDKTTRVGSLKAITSQGSCNTLDIRCGKLDSRDDHVT
                     VPRITAAGSGYTYAHAPKTRFGDQQSDPHRKKQIQINYLDSLASRIPTPGSLHNELQA
                     KENLRVILTKVAQEALEKYALKHGYTVGPKAIDLKCFGSLRNGFILPNTDLDLMVRMH
                     QSSFPKELEKECSQILESAFLDAGFGAYLLPDTMTPIIKLCEKPSQEFLDIMVGERER
                     RQIPKTHQPYNHQPGYHTGSYYSNQNAWCLSDTLRSRHKTDYFGFSQAGLGIRCDINF
                     SGSMPLYNTELLRCYALCDERVRLIGVFVKMWVRARKINDPYRGTMCSYGYILMAIHY
                     LMNVANPPLVPNLQAVPRSFPGHVEATNINGYDVRFLNDESELRAISKRNRLSGNQQS
                     VGELLRGFFAYYGTRGSGSPQGSFHWANNAISIRTQDGIIPKDEKGWHTAKTDRNGNR
                     LRFLLAIEDPFEHEHNIAATVTEGGVSTIRAEFNRAQTIINRIQEIPGVGWEWRTDEG
                     DVGQDLLAEAQDLSNSCRQPRNPGSPTGPGHLDCVPELCTARMDNNPRGRPISKSSSL
                     NGHPSAIPGPQSSCAGSASDNPAKCAHHDTFHLRSYDHCGNTTIGGPIRVTGKHDASG
                     PTMPPASPLHANSSLMRLLVSSITDDEQTVQEFRQPAGLATEVTPDPKYRQGAQDINF
                     WGARLQSPDRFLASPSQAKIMGSSSSGFVIDGHKPIVQISEGAPKVQQLTVPHTSRFR
                     GVSLDLRQFHGPGVIRDRRAASKHGPTDFLNPSPNDNVAVASDTESACQVDDLGKSEL
                     LANLPFGG"
     gene            <780937..>783271
                     /locus_tag="ACHE_40271S"
                     /db_xref="GeneID:66982066"
     mRNA            join(<780937..782262,782328..782633,782695..782947,
                     783033..>783271)
                     /locus_tag="ACHE_40271S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278451.1"
                     /db_xref="GeneID:66982066"
     CDS             join(780937..782262,782328..782633,782695..782947,
                     783033..783271)
                     /locus_tag="ACHE_40271S"
                     /note="COG:K;
                     EggNog:ENOG410PJN7;
                     InterPro:IPR008851,IPR011039;
                     PFAM:PF05793;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_process: GO:0006367 - transcription initiation from RNA
                     polymerase II promoter [Evidence IEA];
                     go_process: GO:0032968 - positive regulation of
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136229.1"
                     /db_xref="GeneID:66982066"
                     /translation="MSAPTNQSDNRLPTGPNGARPMKIRRPKMADPLVRPKKKPASRP
                     AAPTPSVHATASKSLPPRPAAQPIASVPARDDLSTNGFSGPLLSETYVDYPLVTTKRA
                     LREGLKHHVARFASKKNIDPRDESQFTRPVRLQRRDPRAKTHATNEEKSQNSEKFLDS
                     QQMDEAEREELEAKKAAREKERAENLAQIAPSAGSAPKRANIPKQKTQQVYKAEMTPE
                     EIARTRIKYEEALPWHLEDFDNKNTWVGNYEAALSETHAIFVLENTGKMRMIPVEKWY
                     KFNVKNQFKALTIEEAEKFMAKKIKDPRWFMEKQQEQAEKKELESFAKQRKVYAGKQS
                     TPGGGEGLEADEMDFEEDRFADDEEHDDLFNEDEEAKTAEKRIKQDQLKANVFDLKDE
                     RDYEEEERRERKEKEARRVQGKGVRKALKKREKNYDYSSGSDVNPYSDDESSDESEEE
                     RAKEEERKAEEERNKKESSTKGGSTPSGRPKHTNPLKKGTATQPRKRLGSPNASDASG
                     TDTSRKNTKSKHPSTKQPTPQPGSRPLSPAAPSSAPAGKKRVRNVPGGGAGSISDVDG
                     GAASGGEMSESGKAKKLKLNPPTAASQTGTPQGSRAASPTAIGSRGFTGSRASSPEGG
                     VPMRGQTRVSTPVPSGNQGFPTPVEIHAAIPASGILSSDLLKIFRPRIGESKENHRRF
                     IAIVKDVSVYGKEDRLLRPGSLRDN"
     gene            complement(<783688..>790025)
                     /gene="FAS1"
                     /locus_tag="ACHE_40272A"
                     /db_xref="GeneID:66982067"
     mRNA            complement(join(<783688..784155,784233..>790025))
                     /gene="FAS1"
                     /locus_tag="ACHE_40272A"
                     /product="beta subunit of fatty acid synthetase"
                     /transcript_id="XM_043278452.1"
                     /db_xref="GeneID:66982067"
     CDS             complement(join(783688..784155,784233..790025))
                     /gene="FAS1"
                     /locus_tag="ACHE_40272A"
                     /note="COG:I;
                     EggNog:ENOG410Q0WA;
                     InterPro:IPR032088,IPR003965,IPR041099,IPR039569,
                     IPR001227,IPR014043,IPR002539,IPR040883,IPR016452,
                     IPR016035,IPR029069,IPR013785,IPR013565;
                     PFAM:PF17951,PF16073,PF13452,PF17828,PF01575,
                     PF08354,PF00698;
                     go_component: GO:0005835 - fatty acid synthase complex
                     [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004312 - fatty acid synthase activity
                     [Evidence IEA];
                     go_function: GO:0004313 - [acyl-carrier-protein]
                     S-acetyltransferase activity [Evidence IEA];
                     go_function: GO:0004314 - [acyl-carrier-protein]
                     S-malonyltransferase activity [Evidence IEA];
                     go_function: GO:0004317 -
                     3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase
                     activity [Evidence IEA];
                     go_function: GO:0004318 - enoyl-[acyl-carrier-protein]
                     reductase (NADH) activity [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_process: GO:0006633 - fatty acid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="beta subunit of fatty acid synthetase"
                     /protein_id="XP_043136230.1"
                     /db_xref="GeneID:66982067"
                     /translation="MYGTAPQTGINTPRSSQSLRPLILSHGSLEFSFLVPTSIHFHAS
                     QLKDSFTASLPEPTDELAQDDEPSSVAELVARYIGHVAHEVEEGEDDAQGTYLEVLKL
                     GLNEFERAFMRGNDVHAVAAALPGISAKRVAVVQAYYAGRAAAGRPTKPYDSALFRAA
                     SEEKASIYSVFGGQGNIEEYFDELREIYITYPSFVEELINPAAELLQSLSREPEASKL
                     YPKGLDIMRWLQDRDSQPDTDYLVAAPVSLPLIGLVQLAHYMVTCKVLGREPGEVLER
                     FSGTTGHSQGVITAAAIASATSWDSFHKASRDALTMLFWIGLRSQQAYPRTSIAPSVL
                     QDSIENGEGNPTPMLSIRDLPKSAVQEHIDATNQHLPADRHISISLVNSARNFVVTGP
                     PLSLYGLNLRLRKVKAPTGLDQNRVPFTQRKVRFVNRFLPITAPFHSQYLSSAYDRIL
                     EDLNAAAIQIPGKSLAIPVYGTRTGEDLRNSGADNDVVPALVRMITHDPVDWEQATVF
                     PNATHIVDFGPGGISGLGVLTNRNKDGTGVRVILAGAIDGTNGEVGYKPELFDRDEHA
                     VQYAIDWVKEFGPRLVKNAAGQTFVDTKMSRLLGIPPIMVAGMTPTTVPWDFVAATMK
                     AGYHIELAGGGYYNAQSMTAAISKIEKEIPPGRGITVNLIYVNPRAMAWQIPLIGRLR
                     ADGVPIEGLTIGAGVPSIEVANEYIETLGIKHIAFKPGSVDAIQQVINIAKANPKFPI
                     IMQWTGGRGGGHHSFEDFHQPILQMYTRIRRCENIVLVAGSGFGGSEDTYPYLSGTWS
                     SRFGYPPMPFDGCLFGSRMMTAKEAHTSKNAKKAIADAPGLDDQDWEKTYKGPAGGVV
                     TVLSEMGEPIHKLATRGVLFWHEMDQKIFKLDKAKRVPELKKQRNYIIKKLNDDFQKV
                     WFGRNAAGQAVDLEDMTYAEVVHRMVDLMYVKHESRWIDHSLKRLTGDFIRRVEERFT
                     SADGKPSLLQSYSELDTPYPAVDNILAAYPEAATQLINAQDVHHFLLLCQRRGQKPVP
                     FVPSLDENFEYWFKKDSLWQSEDLEAVVDQDVGRTCILQGPMAARFSTVVDEPVQDLL
                     NGIHQGHIAGLVKDVYGGDEAQVPIIEYLGGQLHDSDEPDADGLTISEDAGKITYRLS
                     SAPTANLPELDHWLRLLAGDSYSWRHALFQADVFVQGHRFQTNPMKRIAAPTPGMYVE
                     ITSPTDLSQTTISVQEPSQSGKLVTTVEAKMNEQKQISLTLLEPRTAENGVVPLTFLF
                     TYHPEAGYAPIREVMGDRNDRIKEFYYRVWFGNKDVPFDTPITATFSGGRTTITSQAV
                     ADFVHAVGNTGEAFVDRPGKEVFAPMDFAIVAGWQAITKPIFPRTIDGDLLKLVHLSN
                     GFKMVPGAQPLKVGDVLDTTAQINAVINQDSGKMVEVCGTIMRDSQPIMHVTSQFLYR
                     GAYLDFENTFQRKDEVPMQVHLNTSRDVAILRSKEWFRLDEPDVELLGQTLTFRLQSL
                     IRFKNKSVFSHVQTIGQVLLELPTKEVIQVASVDYEAGDSHGNPVIDYLERNGTSIEQ
                     PVYFENPIPLSGKTPLVLRAPASNETYARVSGDYNPIHVSRVFASYANLPGTITHGMY
                     SSAAVRSFVETWAAENNIGRVRGFHVSLVGMVLPNDVLTVKLQHVGMIAGRKIIKVET
                     SNKETEDKVLLGEAEVEQPATSYVFTGQGSQEQGMGMELYNNSPVAREVWDRADRHFL
                     ENYGLSIIDIVKNNPKELTVYFGGPRGKAIRQNYMAMTFESVNADGSIKSEKIFKGID
                     ENTASYTYRSPAGLLSATQFTQPALTLMEKASFEDMRSKGLVQRDSSFAGHSLGEYSA
                     LAALADVMPIESLVSVVFYRGLTMQVAVERDEQGRSNYSMCAVNPSRISKTFTEQALQ
                     YVVGNISEQTGWLLEIVNYNVANMQYVAAGDLRALDCLTNVLNYLKAQNIDIPALMQS
                     MSLEDVKAHLVKIIQECQKQTESKPRPVALERGFATIPLRGIDVPFHSTFLRSGVKPF
                     RSFLLKKINKTTIDPSKLIGKYIPNVTARPFEITKEYFEDVYRLTNSPRIAHILANWE
                     KYEQDTEGNTTA"
     gene            <791364..>797006
                     /gene="FAS2"
                     /locus_tag="ACHE_40273S"
                     /db_xref="GeneID:66982068"
     mRNA            join(<791364..791898,791962..>797006)
                     /gene="FAS2"
                     /locus_tag="ACHE_40273S"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase"
                     /transcript_id="XM_043278454.1"
                     /db_xref="GeneID:66982068"
     CDS             join(791364..791898,791962..797006)
                     /gene="FAS2"
                     /locus_tag="ACHE_40273S"
                     /note="COG:I;
                     EggNog:ENOG410PFY5;
                     InterPro:IPR037143,IPR002582,IPR016035,IPR009081,
                     IPR041550,IPR016039,IPR036291,IPR018201,IPR026025,
                     IPR014030,IPR014031,IPR040899,IPR004568,IPR008278;
                     PFAM:PF01648,PF00109,PF02801,PF18325,PF18314;
                     go_component: GO:0005835 - fatty acid synthase complex
                     [Evidence IEA];
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0004312 - fatty acid synthase activity
                     [Evidence IEA];
                     go_function: GO:0004315 - 3-oxoacyl-[acyl-carrier-protein]
                     synthase activity [Evidence IEA];
                     go_function: GO:0004316 - 3-oxoacyl-[acyl-carrier-protein]
                     reductase (NADPH) activity [Evidence IEA];
                     go_function: GO:0008897 - holo-[acyl-carrier-protein]
                     synthase activity [Evidence IEA];
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_process: GO:0006633 - fatty acid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0042759 - long-chain fatty acid
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase"
                     /protein_id="XP_043136231.1"
                     /db_xref="GeneID:66982068"
                     /translation="MRPEVEQELSHTLLVELLAYQFASPVRWIETQDVVLAEQRTERI
                     VEIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDAKEIYYDVDPIEEEPEAA
                     PESGAASTPAASAPAAAAAPAAAPAAAPAAAPAGPAAAVEDAPVTAVDVLRSLVAQKL
                     KKSLADVPLTKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGAAMQATF
                     NGQLGKQSSSLIARLVSSKMPGGFNITAVRKYLETRWGLGSGRQDSVLLLALTMEPPS
                     RLGSEADAKAYLDDTANKYAANAGINLSTPAAGGDSGASSGGMLMDPAAIDALTKDQR
                     ALFKQQLEIIARYLKMDLRSGDKAFITSQETQKTLQAQLDLWQTEHGDFYASGIEPSF
                     DPLKARVYDSSWNWARQDALSMYYDIIFGRLQVVDREIVSQCIRIMNRSNPLLLDFMQ
                     YHIDNCPTDRGETYHLAKELGQQLIENCKEVLGVSPVYKDVAIPTAPQTTIDARGNIG
                     YQEVPRASARKLEHYVKQMAEAGPISEYSNRAKVQNDLRSVYKLIKKQHRMSKATELQ
                     FNALYKDVLRALNMNEHQIMPQENGSSGTKKGRNGIKPPRAGKVETIPFLHLKKKSEH
                     GWDYNKKLTGVYLDVLESAARAGLSFEGKNVLMTGAGAGSIGAEVLQGLISGGAKVIV
                     TTSRYSREVTEYYQGMYARYGARGSQLVVVPFNQGSKQDIEALIEYVYDTKKGLGWDL
                     DFVIPFAAIPENGREIDSLDSKSELAHRIMLTNVLRLLGSVKAQKQTRGFETRPAQVI
                     LPLSPNHGTFGNDGLYSESKLGLETLFNRWHSENWSNYLTICGAVIGWTRGTGLMSGN
                     NMVAEGVEKLGVRTFSQQEMAFNLLGLMAPAVVNLCQIDPVWADLNGGLQFIPDLKAL
                     MTKLRTDIMETSDVRQAVIKETAIENKIVNGEDSAVLYKKVVAEPRANIKFQFPNLPD
                     WEKDVKPLNENLKGMVNLDKVVVVTGFSEVGPWGNSRTRWEMEAHGKFSLEGCVEMAW
                     IMGLIRHHNGPIKGQAYAGWVDAKTGDPVDDKDVKAKYEKHILEHSGIRLIEPELFKG
                     YDPKQKQLLQEIVIEHDLDPFEASKETAEEFKREHGDKVEIFELESGEYTVRLRKGAT
                     LLIPKALQFDRLVAGQIPTGWDAKRYGIPDDIIEQVDPVTLFVLVCTAEAMLSAGVTD
                     PYEFYKYVHLSEVGNCIGSGIGGTHALRGMYKDRYLDKPLQKDILQESFINTMSAWVN
                     MLLLSSTGPIKTPVGACATAVESVDIGYETIVEGKARVCFVGGFDDFQEEGSYEFANM
                     KATSNAEDEFAHGRTPQEMSRPTTTTRAGFMESQGCGMQLLMSGQLALDMGVPIYGVL
                     ALTTTATDKIGRSVPAPGQGVLTTARENPGKFPSPLLDMKYRRRQVDLRRKQIKEWQE
                     SELLYLQEEVDAMKAQDSEFDTTEYMQERARHVEREAVRQEKDAQFSLGNNFWKQDSR
                     IAPLRGALATWGLTIDDVGVASFHGTSTVANDKNESDVICQQMKHLGRKKGNALMGIF
                     QKYLTGHPKGAAGAWMFNGCLQVLDTGLVPGNRNADNVDKALEKFDYIVYPSRSIQTD
                     GIKAFSVTSFGFGQKGAQVIGIHPKYLYATLDQAQFQTYKTKVESRQKKAYRYFHNGL
                     INNSIFVAKNKAPYEDDIQSQVFLNPDYRVTADKKTSELKFPAVPPKTEDKGAESTRQ
                     VVESLAKANAAENSKIGVDVESVEAVNIDNETFIERNFTASEQEYCRKAASPQASFAG
                     RWSAKEAVFKSLGVSSRGAGAPLKDIEIVNDTNGAPVVNLNGAAANAASQAGVKSVNV
                     SISHSDSQAVAVAVSQF"
     gene            complement(<797397..>799676)
                     /gene="TRM1"
                     /locus_tag="ACHE_40274A"
                     /db_xref="GeneID:66982069"
     mRNA            complement(<797397..>799676)
                     /gene="TRM1"
                     /locus_tag="ACHE_40274A"
                     /product="RNA methyltransferase
                     tRNA(m5U54)methyltransferase"
                     /transcript_id="XM_043278455.1"
                     /db_xref="GeneID:66982069"
     CDS             complement(797397..799676)
                     /gene="TRM1"
                     /locus_tag="ACHE_40274A"
                     /note="BUSCO:EOG09261H5E;
                     COG:J;
                     EggNog:ENOG410PFUI;
                     InterPro:IPR042296,IPR002905,IPR029063;
                     PFAM:PF02005;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0004809 - tRNA
                     (guanine-N2-)-methyltransferase activity [Evidence IEA];
                     go_process: GO:0008033 - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="RNA methyltransferase
                     tRNA(m5U54)methyltransferase"
                     /protein_id="XP_043136232.1"
                     /db_xref="GeneID:66982069"
                     /translation="MRSILRAHSLYFLILQSACKSKPTGASQLAVLGLSPREELLRTP
                     RNRINIGLVRRFHTSSLVMAAEQAQAADQLVQHESKEYKAVKEGLASILTPPTQSKIQ
                     AKDDRPERPDHEVQSVFYNPIQQFNRDLSVLAIRAFGEHVLASKKQKAEKRKQRTAGN
                     KKGTKRKRGEENSQEEKQEAEGVQEIKVAEKNEPVAESHPEQNTPPSFTILDALSATG
                     LRALRYASEIPFSTCVVANDLSPSAIQSMKRNIEYNGLGKKIQPNIGDARAYMYSCLS
                     PGSSNEHGSHTGKFDVIDLDPYGTAAPFLDAAVQGVKDGGLLCVTCTDAGVWASNGYP
                     EKSFALYGGVPIKGGHSHEGGLRLILHALATAASKYGLAIEPLLSLSIDFYARVFVRV
                     HRSPHEVKFTSGNMMLVYNCDAGCGAWSTQPLSATKQRLDKKGNPFYHFGFAQGPTAG
                     PHCSHCGIKTHLAGPMWAGPLHNPHYIQKILDMLPGADKEIYQTTDRIEGMLTTALEE
                     DLDLASSSTTTTEHPDAAKRENRNESAEPSAIIPRLDPAAREPYPFYMNISYLSKVLR
                     TSTMPVDSFRGALRHLGYRTTRSHAKPNTIRTDAPWEVIWEVMREWVRQKSPVKESSL
                     SSGSPGAAIMAKSRENLRKLGEQDQLLSSLKSEILSAVESGKDVSDLVTKVEAALYRS
                     GSRQALGQAIEGQAAPAVVQKPATTSFTATPHPSTLEVVFDEALGREASAANTKKRLV
                     RYQVNPRANWGPLSRASAS"
     gene            complement(<801887..>802943)
                     /locus_tag="ACHE_40275A"
                     /db_xref="GeneID:66982070"
     mRNA            complement(join(<801887..802674,802742..>802943))
                     /locus_tag="ACHE_40275A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278456.1"
                     /db_xref="GeneID:66982070"
     CDS             complement(join(801887..802674,802742..802943))
                     /locus_tag="ACHE_40275A"
                     /note="COG:S;
                     EggNog:ENOG410PPQ0;
                     InterPro:IPR012472,IPR034804,IPR039960;
                     PFAM:PF07950;
                     TransMembrane:5
                     (i81-101o121-138i173-191o220-243i280-301o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0032592 - integral component of
                     mitochondrial membrane [Evidence IEA];
                     go_process: GO:0055088 - lipid homeostasis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136233.1"
                     /db_xref="GeneID:66982070"
                     /translation="MKPDDFDTRSVISMQELEPSPVTDEGPDLENGDLFPESEKAIQS
                     PQGNGSGFFGQKLGLRGHSWDSWLSAIQKYSTYPPTLFTVLHFANTSLIPLATRSVAD
                     SESYLLLTREIYQSPSFEHLVLTAPILTHIASGIVLRNIRASRRARLYGAETRSQRYS
                     LKFWPRMTLQARLGYLLIPLLGTHVLVNRITPIMVEGGSSGVGLGYIAHGFARSPVFW
                     NIYYGIFVAAGVWHIVGGWSSWMGWRVTTVRREHRSKGSLEGHLGEAEVIAQRDRRQR
                     RTRWTVYGMAAIGTAVWLAGALGTIGRAGAAGGWQAKSWNEVYRQVPVIGDWL"
     gene            <803334..>804127
                     /locus_tag="ACHE_40276S"
                     /db_xref="GeneID:66982071"
     mRNA            join(<803334..803342,803473..803499,803558..>804127)
                     /locus_tag="ACHE_40276S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278457.1"
                     /db_xref="GeneID:66982071"
     CDS             join(803334..803342,803473..803499,803558..804127)
                     /locus_tag="ACHE_40276S"
                     /note="COG:S;
                     EggNog:ENOG410PPZX;
                     InterPro:IPR036236,IPR013087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136234.1"
                     /db_xref="GeneID:66982071"
                     /translation="MAPRGFSNPAPKTESARSALSSFTCTLCNKSYSRHPEYEAHISS
                     YDHQHRKRLQDLKQLSRDPNAAEKARRAEKKADAEAGLRVINTNQATSTTTGGTTGGG
                     GFKKGGFKSSFSTVKAPPAPAIKKNVLGDDDEDEEPVAAKPADGQAPAQRAKETIAQN
                     DQTESDIDDEYSNDRSGGGYYNPRKPTDCFSGCAGAHSAML"
     gene            complement(<804593..>805968)
                     /gene="PDB1"
                     /locus_tag="ACHE_40277A"
                     /db_xref="GeneID:66982072"
     mRNA            complement(join(<804593..805064,805123..805409,
                     805493..805616,805715..>805968))
                     /gene="PDB1"
                     /locus_tag="ACHE_40277A"
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /transcript_id="XM_043278458.1"
                     /db_xref="GeneID:66982072"
     CDS             complement(join(804593..805064,805123..805409,
                     805493..805616,805715..805968))
                     /gene="PDB1"
                     /locus_tag="ACHE_40277A"
                     /note="COG:C;
                     EggNog:ENOG410PGHC;
                     InterPro:IPR029061,IPR027110,IPR033248,IPR009014,
                     IPR005475;
                     PFAM:PF02779,PF02780;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004739 - pyruvate dehydrogenase
                     (acetyl-transferring) activity [Evidence IEA];
                     go_process: GO:0006086 - acetyl-CoA biosynthetic process
                     from pyruvate [Evidence IEA]"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /protein_id="XP_043136235.1"
                     /db_xref="GeneID:66982072"
                     /translation="MAAPRLFRPAARLLSSRLSSTPLRPAFQKTACAPSILRSRGYAT
                     ETGGTKEVTVRDALNEALAEELESNPKTYILGEEVAQYNGAYKVTRGLLDRFGPKRVI
                     DTPITEAGFCGLAVGSALAGLHPICEFMTFNFAMQAIDQIINSAAKTHYMSGGIQPCN
                     ITFRGPNGFAAGVAAQHSQDYSAWYGSIPGLKVVSPWSSEDAKGLLKAAIRDPNPVCV
                     LENELMYGQAFPMSEAAQKDDFVLPIGKAKIERPGKDVTIVSVSRCVGQSLNAAAELK
                     QKYGVDAEVVNLRSIKPLDVETVIQSLKKTGRLMVVESGFPMFGVSSEILALAMEYGF
                     DYLTAPALRVTGAEVPTPYAVGLENMSFPQEDTIVGQAAKLLRL"
     gene            <806245..>808104
                     /locus_tag="ACHE_40278S"
                     /db_xref="GeneID:66982073"
     mRNA            <806245..>808104
                     /locus_tag="ACHE_40278S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278459.1"
                     /db_xref="GeneID:66982073"
     CDS             806245..808104
                     /locus_tag="ACHE_40278S"
                     /note="COG:F;
                     EggNog:ENOG410PHZS;
                     InterPro:IPR029052,IPR014485,IPR006179,IPR004843,
                     IPR041823,IPR036907;
                     PFAM:PF00149;
                     SECRETED:SignalP(1-27);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_process: GO:0009166 - nucleotide catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136236.1"
                     /db_xref="GeneID:66982073"
                     /translation="MVLTVMMVVFTLSLLSLITSIPQHVFAAQPSAPKPIPAQLRDLE
                     WGQLNFLHTTDTHGWLAGHLQEPFYSADWGDYVSFTTRMREKAEAQGQDLLVIDTGDR
                     VEGNGLWDSSDPKGVYVSEILRQQPIDVLTIGNHELYKQYTSEAEFYTTVHNFRGHYL
                     ASNVDIIHPITKDAVPFAPRYRKFTTEKQGIRIVAFGFLFDFTMNYNNTIVQRVEDTV
                     EEEWFQEAIRDTNVDLFLVAGHVPVHSKEAEAIFKAIRAVRWDVPIQFFGGHYHIRDY
                     ARYDDKAYGLASGRFMETIGFASIDGLSTSTPRFSRKYIDNNLFSFYHHTGLDEQTFP
                     TEHGQNTSQLIQESRSALRLDQVYGCAPRNLWMSSVEYPGENNIYTWLEKEVLPDALK
                     DDRRSGKPAIAIVNTGAIRFDLFKGPFTQDSLYILSPFTSGFRYLKDIPYDKAQLIVE
                     VLNKQTQILGASQHSAHFPRWALAPPEQSAYPHDRVVSDDDIRASFASKVGQTLLSWS
                     SQSHSKPKSLPGYTTKDDGGSDGDDTIHSPISFYRVPNCIQALVSPNSSVAPDTVDLV
                     YIDFIERYITLAAKFASLDIDVPRNSDVYMPSMSMTNLILGWVKDNWKCDTTA"
     gene            complement(<808309..>809670)
                     /gene="ETR1"
                     /locus_tag="ACHE_40279A"
                     /db_xref="GeneID:66982074"
     mRNA            complement(join(<808309..809353,809447..>809670))
                     /gene="ETR1"
                     /locus_tag="ACHE_40279A"
                     /product="mitochondrial 2-enoyl thioester reductase"
                     /transcript_id="XM_043278460.1"
                     /db_xref="GeneID:66982074"
     CDS             complement(join(808309..809353,809447..809670))
                     /gene="ETR1"
                     /locus_tag="ACHE_40279A"
                     /note="COG:C,K;
                     EggNog:ENOG410PGVI;
                     InterPro:IPR013149,IPR011032,IPR020843,IPR036291;
                     PFAM:PF00107;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 2-enoyl thioester reductase"
                     /protein_id="XP_043136237.1"
                     /db_xref="GeneID:66982074"
                     /translation="MFSRAALRSSAVNVSRSNGAALSLKARASTPLAANPCRTPFIDS
                     LGARRYISVYGYTQAKALVYSKHGEPKDVLKLHKHSISAPHGTQVNLRLLTAPMNPAD
                     INQIQGVYPSKPDFDSSLGTGEPSAVAGNEGAFEVISIGSGVQNLNKGDWVIMKRTNQ
                     GTWRTHAQMDESQLIKIQNKEGLTPLQVGTVSVNPVTAYRMIKDFCEWDWLRAGEEWL
                     IQNGANSGVGRAAIQLAREWGIKTLNVIRDRKTPEETESMKKELLDLGATAVITESEL
                     LSAEFKNTVKELTHEGKEPIRLALNCVGGKNATALAKVLAPGSHMVTYGAMSKQPVAL
                     PSGLLIFKNLAFDGFWVSKWGDKNPQLKENTIKDVLELTRAGKFKDIPSEDVKWSWDT
                     QGPELTDSVQETLSGFRSGKGVLKFEGGDE"
     gene            <810231..>811929
                     /gene="HER2"
                     /locus_tag="ACHE_40280S"
                     /db_xref="GeneID:66982075"
     mRNA            join(<810231..810369,810440..810764,810831..811006,
                     811067..>811929)
                     /gene="HER2"
                     /locus_tag="ACHE_40280S"
                     /product="trimeric GatFAB amidotransferase(AdT) complex
                     subunit"
                     /transcript_id="XM_043278461.1"
                     /db_xref="GeneID:66982075"
     CDS             join(810231..810369,810440..810764,810831..811006,
                     811067..811929)
                     /gene="HER2"
                     /locus_tag="ACHE_40280S"
                     /note="BUSCO:EOG09262UAS;
                     COG:J;
                     EggNog:ENOG410PGBS;
                     InterPro:IPR023631,IPR000120,IPR020556,IPR004412,
                     IPR036928;
                     PFAM:PF01425;
                     go_component: GO:0030956 - glutamyl-tRNA(Gln)
                     amidotransferase complex [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0050567 - glutaminyl-tRNA synthase
                     (glutamine-hydrolyzing) activity [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="trimeric GatFAB amidotransferase(AdT) complex
                     subunit"
                     /protein_id="XP_043136238.1"
                     /db_xref="GeneID:66982075"
                     /translation="MSLLREAERCIANQKAHAALNAFITPLRSSGPWLEQVKDADRRR
                     EQGKPRSNLDGRLISVKDNICTRDLPTTCASGILNKFTSPFNATVVEQLENAGAVVAG
                     KTNLDEFGMGSHSVNSRFGPVANSRQNHDGGALSAGGSSGGSAVAVATDQCYAALGTD
                     TGGSVRLPAAYTGSVGFKPSYGLISRWGVVAYANSLDTVGIMGRDTSIVRHVFDIMNK
                     HDPRDPTNISVTSRNRIRSLLESSNLASRMTSGLRIGVPLEYNISELAPSVRNAWSRT
                     LSLLRQQSHTIQPVSLPSTQQALSAYYVLAPAEASSNLAKYDGVRYGTRAEGPDSDGK
                     PENVLYASTRGEGFGSEVKRRILLGAFSLSADAIDNYFIQAQRIRRLVQRDFNAVFST
                     EHPFNSYSDLLAEPASKPADVDVLVCPTAPSSPPQLSKLLDGDTVTSPLDAYTNDVFT
                     VPASLAGLPAISVPVSANNSTKEDLAGIQVIGQYGNDELVLKVGELIEGK"
     gene            complement(<812175..>813965)
                     /locus_tag="ACHE_40281A"
                     /db_xref="GeneID:66982076"
     mRNA            complement(<812175..>813965)
                     /locus_tag="ACHE_40281A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278462.1"
                     /db_xref="GeneID:66982076"
     CDS             complement(812175..813965)
                     /locus_tag="ACHE_40281A"
                     /note="BUSCO:EOG09262X7T;
                     COG:B,K;
                     EggNog:ENOG410PGAS;
                     InterPro:IPR037353,IPR001870,IPR003877,IPR013320;
                     go_component: GO:0048188 - Set1C/COMPASS complex [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0051568 - histone H3-K4 methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136239.1"
                     /db_xref="GeneID:66982076"
                     /translation="MASVQSTGVSAPTSNVNSPRGTPSFNGAGLDLNPSSSPAPPSNA
                     SAQLDSKSKRNKRDSRKKREAKGLDQESAPPPKKKSAVVQNIALPSSDLSILRPLLLA
                     EPKHSDLLPPQPRQMNPVTRKSSSTNNQQWDFYEVVDKLTNKNGFRYSYAIADPGFPH
                     IKYRQTDLHPYHARFSFEDSPAAIQFSKDALAVTTPEPWHTARANVCAREGTYYYEAR
                     IISGVVNDPQAPPTNGNSKTLSRGHVRLGFARREADLDVNVGVDCYGYGIRDVNGEVV
                     NRMRCEHLFPKGESIREGDVIGMLITLPPLSLHKKIVEGTYDPAVDSNASAQNSEHPY
                     SSNIIRDRIPFHYKNDFCWQQSNVFPTKHLRDYAYNLKDTPSQGPPSPLNSEDASMRT
                     LPGSSITIFKNGVKMGTPFKELYAFLPPASRLANGTNNLGLGERENADDGMIGYYPAV
                     SCYGGGAVECRFEGPWWFGPPSETENGEPVRPMGDRFNDQIVEDVMADIVDEVEAMMV
                     WGGVDGDVVGNAQMDSTESGAVGGSEVLKGGVGAAFESAGSTGGNNTPTTGVADGAEH
                     TAFEDAGTPNVETSDVKVEDAAVNQDIEMS"
     gene            <814990..>816592
                     /gene="ENP1"
                     /locus_tag="ACHE_40282S"
                     /db_xref="GeneID:66982077"
     mRNA            join(<814990..815370,815428..815660,815722..>816592)
                     /gene="ENP1"
                     /locus_tag="ACHE_40282S"
                     /product="snoRNA-binding rRNA-processing protein"
                     /transcript_id="XM_043278463.1"
                     /db_xref="GeneID:66982077"
     CDS             join(814990..815370,815428..815660,815722..816592)
                     /gene="ENP1"
                     /locus_tag="ACHE_40282S"
                     /note="BUSCO:EOG09263KZJ;
                     COG:W;
                     EggNog:ENOG410PGSF;
                     InterPro:IPR007955;
                     PFAM:PF05291"
                     /codon_start=1
                     /product="snoRNA-binding rRNA-processing protein"
                     /protein_id="XP_043136240.1"
                     /db_xref="GeneID:66982077"
                     /translation="MPKATTPSRSAAAARRHNPLADDMTSVGHIRTQPSKKNKRKSRT
                     DEDREDGERFVDAKQSRKILQIGQELADEDASEQKAARGETSGKINHAFDFESRLEGD
                     EPVSDDEDKFGEDEWGDEDEEVEEVEVDPNDLDMFNKFIPAGDEDPIFNPGAGGQTTN
                     LADLILEKIAEHEAKQSGDSGFIQGGGLPEDAVQIPAKAVEVYEKVGMILSRYKSGPL
                     PKPFKVLPSVPNWETLLDITRPESWTANAVYAATRLFISSKAVVAQEFISMVLLDRVR
                     DEIRETKKLNVHTYNALRKALYKPACFFKGLLFPLVSGGTCTLREAHIVSSVIARVSI
                     PVLHSAAALLRMCDLAAEQSLKSLESTGAVNMFIRVFLEKKYALPYKVIDALVFHFLR
                     FRASDNGEDAMMTDGPSGSGAKHYKLPVLWHQCLLVFAQRYRNDITEDQREALLDLLL
                     VRGHKDIGPEVRRELLAGRGRGVVVPDPEKLSALEAGDDTMDME"
     gene            <817793..>819166
                     /locus_tag="ACHE_40283S"
                     /db_xref="GeneID:66982078"
     mRNA            join(<817793..817992,818047..>819166)
                     /locus_tag="ACHE_40283S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278465.1"
                     /db_xref="GeneID:66982078"
     CDS             join(817793..817992,818047..819166)
                     /locus_tag="ACHE_40283S"
                     /note="COG:K;
                     EggNog:ENOG410PPY0;
                     InterPro:IPR004827;
                     PFAM:PF00170,PF07716;
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136241.1"
                     /db_xref="GeneID:66982078"
                     /translation="MEDDQFSSIDSLRGTPESDMPLTVSPADTSLNDDDCDERKTDEK
                     KPAKKRKSWGQELPVPKTNLPPRKRAKTDDEKEQRRIERVLRNRAAAQTSRERKRLEM
                     EKLENEKIQMEQQNQFLLSRLTQMETENNRLNQQVAQLSAEVRGSRSVSPKPGSPAAK
                     SPTLTPTLFKQEGDELPMERIPFPTPSVTDYSPTLKPSTLAESSDATQHPAAMLCDLQ
                     CPSLDSKELEAPSHSSTSAPAQNLTLHVMLQLLFLTMTSTAYSTVIRPLSLILQSLKM
                     GSPLEFSTTEIYQHFPLILWLISTPNLSLSTTSTSRPTVFRMRLLARLLACSPALARP
                     LRDATGRALQLAVSDSLPRGHQTAAIDGVAGRQNWESLLTMALVIDCLQKKPGHLRRQ
                     RTSTSNNNGLRLARVGKFTGNRSSSRRSNSSTMGETLSSLLMGKEFL"
     gene            <819473..>820267
                     /gene="DID2"
                     /locus_tag="ACHE_40284S"
                     /db_xref="GeneID:66982079"
     mRNA            join(<819473..819616,819683..>820267)
                     /gene="DID2"
                     /locus_tag="ACHE_40284S"
                     /product="vacuolar-sorting protein SNF7"
                     /transcript_id="XM_043278466.1"
                     /db_xref="GeneID:66982079"
     CDS             join(819473..819616,819683..820267)
                     /gene="DID2"
                     /locus_tag="ACHE_40284S"
                     /note="BUSCO:EOG092656CM;
                     COG:U;
                     EggNog:ENOG410PH3M"
                     /codon_start=1
                     /product="vacuolar-sorting protein SNF7"
                     /protein_id="XP_043136242.1"
                     /db_xref="GeneID:66982079"
                     /translation="MSRTCTSSAAHPITLFQLTVHFPFFASLIRADKMVRKDPIFEAR
                     TNVKLHSNRLKKEAARADATFKSEKAKADKAMKNREFQIARIHAASAVREKRRQVTLR
                     AEAARADVIINELKAAQSTRDTSRTLALASRGLDAASKSVNLEHLVSHANNFLARSED
                     FKIASSAIEDVAQGVSMQEYGAEGETEVDRMMEQLADDAGVDMRMALDADAAPKEDVK
                     EQKQADTELEDGLGARLRALRAAN"
     gene            820570..820641
                     /locus_tag="ACHE_t40002S"
                     /db_xref="GeneID:66987393"
     tRNA            820570..820641
                     /locus_tag="ACHE_t40002S"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:66987393"
     gene            821331..821403
                     /locus_tag="ACHE_t40003S"
                     /db_xref="GeneID:66987394"
     tRNA            821331..821403
                     /locus_tag="ACHE_t40003S"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:66987394"
     gene            <821701..>824232
                     /locus_tag="ACHE_40285S"
                     /db_xref="GeneID:66982080"
     mRNA            join(<821701..821794,821858..821897,821955..822440,
                     822497..823021,823076..823214,823267..823343,
                     823392..823465,823523..>824232)
                     /locus_tag="ACHE_40285S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278467.1"
                     /db_xref="GeneID:66982080"
     CDS             join(821701..821794,821858..821897,821955..822440,
                     822497..823021,823076..823214,823267..823343,
                     823392..823465,823523..824232)
                     /locus_tag="ACHE_40285S"
                     /note="COG:S;
                     EggNog:ENOG410PM9T;
                     TransMembrane:1 (o234-254i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136243.1"
                     /db_xref="GeneID:66982080"
                     /translation="MDHAHAAVSKPGRISHGKQAACLNCRRSKIRFPSHHVGRQKGVK
                     NKRTGLEKALYQIEQAIKRPRGPDAAASDAAHKVISNLQELLGKAQDQQQVSHSETDD
                     FSENQDQTHSLPSPREQEDSLALDDAENPLQLLARASDLQLSPAETRKVPAPLQQQQA
                     ISRTQGHNSCANSFFVPVRASRDVGPELDPIELGLVTVEEAESLFSFFYQNLAHTRWG
                     LDPLIHTVSFVRAQSAFLFTSILAATTLFLSSAAALSKRLFRHCRYLANIVAVQRHRS
                     VEIVLAFMVNVPWMAPGNCLGDDDACAYIAMALTVALDLSLNKIVVPSSSFDNSFLKR
                     QAKADCIDAKRALHMDGFDDVDAGSEWGRRLLRRRERAWIALFVLERGVCLARGRSYT
                     VPPTTLVENCDHWHISDIADSRDGPMNSMAALRRNLDEIFRKVKSNCDNYQVVDIGPE
                     AAQSIKTMIESFYDRWYATWAPAIGEGQSLSLPPYVDILVTHTRLSTYAGVINHPTAP
                     IEVKRFFRAAALSSALNVLRAAIQGEARLKSMPNNTVIMISFAACSALSLSVTPGDSR
                     SSLAPSVRNSIEETAGVLERIGATPSHRHGASVLYGRFLRELIRRAPVGSRSQNHFDQ
                     RRAMGSTEALQPMSSLDVYDPIVTTAQPSASPSLLWMEPLQFSAMSDDQIIDAVNRAG
                     TAFGTTVPDVPFDDMLRWDWLDFANNGSDFNL"
     gene            <824450..>826549
                     /locus_tag="ACHE_40286S"
                     /db_xref="GeneID:66982081"
     mRNA            join(<824450..824741,824800..825084,825144..825330,
                     825387..825688,825742..825821,825877..825908,
                     825963..826080,826134..826355,826415..>826549)
                     /locus_tag="ACHE_40286S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278468.1"
                     /db_xref="GeneID:66982081"
     CDS             join(824450..824741,824800..825084,825144..825330,
                     825387..825688,825742..825821,825877..825908,
                     825963..826080,826134..826355,826415..826549)
                     /locus_tag="ACHE_40286S"
                     /note="COG:C;
                     EggNog:ENOG410PGYY;
                     InterPro:IPR004165,IPR012792,IPR012791,IPR037171,
                     IPR014388;
                     PFAM:PF01144;
                     go_function: GO:0008410 - CoA-transferase activity
                     [Evidence IEA];
                     go_process: GO:0046952 - ketone body catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136244.1"
                     /db_xref="GeneID:66982081"
                     /translation="MATLRVSALFLSRRSLSVCRPRLRLGVRCRAGLRPSFQPSTIDC
                     AKSYSTVPSARQRLAPIVERGASKLFKDADEAVADLKSGSVILSSGFGLCGVAETLIS
                     AIQRRGLKNLHSLTAISNNAGAPGKGGLATLTQAGQVNKLILSYLGNNKPLEQKYLTG
                     EISIELCPQGTLAERMRAGGAGIPAFFTPTGAHTFLQDGRIPVRMDASGKVVEHGKPR
                     ETREFNNKTYLMETAITGDVAILRAWKADEAGNCVFRYTTKAFGPIMAKAADLTIVEA
                     ENIVPVGSINPNDVDLPGIFVNRIVPATDPKNIEIKKLRSANDEGAVKSEKSAALAQR
                     NRIAKRAAKELKQGYYVNLGVGIPTLAPSFLPEDVKVWVQSENGLLGMGPYPTEDEVD
                     ADIINAGKETVTLVDGASTFDSSESFGMIRGGHVDVSILGALQVSAKGDLANYMIPGK
                     VFKGMGGAMDLISNPDQTKIVVATSHTAKDGSPKVVADCSLPLTGANCVSTIITDLCV
                     FQVDRTQGALLLTELAPGVEVEEVRSKTGAEFTVADRLEVME"
     gene            complement(<826686..>827597)
                     /locus_tag="ACHE_40287A"
                     /db_xref="GeneID:66982082"
     mRNA            complement(join(<826686..827381,827439..>827597))
                     /locus_tag="ACHE_40287A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278469.1"
                     /db_xref="GeneID:66982082"
     CDS             complement(join(826686..827381,827439..827597))
                     /locus_tag="ACHE_40287A"
                     /note="COG:S;
                     EggNog:ENOG410PJMI;
                     InterPro:IPR029032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136245.1"
                     /db_xref="GeneID:66982082"
                     /translation="MSKLSNSLKSLINSPSARPGTVPAPRNIQSVFHKIQQDAESNDV
                     SQPSWVALSTAATMTMNSPDSLGILFNQATSASQSPEESVATAELMREVGLKCISFNG
                     IPRTINCLNAFKAGLPESVAAKLSKTSTRTPTVENINEIRERGRNLWDSIYRPFENKL
                     YEKLADAHPDLPVHILNGNYGALLSDPAGRSTGANAGRVLTSIVAVACLRAQTGVGPQ
                     VTSHVFGLRKALEDGTWESDVEGEKGAKWLASDEGNTWILNSVDRIVESISQGEGTNF
                     APGRTSKL"
     gene            <828059..>829975
                     /locus_tag="ACHE_40288S"
                     /db_xref="GeneID:66982083"
     mRNA            join(<828059..828180,828240..828395,828454..828722,
                     828782..828867,828924..829054,829115..829341,
                     829390..829659,829716..829800,829858..>829975)
                     /locus_tag="ACHE_40288S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278470.1"
                     /db_xref="GeneID:66982083"
     CDS             join(828059..828180,828240..828395,828454..828722,
                     828782..828867,828924..829054,829115..829341,
                     829390..829659,829716..829800,829858..829975)
                     /locus_tag="ACHE_40288S"
                     /note="COG:G;
                     EggNog:ENOG410PG15;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i38-55o81-101i108-127o133-157i169-189o201-223i279-
                     303o315-337i344-365o371-391i403-424o436-458i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136246.1"
                     /db_xref="GeneID:66982083"
                     /translation="MDTAGIDDEKPDTSHKPIDSVQDLAYQQKLTQRVLFKLDTRILP
                     ILAILFLLSFLDRTNVGNAKIIGLEEDLGITDHQYDIGLAVYYLTYVLSELPSNLILK
                     KASPRIWLPLITALWGVMTMCLGFVRNFAGFVAVRCLLGAFEGGLLPGMVLYLSFFYR
                     RSDLALRIGLFYTAASLSGAFGGLLARGLAEIGPRGGLEGWRWIFIIEGLLTVTCAAI
                     SYFGLPNNPTTAPFLTIEEREFVRDWLSGDNPCAPAGTLASEQESFQWSEVRRGLLDP
                     RMWLSAAAYFSLLSGMYSFGLFLPTIINDSGYAANEDQVQLWSVIPYAVAAVFTVMVA
                     FFSDRLQLRGTLMLVTIPLAIAGYAAIANVQGARLKYGMTFIMAMGMYGSIPCILVWN
                     SNNSAGHYKRATTSAMQLTIANCGGFVATFIYPSKDKPQYHRGHTVVLGLLVFSWFMI
                     LLNVLYCAKVNRDKKRGKYVQYAGYNDDRNPDFKLVL"
     gene            complement(<833410..>834646)
                     /locus_tag="ACHE_40289A"
                     /db_xref="GeneID:66982084"
     mRNA            complement(join(<833410..833629,833680..833831,
                     833890..834465,834521..>834646))
                     /locus_tag="ACHE_40289A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278471.1"
                     /db_xref="GeneID:66982084"
     CDS             complement(join(833410..833629,833680..833831,
                     833890..834465,834521..834646))
                     /locus_tag="ACHE_40289A"
                     /note="COG:K;
                     EggNog:ENOG410Q1WU;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o330-349i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136247.1"
                     /db_xref="GeneID:66982084"
                     /translation="MDRDRSRPISSFPTSSRQPLEKPKGRKKVSSACLACKTRRSRCS
                     GQDPCGNCVRNNTECSYAANQDKRRGIQIKERLERLEEDRDLLIRFVTALREGGDRQA
                     LQLVSLIRSKASLDEIKVYLNEHMRVNQQTSPELLDVERQLSRMQEFESQRSSILDSN
                     TLAVAPRWRVPARPWTKVTDNDNLVSHLLSSWFTWHHPYWIDRDRFIEDMQTRDPKQT
                     KYCSPFLTNIILADACAYMGYPETLAEMSDIPTRTHRFYGEAKRLYEQEEGNVTLTTM
                     QGLGVLWTCASLLRKERNGWNYQGQLTYTIQQFILLVNSGKASHYEPKAVDTSVWGLF
                     NIITYIYIYIYFLFFSTPLKLNG"
     gene            <835403..>837659
                     /locus_tag="ACHE_40290S"
                     /db_xref="GeneID:66982085"
     mRNA            join(<835403..835546,835605..836180,836256..836407,
                     836459..836632,836685..837032,837089..>837659)
                     /locus_tag="ACHE_40290S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278472.1"
                     /db_xref="GeneID:66982085"
     CDS             join(835403..835546,835605..836180,836256..836407,
                     836459..836632,836685..837032,837089..837659)
                     /locus_tag="ACHE_40290S"
                     /note="COG:K;
                     EggNog:ENOG410Q1WU;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136248.1"
                     /db_xref="GeneID:66982085"
                     /translation="MESKQTYKPLAPKVPKTNENQAPGPYFNAYRDTRVSTACSSCRS
                     RQIKCDGVAPCGNCRKFQAECIIDENSDNRRNATLKRKFDSLENDRELLIQLMESFRN
                     SDDNRVHALLNLIRSNAPLFELKSYIDNQLNRESSPKLAVVGEEIRRLQQAKPRAHRN
                     VMDVRRLCDQAVYRVPAKPWTTVTDDDEFVSHLISLYFTWYHPCFPWIDREIFLRDMK
                     AGNADSEFCSPFLVNSLLADACAYSDYAEAYADSEDLSTRGAHFFAEAKRCLEEEEGR
                     FTVATVQGLEVLSVCAFLMGKDRRGWVYQGQLAFAAKELARSTHSAPSNATAKSPDLA
                     QATNFTFWGLYVITMASAMAYHKPSLVEKPDRPCPHVAHDHHKDLWYPYPAQSDGYST
                     HPLCHFNNLCELTIVINNWCQFLFGDSDKPAFDRVKELTESVDRRLSEWQQGLPPCLD
                     LNIEGALLPQVLCLHMYYHNIVITIFGFAKNAENEDDETGRSSAFHKYAADRCLRSAR
                     EISNLMKLHRSFWGLDIFPAGHIQWITVSLFTLLEGRDDPANREAFTNLSIAAKTASR
                     RWTLGKGMLRAVQVTAGKMAVSMPPETDLLFADFEQQIRNSKDREGLNSLYPNFAVST
                     GSIQTDEVELDKFLEKWDALGVSESNEPDV"
     gene            <840000..>842212
                     /locus_tag="ACHE_40291S"
                     /db_xref="GeneID:66982086"
     mRNA            join(<840000..840143,840205..840719,840768..840851,
                     840903..841012,841062..841213,841269..841757,
                     841817..>842212)
                     /locus_tag="ACHE_40291S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278473.1"
                     /db_xref="GeneID:66982086"
     CDS             join(840000..840143,840205..840719,840768..840851,
                     840903..841012,841062..841213,841269..841757,
                     841817..842212)
                     /locus_tag="ACHE_40291S"
                     /note="COG:G;
                     EggNog:ENOG410PHNV;
                     InterPro:IPR010720,IPR017853,IPR013780;
                     PFAM:PF06964;
                     SECRETED:SignalP(1-25);
                     go_function: GO:0046556 - alpha-L-arabinofuranosidase
                     activity [Evidence IEA];
                     go_process: GO:0046373 - L-arabinose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136249.1"
                     /db_xref="GeneID:66982086"
                     /translation="MVAFSTLSGLSAFSLLFSLIQHVHGVSLEVSTEGGNSSSPLLYG
                     FMFEDINYSNDGGIYGQLLQNNGLQGSSPNLTAWASVGDATISVDAENPLTSAIPHSL
                     KLDVPEGTTGQVGFTNEGYWGIPVDGSTFQNYFWIKGDFSNSVTIRLVGTNSGTEYAS
                     TSVEVSSNADEFTYVTTSFPTTKAPDGDVLYELTVDGELIAGKSLNFGLLQLFPETYK
                     SRYNGLKPQLANALESVKGSFLRFPGGNNLEGDTEETRWKWNETIGPVEDRPGHQGTW
                     TYYNTDGLGLMEYFYWCEDLNLTPVLGVWAGFSLESGGNTPFTGDALQPYIDDVLNEL
                     EFVLGDSSTTYGSLRATYGHEEPFNVNLVEIGNEDNLGGGCESYAERFTAFYDAIHAA
                     YPDLTLIASTDNASCLPSTIPEGAWVDFHDYNTADGLVSEFNLFDNKDRSVPYFIGEY
                     SRWEIDWPSMKNSVAEAVYMIGLERNSDVVKMAAYAPLLQLVNSTQWTPDLIPFTQNP
                     TDMVIETVSYYVQQMFSVNRGDTIKEVTSDSAFGPVYWVASSAGNKYYVKLANYGSET
                     QDVTVSIPGLSSGKLTVLADNDPEASNTDTQTLVTPSEKDVTGENGSFSFTLPAWSVA
                     VLAAN"
     gene            complement(<842359..>843202)
                     /locus_tag="ACHE_40292A"
                     /db_xref="GeneID:66982087"
     mRNA            complement(join(<842359..842469,842530..842955,
                     843014..>843202))
                     /locus_tag="ACHE_40292A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278474.1"
                     /db_xref="GeneID:66982087"
     CDS             complement(join(842359..842469,842530..842955,
                     843014..843202))
                     /locus_tag="ACHE_40292A"
                     /note="COG:E;
                     EggNog:ENOG410PK8K;
                     InterPro:IPR036412,IPR023214;
                     PFAM:PF12710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136250.1"
                     /db_xref="GeneID:66982087"
                     /translation="MWGSLTIPIEDGFDTMRNNMSMDPKFKEFHEFCMENNISFNVIS
                     AGLRPILRKVLDAFLGAQESSNINIVANDADIDGSTPWKPIWLHETELGHDKALSVNQ
                     GRAEAASACVEGEIPLIIFIGDGVSDLTAAREADILFARKGLKLEEYCNKNQIPYIPF
                     ETFADIKKEVQHIMKEDLEKTGGTGIPARFNPRANMWRRISSKQAVPKFAAATPSNEE
                     KMFLWPEAFSDYQPKAVPQDGSV"
     gene            complement(<844960..>845198)
                     /locus_tag="ACHE_40293A"
                     /db_xref="GeneID:66982088"
     mRNA            complement(join(<844960..845087,845144..>845198))
                     /locus_tag="ACHE_40293A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278476.1"
                     /db_xref="GeneID:66982088"
     CDS             complement(join(844960..845087,845144..845198))
                     /locus_tag="ACHE_40293A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136251.1"
                     /db_xref="GeneID:66982088"
                     /translation="MPNQKNPSDLRRKINIFSDFDGTIFMQDTGHVLVSNLSRRSTRM
                     MERPTHGFYLGSYRRE"
     gene            complement(<845788..>846510)
                     /locus_tag="ACHE_40294A"
                     /db_xref="GeneID:66982089"
     mRNA            complement(<845788..>846510)
                     /locus_tag="ACHE_40294A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278477.1"
                     /db_xref="GeneID:66982089"
     CDS             complement(845788..846510)
                     /locus_tag="ACHE_40294A"
                     /note="COG:H;
                     EggNog:ENOG410PGN4;
                     InterPro:IPR036551,IPR003382;
                     PFAM:PF02441;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136252.1"
                     /db_xref="GeneID:66982089"
                     /translation="MTTRAETMQQAPAEEVAASINDGKTHLLLAATGSVATIKLPLII
                     SSFERHPNLSIRVIITKSAAHFLAGQSSEQPTVESLSSLPNVDGVHRDEDEWVVPWTR
                     EANILHIELRRWAHLLAIVPLSANVLAKMTGGLCDDLLTTVIRAWDTGTPESRGPPIL
                     VAPAMNSMMWIHPLTSKQLSILENEWWWVEILPAQSKTLACGDTGQGGMCDWKRIVRV
                     IEERLELTRVYHRRNLISTDAV"
     gene            <847244..>847630
                     /locus_tag="ACHE_40295S"
                     /db_xref="GeneID:66982090"
     mRNA            <847244..>847630
                     /locus_tag="ACHE_40295S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278478.1"
                     /db_xref="GeneID:66982090"
     CDS             847244..847630
                     /locus_tag="ACHE_40295S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136253.1"
                     /db_xref="GeneID:66982090"
                     /translation="MDVEDDNMVHDQYDFMLQFSCYVLADKLQASGFKCYIMDEIRCH
                     EEFCDPINLTVDHIRYAYDNTVRQNDPLRRLCPMIRCKRISIWQIINDFKFIALMEEG
                     GAFVRDMMQMSWKLTLKTEGANEETT"
     gene            <848047..>849160
                     /locus_tag="ACHE_40296S"
                     /db_xref="GeneID:66982091"
     mRNA            join(<848047..848585,848632..>849160)
                     /locus_tag="ACHE_40296S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278479.1"
                     /db_xref="GeneID:66982091"
     CDS             join(848047..848585,848632..849160)
                     /locus_tag="ACHE_40296S"
                     /note="COG:S;
                     EggNog:ENOG410PTDD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136254.1"
                     /db_xref="GeneID:66982091"
                     /translation="MPQFFQRFRRRPKDQDATSTDLPLILSKTGIDYDTCNSNASLRD
                     YRDYTAMPLPPPRRPLTPPPESADPEESPGAVNTQTQSALFARLPRNIRERIYIELFG
                     ERAVHVEYDYGFAPGYRGREKKPPDQWRWWHRVCEEEEAKPGDMCRSDDLDDLKRKGK
                     RELLKYKLKGVEWLRTCRIGYQEALPILYGTNTFLVASAVKLCRFPKVIVPSHLSAIT
                     SLDILHIAKAATPSTMSDDDWSMYNTIFRTLRLSYTGLQRLRLVVYILNKPCTPRAGS
                     VPEEFEEAWFRPWQDLASSRTWEKLEIGIQASWFKDFSEGAERWAKRIGRAEPGYTLV
                     QVEDYTTWDGKLSEVWNAPYL"
     gene            <849530..>850564
                     /locus_tag="ACHE_40297S"
                     /db_xref="GeneID:66982092"
     mRNA            <849530..>850564
                     /locus_tag="ACHE_40297S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278480.1"
                     /db_xref="GeneID:66982092"
     CDS             849530..850564
                     /locus_tag="ACHE_40297S"
                     /note="COG:S;
                     EggNog:ENOG410PYHT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136255.1"
                     /db_xref="GeneID:66982092"
                     /translation="MPIAILTMHPPLSNPTEPNSILNLIQPLNITMDVSFFEESSRLK
                     SNQILRQVQSIHTVTEDLITELQTTLGEGKFVVDKFKVRPQEWHDWYKANRRLREVVE
                     YDSLKQYIIVKGKPGPLHDAVTATFKKFFEDLQDLMYGLNRHQTTTRKPVQEIPFLAL
                     EIGICESTNKLLQNAEHLLTRTTNRKNAVIVVDIQERRPPPIRSFKQFDLSADDIKAF
                     GLSQVTDAITKWYQRNKNPLVGEFSVGVYFCYPEGETVTIYKGDLPTTGNGSIGKARK
                     PIGNAAAIPYGRLLPALQRKREIMFPVPVDELLGELQKTLTWVLPHYRAERKAIELKK
                     RLAKRRISKV"
     gene            complement(<850829..>852484)
                     /locus_tag="ACHE_40298A"
                     /db_xref="GeneID:66982093"
     mRNA            complement(join(<850829..852318,852367..>852484))
                     /locus_tag="ACHE_40298A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278481.1"
                     /db_xref="GeneID:66982093"
     CDS             complement(join(850829..852318,852367..852484))
                     /locus_tag="ACHE_40298A"
                     /note="COG:G;
                     EggNog:ENOG410PHVM;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083;
                     TransMembrane:10
                     (n10-21c26/27o60-80i92-110o116-137i149-168o180-201i314-
                     334o340-363i375-394o414-432i444-463o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136256.1"
                     /db_xref="GeneID:66982093"
                     /translation="MKFRPSQPWFGLRGGWLTFWVTVACATDMTLFGYDQGVFGGVIV
                     TNDFLDTLQLRDDPTLLGTVTAIYDVGCLFGAIFSMYFGEVWGRKKSIMVGTTVMAIG
                     ALLQITAYGVPQMIVGRIVAGLGNGMNTATAPVWQGETSQIKWRGKLVIIEMILNIAG
                     YSLSNWVTYALSYVPGPASWRFPLAFQFVFIIILWVTVPWLPESPRWLIAHGRPDEAR
                     EIIANLEDMDANDSYVITAHTEIVDAVEYEREHSVSWLNLLRGKTGDQGGTCAIRRLL
                     LGAGAQAMQQLSGINVTSYYLPTVLMESVGMSEKMSRLLAACNSVSYLLAGLVAIPHI
                     ERWGRRRLFMICALGQGLCYLLITVLIRFNEKQGYAYQEQVASASVAFFFLYYVFFGM
                     GFQGIPWLLPVEINSLSMRTKGAALATATNWAMNFMVVEITPVGIQNLGYRFYIIWTV
                     LNLSFVPIIYFFYPETANRALEDIDMFFRENHFIFVHNNKEAISAKRPARYVEMEHDL
                     VQRTAEQTEEKMEAEEAKGSMEQMEGV"
     gene            complement(<854391..>855203)
                     /locus_tag="ACHE_40299A"
                     /db_xref="GeneID:66982094"
     mRNA            complement(<854391..>855203)
                     /locus_tag="ACHE_40299A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278482.1"
                     /db_xref="GeneID:66982094"
     CDS             complement(854391..855203)
                     /locus_tag="ACHE_40299A"
                     /note="COG:S;
                     EggNog:ENOG410PVXT;
                     InterPro:IPR038903;
                     SECRETED:SignalP(1-19);
                     go_component: GO:0005576 - extracellular region [Evidence
                     IEA];
                     go_function: GO:0019863 - IgE binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136257.1"
                     /db_xref="GeneID:66982094"
                     /translation="MQLTKTLMLLAALTSGSLANINKRSSTLIPVASPTSSSPSSASS
                     SSSGGSSGGSWTATPSSGSYSTEGFGGRTSSGGSGITYAGNTGNPWGSNMIQVSESDA
                     ANYKNVAQFKGQNEETWTVVLFNKCGPDGQMTGWYGNSALTFELSAGDTKYVAFDDDS
                     RGGWAAASGSIPTDNNGGYASTWGEFDFTSSSNGGWSGFDVSAIMAQNAGLTVQGMSI
                     CDALGSTCSSITPDAASVDNAYTSAETDAGGIGGNLSGGGAVRLAVTIDYKG"
     gene            <860631..>861029
                     /locus_tag="ACHE_40300S"
                     /db_xref="GeneID:66982095"
     mRNA            join(<860631..860699,860772..>861029)
                     /locus_tag="ACHE_40300S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278483.1"
                     /db_xref="GeneID:66982095"
     CDS             join(860631..860699,860772..861029)
                     /locus_tag="ACHE_40300S"
                     /note="TransMembrane:1 (o20-44i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136258.1"
                     /db_xref="GeneID:66982095"
                     /translation="MPSKTVSTSLPEWQWEPAVWNFVLPSANAVAAAAIVLVDEAILL
                     SVLDPAQSRFCVSGFPMPSVAKEPSVEVEESSGGSLSLKPPKGQLQHTRQFVSYLGTS
                     EYSSTA"
     gene            complement(<862148..>863132)
                     /locus_tag="ACHE_40301A"
                     /db_xref="GeneID:66982096"
     mRNA            complement(join(<862148..862456,862521..862695,
                     862765..>863132))
                     /locus_tag="ACHE_40301A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278484.1"
                     /db_xref="GeneID:66982096"
     CDS             complement(join(862148..862456,862521..862695,
                     862765..863132))
                     /locus_tag="ACHE_40301A"
                     /note="COG:S;
                     EggNog:ENOG410PGY4;
                     InterPro:IPR000791;
                     PFAM:PF01184;
                     TransMembrane:6
                     (o75-92i104-123o143-161i173-192o198-220i232-256o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136259.1"
                     /db_xref="GeneID:66982096"
                     /translation="MTDTIDKEQTNNTNPSNTTHNTNNTAPQYYYIDPRYGPLARVNT
                     AETQLPAFATELQPGLHRPGPVEEQKIGNPAPLGLAAFALTTFILGCINMGARDITEP
                     NIVVGPAFAYGGLVQLCAGMWEMAAGNTFGATALSSYGGFWISLAIVFTPGGFNIMAA
                     LEKAGGGTTDMFYDSLGLFLMGWFIFTFLLVLCTLKSTFVFCGIFVTVDIAFLLLGIG
                     YIHRNGSSSPNEPVIKAGGLFALLAAFQAWYVCLAGLANDSNSFVRIPATHFPWSEKG
                     RESRKNN"
     gene            complement(<865199..>865672)
                     /gene="ATP9"
                     /locus_tag="ACHE_40302A"
                     /db_xref="GeneID:66982097"
     mRNA            complement(<865199..>865672)
                     /gene="ATP9"
                     /locus_tag="ACHE_40302A"
                     /product="ATPase complex subunit 9"
                     /transcript_id="XM_043278485.1"
                     /db_xref="GeneID:66982097"
     CDS             complement(865199..865672)
                     /gene="ATP9"
                     /locus_tag="ACHE_40302A"
                     /note="COG:C;
                     EggNog:ENOG410PPGS;
                     InterPro:IPR038662,IPR035921,IPR000454,IPR020537,
                     IPR002379;
                     PFAM:PF00137;
                     TransMembrane:2 (n6-14c22/23o97-117i129-153o);
                     go_component: GO:0033177 - proton-transporting two-sector
                     ATPase complex, proton-transporting domain [Evidence IEA];
                     go_component: GO:0045263 - proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence IEA];
                     go_function: GO:0015078 - proton transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA];
                     go_process: GO:1902600 - proton transmembrane transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ATPase complex subunit 9"
                     /protein_id="XP_043136260.1"
                     /db_xref="GeneID:66982097"
                     /translation="MASSRVFASRLASAMAPTTRVAARPAVRAAVPKRTFTDARAAFR
                     PQPLQTMKRQQPSTLLQANARQVFANYQSRRQYSSEIAQAMVAVSQNVGMGSAAIGLG
                     GAGIGIGLVFAALLLSVSRNPALRGQLFTYAILGFAFVEAMGLFDLMVAMMCKYV"
     gene            complement(<873564..>874832)
                     /locus_tag="ACHE_40303A"
                     /db_xref="GeneID:66982098"
     mRNA            complement(join(<873564..874374,874426..>874832))
                     /locus_tag="ACHE_40303A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278487.1"
                     /db_xref="GeneID:66982098"
     CDS             complement(join(873564..874374,874426..874832))
                     /locus_tag="ACHE_40303A"
                     /note="COG:E;
                     EggNog:ENOG410PIS9;
                     InterPro:IPR002872,IPR015659,IPR029041;
                     PFAM:PF01619;
                     SECRETED:SignalP(1-34);
                     go_function: GO:0004657 - proline dehydrogenase activity
                     [Evidence IEA];
                     go_process: GO:0006562 - proline catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136261.1"
                     /db_xref="GeneID:66982098"
                     /translation="MPTGPLLRSLLFTSIMSSPLLNPCLSMLTRVVNSTSPLLDPSQN
                     PLMNHLLRMTIYNHFCAGENERSVQQTVHGIKTLGFKGVIMGYAKETVVKENESTTSS
                     TSQEEASLRSVEEWKRGNLRTLGMIGAGDYLAVKFTGAGPIALNALASGDAIPQCIYQ
                     AMREICQTAAAQNSRLWIDAEQQVFQPAIDVWTIELMREFNRGESPVVFNTIQAYLKD
                     SEANVQRHLLLSKQEGWKLGIKLVRGAYIAHDRRDRIHDTKPETDANYNSIVENLLQR
                     KYPLPTSQQQSEFPDIRLFVASHNSETVRKAYTLHRQLIKSGAPTIPIEFGQLQGMAD
                     EIGCGLVQQNRMDSRDDVPGVFKYLAWGTTEECLHYLLRRAVENKGAVQRTRDMAVAL
                     RRELWRRLSFSFW"
     gene            complement(<875970..>877681)
                     /locus_tag="ACHE_40304A"
                     /db_xref="GeneID:66982099"
     mRNA            complement(join(<875970..877324,877378..>877681))
                     /locus_tag="ACHE_40304A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278488.1"
                     /db_xref="GeneID:66982099"
     CDS             complement(join(875970..877324,877378..877681))
                     /locus_tag="ACHE_40304A"
                     /note="COG:S;
                     EggNog:ENOG410PM15;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136262.1"
                     /db_xref="GeneID:66982099"
                     /translation="MLLPFALLVLSAVWSTASLTDSNLKKHVDVLTLENSFNPVKAAY
                     WTNYPHHRRTPFAVSPDGKSAYLAYLDSSETDVHVQQLDPATFEATGTSVTVSGGKEA
                     GGLVAHNDGFALLVNEEMPTGTSNAPASGTPVPVLYRYTDGKQSWKTWLGGPGVHESE
                     GLAASPDMNGDLAYSEGAGYYGAYFVVTDYSGDASGHYGDSIEYVANNGTLLDIPGAS
                     SVWGCSHNTGIAFEAADEAPFASICAEDQGAIWLNTKTQGMDNTGIKISNENTTNGAS
                     GEPMGGMSGSYSAFARFADSSRYIFSWVSRGAVDLSENTWMGGGYTHSVNRTNNRNVA
                     ISLFSDKYTKVGAQASSEVGAEDGDSQVNWITSGSGNDRSNAHAATFGPNNALVTWEE
                     ISDPICDYIAMGCRGQFAGSFFQQVNSDGEKVGDALKSTDVYVAGDMVTMNDGRICWP
                     YVSMEWDLSSPVDTYLGTGSSTTKKMSFACMSLGAGSTAQTTAGTASGSASPVGQTAS
                     SATPTTMKTVSRTAEATGTSSTAEAETPKPSPQEGPMFPSSWWE"
     gene            complement(<885527..>886981)
                     /locus_tag="ACHE_40305A"
                     /db_xref="GeneID:66982100"
     mRNA            complement(join(<885527..886638,886723..>886981))
                     /locus_tag="ACHE_40305A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278489.1"
                     /db_xref="GeneID:66982100"
     CDS             complement(join(885527..886638,886723..886981))
                     /locus_tag="ACHE_40305A"
                     /note="COG:S;
                     EggNog:ENOG410PW0J"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136263.1"
                     /db_xref="GeneID:66982100"
                     /translation="MEAQELCGGGISHASPPGVDNVASQFAETEDMPVTPTPIRWRSG
                     NMMQPEFNEGSMESASMDENEGQEHWQTRGSSRAPSRAPSWANVSKHAQVLVGALEAA
                     QNQQEMFQMVQEQVQAHLAEELSNWRAEQQVHEGLYLERVTKLELEVSKLRTELTEAQ
                     NTIQRIKPMKQDTPTTTNAQSSQMNQHNSSKVPKIREATSQKSRQQPTFADLATLLST
                     RPGGQEWQEVTKKKQKNRQIQAVAAVSQPDPIKLKPAKDTPKEARRFLFRREGGKAAP
                     RSEREDIILAINRAVAKAHFPAFIRVVDAGYTNTGVITILLEKGTLGSMLLPDYKDLL
                     VTAAWQADPAVISVELPEQWYRVKVHGVPIKRYLTCGLALAREEIELGTEYQLKRNPT
                     WLRSSKELHTSNQKCSTIVITVGSLEARRLLINSIRFGGSRYKTEQYWETGVDTVCPR
                     CCQLGH"
     gene            complement(<889684..>890199)
                     /locus_tag="ACHE_40306A"
                     /db_xref="GeneID:66982101"
     mRNA            complement(join(<889684..889740,889788..889867,
                     889914..>890199))
                     /locus_tag="ACHE_40306A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278490.1"
                     /db_xref="GeneID:66982101"
     CDS             complement(join(889684..889740,889788..889867,
                     889914..890199))
                     /locus_tag="ACHE_40306A"
                     /note="COG:O;
                     EggNog:ENOG410PZ95;
                     InterPro:IPR001338;
                     PFAM:PF01185;
                     SECRETED:SignalP(1-15);
                     go_component: GO:0009277 - fungal-type cell wall [Evidence
                     IEA];
                     go_function: GO:0005199 - structural constituent of cell
                     wall [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136264.1"
                     /db_xref="GeneID:66982101"
                     /translation="MKFLAITTFLATALAVPSTPGESCPKDAGQVTLKQAQNKCGSQA
                     KVSCCNKKIESGDSYNQNKGLLSGGILNGLLGGKGSEGLGVFDQCNELSVTALLGLDD
                     ILSDQCKQNIACCDDSNAKAEGGLVNVALPCVVLQDLL"
     gene            complement(<895025..>895849)
                     /locus_tag="ACHE_40307A"
                     /db_xref="GeneID:66982102"
     mRNA            complement(<895025..>895849)
                     /locus_tag="ACHE_40307A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278491.1"
                     /db_xref="GeneID:66982102"
     CDS             complement(895025..895849)
                     /locus_tag="ACHE_40307A"
                     /note="COG:S;
                     EggNog:ENOG410PRQK;
                     InterPro:IPR021054;
                     PFAM:PF12296;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136265.1"
                     /db_xref="GeneID:66982102"
                     /translation="MKFSPSLLTTLALSANVLATPTLEARSPTRVERDLASITGVLSG
                     ISDKVGTLHTAINNYNGGDTQPVESASDSLVDTINAGTTKVNGGDELSSMDALGLQQP
                     VSDLKDKIQSTISDLNGKKQQIVAAGKGSLTYNDLQKQKAAALKLSDAIVSKVPDNLH
                     DIAHSLASGISDAIQKGVEDFQDVAKSNSANKVAKAPVSTAPTPAETSSSTAPVSSRA
                     VKPTSSSLFKAPATSSASSSVAASSSIAPQFTGAASVNKMSGPVGALAIAAMVMAF"
     gene            <898391..>899044
                     /locus_tag="ACHE_40308S"
                     /db_xref="GeneID:66982103"
     mRNA            join(<898391..898757,898821..>899044)
                     /locus_tag="ACHE_40308S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278492.1"
                     /db_xref="GeneID:66982103"
     CDS             join(898391..898757,898821..899044)
                     /locus_tag="ACHE_40308S"
                     /note="COG:S;
                     EggNog:ENOG410PSER;
                     InterPro:IPR000182,IPR016181;
                     PFAM:PF13673,PF13508;
                     go_function: GO:0008080 - N-acetyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136266.1"
                     /db_xref="GeneID:66982103"
                     /translation="MLALEPVTEADLPAITDLWYSAFGPSGFLELIPDTPNIREWWNS
                     ANGHDLLHKPTAYYWKVVDAAHPSKPLVAYAKWDLESAEERGDRFPPWHAEMNKKGCD
                     DLFGKLEKQRSLLLGGTKNYYLDMLCTNPSYRGRGAGSMLVAWGCEQADKDRVAAYVD
                     ASRDGRPLYARHGFEDRTIDEHRAEGITCMVREPRS"
     gene            <901000..>903361
                     /locus_tag="ACHE_40309S"
                     /db_xref="GeneID:66982104"
     mRNA            join(<901000..901290,901343..901568,901623..902203,
                     902258..>903361)
                     /locus_tag="ACHE_40309S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278493.1"
                     /db_xref="GeneID:66982104"
     CDS             join(901000..901290,901343..901568,901623..902203,
                     902258..903361)
                     /locus_tag="ACHE_40309S"
                     /note="COG:P;
                     EggNog:ENOG410PM93;
                     InterPro:IPR018028,IPR029062,IPR020835,IPR011614,
                     IPR024708,IPR002226,IPR043156,IPR041399,IPR024712,
                     IPR037060,IPR010582;
                     PFAM:PF18011,PF00199,PF06628;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0004096 - catalase activity [Evidence
                     IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136267.1"
                     /db_xref="GeneID:66982104"
                     /translation="MRALSLAVVNGAIGLANAACPYMTGELNARDTSSNDAAAATEEF
                     LSQYYLNDNNTYMTTDVGGPIEDQNSLSVGERGPTLLEDFIFRQKIQRFDHERVPERA
                     VHARGAGAHGTFTSYANWGNITAASFLGAEGKQTPMFVRFSTVAGSRGSADLARDVHG
                     FATRFYTDEGNFDLVGNNIPVFFIQDAILFPDLIHAVKPRGDNEIPQAATAHDSAWDF
                     FSQQPSALHTLFWAMAGHGIPRSFRHVDGFGVHTFRLVTDDGDTKLVKFHWKSLQGRA
                     SMVWEEAQQVSGKNPDFIRQDLFESIENGYYPEWELGAQIMDEDDQLRFGFDLLDPTK
                     IVPEELVPVTPLGKMQLNRNPRNYFAETEQAMFQPGHIVRGIDFTDDPLLQGRLFSYL
                     DTQLNRHGGPNFEQLPINQPRVPFHNNNRDGAAQMFIPLNRDAYTPGPHTTNQGAPKQ
                     ANQTVGKGFFTAPNRKPGGTLQRTVSSTFSDNWSQPRLFYNSLDPVEQQFIVDAMRFE
                     NSNVKSEVVRNNVIIQLNRVSNDLARRVARAIGIEEPSPDPTFYHNNKTTNVGTFGGK
                     LQKLEGLKVGYLASVDNKDSLTEAATLSKSLSKNGVEVVVVAERLTDGVDQTYSGSDA
                     IQFDAVVVANGAESLFSFSSLTGGGAKNATAGAASTLFPAGRPLEILIDGFRFGKPVA
                     ALGSAVTALRGAAISPSREGVYVAKSAGDIVDEIKEGLRTFKFLDRFAVDN"
     gene            complement(<903686..>906952)
                     /locus_tag="ACHE_40310A"
                     /db_xref="GeneID:66982105"
     mRNA            complement(join(<903686..906886,906941..>906952))
                     /locus_tag="ACHE_40310A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278494.1"
                     /db_xref="GeneID:66982105"
     CDS             complement(join(903686..906886,906941..906952))
                     /locus_tag="ACHE_40310A"
                     /note="CAZy:GH65;
                     COG:G;
                     EggNog:ENOG410PGGE;
                     InterPro:IPR037018,IPR011013,IPR008928,IPR005195,
                     IPR012341,IPR005196;
                     PFAM:PF03636;
                     SECRETED:SignalP(1-21);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0030246 - carbohydrate binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136268.1"
                     /db_xref="GeneID:66982105"
                     /translation="MQSKILATLLPLLLQLSPVDCASSSGRITRAIERNTRHLDTNAS
                     SIYHTKFPGVTWDEDNWLLTTTVLDQGHYQSRGSVANGYFGINVASVGPFFELDLPVS
                     GDVVSGWPLFSRRQSFATIAGFLDSEPSLDESNFPWLYQYGGDSVVSGVPHWSGLVLD
                     LGDGTYLDSTVDSNTITDFRSTYDFKAGVLSWSYKWTPEGKGSFDITYRLLNHKLNVN
                     QAVVDMEVVPSADSNATVVNVVDGYSAVRTDFVESGEDDGAIFSAVRPWGISNVTAYV
                     YTNLTGSAGVDLSSRKLVTDKPYVSANASSIAQSVDVQFKANEKMRVTKFVGAASTDA
                     FENPQQTAKQATSKALSDGYLKSLVSHVSEWAKVMPENSVDHFIDPKTGRLPSDQHVI
                     DSAIVAVTSTYYLLQNTASKNAIKAASGAPINVESIPVGGLTSDSYAGQIFWDADVWM
                     QPGLVFSHPEAAQRITNYRVKQYPQAMDNVNAKYAGSKNQTYFDSSAAIYPWTSGRFG
                     NCTATGPCWDYQYHLNGEIGLSMMYEWVASGDTKHFREKHFPIYDSVATLYSNLLERN
                     GSSWTITNMTDPDEYANMVDAGGFTLPLMAETLNYVNSYREQFGVEPNETWTEMADNV
                     QMLRQNGVTLEFNTMNGSAVAKQADVVLNTYPLGYTDNYTTENALNDLDYYANKQSPD
                     GPAMTWAIFSVVANEVSPSGCAGYTYGQYSYEPYVRAPFYQLSEQLIDDPTINGGTHP
                     AYPFLTGHGGANQVVLSGYLGLRMRPDNAIHIDPNLPPQLPHVTYRTFYWRGWPISAS
                     SNYTHTTLSRASDAAVLDTAEARFADETIPVHVGSFSNSTVYELPVTGSLTVPNRKIG
                     SKNTVAGNLVQCRPAVSHDAFEPGQFPISVVDGATSTKWQPSSANLSAVTVSFAESVA
                     QSAVSGFYFDWHQSPPVNATVIFHNKTIEDPTSALDSSDVQVVTTLINIKQSKPYDPE
                     TVNLNEVMLPESNTTSIDLSGPVPAARYATLLISGNQAAPDAEDGVGATVAEWAILAD
                     AHNEASVPSDGKSKRKISMRDAAALSSGGFAGRRRQVGRG"
     gene            complement(<907931..>909083)
                     /locus_tag="ACHE_40311A"
                     /db_xref="GeneID:66982106"
     mRNA            complement(join(<907931..908209,908278..908900,
                     908954..>909083))
                     /locus_tag="ACHE_40311A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278495.1"
                     /db_xref="GeneID:66982106"
     CDS             complement(join(907931..908209,908278..908900,
                     908954..909083))
                     /locus_tag="ACHE_40311A"
                     /note="BUSCO:EOG092645L9;
                     COG:L;
                     EggNog:ENOG410PNWY;
                     InterPro:IPR001841,IPR014857,IPR036388,IPR011513,
                     IPR013083;
                     PFAM:PF08746,PF07574;
                     go_component: GO:0030915 - Smc5-Smc6 complex [Evidence
                     IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136269.1"
                     /db_xref="GeneID:66982106"
                     /translation="MTNDIGVVDYNDSNRAFLQAFMAHSSMTFEEARPILAAIFSAHE
                     REPVSPTDITEEDLSSYIAAANTAVSPFDLEIRSTLRQIQTNGDDTNIHPERVYALVN
                     TISDPLTQLATTYSPDEIAFVKRLLDAMFETNNTRISEAMVVSGMQAMQLARVSSADA
                     GVSRRESMGTGTGTQGGTVQSLTMSQAETVMQQLVEEGWMEKSRKGFYGLSPRGLMEL
                     RGWLVATYNDETDDGRRAEKVKFCAACRDIITVGQRCANRDCAGRLHDYCIRNFFRMQ
                     QAEKCPVCKAAWPGDKFVGERAITSTDRYLQGKRRSTNTQRQSGDGASSQVTAGVGEE
                     EESSEEDVG"
     gene            complement(<909422..>910112)
                     /locus_tag="ACHE_40312A"
                     /db_xref="GeneID:66982107"
     mRNA            complement(join(<909422..909750,909812..>910112))
                     /locus_tag="ACHE_40312A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278496.1"
                     /db_xref="GeneID:66982107"
     CDS             complement(join(909422..909750,909812..910112))
                     /locus_tag="ACHE_40312A"
                     /note="COG:A;
                     EggNog:ENOG410PHGA;
                     InterPro:IPR000504,IPR035979,IPR012677,IPR009145,
                     IPR000571;
                     PFAM:PF00642;
                     go_component: GO:0089701 - U2AF complex [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136270.1"
                     /db_xref="GeneID:66982107"
                     /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQ
                     TILMPNMYQNPAFDPKNRMNSSQLQNHFDAFYEDVWCEMCKYGELEELVVCENNNDHL
                     IGNVYARFKYEEDAQSACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGG
                     FCNFIHRKDPSAELDREMRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     gene            complement(<910529..>911371)
                     /locus_tag="ACHE_40313A"
                     /db_xref="GeneID:66982108"
     mRNA            complement(join(<910529..911345,911367..>911371))
                     /locus_tag="ACHE_40313A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278498.1"
                     /db_xref="GeneID:66982108"
     CDS             complement(join(910529..911345,911367..911371))
                     /locus_tag="ACHE_40313A"
                     /note="COG:E;
                     EggNog:ENOG410Q18Y;
                     InterPro:IPR006076,IPR036188;
                     PFAM:PF01266;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136271.1"
                     /db_xref="GeneID:66982108"
                     /translation="MGDPLRLSKFLINTAVSRGVKLHHPARAVSVVTGETGTITGVKI
                     VDLNTRNETTIPCTNLIVSAGPWTPQVFKEIFPSSEVSLPIGPLAGYSLVLRSPRYTL
                     EHERVTHGGKSHAIFTTHPDSCGFCPEIFSREGGEIYIAGLNSWDIPLPSHAEGSRDL
                     FDSNEIARLKDVSIRLMGKLADGSAESTDDVPNVDDLEILREGLCFRPVTSRGTPLVS
                     KIGEQSLGGVRAQGGVYVAAGHGPWGISLSLGTGRVVAEMIQGVKTSADVSGLAV"
     gene            complement(<911393..>911857)
                     /locus_tag="ACHE_40314A"
                     /db_xref="GeneID:66982109"
     mRNA            complement(<911393..>911857)
                     /locus_tag="ACHE_40314A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278499.1"
                     /db_xref="GeneID:66982109"
     CDS             complement(911393..911857)
                     /locus_tag="ACHE_40314A"
                     /note="COG:E;
                     EggNog:ENOG410Q18Y;
                     InterPro:IPR006076,IPR036188;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136272.1"
                     /db_xref="GeneID:66982109"
                     /translation="MSTVILGGGIIGSSIAYYLSNKQPTEEIHVVECSSQLFSAASGY
                     AAGFLAKDWFAPSLAPLAALSFDLHGELAAENGGTEKWGYMKGSALSLDVSTGGLRNG
                     PRGDDWLRAGTSRADTAAGSRESQIAEAPTWLTKQKGAALEKISDDDTTAVA"
     gene            <912347..>913401
                     /locus_tag="ACHE_40315S"
                     /db_xref="GeneID:66982110"
     mRNA            join(<912347..912515,912578..912891,912947..913317,
                     913365..>913401)
                     /locus_tag="ACHE_40315S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278500.1"
                     /db_xref="GeneID:66982110"
     CDS             join(912347..912515,912578..912891,912947..913317,
                     913365..913401)
                     /locus_tag="ACHE_40315S"
                     /note="COG:Q;
                     EggNog:ENOG410PNB7;
                     InterPro:IPR002347,IPR036291,IPR020904;
                     PFAM:PF00106,PF13561,PF08659;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136273.1"
                     /db_xref="GeneID:66982110"
                     /translation="MPLDYITQKSTGSRGHLNYSTYTTTDFLTTASIDQSLIHQYRIM
                     SAKTIIVTGASRGIGLSITKYLLSAPQSHNVVVVARSPEPLQKLKDQYGKQVEILNGD
                     LADFSLAPKAVDLAVKSFGKLDGIVLNHGMLGQVGKIAEAEPEQWKYGWDVNFLSLVA
                     FVKAALPALRETKGKIIFTSSGASVTAYTGWGLYGASKAAMNHLALSLGDEEPDVTSV
                     SIRPGMVDTEMQRELREDHATSLVPHIHSKFVGVHKEGKLLKPEQPGHVMAKLVLDAP
                     SALSGKFLSWNDKELAGFQE"
     gene            <914193..>914791
                     /locus_tag="ACHE_40316S"
                     /db_xref="GeneID:66982111"
     mRNA            join(<914193..914214,914269..914295,914346..914605,
                     914672..>914791)
                     /locus_tag="ACHE_40316S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278501.1"
                     /db_xref="GeneID:66982111"
     CDS             join(914193..914214,914269..914295,914346..914605,
                     914672..914791)
                     /locus_tag="ACHE_40316S"
                     /note="COG:K;
                     EggNog:ENOG410PNSW;
                     InterPro:IPR009072,IPR042225,IPR003958;
                     PFAM:PF00125,PF00808;
                     go_component: GO:0017054 - negative cofactor 2 complex
                     [Evidence IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA];
                     go_process: GO:0000122 - negative regulation of
                     transcription by RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136274.1"
                     /db_xref="GeneID:66982111"
                     /translation="MSDREFSSNDDLSLPKATVQKIITEILPYSSGQTFSKDARDLLM
                     ECCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFGDYIPDVLAVAEEHKEQL
                     KSREKKQSKMEQSGLSEEELLRQQQELFRSATEKYNAAPE"
     gene            <915816..>916705
                     /locus_tag="ACHE_40317S"
                     /db_xref="GeneID:66982112"
     mRNA            join(<915816..916037,916164..916627,916681..>916705)
                     /locus_tag="ACHE_40317S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278502.1"
                     /db_xref="GeneID:66982112"
     CDS             join(915816..916037,916164..916627,916681..916705)
                     /locus_tag="ACHE_40317S"
                     /note="COG:S;
                     EggNog:ENOG410PP49;
                     InterPro:IPR007065;
                     PFAM:PF04982;
                     TransMembrane:5 (o35-55i67-85o97-115i127-147o167-189i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136275.1"
                     /db_xref="GeneID:66982112"
                     /translation="MAFSIPSVNILPRLPRWVSHWFGYRPTPPKPLPQYLVWIWSFFA
                     AFCGLCVLQAIFNYSSYFERRHVPGIVASFGASAVLCYGAIDAPLAQPRALIFGHFLS
                     ALVGICVTKLFSLMPDEERFNSLRWLAASLSSAVAIVVMQVTQTTHPPAGATALLPAV
                     DDAIWELSWYFLPVVLLSSVIIMAVALLLNNIQRRYPTFWIAPSPPPKPAPTPVTAPE
                     HQKEHAEEELGGNTLLPR"
     gene            <917371..>919495
                     /gene="ARP9"
                     /locus_tag="ACHE_40318S"
                     /db_xref="GeneID:66982113"
     mRNA            join(<917371..917400,917461..918862,918912..>919495)
                     /gene="ARP9"
                     /locus_tag="ACHE_40318S"
                     /product="actin-like protein Arp9 (SWI/SNF complex
                     component Arp9)"
                     /transcript_id="XM_043278503.1"
                     /db_xref="GeneID:66982113"
     CDS             join(917371..917400,917461..918862,918912..919495)
                     /gene="ARP9"
                     /locus_tag="ACHE_40318S"
                     /note="COG:Z;
                     EggNog:ENOG410PFKF;
                     InterPro:IPR004000,IPR043129;
                     PFAM:PF00022"
                     /codon_start=1
                     /product="actin-like protein Arp9 (SWI/SNF complex
                     component Arp9)"
                     /protein_id="XP_043136276.1"
                     /db_xref="GeneID:66982113"
                     /translation="MPPFKDEHVLIIAPGSQVTLAQLGLPESFTPARFRFPTRMFPAE
                     KQGEYEPYRIREKRQEVVKNGAGGNGAAPVPKVDVNMKDADAVPETKTENTEDTEKEK
                     TEGQEGEGTKQEVTEEIVYEEDVTSDEGAVYPMENGRIVDWPCFFALLTHIHNTLSPP
                     FHTPIMIISEPVWTARDREAITQFVFEKFKTPAFSLMDSALAVCYGYGTQTATVVDVG
                     KGKVNVTAVTDFLVNEHGRGIALEGCGGDYMTDRIEELLGSKGFTREMCEQLKRSNIT
                     EILPPGTPLPGAAATARQGANPAASASTGAPEGGAPNENVPRGPGDSTQTGEEGAEGE
                     DEGVLDVAAIVSGNTSEYLANIEKEKGSTKKGSAAEQAAKALRLPNSKKEKASFQFEE
                     LVPIQSEENSNASGRYIRQKRDIEVGVERFLSATPKQQAGERFSNGILDDIATQIHHT
                     ILSVPDASKRSELWDSLIVVGNGSKIKGFTQSLLGTITQKFILSPSASMFSSEIPSNF
                     ASPLPTGGTTTPAQMTPGYPVAGQGVNPLLVAATHSGNPGMSHMGTPSADPSLLYRPS
                     GHSQTPTSVKTLKPPEYFSEWKEQANSNAPGASGGGGGSNNGNAAGGPGAPGQPSTGH
                     GMEEAVFLGAQVASKVIFILDQGLTKGFMSRVDYNENGPSAIHDYIL"
     gene            <919833..>921050
                     /locus_tag="ACHE_40319S"
                     /db_xref="GeneID:66982114"
     mRNA            join(<919833..920032,920114..920294,920367..>921050)
                     /locus_tag="ACHE_40319S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278504.1"
                     /db_xref="GeneID:66982114"
     CDS             join(919833..920032,920114..920294,920367..921050)
                     /locus_tag="ACHE_40319S"
                     /note="BUSCO:EOG092657UN;
                     COG:A;
                     EggNog:ENOG410PG1U;
                     InterPro:IPR036236,IPR019447,IPR037321,IPR038254,
                     IPR013087;
                     PFAM:PF10357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136277.1"
                     /db_xref="GeneID:66982114"
                     /translation="MPRAEAGSNKAISNGMKAVCSPNPSPRAFCNTSNEHEVDNEQKG
                     LGRLRWYCQACEKQMRDENGFKCHVQSESHVRQVLLIGEDPKKYIESYSKEFVQNFVN
                     MLRTTHGEKKVHVNQFYQQVIQDKHHIHMNATKWKSLTQFAAYLGREGICRVEETEKG
                     LFVSWIDNSPETMKRREAIMRKERQDKGDEEREQKQIQEQIERAQQKADREDELDPEA
                     KLLQRKEGEKVKLNIGFGAKPVEAKPESEKQSSPEQKDKSTAPEAAAAESPAPSAEAA
                     PVPAPKISMSLGGGNKPKNVFAAVAKKNPLAGKKGPVMEAPKKMTEQERIMKAEMEAM
                     ERKRSRGPSGFPNAKRPKVS"
     gene            <921602..>924453
                     /locus_tag="ACHE_40320S"
                     /db_xref="GeneID:66982115"
     mRNA            join(<921602..921723,921776..921803,921857..922002,
                     922057..922828,922876..923469,923518..>924453)
                     /locus_tag="ACHE_40320S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278505.1"
                     /db_xref="GeneID:66982115"
     CDS             join(921602..921723,921776..921803,921857..922002,
                     922057..922828,922876..923469,923518..924453)
                     /locus_tag="ACHE_40320S"
                     /note="COG:S;
                     EggNog:ENOG410PXBR;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF04082;
                     TransMembrane:2 (o348-365i611-629o);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136278.1"
                     /db_xref="GeneID:66982115"
                     /translation="MSDTHGERVENTLSQVEDVNIAPEEYPPKRQKRGRYVSKACDEC
                     QKRKIKCDGRLPCRACTLKGRECNRQTIDMRRRGLTVPDEALERSHSPGDQDKEHPTT
                     KELAVRLDRIENQLSSLVSSISRGLGGLDGSTSEPVSPQDHRTNHGPRSLGFSSIKST
                     PNNSVPMFSGETSIAHTLDQVENHLAHIGGDENRHSAATSQIAKTSLPPSPIPRGEVD
                     DENHEQIYIRQVLNDFDIEPDRQCWDEFLDTFCEEVHILYPMLHLPTLRLTYIKMWGK
                     HLLSPECELGHDDSRFSIAQIWICLAIGRCTQSARIHGEDGRHSAGWSLYDAAMHLIG
                     DLLSSFRECSSPKLILQTLVLIVIYLFRLDANESAEKVLALAITHSHNLGIHRRKVVE
                     GISAFNSEMVRRVWWCIYLMDRRLAIDTGHPFLIQDVNVDTPLPRELSDDWLTGYRDD
                     PSTNCEVEPDIQAEVARAPLTAVSYLNAMISYSRLIGRVWEGMYGVGRTETAPSFLLR
                     ESLEQHIARAQKEIQSEFLQDYNKPLNWKLNSAPWWRTKQRMLMHIRWYSIQLLIRKP
                     MLQRAVSPSSPIPESPENEVTCMHIAQNMIQGLTKFPKERVRSTFTFLHYFVSATMIS
                     MGLIIKEPSFKAAYGNATLQAARMLRTYCRQTWISGRMVRSIYRLNQMATRVLSDYSS
                     RPSSREVKEARKPALANRPSKQPYFAPDMHPQHNTSYSLGNAPDSRQAPQATENTQGQ
                     QIKFPNNPLDYPTNTGLHDLSAFEDIWNPELTNIVMDDFDFEETTASNLNQTFPSNAY
                     GINPALTQTTTTFAAPDVESARPLNAQTAFIYDAPTGISQDVQVTGESEMEIDWLQSL
                     FWDSVGSYL"
     gene            complement(<926075..>927148)
                     /locus_tag="ACHE_40321A"
                     /db_xref="GeneID:66982116"
     mRNA            complement(<926075..>927148)
                     /locus_tag="ACHE_40321A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278506.1"
                     /db_xref="GeneID:66982116"
     CDS             complement(926075..927148)
                     /locus_tag="ACHE_40321A"
                     /note="COG:S;
                     EggNog:ENOG410PP0G;
                     InterPro:IPR006680,IPR032466,IPR032465;
                     PFAM:PF04909;
                     SECRETED:SignalP(1-24);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016831 - carboxy-lyase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136279.1"
                     /db_xref="GeneID:66982116"
                     /translation="MKPPLSSSLLLALPIALVASTASGDRDSLLKDNKAWYLTDTHIH
                     AIPPGYKNALAEAGGDPSGYPTPDWSEEGTLESLDWTGSARAVLSVSTPGIPIAGTSQ
                     QARNLCRETNNYLADLVNKHPLRLDFFGALPDWRDVNGTLEEIDYIYSIQKQAVGVGL
                     YTSYGDLLPGDAMFKPIWDKLDSYGALAFMHPGIMDVKPFFIGGFLPQPIIDYPQQTT
                     RAAVDLVVSGVRSNTPNVDLVLSHAGGTLPFLAQRAYGSLTSEDIAKNSVVDAAEALV
                     QFKRFYYDTALSNSPAQLSALLLSVDPSHILLGTDYPYAPAETIKASFKEYTEWLKVH
                     PALSADVLTQNAMKLILKHALWK"
     gene            <927948..>929533
                     /gene="HOG1_4"
                     /locus_tag="ACHE_40322S"
                     /db_xref="GeneID:66982117"
     mRNA            join(<927948..928111,928161..928208,928275..928404,
                     928454..928497,928546..928645,928695..929051,
                     929103..929181,929236..929419,929476..>929533)
                     /gene="HOG1_4"
                     /locus_tag="ACHE_40322S"
                     /product="MAPK protein hog1"
                     /transcript_id="XM_043278507.1"
                     /db_xref="GeneID:66982117"
     CDS             join(927948..928111,928161..928208,928275..928404,
                     928454..928497,928546..928645,928695..929051,
                     929103..929181,929236..929419,929476..929533)
                     /gene="HOG1_4"
                     /locus_tag="ACHE_40322S"
                     /note="COG:K;
                     EggNog:ENOG410PF8J;
                     InterPro:IPR008352,IPR008271,IPR003527,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004707 - MAP kinase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="MAPK protein hog1"
                     /protein_id="XP_043136280.1"
                     /db_xref="GeneID:66982117"
                     /translation="MSGDQPHQSYVNIYDRIPRLSFDHLVLLVDHRLTKDMAEFVRAE
                     VLGTTYEITQRYRDLQPRGFGASGVICCAHDSLSNLPVVLKKIANSFDSVAVMKRTFR
                     EVHMLNKLRHDNLINLNDIFISPSEDIYLVTDFMMTDLHQVIRATTLESQFIQFFTYQ
                     ILRGLKFIHSAGVIHRDLKPQNLLVNNNCDLKICDFGLAREQDHQMTGYVVTRYYRAP
                     EVMLTWQQYSYAVDMWSVGCIFAEMLRGTPLFPGENHIHQFTIITQVLGNPPQEVVER
                     VYSRNTLKFLESLPPREPRPLSSLFTGVEEEAVDLIEKMLQLDPYKRIVATDALSHPY
                     LVNFHDSEDEPVASQEIDMSYDEVELSPDEWKKRMYREVLDFHEGPCSKKVES"
     gene            complement(<929729..>931107)
                     /locus_tag="ACHE_40323A"
                     /db_xref="GeneID:66982118"
     mRNA            complement(join(<929729..929972,930024..930451,
                     930508..930631,930683..930851,930901..931002,
                     931050..>931107))
                     /locus_tag="ACHE_40323A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278509.1"
                     /db_xref="GeneID:66982118"
     CDS             complement(join(929729..929972,930024..930451,
                     930508..930631,930683..930851,930901..931002,
                     931050..931107))
                     /locus_tag="ACHE_40323A"
                     /note="COG:Q;
                     EggNog:ENOG410PG3J;
                     InterPro:IPR026992,IPR027443,IPR005123;
                     PFAM:PF03171,PF14226;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136281.1"
                     /db_xref="GeneID:66982118"
                     /translation="MPGKIEIERYEHVPVTKEELDWAELIMLDLSLYEQPGGKEELVK
                     QLDHAVRHVGFFYVKNFNISQEEVDRQFALGRAFYALPLEEKLKYHNSNDLERGEYNG
                     YRPAGHRILGNGIKDNVQVYNIPKFDGHHHRQQPAVLVDYIDEIEAFSRKCHTEVVEK
                     LLRLFAILLQLPDEDQLVRDHQYDAKGEDHLRYMHYAARSVEVNKQVGELYSPGHTDL
                     GTVTLLFRQPVAALQILNSEGQWKWVRPQDGTITINTCDALTALTGGLIKSSIHRVHA
                     PPPDQAHVDRLGVLYFARPNNHVILDPIQNSPLLNELGLTQNAFTELGQHLTTEQWVK
                     VRQTQQQRRRQEAKISDDGKYTYAPKDLEVIPGLHAKVYN"
     gene            <931509..>933373
                     /locus_tag="ACHE_40324S"
                     /db_xref="GeneID:66982119"
     mRNA            join(<931509..931609,931654..931703,931754..931771,
                     931820..931970,932018..932169,932218..932593,
                     932644..932886,932935..933043,933101..>933373)
                     /locus_tag="ACHE_40324S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278510.1"
                     /db_xref="GeneID:66982119"
     CDS             join(931509..931609,931654..931703,931754..931771,
                     931820..931970,932018..932169,932218..932593,
                     932644..932886,932935..933043,933101..933373)
                     /locus_tag="ACHE_40324S"
                     /note="COG:G;
                     EggNog:ENOG410QDII;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i35-56o82-103i110-129o135-160i172-192o204-226i275-
                     294o314-333i338-359o365-385i397-418o438-455i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136282.1"
                     /db_xref="GeneID:66982119"
                     /translation="MSDGDSKPEKLTLVRLVKEIFNWYPSSYPSEERKLLFKLDVSIL
                     IFACLCFFVKYLDQTNITNAYVSGLKEDLELNGNQLNYFNVCYYTAYVVFQVPGLLLM
                     SRPKLSRWLLPGLEVLWGICTFAQSRVQNVGQLYALRFLVGMFEAPVFAGTHFILGAW
                     YSGPELFKRAGMWFVCNPLGSMVSGYLQAAAYTNLSGVSDMPGWRWLFIIDGVFTIPV
                     ALIGFIVFPGIPDSPRPFYLTEKDIALAKEREKKANIRRPGKLGLDVFRRSLKRWHIW
                     VFILCYACMIISAYPTTYMSLWLKEAGYSVTQVNNLPTVIYAIQIVASWLGSTLAAIY
                     PAWIIYTIVSVCCLFSTLCMIIWNIPTALKFFAWYLFGVSGCASPILYSTVNTIVKDD
                     SEERALILGSMMTFGYSFNIWVPLLLFPTAGPDGAPRWRKGWPVTFVFYFLLWAGFVA
                     SILIYRREKKRDAAIPSRESNSDAEGEAVVQVGESAKHGS"
     gene            <934200..>934847
                     /locus_tag="ACHE_40325S"
                     /db_xref="GeneID:66982120"
     mRNA            <934200..>934847
                     /locus_tag="ACHE_40325S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278511.1"
                     /db_xref="GeneID:66982120"
     CDS             934200..934847
                     /locus_tag="ACHE_40325S"
                     /note="COG:S;
                     EggNog:ENOG410Q1JJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136283.1"
                     /db_xref="GeneID:66982120"
                     /translation="MCACCRMDAGADPTYRWAPESEAQHCNLNFLARQKNVHLRHLGV
                     SEPPLSSLELPVIYLVVLGRGESLARYLGVSLLNDFVEEKFNKLFSTCSPPLAETDNA
                     QGSDILSWVDVIRKFNYDQAEYTDDGTYRFPVQGLLVQISEADYAIIQSGILHKLHNP
                     WPDSRDAQEELETVELAIAEVSEWNQYALRGGIVTVPSSKVQFRLVANILHSHST"
     gene            <936857..>937150
                     /locus_tag="ACHE_40326S"
                     /db_xref="GeneID:66982121"
     mRNA            <936857..>937150
                     /locus_tag="ACHE_40326S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278512.1"
                     /db_xref="GeneID:66982121"
     CDS             936857..937150
                     /locus_tag="ACHE_40326S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136284.1"
                     /db_xref="GeneID:66982121"
                     /translation="MPGIYPDTPATGLPLGGHINPGETSIQAAARRYHERKRRESASG
                     LDSQFTQPSPAEHLIEEPRRDSRDSRNSTGSAEMPRRRSSLSERWNEFKRHLP"
     gene            complement(<937664..>940045)
                     /locus_tag="ACHE_40327A"
                     /db_xref="GeneID:66982122"
     mRNA            complement(join(<937664..938084,938151..938377,
                     938441..938842,938895..939211,939279..939834,
                     939949..939972,940028..>940045))
                     /locus_tag="ACHE_40327A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278513.1"
                     /db_xref="GeneID:66982122"
     CDS             complement(join(937664..938084,938151..938377,
                     938441..938842,938895..939211,939279..939834,
                     939949..939972,940028..940045))
                     /locus_tag="ACHE_40327A"
                     /note="COG:S;
                     EggNog:ENOG410PV6M;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136285.1"
                     /db_xref="GeneID:66982122"
                     /translation="MLRPRVCDPCHSRKVRCDGNDPCGNCLDQKAACTRARDMKRLSK
                     RNLAQNQRRRVREHQADEPLAIQPLATSCGSGSLQSFVEQSSDPSMSNVLHQIEDGFL
                     VDILGDGMLLEHLDMNYGPPSWMSFVPLTDDQMANQHQVEHSQGLAWNRRQALQSALS
                     VASQLLGGMEECTEMARETAISEEQRNIPSFEFLYWMLNDIYSDRFGSFVLDFFRHIG
                     KHTLKHMGSSILFNTATSCDSILYTTCVNSVAYKFLNTISGTERDDDLAQKLRHRALL
                     YRETAITTMKKIPLMIRPSLSLLQALLCGIFLQQGAGDTHICWELTRTACRVCIDIGL
                     HPAAASEEEYYCFMWCYILDRNYAWKLGKPRILTVETNTIMGPRSSNTAASELFLIYL
                     DLAKVQDIMIPSLKDSIKPDTDAFQSFHDIGAHVSRNMESIRRKIDQIKLPSTNWSGL
                     DVHHEIATLDFAYHSIMTCILHLHLATLDQNAADNYLVSARRELLALIAICASNDTQK
                     TVAYLHWTLLYYPLTAYFAVFCNAVATCHTGDFQILKELANCLAESGTMSKPIANMHS
                     LFQQFVSLSWCFFSEEDTNISANECVARRPQSSSHHWGAIAGSSLSPLSLPSWMESAL
                     SQEALTPNTATVRQAFEPTSSRVLGDVFGS"
     gene            complement(<941794..>943427)
                     /locus_tag="ACHE_40328A"
                     /db_xref="GeneID:66982123"
     mRNA            complement(join(<941794..942468,942523..942884,
                     942946..943279,943338..>943427))
                     /locus_tag="ACHE_40328A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278514.1"
                     /db_xref="GeneID:66982123"
     CDS             complement(join(941794..942468,942523..942884,
                     942946..943279,943338..943427))
                     /locus_tag="ACHE_40328A"
                     /note="CAZy:GT2_Chitin_synth;
                     COG:M;
                     EggNog:ENOG410Q1ZC;
                     InterPro:IPR029044,IPR004835,IPR004834,IPR013616;
                     PFAM:PF01644,PF08407;
                     go_function: GO:0004100 - chitin synthase activity
                     [Evidence IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0006031 - chitin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136286.1"
                     /db_xref="GeneID:66982123"
                     /translation="MEYDQDASFSPPPFEAAGNRYSLRELTPAIPERHSIDEHDYLAQ
                     SLLPPPSDDLHPSFSPPWHSETPRQSSSKDPNTSSWQERQNAATCGSLRRRPTRKINL
                     IQGSVLSVDYPVPSAIRNAVETKYHDPNGSSPEEFTHLRYTAAICDPDDFNLRNGYNL
                     RPAMYNRHTELLIAITYYNEDKVLTARTLHGVMQNIRDIVSLKKTKFWNKGGPAWQKI
                     VVCLVFDGIGPCDKDTLDVLATVGVYQDGIMKHDVDGKETTAHIFEYTTQLSVTPTQQ
                     LVRPHHDDPKNLPPVQMIFCLKHNNSKKINSHRWLFNAFGRILNPEVCILIDAGTKPG
                     HKSLLVLWEAFHNNKHLGGACGEIHALLGRHWKMLANPLVAAQNFEYKISNILDKPFE
                     SMFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSKRLGKKGIEGMNIFKKNMFLA
                     EDRILCFELLAKAGFKWTLSYVKASKGETDVPEGKL"
     gene            <944160..>944673
                     /locus_tag="ACHE_40329S"
                     /db_xref="GeneID:66982124"
     mRNA            join(<944160..944222,944279..944389,944458..>944673)
                     /locus_tag="ACHE_40329S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278515.1"
                     /db_xref="GeneID:66982124"
     CDS             join(944160..944222,944279..944389,944458..944673)
                     /locus_tag="ACHE_40329S"
                     /note="COG:S;
                     EggNog:ENOG410Q1IN;
                     InterPro:IPR014752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136287.1"
                     /db_xref="GeneID:66982124"
                     /translation="MKLSGSATSRLDSGKLTQSHQLFGRVEQVFPPDKCAAWFTSRTV
                     TIPPGEHAFPFSIRFPQVSECYKTSPTDVSGKRPGGRRKHHLLRKLPPSSGGKTTPEE
                     IKYFLEATVRQDGILRRTQKAVELSHT"
     gene            complement(<945825..>946304)
                     /locus_tag="ACHE_40330A"
                     /db_xref="GeneID:66982125"
     mRNA            complement(<945825..>946304)
                     /locus_tag="ACHE_40330A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278516.1"
                     /db_xref="GeneID:66982125"
     CDS             complement(945825..946304)
                     /locus_tag="ACHE_40330A"
                     /note="COG:S;
                     EggNog:ENOG410PTEQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136288.1"
                     /db_xref="GeneID:66982125"
                     /translation="MTSVTITTAPAATTAATCSGPGQYELPVKDAACGVPNTKNYQSL
                     FDSCAKPAGVRPYYHDCALWALAVDQSVQDLITCLYKAGIAWEDVWCHGASNETATAT
                     SYPTPTATATGKGRTGSSTSSTTETKSATNMALSSQGQIPTKIAVGLLGLVLTGVFV"
     gene            <949844..>951520
                     /locus_tag="ACHE_40331S"
                     /db_xref="GeneID:66982126"
     mRNA            join(<949844..950413,950465..>951520)
                     /locus_tag="ACHE_40331S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278517.1"
                     /db_xref="GeneID:66982126"
     CDS             join(949844..950413,950465..951520)
                     /locus_tag="ACHE_40331S"
                     /note="COG:S;
                     EggNog:ENOG410PWPT;
                     InterPro:IPR021858;
                     PFAM:PF11951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136289.1"
                     /db_xref="GeneID:66982126"
                     /translation="MRTGQKAPLPTSRPEVAEVVHDQTALETEQYGPMDNSQITENEA
                     LLSIDLLTSGSGVDVFGTESLQWPDVGAPIFPSLEDQDSSLFRYYFSLICRINSCFDS
                     DKNLFRVGVGELTKSCPLIHHCILSMSAAHRSCQQGDLATAALDHRTKAISCLRAELI
                     KQNGENDSYSTSSVAKEETLLGSILLGMTEGWHNPSQLGITHLHGARGLFISWIADNQ
                     KSTGPCSQIHSSPTRSFMVGIMAYWEAMASFVIDQPLDVVAYLELFLDRDEMSHIHPN
                     PWTGICTPLFIYLAKVGILGRQKSMLKKLSITNAGAGFRDKLQSTLVEQARETEKAVL
                     RYRLPADNRIEDTGDILTPVHHLHQVAQIYRFATILELYLSFPELLPEPTANAAAAPS
                     NRSIDKVLTLASSVLTLIRTIPSSSGANVLLNAPLIIAGSTLQPTCRRIDTDTGRHDS
                     SWDVLYMELLSLSSQEDVYLHWRDFVRERIEGLYSHVGVATVRRGMEVLDKVWTRADI
                     KALVDVPDGMANAADLVKWTDVMVEERLETILG"
     gene            <955277..>957869
                     /locus_tag="ACHE_40332S"
                     /db_xref="GeneID:66982127"
     mRNA            join(<955277..955668,955728..955953,956012..956174,
                     956242..>957869)
                     /locus_tag="ACHE_40332S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278518.1"
                     /db_xref="GeneID:66982127"
     CDS             join(955277..955668,955728..955953,956012..956174,
                     956242..957869)
                     /locus_tag="ACHE_40332S"
                     /note="CAZy:GH3;
                     COG:G;
                     EggNog:ENOG410PJ4A;
                     InterPro:IPR017853,IPR019800,IPR036962,IPR002772,
                     IPR036881,IPR026891,IPR013783,IPR001764;
                     PFAM:PF14310,PF00933,PF01915;
                     SECRETED:SignalP(1-22);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136290.1"
                     /db_xref="GeneID:66982127"
                     /translation="MPHVKGVVAALATLSLVNSATTQNNQGGRVIQNDTYFYGQSPPV
                     YPTPEISGSGDWDEAFFKAQALVSQMSLEEKVHLTGGSKNETSACGGYISGISRLGFP
                     GMCLQDGPAGLRGTEGVNGYPANVHVGASWNKSLAYDRAYAIAGEFKRKGATVILGPA
                     VLGPLGRIALGGRNWESYGVDPYLSGILGAQSVKGTQDGGVISCTKHLIGNEQETARN
                     PQTDQRTKHTIESSSSNIDDKTMHEMYLWPFADAVHAGTASIMCSYQRLNNSYGCQNS
                     KLLNGLLKTELGFQGFVVTDWTAHRSGVASALAGLDMTMPYGSTFWGSQLVEAVRNGT
                     VPESQVEDMVTRILAAWYYSHQDDPSVPPVGVGLPYDVLSSHELVDARDPEDTSTLME
                     GAIQGHVLVKNVDKALPLIKPRMLAVYGYDAKTPEKNNPSSGMGDWSLGFESNDHRTV
                     ICGFGPDGGKCPPFSPIANGTLMGGGGSSSISPFYVDSPLQALAARARKDETQLFWDV
                     ENSASSVPGSTDACLVFINAFSSEGVDRPSLRDDYSDAWVQNVASQCQNTIVVVHNAG
                     IRLVDQWIDHPNITAVILAHLPGQNSGEAITQILYGDVSPNGKLPYTIARNESDYGAI
                     LEPVITTTNSWDRYYLQDNFTEGVYIDYRAFDEGDIKPRFEFGFGLTYTTFKYSNLKI
                     ENSVDLSTLSPFPDGDIIPGGHADLWDTIATVTADVTNTGDMPAAEVGQLYVTIPSDG
                     QPMKQLRGFDKIMVRPGETKTFEFELRRRDLSVWDVAAQQWKLLSGSEYQLSVGASSV
                     TALY"
     gene            complement(<961069..>962587)
                     /locus_tag="ACHE_40333A"
                     /db_xref="GeneID:66982128"
     mRNA            complement(join(<961069..961633,961680..>962587))
                     /locus_tag="ACHE_40333A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278521.1"
                     /db_xref="GeneID:66982128"
     CDS             complement(join(961069..961633,961680..962587))
                     /locus_tag="ACHE_40333A"
                     /note="COG:H;
                     EggNog:ENOG410PKM6;
                     InterPro:IPR001613,IPR036188,IPR002937;
                     PFAM:PF01266,PF13450,PF01593;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136291.1"
                     /db_xref="GeneID:66982128"
                     /translation="MPHTKEGFLWTPNHTHSGLQTDSIQPSSPTIKPHYDIIVIGAGF
                     AGLIAARDLIQRHNLNVLLIEARDRIGGRTWTAKVLGKELEMGGTWVHWAQPHVYNEL
                     QRYGLHRYLKTSAGTLAPERQFFKSSGGEIEEVSIADNIEALERVAEVFFNIDGLNSR
                     ALMPYPHDPLREPAMWKRYDHLTVQDRLDQLPDKISQRHRELFQSNISTFGSALGKDM
                     GFVEALRWYALGGHSMARVFEMAGIYKIGHGGMTAFSRAILGDYNGDRLFNTTVRQIN
                     HIGSNKVVINTSNGEVKAKAVVSTIPLNCLDNITFNPPVSPLRQAALAKKHINTGAKI
                     HFKLSATQQPWFATADGTNSNSSFVFAFFDHNGTKPSPSGTWCIGFGYNDRLPDKNDH
                     HHIINRFRQDINRDADVEAYVTHDWKNDPYSKGAWACWGSNSASIYLEELQRPHGRVV
                     FASADWADGWRGFVDGAIERGQSAVREAVNLLDGDGVAKL"
     gene            complement(<963213..>964638)
                     /locus_tag="ACHE_40334A"
                     /db_xref="GeneID:66982129"
     mRNA            complement(join(<963213..963369,963462..963767,
                     963842..964328,964389..>964638))
                     /locus_tag="ACHE_40334A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278522.1"
                     /db_xref="GeneID:66982129"
     CDS             complement(join(963213..963369,963462..963767,
                     963842..964328,964389..964638))
                     /locus_tag="ACHE_40334A"
                     /note="COG:I;
                     EggNog:ENOG410PJYC;
                     InterPro:IPR042098,IPR003819;
                     PFAM:PF02668;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136292.1"
                     /db_xref="GeneID:66982129"
                     /translation="MTEGKSPRQPDIQYHPDYEKYQARTEQRKATEVLTKELPAGFPA
                     ELISPLVWEGKDIETRNDWIYELSEKQLNEIDEALKTFKSLNLVFGYINQSTFPLPSL
                     GPILRGLSKELHFGRGFFVLRGLPVDNYSREENVIIYAGVSSYVGNIRGRQEDTRFAN
                     GTSLVLSHIKDLSDKTRKNVIGAPSNTADKQVFHTDAGDVVSLLCLQPAMEGGESYIA
                     SNWLVYNVLAKERPDLIHTLSQDWPVDGFNDPQKPYTNRPLLYHQAATPSTPERVVIQ
                     YARRYFTGFLSQPRSSNIPPITEAQAEARDALHFLAEEHAATLGFRKGDVQYINNLSI
                     FHARNAFRDEPGKERHLMRLWLRNPEFAWETPKPLRTRWDNVFKDVNEEEQVFPIEPR
                     IRKTVGS"
     gene            <965406..>967283
                     /locus_tag="ACHE_40335S"
                     /db_xref="GeneID:66982130"
     mRNA            join(<965406..965545,965603..965826,965884..966350,
                     966460..966619,966672..966982,967059..>967283)
                     /locus_tag="ACHE_40335S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278523.1"
                     /db_xref="GeneID:66982130"
     CDS             join(965406..965545,965603..965826,965884..966350,
                     966460..966619,966672..966982,967059..967283)
                     /locus_tag="ACHE_40335S"
                     /note="COG:E;
                     EggNog:ENOG410PW6R;
                     InterPro:IPR002293;
                     PFAM:PF00324,PF13520;
                     TransMembrane:12
                     (i30-50o62-87i108-126o146-166i178-200o220-238i259-280o310-
                     334i355-378o390-409i421-443o455-480i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136293.1"
                     /db_xref="GeneID:66982130"
                     /translation="MNELEPSATDLKTKDSLHVEESRVLQERTIGVFGAVSLIVNKIV
                     GAGIFSTPATIFKHSGSVGMTLIIWAIGGLISTCGALIMLELGTSMPRTGGMKVYLER
                     AFSPKLLVTCVYLFYCVFLQVSASNAITTSSYLLQAAAVTSTTWRLRGLAIAASAFAV
                     GIHTVWPQGGRRLQDVLSAVKLFILLFIVCSGFAALAGHRHVSDPHNFSFSTSFQGTS
                     KSGYSIGTALLNAIFAFHGYDNVNTVLSEVKNPAKTLRIALPTAMGLITVLYILANIA
                     YFAAVPKSQFLDSDVTIAASMFKNVFGESAATKALPALVAISALGHLLGIAFTVPRVI
                     QELGKDGISPFPSIIMQNRPFRTPIVALFVHLAVTIIFICAPPAGEAFNFVVKLSSYP
                     STVLLTATTIGLVKLRLDKGKGFCPPFSVPWPVIGFYLAGSLFLIVMPFVPPSANKAD
                     GQIPYWLSPVVSLAILALGIVYYELIFVLLPWVLRYQLYPVAVELSDGSRVTRYRKGF
                     "
     gene            <970441..>971695
                     /locus_tag="ACHE_40336S"
                     /db_xref="GeneID:66982131"
     mRNA            join(<970441..970605,970666..971157,971213..>971695)
                     /locus_tag="ACHE_40336S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278524.1"
                     /db_xref="GeneID:66982131"
     CDS             join(970441..970605,970666..971157,971213..971695)
                     /locus_tag="ACHE_40336S"
                     /note="COG:S;
                     EggNog:ENOG410PJGE;
                     InterPro:IPR018712;
                     PFAM:PF09994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136294.1"
                     /db_xref="GeneID:66982131"
                     /translation="MQLILSFDESENDSNIIKIHHMLHRHDSSQAHYYSPGTYGTDTA
                     ALKEYVMGGYRFLMKQCKTEDEIFIFGSARGAYAALYLAEMIERVGLLSGNEEELAPI
                     VWEVYQDWKRNQFPKTKRQERKRQGLLETIKGFRETVCRPAGRVKFFGLFDMIGCTRK
                     RALTQALWHCSIPSTAQYIRHAVSIDEGRAELSPTLIQSMGENQGMSDIQEVWFPGSH
                     GDIVGGLALEPGELFSLSRVPLIWIIHEAQKASLRLDQSKLIEYGFAEQESQFCHSLY
                     LAIATGRVHNSLPSLDPSRMFFKVKHMVRQNLPSHSSPPESSASQGRRRNIRPKAAVH
                     TSALCRMRLNKQYRPSNLVLGNNVGEWVILRKQGDPVEECYARKI"
     gene            <973475..>974740
                     /locus_tag="ACHE_40337S"
                     /db_xref="GeneID:66982132"
     mRNA            join(<973475..973575,973625..973907,973958..>974740)
                     /locus_tag="ACHE_40337S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278525.1"
                     /db_xref="GeneID:66982132"
     CDS             join(973475..973575,973625..973907,973958..974740)
                     /locus_tag="ACHE_40337S"
                     /note="COG:S;
                     EggNog:ENOG410PPKK;
                     InterPro:IPR036291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136295.1"
                     /db_xref="GeneID:66982132"
                     /translation="MVLQSGKVAFVTGANGISGHAIIEQLVKKDKTEWSKIIVTSRRP
                     LPVTWTDHRVEFVAIDFLHPVEKIVGILNKFCTEVTHAFFTSYVHTDDFKVLKEKNIP
                     LFRNFMDAVDTACPMLQRVSLQTGGKYYGVHLGPIRIPLEEWFPRYDDQGYNFYYDQE
                     DYIREVQKRRNTWSHNIIRPNAINGFAPHANGMSEALTLAIYFLICRELNQPARFPGN
                     EYFWNSIDDNSYAPSLADLTIYAATQEHCKDEVFNHCNGDVFVWKYLWKDAARYFGLE
                     APEPMFEKAAGQADTLANEIDMVEWAKDKRPVWEAVVKKYGGKPEAFDYGTWGFFNWA
                     TGKSWCTISSVTKARKYGWQRTDNTFETWIETFRSYENAGLLPTRASLLMNEIS"
     gene            <975262..>976100
                     /locus_tag="ACHE_40338S"
                     /db_xref="GeneID:66982133"
     mRNA            join(<975262..975768,975822..>976100)
                     /locus_tag="ACHE_40338S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278526.1"
                     /db_xref="GeneID:66982133"
     CDS             join(975262..975768,975822..976100)
                     /locus_tag="ACHE_40338S"
                     /note="COG:S;
                     EggNog:ENOG410PWPY;
                     InterPro:IPR029063,IPR008854;
                     PFAM:PF08241,PF05724;
                     go_function: GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136296.1"
                     /db_xref="GeneID:66982133"
                     /translation="MTATTTTATTTSVVPQFLAQYRKDAYVKGWADLWDRGGDYVDWD
                     KGCPNPALEDTLLQQRSILGGPLTLDEQGRRHRKKALVPGCGSGLDVLLLASFGYDAY
                     GLEYSHSAVQTCKAQETRSRARGEYSVRDEEVGGGSVTFMQGDFFDDEWLEGIGLGRG
                     GYDVIYDHSFFCALDPSLRPQWGQRKAQLLAPTGRLICLEFPRHQDPSEMGPPYTALS
                     EDYIEHLSRPGLKRVAYWRPERTHANGFDAQGVIQDRVSIWCW"
     gene            <976423..>977928
                     /locus_tag="ACHE_40339S"
                     /db_xref="GeneID:66982134"
     mRNA            <976423..>977928
                     /locus_tag="ACHE_40339S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278527.1"
                     /db_xref="GeneID:66982134"
     CDS             976423..977928
                     /locus_tag="ACHE_40339S"
                     /note="COG:F;
                     EggNog:ENOG410PKMN;
                     InterPro:IPR006680,IPR011059,IPR032466;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016810 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136297.1"
                     /db_xref="GeneID:66982134"
                     /translation="MTKVLKDGTVLTFDDTAQSIHVLEKASILIENDRITAISEDPDF
                     PVPQDAEVINVHGKLVTPGFVNTHIHTWQTVYRTIGPNVFLSQYFEWLGHISPATAAF
                     TPDDVYISSLEGYLEGLHGGVTSYVEHAHNNWSADVVEPGFNAAVDSGARVWWCYDVA
                     DREGFKIKQQWEALGRIGDKVTEGSPVQLGLSVDGLSGLFGNDPDGHLGYMRDMVRKL
                     DVQAITMHHLGGPWPGKSILNRKTRNDRLIATARKTAPSDINLSTLHTTNLPIIYSHA
                     PFLADSDQKALRENNHFISITPESEFHFGHGQATGHLITDQASLGLDTNWTFSGDMLS
                     QTRLWLQNVRITKSHRTLETGKLPRTNPFTVEEAFLMATRQGGRALRRDDIGVIKVGA
                     KADLVVFNGDSPNMLGWSDPIAAVVLHANPGDIEHVLVDGEFRKRDFKLVDKVLAWGK
                     VRERFLEASRRIKEQIKEPPPMPERLWGVGEFGDVEMVSTRCFGCGPRGTQ"
     gene            <980097..>981174
                     /locus_tag="ACHE_40340S"
                     /db_xref="GeneID:66982135"
     mRNA            join(<980097..980141,980196..980871,980921..981093,
                     981154..>981174)
                     /locus_tag="ACHE_40340S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278528.1"
                     /db_xref="GeneID:66982135"
     CDS             join(980097..980141,980196..980871,980921..981093,
                     981154..981174)
                     /locus_tag="ACHE_40340S"
                     /note="COG:S;
                     EggNog:ENOG410PWIX;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF13460,PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136298.1"
                     /db_xref="GeneID:66982135"
                     /translation="MAPRTVVVIGATGLQGGSVVSELLQHPGTYKVRALTREPTKPAA
                     QSLAARGAEVRRADLDVGADDLETAFSGAHAIYALTDFWQKQSASAEIAQGKSIADAA
                     ARIPTLEHFVWSALPDPEKLSGGRFLNVNHWKSKSLVTEYIQHEKPELWAKTTTILFP
                     NYFENCITTPERYLPVPDANGIYTLSFLHSPDTVMPNVAIADTGKLVRIILEAGSEYF
                     TKTIAFYSQALSEAEKLNALCERYNIPTQYRKISADEFQRILESRDGMSAEMALDFTE
                     QLLIFEEFGNIYAREEFVQAKEVNISRA"
     gene            <981640..>983330
                     /locus_tag="ACHE_40341S"
                     /db_xref="GeneID:66982136"
     mRNA            join(<981640..981694,981745..982241,982301..983031,
                     983081..>983330)
                     /locus_tag="ACHE_40341S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278529.1"
                     /db_xref="GeneID:66982136"
     CDS             join(981640..981694,981745..982241,982301..983031,
                     983081..983330)
                     /locus_tag="ACHE_40341S"
                     /note="COG:S;
                     EggNog:ENOG410PV8I;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:1 (o427-446i);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136299.1"
                     /db_xref="GeneID:66982136"
                     /translation="MGARSQGRGRGSQSHADDHVSPIRAGGTSPFNGIDQFSDAGRRW
                     IESRTGENVNLETLCALELPWANTHRLYTESSSPELPNRLVVEKYVEMYCSSLHIPVF
                     PVISKSLFIITLDLAYGLPEAIGSASARSCVYAFLSVVTQFGFDDNMHGAMDCGSYAS
                     AAQSYMAQITQEMTLDGLQSLIMLVQFQYFLGDLQAATVSVSIATRLLYAFGAHTQYG
                     NSQSYDKSIPEFHLRDLFWLCYSFDKDICLRTGQPPSIQDTCCDLTLPTGYAQIQDSN
                     ILRDTLSIDDHTLPLYPFDLRLSQIKSEAYQALYSASARRKTDTEILSSILELDEALE
                     QWRLSLHPDFRPTLWFSPEMPVSAMNTQTTMLRLAYYHCVNIIHQASERCRFSQEHGP
                     GHDGIRSSISLTINASRSTLSYLQTALPVVKGECFWVVLFYAITAILTLFRSILHNPL
                     DPEINHQMNILGEVPDLIRKIPIRRLTLGEVIHLRFLDGFTTELLRLCACAITKARRD
                     EI"
     gene            <983550..>984293
                     /locus_tag="ACHE_40342S"
                     /db_xref="GeneID:66982137"
     mRNA            join(<983550..983600,983652..983991,984052..>984293)
                     /locus_tag="ACHE_40342S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278530.1"
                     /db_xref="GeneID:66982137"
     CDS             join(983550..983600,983652..983991,984052..984293)
                     /locus_tag="ACHE_40342S"
                     /note="COG:L;
                     EggNog:ENOG410PJH1;
                     InterPro:IPR020084,IPR020476,IPR000086,IPR015797;
                     PFAM:PF00293;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136300.1"
                     /db_xref="GeneID:66982137"
                     /translation="MPNLKYSMPKVLSRSPLNAEEAQWKRLIKTTYLDPNGVERSWES
                     GEYQKRPAGVKSVVGVSVVTILPKSTGPELLLLKQYRPSIDKIAIELPGGMIDAGESP
                     EQAAVRELKEETGYVGVVAESKRNLLFNSPAFCNNNFQYVYVDVDLSLQENQQPQAQL
                     EEDEFIECFAVPMASLFSELKKLESEGYAVETRIVAIAEGLEIARRWSCS"
     gene            <987508..>988200
                     /locus_tag="ACHE_40343S"
                     /db_xref="GeneID:66982138"
     mRNA            <987508..>988200
                     /locus_tag="ACHE_40343S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278532.1"
                     /db_xref="GeneID:66982138"
     CDS             987508..988200
                     /locus_tag="ACHE_40343S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136301.1"
                     /db_xref="GeneID:66982138"
                     /translation="MLQSKAGQDEDLGLLPPDWEQMITLKDRPHNLDRNDKATTTCMN
                     HRAVMSIASGLRACFLEATDRNFNTKTESVVCVEASKAEPEKNSQWKLNVCEHNPTNE
                     SEHTESCDEKENEVDDEKEVEKRNDGKEEGGEDKENEESGESEEHGDEISKHDIKAFI
                     YLTKASLQRRRLFITKGGWTGLSSEDTRQGDVVTILVGGDMPFIVRGDDQEMSDVSKG
                     KQRDGTRVALNS"
     gene            complement(<998690..>1001254)
                     /locus_tag="ACHE_40344A"
                     /db_xref="GeneID:66982139"
     mRNA            complement(join(<998690..998995,999503..>1001254))
                     /locus_tag="ACHE_40344A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278533.1"
                     /db_xref="GeneID:66982139"
     CDS             complement(join(998690..998995,999503..1001254))
                     /locus_tag="ACHE_40344A"
                     /note="COG:Z;
                     EggNog:ENOG410Q1N0;
                     InterPro:IPR000845,IPR011990,IPR035994,IPR027417,
                     IPR002182;
                     PFAM:PF13374,PF01048,PF00931,PF13424,PF13176;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0043531 - ADP binding [Evidence IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136302.1"
                     /db_xref="GeneID:66982139"
                     /translation="MSPFTHSDYTIAWICALPLEMAAARVMLDKKHNSLPQPSTDPNA
                     YELGELNGYYIVIACLPTGIYGTVSAATVVSHMTSTFPQIQFGLMVGIGGGAPSRSND
                     IRLGDVVISKPVGRYSGVIQYDYGKTVQGGQFEPAGTLNKPPQVLLTHMARLEAIQMT
                     SQKNDISTVVWKVLEQNPDMKDGFSPPRQDTDYLFHSSYHHADKKSNCQGCDKEQLVN
                     RRPRDTRTPHTHYGLIASGDKVIKDSKTRDRLAEQHGILCFEMEAAGLMDALPTLVIR
                     GICDYCDSHKQKEWQGYAALTAAAYTKLLLSVVAVSCTDRILRKRDRVRHWMVPLARN
                     PRFVGRQHEINELKEMIMMQDGPSKVAITGLGGVGKTQVVLELAYRLRDWDKDCSIFW
                     LPCTSHAIVEQTYLNIAQTLGLHDVKPAEVKEQIKTYLSSKSAGKWLLIFDNADDVDM
                     WLPAHGAGPALEDFLPQSEQGRIVLTTRNRKLAVELTSSNIITIPDEDGEVASSILQQ
                     SLIKKDLLKDHVTAEALLKQLTFLPLAITQASAYINKNGLSLSTYLGLLQEQELEVVD
                     LLSEDFKDAGRYKDVQNPEKNGPKHPSTLTSMANLASTYWNQGRWNEAEKLNVQVMEI
                     RKTMLGPEHPDTLVSMNNLAYTWESQGKLHDALALMEKCLQVVQQSTRAQSPSYQILL
                     SCS"
     gene            complement(<1004797..>1006020)
                     /locus_tag="ACHE_40345A"
                     /db_xref="GeneID:66982140"
     mRNA            complement(<1004797..>1006020)
                     /locus_tag="ACHE_40345A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278534.1"
                     /db_xref="GeneID:66982140"
     CDS             complement(1004797..1006020)
                     /locus_tag="ACHE_40345A"
                     /note="COG:H;
                     EggNog:ENOG410PGQ2;
                     InterPro:IPR029063,IPR013216;
                     PFAM:PF01209,PF13649,PF13489,PF08241,PF08242,
                     PF07021,PF13847;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136303.1"
                     /db_xref="GeneID:66982140"
                     /translation="MATALASPDSGRSSDSSSLDGAATEKQKLALNGITATTKTKTKS
                     KKSRKSKKDAQGNDLSELNDTAAAPKRWKSFWTAFRYLANLNQKEVDDFMASYVIYNL
                     DWSNEQQMVETLGPNYQEKVGDCLKSYYGVLNHLCALGDVEKMYIPPFMSRKATVLEN
                     QLLYEVSIARDLELKPGDRVLDLGCGRGRVAAHMSAVSGAHITGLNIDPNQIAQARDF
                     NAKQGFTENKFVEQDFNALPLPFADSSFDAFYQIQAFSLCKDLRKLCAEIFRVLKPGA
                     RFSMLDWVSFDAYDPQNPEHDALMRRVKPLIGAVGTPTPKLLEDALTDAGFSVVKSDN
                     ASLDGLQAPLIETVDTYFRTMRGVILALVKVRVLPPHFKTLINRLCLDGEAFVEMDYK
                     RLITTSYRIIAQKPR"
     gene            complement(<1007328..>1008233)
                     /locus_tag="ACHE_40346A"
                     /db_xref="GeneID:66982141"
     mRNA            complement(<1007328..>1008233)
                     /locus_tag="ACHE_40346A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278535.1"
                     /db_xref="GeneID:66982141"
     CDS             complement(1007328..1008233)
                     /locus_tag="ACHE_40346A"
                     /note="COG:U;
                     EggNog:ENOG410Q19X;
                     SECRETED:SignalP(1-18);
                     TransMembrane:1 (n3-14c18/19o181-203i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136304.1"
                     /db_xref="GeneID:66982141"
                     /translation="MKLSILLTLQTLCLLACADQPAQTPAQALPARSLSLIIPDPTPP
                     PSSAPTWTTLIKQKRADSTEDSGDSTDDSNTATETTDAATTAETSAETTAESTSETSS
                     ETSSETTSSETTSSETTSSETSTTSSETTSSTSSTSSSSSSSSTSSTSTTSTSSSTTS
                     TSTATSTASAETAERNRVGNIAAIAVFSSLGGIIAIVFIALALRKRIMRRRREEKKAL
                     LQAGSSAYSMVPVSDEAAASNGEVKFDRLSMMFAANDPKPQDAAGAGAGVQVNATPLL
                     TPQQAAQQGYPQAYPQYPQGYPHQI"
     gene            <1009131..>1009718
                     /locus_tag="ACHE_40348S"
                     /db_xref="GeneID:66982143"
     mRNA            <1009131..>1009718
                     /locus_tag="ACHE_40348S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278536.1"
                     /db_xref="GeneID:66982143"
     CDS             1009131..1009718
                     /locus_tag="ACHE_40348S"
                     /note="COG:S;
                     EggNog:ENOG410PZ49;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136305.1"
                     /db_xref="GeneID:66982143"
                     /translation="MKSSLTLLALATTALSQTTTLKVFDAGESALPLTDIAASVVEVN
                     ALETILALNCAPNATASICPLETPFTLTYGPSTASLNAVYATKTSGVQAKMSLVEGCD
                     ITSSTQGASCSMSMVMGMSVRGVSTSTTTTTTTSFGEEDITYRDLAVTAGVSKLTAPE
                     ATQTPEGGAAPGAVVNGKGIGGLAAAAVAAAAMFV"
     gene            complement(<1010219..>1011796)
                     /locus_tag="ACHE_40347A"
                     /db_xref="GeneID:66982142"
     mRNA            complement(join(<1010219..1011693,1011748..>1011796))
                     /locus_tag="ACHE_40347A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278537.1"
                     /db_xref="GeneID:66982142"
     CDS             complement(join(1010219..1011693,1011748..1011796))
                     /locus_tag="ACHE_40347A"
                     /note="COG:E;
                     EggNog:ENOG410PFTU;
                     InterPro:IPR021115,IPR002129,IPR010977,IPR015424,
                     IPR015421,IPR015422;
                     PFAM:PF00282;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016831 - carboxy-lyase activity [Evidence
                     IEA];
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0006520 - cellular amino acid metabolic
                     process [Evidence IEA];
                     go_process: GO:0019752 - carboxylic acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136306.1"
                     /db_xref="GeneID:66982142"
                     /translation="MDPDQFRTAAHAAIDDIINYFETLPSQRVVPTIEPGYLRPQIPS
                     NPPTDPESWPEIQADIDTKIKPGLTHWQSPNFMAFYPANVTYPSILGEMYSAAFNAPA
                     FNWLCSPACTELETIVMDWVAKALSLPGCFLSDSENRGGGVIQVSASDSIATVMVAAR
                     ERRVRDLMLAEGLKEGTQESEERMMDLRPRLVALGSDQAHSSTAKGAIIAGTRYRSVK
                     ARLEDNMEMTGEGLRSVLEQCERDNLTPYYITLTMGTTNTCALDRFAEIKAVLSEKPA
                     WQRIWVHIDAAYAGSALIAEEWQHIAQDFAEGVDSFNFNMHKWLLVNFDASCLFVRNR
                     QDLIDALDITPAYLRNTYSETGQVIDYRNWSISLGRRFRALKIWFVMRSYGLTGMKAH
                     VRKAITLGKTFEDLIRSRADLFETITRPAFGLTVFRIKAPGAQANAFVVQPDEASNTL
                     TKKVYELINARGEIFITASVVAGVQAIRIVSANEAAQESYIQRAFDIIVKTTEELIQ"
     gene            <1012383..>1013434
                     /locus_tag="ACHE_40349S"
                     /db_xref="GeneID:66982144"
     mRNA            join(<1012383..1012917,1012971..>1013434)
                     /locus_tag="ACHE_40349S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278538.1"
                     /db_xref="GeneID:66982144"
     CDS             join(1012383..1012917,1012971..1013434)
                     /locus_tag="ACHE_40349S"
                     /note="COG:S;
                     EggNog:ENOG410PRK9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136307.1"
                     /db_xref="GeneID:66982144"
                     /translation="MPTHNICPDGDTTLTLTTTNPPTKLLVSSHHLIHASPYYRALLT
                     GPFREASILRANGTVNITLTDDNTAAMIAVMNAVHGRFFSVPGRKIKLELLKDIAVVV
                     DKYELFESVSTMLHTWASTVRVGNPRASLMDVAKWLLCVTWAFNMSDAFRFATKELVL
                     DTGMNVEVEGTCVPLNVGARITRRRAALLQTVRSRIQRFRDAEYRHSAVCTVYCDDLV
                     HEKLDEILGLLSKGPRSGVKPRIIRKMVHDLYEHRMDGHQVIENCANRYVYVPPLCIR
                     LLEDLDMDIGREFDRVTGMILGRYKGDAKRRVDWMGGDVGLDAKALWPYGQHPEAS"
     gene            complement(<1013494..>1014063)
                     /locus_tag="ACHE_40350A"
                     /db_xref="GeneID:66982145"
     mRNA            complement(<1013494..>1014063)
                     /locus_tag="ACHE_40350A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278539.1"
                     /db_xref="GeneID:66982145"
     CDS             complement(1013494..1014063)
                     /locus_tag="ACHE_40350A"
                     /note="COG:S;
                     EggNog:ENOG410Q1QP;
                     InterPro:IPR014710,IPR011051,IPR013096;
                     PFAM:PF07883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136308.1"
                     /db_xref="GeneID:66982145"
                     /translation="MSGMQRPNHLPYIRRYITTHSKDGEAIFLSLTQVPDYIPSKPAG
                     EDGEIALLYTTSTTPVDLTDEGDVADYDDFLHTPPGLTTSQGTVMRTIDLRPGKISPM
                     HRTVSLDYGVVLEGEVELILDSGQSRVLRRGDISVQRGTAHSYKNRSDTEWCRMLFVF
                     LPIKQLTIKGKELGMEVYDEQYEGNGQNK"
     gene            complement(<1014240..>1015850)
                     /locus_tag="ACHE_40351A"
                     /db_xref="GeneID:66982146"
     mRNA            complement(join(<1014240..1015287,1015336..>1015850))
                     /locus_tag="ACHE_40351A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278540.1"
                     /db_xref="GeneID:66982146"
     CDS             complement(join(1014240..1015287,1015336..1015850))
                     /locus_tag="ACHE_40351A"
                     /note="COG:S;
                     EggNog:ENOG410PSA8;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:2 (i45-65o360-381i);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136309.1"
                     /db_xref="GeneID:66982146"
                     /translation="METMALFQYYNNYLDYLYHIILPDRVEGQINAIYQAIENQEPLN
                     LGHLALLFSIIASSLFLQLSIESSVHAEACSREYTFLTGAALIQSNYSAYPTIEGLQA
                     TLIVAHNLSNTNCHPSVRVLFVHGAIVSQAKSLMLHCIDSPQFERKANGTDMIEIELK
                     RRLWWDLASYDWLLGFLSGPQESTYLIHPEHMNVQKLANIDDIIPDSKEKDYSLPTST
                     PTKMSYSLERLKLAEVCREIVDATAYEHLRGREVSYDKVLELDRKLQQAYDFPAFFRL
                     DAVSRQQYGPLYQDRPSIAWQRCLLHQAYHSRLCRLHRQYLVRGARNPTYSYSHVVCL
                     QSARKVLEMKRIMDEDGPTFMPPSSVVWSVMHHVFMAAVILLMDVCFNWDDILAEKRK
                     EEVLDACRMLSKAQQSSSTVREGINAMMEVLQKHWKVSNGKQSAVASSPVINPMELGN
                     PARDSTPTAEPETANLKQSPADLPSNAIDDTGDTLEDIWTEMLDNSENLSSDTPDWTG
                     LLAELTTATVPY"
     gene            complement(<1015875..>1016369)
                     /locus_tag="ACHE_40352A"
                     /db_xref="GeneID:66982147"
     mRNA            complement(<1015875..>1016369)
                     /locus_tag="ACHE_40352A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278541.1"
                     /db_xref="GeneID:66982147"
     CDS             complement(1015875..1016369)
                     /locus_tag="ACHE_40352A"
                     /note="COG:S;
                     EggNog:ENOG410Q0KT;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136310.1"
                     /db_xref="GeneID:66982147"
                     /translation="MKRKASEQEETPPKRAPRQDPVSCELCRRKKLKCNRQQPCSSCA
                     TRRLPCSYGPSVPSSNTSQTQPAGSTVSTKTVQNESRVPDPNAAFARPDGQISRDRNE
                     SVMTADWLEKIVLGDRVQTGMRVTQRGLNEPSKVDVMSPGQRVAGNSLSTYWTASSEN
                     PATV"
     gene            <1017285..>1018356
                     /locus_tag="ACHE_40353S"
                     /db_xref="GeneID:66982148"
     mRNA            join(<1017285..1018004,1018055..1018152,1018203..>1018356)
                     /locus_tag="ACHE_40353S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278543.1"
                     /db_xref="GeneID:66982148"
     CDS             join(1017285..1018004,1018055..1018152,1018203..1018356)
                     /locus_tag="ACHE_40353S"
                     /note="COG:G;
                     EggNog:ENOG410PJ44;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:9
                     (o12-33i45-65o77-99i141-161o173-191i203-222o228-246i258-
                     278o290-314i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136311.1"
                     /db_xref="GeneID:66982148"
                     /translation="MMMASLCKELWQFILAQGILLGVSMALLVTPMLALVGQHVKVKR
                     AAAMGIVIAGSSLGGVIWPIVIRELLQKPNLGFPWTMRISGFIMLPLLLISCICCRPA
                     PTPQPTQPTNEDQPASASKEPKTPLKTDFSILKQPKMQLTCLSFFIIYFGMFSPFFYT
                     TSYGIKMGFSDDLSFYTVSIVNGASLFGRILPGIVADKYGKFNCCIVATGLAGIIALC
                     WTKATSVAGLVVWSAAYGFASGGILSLQQACAAQVATSQTLGLAIGAVMGSTSLSAMA
                     GIPISGQLAGKYGYLALSIYSGVSLLVGAILLVIARLVQNRSLSAIV"
     gene            complement(<1018555..>1018780)
                     /locus_tag="ACHE_40354A"
                     /db_xref="GeneID:66982149"
     mRNA            complement(join(<1018555..1018691,1018750..>1018780))
                     /locus_tag="ACHE_40354A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278544.1"
                     /db_xref="GeneID:66982149"
     CDS             complement(join(1018555..1018691,1018750..1018780))
                     /locus_tag="ACHE_40354A"
                     /note="COG:S;
                     EggNog:ENOG410PTBF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136312.1"
                     /db_xref="GeneID:66982149"
                     /translation="MCKKATCSNCNKTTWWGCGNHIPSVMDAVSQDEWCTCTPQVERE
                     GKAYPPKAENP"
     gene            complement(<1019743..>1020087)
                     /locus_tag="ACHE_40355A"
                     /db_xref="GeneID:66982150"
     mRNA            complement(<1019743..>1020087)
                     /locus_tag="ACHE_40355A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278545.1"
                     /db_xref="GeneID:66982150"
     CDS             complement(1019743..1020087)
                     /locus_tag="ACHE_40355A"
                     /note="SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136313.1"
                     /db_xref="GeneID:66982150"
                     /translation="MKLLSLSIFVTMVTSAALPVLNIAIDGKPSAPASAPVPSNPSIL
                     TQSLTTEAALPDSLPGAFHENEHERMNRTSFGPIPPPEKRDTQDTNKDVNCHNDEQCS
                     PGVCHDGICFLE"
     gene            1020908..1020987
                     /locus_tag="ACHE_t40004S"
                     /db_xref="GeneID:66987395"
     tRNA            1020908..1020987
                     /locus_tag="ACHE_t40004S"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:66987395"
     gene            <1021431..>1022905
                     /locus_tag="ACHE_40356S"
                     /db_xref="GeneID:66982151"
     mRNA            join(<1021431..1021658,1021707..1021721,1021769..>1022905)
                     /locus_tag="ACHE_40356S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278546.1"
                     /db_xref="GeneID:66982151"
     CDS             join(1021431..1021658,1021707..1021721,1021769..1022905)
                     /locus_tag="ACHE_40356S"
                     /note="COG:D,K,T;
                     EggNog:ENOG410PICG;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:11
                     (o90-110i122-138o144-165i177-199o211-231i263-281o301-
                     323i335-352o358-380i392-412o424-443i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136314.1"
                     /db_xref="GeneID:66982151"
                     /translation="MMAPDNHTAEQIEPLLPSDAGRADYGIATDRQIDQETQEEPEHQ
                     AERWNEPRINAWRVLATYYSFIVVGANDGSYGALIPYLQKYYNADYAAVSVVFLSSFI
                     GYATAALINHSIHVRFGQHGVAILGCGMHIIAYLAVTRHPPYPILIAIFILAGLGNGV
                     IDASWNAWIGAMADSSMVMGLLHAFYGLGAALAPLIATTLFTKSGWQWYEFYYIMALA
                     GAVEFVTSVVAFWNARGAAAHAVETAPTDDEQIQSQQQKSPTVQALALPSTWIISAYL
                     FVYVGSEVTVGGWLFTFLVDLRHTAPFAAGIANFAYWAGITGGRVVLGFLTPYLKKQK
                     TAVTLYLIGCVAAQLIFYTVDNFVASAVAVTCLGFFLGPLFPEAVIAQTRILPKHLHV
                     AAVGFACALGSAGGCTFPFITGAIAKSQGIGVLQPMVLVMLCLCLGLWLSLPTKPPAA
                     RRAANGAAV"
     gene            <1030720..>1031166
                     /locus_tag="ACHE_40357S"
                     /db_xref="GeneID:66982152"
     mRNA            join(<1030720..1030731,1030801..1030862,1030919..1031005,
                     1031061..>1031166)
                     /locus_tag="ACHE_40357S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278547.1"
                     /db_xref="GeneID:66982152"
     CDS             join(1030720..1030731,1030801..1030862,1030919..1031005,
                     1031061..1031166)
                     /locus_tag="ACHE_40357S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136315.1"
                     /db_xref="GeneID:66982152"
                     /translation="MTKYRLTIRYAPGADSKYAAGIENIARTKFGAKGVLRFQRFAFN
                     SGYPPFHITLFEASDSVSLEELQSVQLAEGVITQVQRVDRPAER"
     gene            <1034604..>1036001
                     /locus_tag="ACHE_40358S"
                     /db_xref="GeneID:66982153"
     mRNA            <1034604..>1036001
                     /locus_tag="ACHE_40358S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278548.1"
                     /db_xref="GeneID:66982153"
     CDS             1034604..1036001
                     /locus_tag="ACHE_40358S"
                     /note="COG:C;
                     EggNog:ENOG410PVA8;
                     InterPro:IPR015590,IPR044148,IPR016160,IPR016161,
                     IPR016162,IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0004030 - aldehyde dehydrogenase [NAD(P)+]
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136316.1"
                     /db_xref="GeneID:66982153"
                     /translation="MASSNHYKTINPATGQLVRSFPDSTDLDVSKALSTAQECFEKDW
                     RWRTASSRAEIMTRAAGLIRDRTAQLAEIATKDMGKLYTEACYEVSLSADILEYFAVN
                     AESFLRPTTVQERGSGAVAEVVSEPIGIIVAVEPWNYPYYQLARVAGPQLMAGNVVLA
                     KHAASVPQCALAFAKIFEDAGAPPGAYTNIFGSRSQMNQLVDDFRVRGVTLTGSEAAG
                     AGVAERAGRHLKKVVLELGGSDPFVVLEDANLEAAISRASSGRLVAMGQVCAAPKRFI
                     VVGKERGDLFLEGVKQHFSSLEAGDPMDPKTTIGPVFSESALQTLLEQIHRAVEHGAT
                     LVCGGKRIDRPGFYLEPTILTNISAENPIYKEEMFGPVAMMFSVDTDDAAVELANATR
                     YGLGSSVNSEDPKHARAVADRIDAGMVFINSCTVTLPELPFGGIKNSGFGRELSDLGF
                     SEFLNKKLIRMAPTN"
     gene            <1036977..>1037398
                     /locus_tag="ACHE_40360S"
                     /db_xref="GeneID:66982155"
     mRNA            join(<1036977..1037153,1037207..>1037398)
                     /locus_tag="ACHE_40360S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278549.1"
                     /db_xref="GeneID:66982155"
     CDS             join(1036977..1037153,1037207..1037398)
                     /locus_tag="ACHE_40360S"
                     /note="COG:Q;
                     EggNog:ENOG410PHTQ;
                     InterPro:IPR013149,IPR036291;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136317.1"
                     /db_xref="GeneID:66982155"
                     /translation="MGCSMRRLEGLLFVETSTLPCAGLTTWNALFGLRGLKRLEEVDV
                     VLVQGTGGVSLFAMQFARAAGETVITTTSSEAKAPKLASLDAHHVLNYKTDPSWAKPP
                     NSSYPTKRAYISLLMLADLR"
     gene            complement(<1037771..>1039859)
                     /locus_tag="ACHE_40359A"
                     /db_xref="GeneID:66982154"
     mRNA            complement(join(<1037771..1038879,1038928..1039507,
                     1039554..>1039859))
                     /locus_tag="ACHE_40359A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278550.1"
                     /db_xref="GeneID:66982154"
     CDS             complement(join(1037771..1038879,1038928..1039507,
                     1039554..1039859))
                     /locus_tag="ACHE_40359A"
                     /note="COG:Q;
                     EggNog:ENOG410PF88;
                     InterPro:IPR015798,IPR016182,IPR036460,IPR000269,
                     IPR015802;
                     PFAM:PF01179,PF02728;
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0008131 - primary amine oxidase activity
                     [Evidence IEA];
                     go_function: GO:0048038 - quinone binding [Evidence IEA];
                     go_process: GO:0009308 - amine metabolic process [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136318.1"
                     /db_xref="GeneID:66982154"
                     /translation="MSGLHPFDPITPGEIQLATKLLQAALPGVDLRYKRIDIQEPIKK
                     DVVPYIEAERLGKPLPPKPARFLIALFHRLDTGAFCKALLNASTRAVVSLNEMPKDIQ
                     PPVDVDEMIEIEQLCLNHPAVQAEIAKMQLPSGMRVCNDPWIYGTDDQNESRRLFQCY
                     MYIVATDHPQNNHYAHPCKFSPVFDGLTRQLVRIDYLPSTPDHSSVETQPWRPVPGIQ
                     YAHELLEEPLRNDLKPYIVQQPEGASFSVNGNEVSWQKWKFRVGFNTREGMVIHNLNY
                     DGRSVFYRLSVSEMTVPYGHPRAPFHRKQAFDVGDVGFGITANELTLGCDCLGHIKYF
                     DGFRADSKGTPIQLKNVICLHEQDNGLQHKHTNYRTGAATVVRNRQLVAQMICTVGNY
                     EYIFAFIFDQAANVELEVRATGILSTVPFDNEKPGTTVPWGTNVGPGVMAPFHQHMFS
                     FRIDPALDGNQNTIYYEDSVPMPEDENNPYKVGYTTEQTVFKTSSTAQTSVDRHRVFK
                     IRNDNIINPITYHPIAYKLQTSPAQMMLASKNSFGLKRAVFATKPIWVTRYRDGELFA
                     AGEFTNQSKQSHGVEEMVARKDPVENEDVVLWHTFGLTHNPRIEDFPVMPMEKVSVML
                     KPDGFFTKNPALDVPQSNQLFNKSTLHPEKACCAPGQVKL"
     gene            complement(<1040262..>1041763)
                     /gene="DCW1_1"
                     /locus_tag="ACHE_40361A"
                     /db_xref="GeneID:66982156"
     mRNA            complement(join(<1040262..1040837,1040883..1041586,
                     1041655..>1041763))
                     /gene="DCW1_1"
                     /locus_tag="ACHE_40361A"
                     /product="hydrolase 76 protein"
                     /transcript_id="XM_043278551.1"
                     /db_xref="GeneID:66982156"
     CDS             complement(join(1040262..1040837,1040883..1041586,
                     1041655..1041763))
                     /gene="DCW1_1"
                     /locus_tag="ACHE_40361A"
                     /note="CAZy:GH76;
                     COG:G;
                     EggNog:ENOG410PFRH;
                     InterPro:IPR005198,IPR008928,IPR014480;
                     PFAM:PF03663;
                     SECRETED:SignalP(1-28);
                     TransMembrane:1 (n11-22c28/29o440-461i);
                     go_function: GO:0008496 - mannan
                     endo-1,6-alpha-mannosidase activity [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0016052 - carbohydrate catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hydrolase 76 protein"
                     /protein_id="XP_043136319.1"
                     /db_xref="GeneID:66982156"
                     /translation="MRFISISVNSVWVYLAALWCFIGTQVDAIELDVTDEDSIKNVAS
                     QLAWDLVSFYTGNNTGDVPGNLPDPYYWWEAGAFFGTLINYWTYTGDTTYNDITKQAI
                     LHQAGENGDLMPTNQTRTEGNDDQAFWAFTAMMAAESNFPNPEEDKPSWLAMAQAVFN
                     EQAARWDMETCNGGLKWQIYSFNSGYEYKNAISNGCFFDLAARLARYTGNITYAEWAE
                     NTWDWAEAVGLLGEKYQVYDGTSETNNCSDINHIQWTYNNGVFLHGAAHMWNLTNGAQ
                     KWEKRITGLLNAQHVFFSKNQTSKNVMYESACEPQEACTTDSTSFKAYLGRWMGDIAK
                     IAPFTYDTVVSRLRPSAKAAAAQCLGGDTGTYCGTSWTKGSYDGTMGVGQQMSALEVI
                     QANLLDTVGGPLTDRTGGSSDGDSSAGTGRTSAELPGQWRPLTLKDRAGAWAATGGLG
                     TVVIGYTIFMFF"
     gene            complement(<1042274..>1043427)
                     /locus_tag="ACHE_40362A"
                     /db_xref="GeneID:66982157"
     mRNA            complement(join(<1042274..1042299,1042353..1043029,
                     1043081..>1043427))
                     /locus_tag="ACHE_40362A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278552.1"
                     /db_xref="GeneID:66982157"
     CDS             complement(join(1042274..1042299,1042353..1043029,
                     1043081..1043427))
                     /locus_tag="ACHE_40362A"
                     /note="COG:S;
                     EggNog:ENOG410Q21D;
                     InterPro:IPR017804,IPR019257,IPR017805;
                     PFAM:PF10017;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136320.1"
                     /db_xref="GeneID:66982157"
                     /translation="MFENIISSRIDVKPRAVYEPVSRSTAPNNIIDISSAKTETELRS
                     SLQDSIQAACHGEAAMPDLLLWDKKGLQYFEDVTYTPSYYLTNEEIGILEEQKHQIAQ
                     HIQPGSMIIELGSGNLRKIKILLEALDDLGRDVDYFALDVSLHELQRTLNVVPPGTFR
                     HIRCFGLLGTYNDGRQWLQRAELESRPKVLVSLGSTVGSMQRSETAGFLSGFIGPGES
                     NRSFLLGLDGCKDQERVLAAYNDKHGNNHRFIKNGLERANDILGHEAFDLGKWDVVGS
                     WDHENGSHSQYYYPKTDVWLGGEVVPAGRRILAIKSHKYDANDAHALLEKARLDVVDA
                     WGSRNQYNVLFLKSA"
     gene            <1044124..>1045314
                     /locus_tag="ACHE_40363S"
                     /db_xref="GeneID:66982158"
     mRNA            join(<1044124..1044140,1044190..1044395,1044454..1044768,
                     1044824..>1045314)
                     /locus_tag="ACHE_40363S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278554.1"
                     /db_xref="GeneID:66982158"
     CDS             join(1044124..1044140,1044190..1044395,1044454..1044768,
                     1044824..1045314)
                     /locus_tag="ACHE_40363S"
                     /note="COG:S;
                     EggNog:ENOG410PHFD;
                     InterPro:IPR036291,IPR008030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136321.1"
                     /db_xref="GeneID:66982158"
                     /translation="MKNVFITGVSGYIGGDLLSVLAVQYPDYNYRILARSEKSSELIK
                     AQFPAAEIVLSDLNDLETLRKESARADVIIHTADASDHLPAAQAIVQGALEGHDEGHP
                     VYLLHTSGTGILSFLDTENGVYGERRDKLYDDLEGVQEILGFPDHAFHRDVDKFVLEA
                     GAEHSKVLKAAIVSPSTVYGRGRGPCSQRSRQVYEMSKYTLQNGKIPIIGRGLSTGGN
                     IHVADVTSLFVLLFERAHHGDKDGKLWGGEAYYIGATGEHCWGDVAKLVGKVAVDEGF
                     IPSAEIQSLDVETARRLAGFEAVSWGLNMRSRAKRATEYLGWEASGPSLEDEIPGIVR
                     EEWQRLQE"
     gene            <1045527..>1046729
                     /locus_tag="ACHE_40364S"
                     /db_xref="GeneID:66982159"
     mRNA            join(<1045527..1045627,1045677..1045796,1045843..1045931,
                     1045989..1046108,1046158..>1046729)
                     /locus_tag="ACHE_40364S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278555.1"
                     /db_xref="GeneID:66982159"
     CDS             join(1045527..1045627,1045677..1045796,1045843..1045931,
                     1045989..1046108,1046158..1046729)
                     /locus_tag="ACHE_40364S"
                     /note="COG:K;
                     EggNog:ENOG410PMRV;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136322.1"
                     /db_xref="GeneID:66982159"
                     /translation="MIRPPHMPVTEYHRDQMQLLAMDRSRRSRRTQNACQRCRSRKVK
                     CSGIQPCEHCRRRGQDCVFDEDRKIVISEGLFLSMKRKLEERGDNATIEHKRTRLLDS
                     SEPAESRTETTEARQSEERFVSNPLVSASYLKHNGQTQRAWLCLGPTSTWSFSRRVLS
                     IIQTRVHPDSNTPIPLAVDGDAYQIHWGHASSNEPPDISGLPSIDYALYMLSTVKFHL
                     SPMYRFFDEKEFLCNLYEFYDNAPVKAQESRLWYIQFLMVLAFGEAFLTPVRTAENTE
                     NWTRFFTRAMSLLPDITGLWRDPILAIEVLALIALYFHSVDIRDTAYCYVSVPKPLR"
     gene            <1046763..>1048021
                     /locus_tag="ACHE_40365S"
                     /db_xref="GeneID:66982160"
     mRNA            join(<1046763..1047024,1047070..1047245,1047290..1047473,
                     1047519..>1048021)
                     /locus_tag="ACHE_40365S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278556.1"
                     /db_xref="GeneID:66982160"
     CDS             join(1046763..1047024,1047070..1047245,1047290..1047473,
                     1047519..1048021)
                     /locus_tag="ACHE_40365S"
                     /note="COG:K;
                     EggNog:ENOG410PMRV;
                     InterPro:IPR007219;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136323.1"
                     /db_xref="GeneID:66982160"
                     /translation="MRMALVEGWHRALPVEQLGEKMVERCKNIWWTIYILDSRFSSLI
                     GTPNSVNDEDVTAMLWDLRNCSQEAAALTLHVKISQVVTRVLNTVYSVDGKLGGVFLR
                     KMRSVLHEMTDLSRELENVFAHRFQNSVDAISGVTTRLTLSCHLCIIVTVRPLILSLL
                     WERLSCYENGDSLRPLSAPVRTLVQSCVDSAIKSLRLLTALRNQNLLETFLPFDLESL
                     FSAAWILSMILAILPDTLPDHSYRDTYFSLLDDMIERGNRVAQFRKSEIELLEELAQP
                     LLVPSTPVSHPVDEEPEPLITPRSETVPGFNDLDVQPVIATPSLTATGIPDVNEDDLT
                     LDWRDFGASLNQMLSATDELDANWVDMDRGLGMDLWLWDN"
     gene            <1048753..>1049838
                     /locus_tag="ACHE_40366S"
                     /db_xref="GeneID:66982161"
     mRNA            <1048753..>1049838
                     /locus_tag="ACHE_40366S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278557.1"
                     /db_xref="GeneID:66982161"
     CDS             1048753..1049838
                     /locus_tag="ACHE_40366S"
                     /note="COG:S;
                     EggNog:ENOG410PRRT;
                     InterPro:IPR038903;
                     SECRETED:SignalP(1-20);
                     go_component: GO:0005576 - extracellular region [Evidence
                     IEA];
                     go_function: GO:0019863 - IgE binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136324.1"
                     /db_xref="GeneID:66982161"
                     /translation="MHLKFVFILLLALVAESVFARLQGHHRRHIHGKHLAIKNDNDND
                     NIGSGSIIEPRTLTDVNGNAIGIGPLTATLGILPGATLAPTNDHPHEDHPHDGHSTHG
                     GHHEGHSHGHHPHGGHPHDGHPHGHDNEASPHPIKATAAWDQTPPDGQFTWDGFSGRT
                     QSQGDGVGYKGNVGDPWGSNIILLDSETDAPYYKYVAQLHGPKDANAQPWKVVFWNKI
                     GPDGKISGWYQHSALEFDMLPNEIKYVAFDKDSQGGFGAAPGDHLPTDQWGGWSSTWG
                     EFDFGDVKNHAMSGWDVSCIQAQNAGQEVQGMRMCLSNGDKCSTITRGAKKVENAYPS
                     DKAGVDGLGGVVGAGAVRIVVELDYDE"
     gene            <1050766..>1051956
                     /locus_tag="ACHE_40367S"
                     /db_xref="GeneID:66982162"
     mRNA            join(<1050766..1050790,1050850..1051116,1051182..1051273,
                     1051327..>1051956)
                     /locus_tag="ACHE_40367S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278558.1"
                     /db_xref="GeneID:66982162"
     CDS             join(1050766..1050790,1050850..1051116,1051182..1051273,
                     1051327..1051956)
                     /locus_tag="ACHE_40367S"
                     /note="COG:Q;
                     EggNog:ENOG410PFM9;
                     InterPro:IPR013154,IPR013149,IPR014189,IPR036291,
                     IPR011032,IPR020843;
                     PFAM:PF00107,PF08240,PF13602;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136325.1"
                     /db_xref="GeneID:66982162"
                     /translation="MSSTMRAIGIKNNTGPAENLFVDNIPKPSPSAGEALVKIKAFGL
                     NRMDLLQREGKYPVPPQAPPTLGVEFSGVIEVVAEGTDCDFKAGDEVFGLAYGGAYAE
                     YIVVSPAMLVHKPAELSWEEAAGVPETWMTASQALFLIGDFQPGQSVLWHAGASSVSL
                     SGIQLAKAHGAKAIYATAGSQEKIDFLEKQMGVTAAFNYRTQDWASELRQATDGQGVN
                     LIVDFIGGPYFQDDLNSAARDGRVVFLGLMGGGKVPGTADISAMLYKRVRVEGSTLRS
                     RELDYQRKLRDTLVEHALPKLQDKSFTVYVEKVFRFEEIADAHRLLESNATKGKLICV
                     IDH"
     gene            complement(<1052055..>1052923)
                     /locus_tag="ACHE_40368A"
                     /db_xref="GeneID:66982163"
     mRNA            complement(join(<1052055..1052323,1052382..1052519,
                     1052575..>1052923))
                     /locus_tag="ACHE_40368A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278559.1"
                     /db_xref="GeneID:66982163"
     CDS             complement(join(1052055..1052323,1052382..1052519,
                     1052575..1052923))
                     /locus_tag="ACHE_40368A"
                     /note="COG:S;
                     EggNog:ENOG410PWYC;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136326.1"
                     /db_xref="GeneID:66982163"
                     /translation="MHFSTTLLPLALALRASAMYDDWYFGNMFALGPTSDNIHITKAT
                     YSLVPPAVPCGSQQNTSDEAPWLALWVGLSASMSDQKADLFQPLLNWSPDQKSQACPA
                     SNQEWCVATSTYHSSGQVQEPYVPVPNDSELEFTITVDEASNKIIQQISVNGKEISHQ
                     ADDKTINPTYIYSSNECYLDACGTLAAYSWQNMTIHLSDADLNFQNTIALDGARDSGI
                     TTPDNGKTWHINSMRIDRDYFYPDQKDHECGSD"
     gene            complement(<1053459..>1054004)
                     /locus_tag="ACHE_40369A"
                     /db_xref="GeneID:66982164"
     mRNA            complement(<1053459..>1054004)
                     /locus_tag="ACHE_40369A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278560.1"
                     /db_xref="GeneID:66982164"
     CDS             complement(1053459..1054004)
                     /locus_tag="ACHE_40369A"
                     /note="COG:S;
                     EggNog:ENOG410Q1V1;
                     SECRETED:SignalP(1-16)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136327.1"
                     /db_xref="GeneID:66982164"
                     /translation="MKLSLAFLATLSVAMAASIPATCEDIPNSLGDKPQTLHNYFNQE
                     VCQKSKCDTTINDSTSFLEKTVVPQLVQQLSQSLGISTGNQDQIEKVAKEVSQAIQQS
                     CSQQYGDKKVCNDDDSVLQFGQCALKAAEPVISKQSQGDDDVPSEEECQKLKTALTDD
                     QLWSKTLPGYVDQFAKQCKKN"
     gene            complement(<1057075..>1057937)
                     /locus_tag="ACHE_40370A"
                     /db_xref="GeneID:66982165"
     mRNA            complement(join(<1057075..1057757,1057820..1057838,
                     1057896..>1057937))
                     /locus_tag="ACHE_40370A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278561.1"
                     /db_xref="GeneID:66982165"
     CDS             complement(join(1057075..1057757,1057820..1057838,
                     1057896..1057937))
                     /locus_tag="ACHE_40370A"
                     /note="COG:S;
                     EggNog:ENOG410PPAI;
                     InterPro:IPR005645,IPR029058;
                     PFAM:PF03959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136328.1"
                     /db_xref="GeneID:66982165"
                     /translation="MRFLCLPGAFNNAKTFEAQLKPLCDILESNGSATFRFAEGNVLV
                     EIPQEFAGFFGPPPNYAFFNVNNREAINKHLRHFPRGETPESTLRSITKHSVSSFESV
                     RSALDYLIQLLDKEGDIDGVIGYSEGARVAASLILDERQRQKDSGRTPHIKCAIFIGG
                     WQPVHPVSGGDVYADETEERIEIHTCHVLGSNDPYIDASLALYNLCDQDRADLFDHGA
                     GHVLPREKAALEDLADVVRNMITDADEGG"
     gene            <1058859..>1059635
                     /locus_tag="ACHE_40371S"
                     /db_xref="GeneID:66982166"
     mRNA            join(<1058859..1059062,1059330..>1059635)
                     /locus_tag="ACHE_40371S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278562.1"
                     /db_xref="GeneID:66982166"
     CDS             join(1058859..1059062,1059330..1059635)
                     /locus_tag="ACHE_40371S"
                     /note="COG:C;
                     EggNog:ENOG410PGHW;
                     InterPro:IPR004113,IPR036770;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136329.1"
                     /db_xref="GeneID:66982166"
                     /translation="MKLLYDTKQVNIDSKDFCSLTPLSHAAVSGQERAVKFLLDTKKV
                     DIDVTDLNNEAPLSLVEENGHELVQTICGIQPQWALHWFRGTLGFVIEATLKLAHITE
                     ETGVAVATFPTMREAAKAAIQVIHQGIAIGAIELLDDVQMDVTNKIGGTGREWNVLPC
                     CSSNSVGPS"
     gene            <1061569..>1063014
                     /locus_tag="ACHE_40372S"
                     /db_xref="GeneID:66982167"
     mRNA            join(<1061569..1061626,1061675..>1063014)
                     /locus_tag="ACHE_40372S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278563.1"
                     /db_xref="GeneID:66982167"
     CDS             join(1061569..1061626,1061675..1063014)
                     /locus_tag="ACHE_40372S"
                     /note="COG:S;
                     EggNog:ENOG410PJZV;
                     TransMembrane:1 (o434-460i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136330.1"
                     /db_xref="GeneID:66982167"
                     /translation="MTSEFRRSFKLKAKRQFKPHSKQHHFGSKSKISIAHLTASGIWS
                     KHNRALSWYNSWLALQFVNLPSDLFGIFPPPKENCDEENESEDYWQPFVSTFLRIEDL
                     ITSSDSITIDQIIALLKDEGLLRADGTEGDNDERNYHYARYFVFCVLGWQTMLFTPTP
                     KGSSNGILGAETPQLAIDETDGCCGYTHMSLQQDRRGCSNEPLSEFLMGFGVLLPSKS
                     LCLDEDPNIQHAFHKQTEVHARTFNAYSLSAVAGLRIKWVDALACHLEFNSTTKEISL
                     FRFPSFCQSLLLEYTKGRRRNVIHACATTSSSRSYWATEEEVNQLLVEILLSYRLLFG
                     QTRKSRSLFRSSLNPFIKNHFVKKVAYDVNVRDPILSALCGTKDSFDSILSGLVEKDL
                     YHLPRDFPILRYRISVLQRYLSITTPRTWLQLWRDNRDSAGWLTFWAVIAFGVFGSVM
                     AFLQVVLQFVQIIQQ"
     gene            complement(<1063093..>1065531)
                     /locus_tag="ACHE_40373A"
                     /db_xref="GeneID:66982168"
     mRNA            complement(join(<1063093..1063497,1063549..1063572,
                     1063626..1063699,1063751..1064189,1064237..1064286,
                     1064337..1065114,1065183..1065384,1065440..>1065531))
                     /locus_tag="ACHE_40373A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278565.1"
                     /db_xref="GeneID:66982168"
     CDS             complement(join(1063093..1063497,1063549..1063572,
                     1063626..1063699,1063751..1064189,1064237..1064286,
                     1064337..1065114,1065183..1065384,1065440..1065531))
                     /locus_tag="ACHE_40373A"
                     /note="COG:S;
                     EggNog:ENOG410PUHH;
                     InterPro:IPR005317,IPR039461;
                     MEROPS:MER0118932;
                     PFAM:PF03571;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0008239 - dipeptidyl-peptidase activity
                     [Evidence IEA];
                     go_function: GO:0070006 - metalloaminopeptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136331.1"
                     /db_xref="GeneID:66982168"
                     /translation="MLEPQIYKLSVGQAFDGLSDSEKHYAHYMARAAWSGTRIILRQV
                     SPEANDIFDFIIALSHTCGGDWEKLATETQVDSDEVERFLNYAAMFLSNVGNYFILPG
                     ISKESLIKLASVSGATIDIFNRIKEPMYAETPSSLGAPGPYTQTAYYLGDGCLASRED
                     VSAISDIIEENAILPENTRLRRCDNGGKPSYEILQASVEGNEYVVGTRGKTSKISQVR
                     IVKGDHKEELEQVCHNLQEALEYTSNPTQRLMLERIHGSFLTGDLRDYKDGQKIWVTD
                     TAPAVETVIGFVEPYRDPLGVRAEFEGIVGIADTAETSRLQRLAGIADGLVCRLPWVK
                     DHGTSKGPFEKNMFEPPDFSSVQSLAYCSSIVFPGINLPNYNDIRQETGYKNIIFSNR
                     MVSESSRARGLHMVDPIEQETFKQHRFHSYYIWVVLHEILGHGTGRFLSELSPNNFNF
                     DPQSPPINLLTGKPVNSWYRPGQTWTSVFGNLATTVDECRAELVGAYLIDEPEILRLF
                     GYDESSEVRADDIIYNMYLQLGVDGLRGLENYEPITKEWGQAHSRAHYAMLRHLLCDS
                     DGLYTIQLDLENNRLTVRVDRSQVLQKGKPSLGRMLLQLHIYRCTADKDNCREFYENL
                     SQVDDEALKWREVVVSKKDPSLVFCHANTFLEKDEDNVKLKEYEPTSRGVIQSWVERD
                     IDDAL"
     gene            <1065943..>1068255
                     /locus_tag="ACHE_40374S"
                     /db_xref="GeneID:66982169"
     mRNA            <1065943..>1068255
                     /locus_tag="ACHE_40374S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278566.1"
                     /db_xref="GeneID:66982169"
     CDS             1065943..1068255
                     /locus_tag="ACHE_40374S"
                     /note="COG:M;
                     EggNog:ENOG410PKKZ;
                     InterPro:IPR002110,IPR020683,IPR036770;
                     PFAM:PF12796,PF00023,PF13637;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136332.1"
                     /db_xref="GeneID:66982169"
                     /translation="MPLLTLSNELLLEVANYLEWDSDINAFMQVSGRTYYLLSQRLFW
                     HNVFWSESTAFEWALYRGYASVVEKALDAGAWTNIDYKTFSGPLDVAIHYGYADVVKV
                     LLERGVDVDEDPTWIISSANGILEIGDKSPLFKALVRGHPDVLQVFFSFVKKSQGYDV
                     GKRARPVRGGWHTYGINVTKAAAEQLMRDSAARGDLDSVKFLTKFLPSLINSEVEDTF
                     GTAPIIQAVKNNQIEVLRFLLKAGVDPGRDIMFREDTPLYHAAQNGSVEAVQLLLDKG
                     ARLDPRMKYRQGGRGHSLEILETAVTNGHVKVAEILLRLIRTRSKSKSTLKDKDTLIT
                     AAAACGLADLVQEILDNVHKGYQKVEKGQRTFLSDNSRLKPLAVATQNGHKDVVSMLI
                     DYGADMKDITSTSPLIRAVSSGHTEVVKLLLDKAVADLTETNIYNLPVRYLAHSKQCT
                     HGFAALCHAVPFPSTFQVLLDKGAQPASRAEKLILVTEVVRFGSEKTAQILSKQGILL
                     EASEIESAANEGAGEQSLDATFDDAIGQAARQRVEQPGEQSGGKALDPTAKTKAEQRK
                     KGKARGKASKKIRSLIQEIGPNSQEVKDIMLSALVAGDARMVGYLCSQGCSPNHKWPG
                     FSNDKMSSLEVAAMARFCEDTATTLDVLLHHGADINQLQGGWSINCPDDRYLTALKLL
                     VERGADAAPHTSKWGLKVLKLASKMRCRRTTRFLLSESCNRGASFAVVQELIKFCEEH
                     LKRGCDLKFEKVLTDAYWRSIYPVPREKTT"
     gene            <1071278..>1071931
                     /locus_tag="ACHE_40375S"
                     /db_xref="GeneID:66982170"
     mRNA            <1071278..>1071931
                     /locus_tag="ACHE_40375S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278567.1"
                     /db_xref="GeneID:66982170"
     CDS             1071278..1071931
                     /locus_tag="ACHE_40375S"
                     /note="SECRETED:SignalP(1-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136333.1"
                     /db_xref="GeneID:66982170"
                     /translation="MKLTGFALAGFLGAAVALPQPQVFGGAPGPVELSSSATPSSSAV
                     PTSSAVVFKRQFGSSSSATPSSTSAIYKRQFGSSSATPSSTSAIYKRQVDSYPSSSTP
                     IATSSAIYKREDPLFPPPPPYNFHPTPSSSATPSSSATPSSSATPSSSPSFFEKRQYG
                     SIYVPSSSATPSSSATPTPSASALFEKRQFGWPTPSSSPVSSTPTSSSSVAVSTPLF"
     gene            complement(<1076062..>1077306)
                     /locus_tag="ACHE_40376A"
                     /db_xref="GeneID:66982171"
     mRNA            complement(<1076062..>1077306)
                     /locus_tag="ACHE_40376A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278568.1"
                     /db_xref="GeneID:66982171"
     CDS             complement(1076062..1077306)
                     /locus_tag="ACHE_40376A"
                     /note="COG:S;
                     EggNog:ENOG410Q2Z4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136334.1"
                     /db_xref="GeneID:66982171"
                     /translation="MTSQLPPSNPNSSPDEMMDLEILQLQEELTRMRKQRALLQLRSE
                     IAREQQLLAEAQQSLGLAELPAVPPERPVEQRLAERLPSERPRFNPPPDPWPRPIPPT
                     NPTTEDVDELIRGIKRSHSESSNHNGGNELENVQEHRPAGQDNTGEEGQQPQEPISQQ
                     GSSGREKTQDEQEEDVEVPPTFTVKRQYRGASRKEYNLTIEFLQSHFAQYERYYASHE
                     RKIEEGLRHVVPDIERAWGFHVATDDQIEPTWPNFCNFLLSRIINLVDPAVARRQYYG
                     RSQREDQTVREFSNHLGSWESNLEELLTEEQRIQNLWARVLPSVREEAMPFQYQSDRY
                     QDHIAHLQTVESRMPSRAHMQKKIAAAAAAAARNKQNQKYGHQPHFPRSAPKYLRAKR
                     PRMHNPTNHSMHNPTNHSMNNS"
     gene            <1078828..>1079099
                     /locus_tag="ACHE_40377S"
                     /db_xref="GeneID:66982172"
     mRNA            join(<1078828..1079024,1079072..>1079099)
                     /locus_tag="ACHE_40377S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278569.1"
                     /db_xref="GeneID:66982172"
     CDS             join(1078828..1079024,1079072..1079099)
                     /locus_tag="ACHE_40377S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136335.1"
                     /db_xref="GeneID:66982172"
                     /translation="MPFWKKPCPWLGDKQPSTPEVSEETKDPQVDLVESQSADYDAVV
                     FSKIRATEWMRSWKGRYFVYAGLGLIMIIL"
     gene            <1079207..>1080535
                     /locus_tag="ACHE_40378S"
                     /db_xref="GeneID:66982173"
     mRNA            <1079207..>1080535
                     /locus_tag="ACHE_40378S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278570.1"
                     /db_xref="GeneID:66982173"
     CDS             1079207..1080535
                     /locus_tag="ACHE_40378S"
                     /note="COG:G;
                     EggNog:ENOG410QE2S;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i32-50o56-77i89-109o121-143i163-188o200-218i276-296o302-
                     321i333-358o370-391i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136336.1"
                     /db_xref="GeneID:66982173"
                     /translation="MLASLNTATSIIGAVFKPPIAKLSDVLGRAEAYLFTVCCYVISY
                     ILCAASKDFDTYAGGVILYSVGQSGITVLNAVLISDLSSMRWRGFAYNILYLPFLVTP
                     WVSAFIIDSVVNGIGWRWGIGMFAILMPFCASLIIITLAVFQSRAKQSGLILKQRPTP
                     YDFCSRIDLGGTLLLSGGFALLLIPITIASTTTSRWKTPWVDALIALGILSLVALYPY
                     ERYIAKHPVVPVRYFRVLAIVSSVCLTCIDNVGFGVTHTYLYAWSTVSRGFSARNAQF
                     LTYTNGVMQALTGMVIGLIIYRLRSYKWILVAGAIIRLIGYGVMIRLRTNDSSIAELF
                     IVQLVQGLGSGIIETIVIVASQIIVPHRELAQVTSLLMLSAFLGNGIGSAIAGGIYTD
                     TLKSRLRARLGKEVSEGKLDKLYNSITGALPAWGSSERIAVNKAYSDVIG"
     gene            complement(<1080895..>1082001)
                     /locus_tag="ACHE_40379A"
                     /db_xref="GeneID:66982174"
     mRNA            complement(<1080895..>1082001)
                     /locus_tag="ACHE_40379A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278571.1"
                     /db_xref="GeneID:66982174"
     CDS             complement(1080895..1082001)
                     /locus_tag="ACHE_40379A"
                     /note="COG:T;
                     EggNog:ENOG410PUX0;
                     InterPro:IPR000719,IPR011009,IPR008271;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136337.1"
                     /db_xref="GeneID:66982174"
                     /translation="MRHHHLSVQTDTPVASTTTPPATPSTPSKRDPDNLNRILHYTDS
                     LDYHHHPDSSSPVQFGHGVWSAVYKASSLPAPPSTGALITPPASPASKNRIVAVKSPI
                     RKDAHPVLESEARVLTRLTLSPGAERYIVPFLGFIPRSHALVMGAVPLALSSYITEAA
                     VKAQEHRSTSNMFEPVLGKRRWINLARKLVSGLDWMHNTASVVHGDIKPHNILLRRVP
                     AISDGGEEFVYEPLYADFSSAHDTCSAASSPAPGSALTPPFAAPELLSAAALKAPAGA
                     PPTTASDVFSLAVTLLAAATGDLLLYPGTSHMQRLAMAREGHRVVEFARSGGNGMRVP
                     RGGAVESVVKVAVCKQPEERVRAGEWVELMKSVE"
     gene            complement(<1083052..>1083591)
                     /locus_tag="ACHE_40380A"
                     /db_xref="GeneID:66982175"
     mRNA            complement(<1083052..>1083591)
                     /locus_tag="ACHE_40380A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278572.1"
                     /db_xref="GeneID:66982175"
     CDS             complement(1083052..1083591)
                     /locus_tag="ACHE_40380A"
                     /note="COG:S;
                     EggNog:ENOG410PT6J;
                     InterPro:IPR023393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136338.1"
                     /db_xref="GeneID:66982175"
                     /translation="MAQSTPSLNGSDAVYYAYSSATTTAPAEKTWQTLIDTSTWPSWN
                     SFCPRVTIRHQPGQHELSPILQNGTRMTFHVHMDPNSPAETDVYLVVTLFEPPEGGKT
                     GRIAWSADYTASGTLPRFLLQAERVHEIEPFGEGRGSEVRNWEVQVGYAAYAVRWMYG
                     RVVQEAFERWVQDLRSYVA"
     gene            complement(<1083750..>1084586)
                     /locus_tag="ACHE_40381A"
                     /db_xref="GeneID:66982176"
     mRNA            complement(<1083750..>1084586)
                     /locus_tag="ACHE_40381A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278573.1"
                     /db_xref="GeneID:66982176"
     CDS             complement(1083750..1084586)
                     /locus_tag="ACHE_40381A"
                     /note="COG:S;
                     EggNog:ENOG410Q252;
                     InterPro:IPR002918,IPR029058;
                     PFAM:PF01674;
                     SECRETED:SignalP(1-19);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_process: GO:0016042 - lipid catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136339.1"
                     /db_xref="GeneID:66982176"
                     /translation="MPSLRSIIATLTACSTATATLINDFSCKSSSHPNPVILLHGLGA
                     TGYEDINVLQYWLQGKDYCTFARTYGAYDGFPFLGGLKPIAESASEIAKYIQEVAEKT
                     GAEKVDVVGHSEGALQTLYVPKFHSEVVPLIDKLVAIAPPTRGTDFAGLYKLAIDLGN
                     NTKSAVDKALDTVGCQACSELVTGGEAIKKLNDGEPIVQEGNSLTVIASKHDELVTPV
                     ETSFVHEEGVRNVWVQDKCRFDIVGHIGEAYDPNVWNLVKNALDDTPDRDFVCVIGAP
                     LK"
     gene            <1085881..>1086506
                     /locus_tag="ACHE_40382S"
                     /db_xref="GeneID:66982177"
     mRNA            join(<1085881..1086225,1086312..>1086506)
                     /locus_tag="ACHE_40382S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278574.1"
                     /db_xref="GeneID:66982177"
     CDS             join(1085881..1086225,1086312..1086506)
                     /locus_tag="ACHE_40382S"
                     /note="InterPro:IPR021054;
                     PFAM:PF12296;
                     SECRETED:SignalP(1-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136340.1"
                     /db_xref="GeneID:66982177"
                     /translation="MLPKRLLTILLASLTSLAPVSASPHTALSHSVSQLGSIQSHLSL
                     LTEALDSYNGGVWGLLTLANRVNNAQSAIRGARLNLDQLPVLSGDDFENWAGSYEKLQ
                     PVILGALKTAHGKTDHFHKLGLKPVVAALVQGLIDERNGYKKTIEGKMSRENITAMVA
                     HNEEVDKTVKFVFEALESV"
     gene            complement(<1086851..>1088735)
                     /locus_tag="ACHE_40383A"
                     /db_xref="GeneID:66982178"
     mRNA            complement(join(<1086851..1088547,1088603..>1088735))
                     /locus_tag="ACHE_40383A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278576.1"
                     /db_xref="GeneID:66982178"
     CDS             complement(join(1086851..1088547,1088603..1088735))
                     /locus_tag="ACHE_40383A"
                     /note="COG:S;
                     EggNog:ENOG410PK5F;
                     InterPro:IPR001737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136341.1"
                     /db_xref="GeneID:66982178"
                     /translation="MPPGMNRWTPVARFPLTKRMNDRFPGPGRKRTWAKSEIVNEDLC
                     DDILHRVSPYLNRKSPIDILDLWPGVGLFSSKVNDFLKPRRHLMIEPLLDTYGPFLKP
                     LVASKPGYELLSLDIHAHKDWDSIISKHLPEQGPSSADSSGAVAKNDTLLVLASPPPN
                     TSKRNHYTPSRWWSIFLEMCLRQAGFHTYGSVRLLATLPSVEVPNIIPRTVVERKRPA
                     LLTESLALHAFELASPMDSGFWTMTKGWDVMAQNAARVAERTAANKIEIPPGREPRTY
                     PLAPASPEAGWKPAPYTPRVSTEKLEQLIKLVEEVSKTSSDKTAKQKRSRALIQINQD
                     NRHAYIRAQLKEKRIQIDQLTKSLSQAAADPKTTLGSLKQYTDQIDALLSKIEEEASE
                     NHYDTFTHLSGLVDDHRASLHTGNFDDGLLHWDRRPFEPLHIDPEELYPQELDRTVLY
                     FEPDVNSPVIQRVKEVDPSKRSNLFQLFEFLTLAFNTRGSMPVSELLSLMFPSKSIRD
                     LIRAIPSLATYAGKKPKPDFDSIPKPPPSEVDPSTTYQENIDYDLSEVRLRSLPALTL
                     WEITLEYMNTAADKSPVHLNRLLGGSLTSFRTGDYKASYKRLN"
     gene            <1089201..>1090909
                     /locus_tag="ACHE_40384S"
                     /db_xref="GeneID:66982179"
     mRNA            join(<1089201..1089347,1089407..>1090909)
                     /locus_tag="ACHE_40384S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278577.1"
                     /db_xref="GeneID:66982179"
     CDS             join(1089201..1089347,1089407..1090909)
                     /locus_tag="ACHE_40384S"
                     /note="COG:T;
                     EggNog:ENOG410PIV2;
                     InterPro:IPR000555,IPR015063,IPR037518,IPR044098;
                     MEROPS:MER0029722;
                     PFAM:PF14464,PF08969,PF01398;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008237 - metallopeptidase activity
                     [Evidence IEA];
                     go_function: GO:0061578 - Lys63-specific deubiquitinase
                     activity [Evidence IEA];
                     go_function: GO:0070122 - isopeptidase activity [Evidence
                     IEA];
                     go_process: GO:0016579 - protein deubiquitination
                     [Evidence IEA];
                     go_process: GO:0070536 - protein K63-linked
                     deubiquitination [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136342.1"
                     /db_xref="GeneID:66982179"
                     /translation="MASQLSSDSMGLTPPQSVEKITRKAQDYEYNPHISLRNWLRTAT
                     TLVREARIYEREGNDEQTYLLLFRHAQLVLVNLSKHPESKQEKNRKALLEAETQVKAS
                     IEKLETLKPRINKRYERYVQLLRERKVRRQPSLTTSPPQDPTRHDPALAGVAAPLEAG
                     ENKGFAVELAKTEISRRATARKALREAGVSEEEERIRRSAGVWGDWESALEKDGRKTT
                     DKNDLSMRIQEVRLNVDQTQKERYAKPTPRQQTISSPVAAYKYPTVPRQQPLSTITSP
                     PVVPVKTQTRVDPPALPLKQVENHGSALVDSPPPRPNKISPTAISEPAPSSLLPPALP
                     DKVRLEDDTKFRSDLDPSSFTFKPSAYLENGTPLRTVFLPPDLRKQFLILAASNTRRN
                     LETCGILCGTLISNALFISRLLIPEQTSTSDTCETVNESAIFDYCDSEDLMVLGWIHT
                     HPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPSQTPDWGIFRLTDPPGLKTVLNCTQ
                     SGLFHPHSESNIYTDALRPGHVFEAKGLEFETVDLRPEPRI"
     gene            complement(<1091304..>1091769)
                     /locus_tag="ACHE_40385A"
                     /db_xref="GeneID:66982180"
     mRNA            complement(join(<1091304..1091492,1091566..>1091769))
                     /locus_tag="ACHE_40385A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278578.1"
                     /db_xref="GeneID:66982180"
     CDS             complement(join(1091304..1091492,1091566..1091769))
                     /locus_tag="ACHE_40385A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136343.1"
                     /db_xref="GeneID:66982180"
                     /translation="MTLPQQAPSISTIHIYLSSSTIIIRVKNILQTINNPTKTMTDNL
                     AVEQAANLPRRGRASSGERDNRLLRQAADTRSTINTSNTRNRRSSRRPPTPNRMAGVR
                     SGSGARRRSKSRSRAPSKSRSRERRIGD"
     gene            <1094705..>1096051
                     /gene="OXR1"
                     /locus_tag="ACHE_40386S"
                     /db_xref="GeneID:66982181"
     mRNA            join(<1094705..1095852,1095907..>1096051)
                     /gene="OXR1"
                     /locus_tag="ACHE_40386S"
                     /product="oxidation resistance protein 1"
                     /transcript_id="XM_043278579.1"
                     /db_xref="GeneID:66982181"
     CDS             join(1094705..1095852,1095907..1096051)
                     /gene="OXR1"
                     /locus_tag="ACHE_40386S"
                     /note="BUSCO:EOG092629U5;
                     COG:L;
                     EggNog:ENOG410PJD6;
                     InterPro:IPR006571;
                     PFAM:PF07534"
                     /codon_start=1
                     /product="oxidation resistance protein 1"
                     /protein_id="XP_043136344.1"
                     /db_xref="GeneID:66982181"
                     /translation="MTVAILNISPPPYRITNRAEYKYSTFSSLLYLPFPLISVFQPRL
                     NGFILSISYCPPHAMSSSSIKSGSRTPHANSNNPNSLNYFSYPVTHVVSGLYRRFTDN
                     SSSSKSSSSRNMLNPLSNNTSTSPEVFTPIRTASPFQPPPLTPLTLTSSFDSIPEPDL
                     DSDSLQQLLTRALAEEIRLLVPARLQLVDTWRLAYSLDRDGASLGTLYAKCRDVASRS
                     PRAGFVLVVRDASPNGAVFGAYMTDPPHPDNHYYGTGECFLWRASVLPPPGSMGLQDV
                     SGAGGENPPSEDLLELAGLPPPPSADTTNAGRSTTLRGEPKQKLRQDSFDDSNNRLAP
                     PRSQTQTPTGSIRSGTSTPERIRFKAFPYSGVNDYMMFCETGFLSLGGGDGHYGLWVD
                     SGLEKGVSAPCQTFGNEPLSDEGVKFDIIGVEVWYVGA"
     gene            complement(<1096495..>1099066)
                     /locus_tag="ACHE_40387A"
                     /db_xref="GeneID:66982182"
     mRNA            complement(join(<1096495..1097316,1097366..1098933,
                     1099048..>1099066))
                     /locus_tag="ACHE_40387A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278580.1"
                     /db_xref="GeneID:66982182"
     CDS             complement(join(1096495..1097316,1097366..1098933,
                     1099048..1099066))
                     /locus_tag="ACHE_40387A"
                     /note="BUSCO:EOG09260WG2;
                     COG:U;
                     EggNog:ENOG410PIZ4;
                     InterPro:IPR040979,IPR013863,IPR011044,IPR040458,
                     IPR040768;
                     PFAM:PF17747,PF17748,PF08553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136345.1"
                     /db_xref="GeneID:66982182"
                     /translation="MFMLRNVSKFIFGDTSKESIIEIPQGQLYLVRPLSPKGYSELIF
                     KDAAATIRRTGQEFQYQLVVQRAYEEGEEELADDDDGEGGSDSLDKDEKVFLLDQSLH
                     FRSEVREGGAKVLAWSDLSGDLGDLFEFVCDPSVPSEKVATFELAAVQCQYERKYRQS
                     AQKATEQELEQFSFQEEKPIPSASPIASPTTKSRAPSLTAQESTAAMAKDVEYSRTKG
                     IVKPAEESTVAPPSAAQPEVKEILAQETAELHLFDFTTGTFVQQDPKITATVSEIGTW
                     QYWLQISGQDKEWLGQAVVADLNPVFNFEYLSFIFNHYTEDGSAFSWLLRFRDQETEE
                     RFQEGLMQALWEQLNEMKWVKVKEDDRDYVLDAFQDLTMEDQNEEQEQADAEAEAEEE
                     EEEEEDQADGQRSEHYDSDEEEEDVVTRDDDGNVNSQLAVGYKHDRSFVVRGSKIGVF
                     KHTPNNNLEFSTNISKVETPGGKLFSPKKVMLHAEDSNMILQNENDPNSLYRMDLEYG
                     KVVDEWKVHDDIPVNIFAPENKFSQMTSAQTFVGASNNALYRVDPRLSGNKMVDSDLK
                     QYASKNDFSSMATTEKGYLAVASNKGDIRLFDRLGINAKTHIPALGEPIIGTDVSADG
                     RWVLATCRTYLLLVDTLQKEGKNEGKLGFERAFPKDSKPQPRRLGLQPAHVAQFQHET
                     KKPLSFTPAKFNTGVDSSETSIITATGPFIITWSLKKVTAGRKDPYTIKRYAEDVKAD
                     NFRFGSDKNVIVALPNEVNMVAKKSFQKPTRESIAGPPVTPSRRNTRWGNRLGREDIV
                     NSPF"
     gene            complement(<1099380..>1100624)
                     /gene="TRM10"
                     /locus_tag="ACHE_40388A"
                     /db_xref="GeneID:66982183"
     mRNA            complement(<1099380..>1100624)
                     /gene="TRM10"
                     /locus_tag="ACHE_40388A"
                     /product="tRNA (guanine(9)-N(1))-methyltransferase"
                     /transcript_id="XM_043278581.1"
                     /db_xref="GeneID:66982183"
     CDS             complement(1099380..1100624)
                     /gene="TRM10"
                     /locus_tag="ACHE_40388A"
                     /note="BUSCO:EOG09263760;
                     COG:U;
                     EggNog:ENOG410PKY7;
                     InterPro:IPR007356,IPR016653,IPR016009,IPR038459,
                     IPR028564;
                     PFAM:PF01746;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="tRNA (guanine(9)-N(1))-methyltransferase"
                     /protein_id="XP_043136346.1"
                     /db_xref="GeneID:66982183"
                     /translation="MDEEERPRKQQKLDTEGQKQEENMGPAMTGAVGEEKVDDHATTA
                     THNGNENKTTSETGDGEHNESETAGHQQHPEGAAPTMSKNQLKKLRRKEAWDAKADER
                     RAKRKEENAAKKQRKKNLLEEAKKQGKEAEEAMRKKFASTRQRHHQSTLVPLTFVMDC
                     GFDELMMDKERISLGSQLTRAYSDNSRSKYRVHYVISSFDKQLRERFDTVLKKTYLNW
                     RGVRTMQEDYVHAAEMAKVWMTGPEGGKLAGRLEEQSDAKPGDGEVIYLSSDSPNTLT
                     ELKPYSTYIIGGLVDKNRHKGICHKQATERGIKTAKLPIGDYIQMASRSVLATNHVME
                     IMLRWLETGNWGEAFMQVIPQRKGGKLKGKAAAGEGSPTNEYAEGIEEDGDDGEDNDA
                     EASEAAQGEIEQRELHATAEQA"
     gene            <1100931..>1101519
                     /locus_tag="ACHE_40389S"
                     /db_xref="GeneID:66982184"
     mRNA            join(<1100931..1100981,1101067..1101173,1101251..1101403,
                     1101471..>1101519)
                     /locus_tag="ACHE_40389S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278582.1"
                     /db_xref="GeneID:66982184"
     CDS             join(1100931..1100981,1101067..1101173,1101251..1101403,
                     1101471..1101519)
                     /locus_tag="ACHE_40389S"
                     /note="COG:C,D;
                     EggNog:ENOG410PRI3;
                     InterPro:IPR009346;
                     PFAM:PF06212;
                     TransMembrane:1 (o28-47i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136347.1"
                     /db_xref="GeneID:66982184"
                     /translation="MPQDMPPVGGYEPVQYKRHLPARGFRPVYYLLGMHMVMAYGYYK
                     LFYGVREQHELAREKIWSRLHILPLLQAEEDRDQVRRHFADKARERELLGQETKVYNT
                     DRFVRPTFVYTPSNVTQ"
     gene            complement(<1102192..>1106406)
                     /locus_tag="ACHE_40390A"
                     /db_xref="GeneID:66982185"
     mRNA            complement(join(<1102192..1102868,1102932..1103530,
                     1103580..1103722,1103771..1104029,1104082..1104185,
                     1104239..1104463,1104520..1104591,1104640..1104764,
                     1104817..1105288,1105343..1105531,1105582..>1106406))
                     /locus_tag="ACHE_40390A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278583.1"
                     /db_xref="GeneID:66982185"
     CDS             complement(join(1102192..1102868,1102932..1103530,
                     1103580..1103722,1103771..1104029,1104082..1104185,
                     1104239..1104463,1104520..1104591,1104640..1104764,
                     1104817..1105288,1105343..1105531,1105582..1106406))
                     /locus_tag="ACHE_40390A"
                     /note="COG:U,Y;
                     EggNog:ENOG410PGU3;
                     InterPro:IPR016024,IPR011989,IPR040018,IPR013598;
                     PFAM:PF08389;
                     go_process: GO:0051168 - nuclear export [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136348.1"
                     /db_xref="GeneID:66982185"
                     /translation="MAAAELSEGGMADLVRALELIHSPSSTNELRREALTYVESQKQS
                     KAAAHNGFLLASRTENAPLVRYFGLTLLDHVLRHTSITSNQLVELRELVIPLAQSIRQ
                     EDPPYIRNKIPQLWTEVAKRSWGLDWLDMDQTLVQFWSASLVHKEFVLSVLETLSEDI
                     FYREDTVSSLRGTDLNRALIEIYTPLSVFEEVYPKRDKQLEIRCGTEGWMARMCEFLG
                     ECIENVQTSKQAKDAAIKALATLKACLAWTIPKAIISTNCVPHIVRAFTCHDEQVLLA
                     GVEALHSLYSRANFDIDEFQPLVHLMYETEYLDLLQKLYEWSIVGPDDIDDPRYTISK
                     KLSEMLSYVAGFLEEKGFSLETVHGLNLPYFFHLMINVIQHQSLTISIPVLHIWSKLL
                     ASEKIGNTEFVTGLVPQLLGICTQRLVRWESLPEDSGNPTVTFLYEDIDTVPERHAFV
                     GNYRRYCSNIIETIVQKRPQEAIPHILSGVEVNLNSLYEGVAPFNVTTFSKSSIPLMR
                     ADTQFAVVDATLKGYNKWISAHGKTPQQDEQKRSELETALEAWAMSLLQRNFEDPILN
                     ERIIKLAVDISCRALDKTPSFALKVLEHILMTRLPDQPDYPAYSEAVKELHGLSSHEL
                     RRLAVRYADYFSTFYDVLEPKIREITMANQMDDKLQMELTSVLVIITLRASNMDPYVR
                     ESRLVSFVQPVRQAWQDEELQRLSSSFEGFCGMLGLQDVGPYMQARQAHKLEDWTEVS
                     VDSDGKQIQEGMTRKFQQLPLRGTKIMLAISTEKVKKGEPAYELACKTWHDTIPVILP
                     SLLQLVSNAHAFHNPTNWGGLPDEMKAVVEHILTDRFWQAGISTGSRDEFYAKITASR
                     GTLEGFASSVRGKVRAVREACYSILFSMSRMREHFYGFAELPRPLSEALFNDSVHLSS
                     HQFSVLLNVSRCLIDDCPVRFRSQFLPPMLSALFTHIDRKVTAEWEIIEQQKAGMAES
                     DLTDEMKSESILRQLTYSAVIMVASLLDPQRGDPDQTDSTDPSAPTPPPSITDSIRHF
                     VLSSPEIFEPVMLFCTHALRMRDTRCCSIITRVIRSLLQDFAPPNNTPTTATIREFIC
                     SEVLKACITSVHEPYFVDMQKDLASLIASIWVLYGSSSPTPRTVMLSLPGIDPQRVAY
                     AENALLRSNSARQQRALILELLEGLRGVSIAEQGKILDSRVERRKTRSALQEKYMKND
                     MEGQQTTKVDINDGPDLGGIADMFG"
     gene            complement(<1107310..>1109731)
                     /locus_tag="ACHE_40391A"
                     /db_xref="GeneID:66982186"
     mRNA            complement(join(<1107310..1107936,1107994..1108312,
                     1108360..1109291,1109348..>1109731))
                     /locus_tag="ACHE_40391A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278584.1"
                     /db_xref="GeneID:66982186"
     CDS             complement(join(1107310..1107936,1107994..1108312,
                     1108360..1109291,1109348..1109731))
                     /locus_tag="ACHE_40391A"
                     /note="CAZy:GH5;
                     COG:G;
                     EggNog:ENOG410PGAW;
                     InterPro:IPR017853,IPR001547,IPR041036;
                     PFAM:PF18564;
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0071704 - organic substance metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136349.1"
                     /db_xref="GeneID:66982186"
                     /translation="MASPRLRIDGKTFKDLQNREITIRGINVAGEAKYPAKPDVPTYI
                     SDHFFDADDVSFVNRPFPLEDAHMHFAKLRKWGYNTIRYVFTWEAIEHAGPGIYDQEW
                     VEFTIEVLRVSKKYGFYIYMDPHQDVWSRLSGGSGAPGWTLYAAGFNPKAFKKTEAAL
                     VQNTYDNPALFPKMIWSTNYTRLFCQAMFTLFWAGRQFAPKAIIDGMNIQDYLQSHFI
                     AACKYLAERIHEAGDLENEVVIGWESINEPHRGLIGVQDISVIPPEQQLQLGTSPTAW
                     QAMLTGAGRPCEITTWGFGSFGPYQTGRELVDPEGESAWLPADYDDSRYGWKRDPGWK
                     LGECIWAQHGVWDPSTDQLLQKDYFAKDPNTGEPLDYEKFTNTHFLEHYRAYRDAIRS
                     VWPEAIMFCQPPVMEVPPDLKGTIDDDPNMVHAVHYYDGLTLLTKHWNRLYNVDVIGV
                     LRGKYWGPAFAVKIGETAIRNCLRDQLKFLRDESLRYMGNHPMIFTEIGIPYDMDDKY
                     AYKTGDYSSQIRAMDANHFALEGSTSNGFTLWLYSTRNDHEWGDHWNGEDLSIFSNDD
                     LELPSGSSAPFNLQSPGYSESQSNTGGQHVGPGDLKQALSPPSISSERSQPTGAGSGH
                     RAAEAYIRPSPIKTNSQVVSHLFDLQKCTFTMSLQAKEMAGQETPTEIYLPEFHFPED
                     QSEVSVSSGKWEIDAEEFNSVKVQRLRWWHEGGKQNIKIEGVKRKLGEVSNAPGDDIS
                     YLEQCQKGGCTVM"
     gene            <1110378..>1114758
                     /gene="SKI3"
                     /locus_tag="ACHE_40392S"
                     /db_xref="GeneID:66982187"
     mRNA            join(<1110378..1110490,1110561..1110761,1110813..>1114758)
                     /gene="SKI3"
                     /locus_tag="ACHE_40392S"
                     /product="superkiller protein 3"
                     /transcript_id="XM_043278585.1"
                     /db_xref="GeneID:66982187"
     CDS             join(1110378..1110490,1110561..1110761,1110813..1114758)
                     /gene="SKI3"
                     /locus_tag="ACHE_40392S"
                     /note="BUSCO:EOG09260779;
                     COG:A;
                     EggNog:ENOG410PHEB;
                     InterPro:IPR011990,IPR019734,IPR039226,IPR040962,
                     IPR013026;
                     PFAM:PF13424,PF13432,PF13176,PF18833;
                     go_component: GO:0055087 - Ski complex [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006401 - RNA catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="superkiller protein 3"
                     /protein_id="XP_043136350.1"
                     /db_xref="GeneID:66982187"
                     /translation="MSKSALKAVRTALDSKDFEDAAQKAKDIVKQEPQNYHANLFLGL
                     AYDKLNKNDNAESAYFAATHAKLGDRAAWQGLINLYEKQGSHKLESYRYAAVNLALIF
                     ADEDDKHRCQDVVDKYTKFAKRQGSRSQQKQALEVHLPSSPLYNYLEGRIPHPSLTYQ
                     RLIDITEAEEKEFINREIGERRTRLGARIDQVTLEVKREAFKRSELEQLYRGIVDWSH
                     DDQVRRQYEEKLIQRAYDTLAVLPSADKSTKRDELLRAAHDMVIIKHPFELAWKIVLE
                     WQDVEEFSQWDLNFLKEFIEFFPEDGLAKVLKGFLASDISSFPKEQKSPKESPSSEQE
                     PELENNGDYQEMAVQDRLILMVEGLDSARSSIVAHRIMAELYLSLEEYESVADVARKG
                     LLNIKDLVKMTGVDLQHTTDAVNIMLANSLIYYQLPRNHPEAKAIFEGILERKPKSTS
                     CLLGIGLILKVDEDYGEAIEFLERALERDSPNIKVRAELSWCRALNGDLHSGLEGLQG
                     VLSEIQDSRMENRDFKSEILYRIGYCLWELNPSSAARKDRHGAYASFLASIQANMNFA
                     PAYTSLGIYYADYKRDRVRARRCFHKAFELSASEVEAAERLARTFADQKEWDLVEAVA
                     QRVVDSGKAKPAPGSKRRGYSWPYAALGTVQVNKQQYSKSVVSFQAALRISPGDYHSW
                     VGLGESYHHSGRFIAATKAFDHAQQLEGNLSNDEKENIWFARYMLANVKRELGEYDDA
                     VSRYEDVLSIRRNELGVTISLLQTLTENSWKCIESGLFNDGAELASKAIRVATSLVHE
                     RADIFNLWKAVGDACANFSYIKLKADKLPINEVRQLLNTELDPAAFDILADVDEMGQN
                     YISLPEADETGPFPKSDICVYASILAYKRAIHVSIQDVHAQAVAWYNLGWAEYRSYRS
                     VQNRSAKKSKKQPRKFLRAAIRCFKRAIELEAGNSEFWNSLGVVTTNLSPKVAQHAFV
                     RSLHLHDRSAQVWANLGTLYLIHNDIQLANEAFTRAQSTDPDYAQAWIGQGLLALLFG
                     APGEARGLFEHAFDISTSSLALSKQQYTSTLFDHLLSDSAASNELSNLIQPFFALHQL
                     RCQDPSDMMFIHLSSLLAERIGEFSDASASLQGVCAAMEEEYEISESAASLSRFAQAN
                     ADVARILLARHEFEEAAEKAETALMLSGEEDAEKFDPEMNGRLRLSAHLTAGLAHYYL
                     KSMDRAIDMFRDALQEAENAPEVVCLLAQVLWAKGGEEERAVARQQLFDCVENNPDHV
                     GAVTLLGAIALLDSDKDAIEAVESDLQGMITRDDIDIHGRAKLIKLLTAVSTLGLTDS
                     NIPEETRRMGEATAAVMRAPDQPQGWMELSAASNELHPAEMAVKRALRSVPPRSNLDA
                     NDLSEAFAQTGKAGDALRAIMYAPWKRDGWEELNHVVSGSA"
     gene            complement(<1114869..>1115645)
                     /locus_tag="ACHE_40393A"
                     /db_xref="GeneID:66982188"
     mRNA            complement(<1114869..>1115645)
                     /locus_tag="ACHE_40393A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278587.1"
                     /db_xref="GeneID:66982188"
     CDS             complement(1114869..1115645)
                     /locus_tag="ACHE_40393A"
                     /note="COG:S;
                     EggNog:ENOG410PP0C;
                     InterPro:IPR039215,IPR033472,IPR042470,IPR013894;
                     PFAM:PF08585;
                     go_component: GO:0031422 - RecQ family
                     helicase-topoisomerase III complex [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136351.1"
                     /db_xref="GeneID:66982188"
                     /translation="MSTPQTQIAAQLQSTKSLSVSPSWLDTFIASSSASLQRNVPISA
                     LTQTALFRVLSSDFRDTLTTTNHSSVLPVDIFDPTVKERRLSGPIPVQVLDIEDIGSS
                     LWSQVEAIERVERGEAIRGREIVRTVNVGEDSEDWASNDNGNNNNNNAGGGSNGPHRL
                     ILQDAAGTRTVGIELRRIGDVSIGKLPIGAKMILRNATVARGMVLLTPDCATVLGGKI
                     ESMDRAWKEGRKARLLARIDEMAREERQTSGSRGGDAMEG"
     gene            <1115905..>1116807
                     /locus_tag="ACHE_40394S"
                     /db_xref="GeneID:66982189"
     mRNA            <1115905..>1116807
                     /locus_tag="ACHE_40394S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278588.1"
                     /db_xref="GeneID:66982189"
     CDS             1115905..1116807
                     /locus_tag="ACHE_40394S"
                     /note="COG:U;
                     EggNog:ENOG410PM0G;
                     InterPro:IPR014812;
                     PFAM:PF08700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136352.1"
                     /db_xref="GeneID:66982189"
                     /translation="MSTISSPRPSIASSRAHSPTPTSSHRPSLDTLNTNTGAAGLSAS
                     STPSTARAVSPSLHPPRRNRAALRDYYNLKPEAAAAAAGNADARRSRSVPRHTDAGDI
                     SNTNPSVVATGTELDNPDFDAQRYVEQLLATSSLSTVLKAENSLVGDIRTLDSERKAL
                     VYDNYSKLIRAVETIGKMRRSMDDQGAPLKMTKTLGPAIGFVAETAGSLIQEGEEQRR
                     RMKESKTTEQASSKKAEKETVKWVLGTPSRLEKLLADGKREEADKDWAEVKDLLDKWE
                     GVKGVSEIKEACLKAMETGKDKDS"
     gene            complement(<1117148..>1118141)
                     /locus_tag="ACHE_40395A"
                     /db_xref="GeneID:66982190"
     mRNA            complement(join(<1117148..1118034,1118087..>1118141))
                     /locus_tag="ACHE_40395A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278589.1"
                     /db_xref="GeneID:66982190"
     CDS             complement(join(1117148..1118034,1118087..1118141))
                     /locus_tag="ACHE_40395A"
                     /note="COG:S;
                     EggNog:ENOG410PRF7;
                     InterPro:IPR015034,IPR023398;
                     PFAM:PF08939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136353.1"
                     /db_xref="GeneID:66982190"
                     /translation="MATTIQDTDLFSDESSFYGDDTQITHYEDLADSYDPEPYWVETH
                     PHLLTTIQHDALVPAQPSPASKTTAGLEEEECLPPIGSRRLPRNARGRNEPVPEFLAR
                     LPPSTTKEESVGPWIFVSEPNRRKGVDEEEEEDMASFVAKGTELLHEFKEKKTELEEE
                     HDRSGAKSKAPLTRKLNVHRRALEEDIFALARENGVVSGKWMLFPSVGRVDAVWKAVV
                     EATVDGELGDGAKVATDAGDREARGMMIYTKDYEDTEDVRRVLGKLVELELVNIEQRM
                     GIYYKADAFTYLRILGDNPYGLKASLYSSKDVLAGKV"
     gene            complement(<1118472..>1120037)
                     /locus_tag="ACHE_40396A"
                     /db_xref="GeneID:66982191"
     mRNA            complement(join(<1118472..1118552,1118606..1118761,
                     1118823..1118943,1119003..1119189,1119245..1119253,
                     1119304..1119576,1119630..1119763,1119817..>1120037))
                     /locus_tag="ACHE_40396A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278590.1"
                     /db_xref="GeneID:66982191"
     CDS             complement(join(1118472..1118552,1118606..1118761,
                     1118823..1118943,1119003..1119189,1119245..1119253,
                     1119304..1119576,1119630..1119763,1119817..1120037))
                     /locus_tag="ACHE_40396A"
                     /note="COG:S;
                     EggNog:ENOG410PJU4;
                     InterPro:IPR010497,IPR016292,IPR029058,IPR000639;
                     MEROPS:MER0000432;
                     PFAM:PF06441;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0033961 - cis-stilbene-oxide hydrolase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136354.1"
                     /db_xref="GeneID:66982191"
                     /translation="MSLSFSRLPSTARITPAPFKISFSDNELEDLKTLVRLARTAPRT
                     YENSQQDRRYGITSDWLNDLKEQWTKDFDWKATEARINEFPQFTTTIEGMSIHFAALF
                     SEQDDAVPILLLHGWPGSFQEFLPLLKLFREEFTPANLPYHLIVPSLPGYTLSSGPPV
                     DKNFTTEDIARVVDQLMKDLGFGGGYVAQGGDIGSRIGRVLAVDHDSCKAVHLNACFM
                     QRPNGFSDEFLNEFEQRGLKRAGDFVTRGTAYAYEHGTRPSTIGHVLASNPIALLAWV
                     GEKYLDWVDDPLSSTTILEFASLYWLTETFPRAIYPYRENFPPKGTPAGNDPRWYISK
                     PFGFSYFPNEVLPVPRSWVETSGNLVFWREHQKGGHFAALERPEQIKADLTDFVKQIW
                     T"
     gene            <1120281..>1121594
                     /locus_tag="ACHE_40397S"
                     /db_xref="GeneID:66982192"
     mRNA            join(<1120281..1120495,1120562..>1121594)
                     /locus_tag="ACHE_40397S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278591.1"
                     /db_xref="GeneID:66982192"
     CDS             join(1120281..1120495,1120562..1121594)
                     /locus_tag="ACHE_40397S"
                     /note="COG:E;
                     EggNog:ENOG410PFR0;
                     InterPro:IPR015943,IPR036322;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136355.1"
                     /db_xref="GeneID:66982192"
                     /translation="MESAIQRPQSASTIFLDQPPSCLQFCPAAPDYVVIGTYLLSETR
                     DSEEEGAVQQKKTGSLQLWKINPIANTLSCVERLPLPYAVFDLHFHPRDPTLLAIAGS
                     SGCVALFKVSLASSTNEAIIPIWTLSVHEDLSIPALFLAWTPEHWLTQEKADGFAVSF
                     SDGRTTVFGTSGDITESEKVADLGTFSARQMIEVWFVALATFHDGEEQETDSPTPKIP
                     FLFTGDDFGSLHTRRFDVENSSDGDDDGRGMPPVLLDYDDRARHHSSGVTAILPLPFP
                     MVEDSPLLLTGSYDEHLRIYHATRRGNVLAELSLGGGVWRLQPLGVENMTFLSETGPQ
                     EWRFLVLASCMHGGTRVVRITGDGEHQWNIEVLAEFTEHESMNYASDVWKGGQGIGAK
                     RSELLCLSSSFYDRRVCLWRVNV"
     gene            complement(<1121745..>1122664)
                     /gene="RPN12"
                     /locus_tag="ACHE_40398A"
                     /db_xref="GeneID:66982193"
     mRNA            complement(join(<1121745..1122023,1122098..>1122664))
                     /gene="RPN12"
                     /locus_tag="ACHE_40398A"
                     /product="regulatory particle non-ATPase"
                     /transcript_id="XM_043278592.1"
                     /db_xref="GeneID:66982193"
     CDS             complement(join(1121745..1122023,1122098..1122664))
                     /gene="RPN12"
                     /locus_tag="ACHE_40398A"
                     /note="BUSCO:EOG09263XN3;
                     COG:O;
                     EggNog:ENOG410PI8S;
                     InterPro:IPR033464,IPR000717,IPR006746;
                     PFAM:PF10075;
                     go_component: GO:0005838 - proteasome regulatory particle
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="regulatory particle non-ATPase"
                     /protein_id="XP_043136356.1"
                     /db_xref="GeneID:66982193"
                     /translation="MSDLRSIVPELRNALDRNQLDAANNLLSRAKRSLLLENALIPTP
                     LTPPQLISLAREVLEFGAIASIRQTDADTFTRYYQQLQPFYDLERHASTPGESAGNMD
                     FSTSQRSKITGLYLLLLLSTGNSTNFHTVLEGLVEEASLNGKSVEDDPYIKYPVELER
                     NLMEGSYDKVWRETKSERVPSEDFGLFSNVLVGTIRSEIADCSEKAYPSLPIFNAKNL
                     LFLESEGAVIEFAQQRGWILRDGRIHFPVEPEQAARSEKDILVASSTVIENTIGYARE
                     LETIV"
     gene            complement(<1123017..>1124872)
                     /gene="SED4"
                     /locus_tag="ACHE_40399A"
                     /db_xref="GeneID:66982194"
     mRNA            complement(join(<1123017..1123317,1123374..>1124872))
                     /gene="SED4"
                     /locus_tag="ACHE_40399A"
                     /product="vesicle formation at the endoplasmic reticulum"
                     /transcript_id="XM_043278593.1"
                     /db_xref="GeneID:66982194"
     CDS             complement(join(1123017..1123317,1123374..1124872))
                     /gene="SED4"
                     /locus_tag="ACHE_40399A"
                     /note="COG:O;
                     EggNog:ENOG410PI5I;
                     InterPro:IPR036852,IPR023828,IPR015366,IPR030400;
                     MEROPS:MER0078639;
                     PFAM:PF09286;
                     SECRETED:SignalP(1-23);
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="vesicle formation at the endoplasmic reticulum"
                     /protein_id="XP_043136357.1"
                     /db_xref="GeneID:66982194"
                     /translation="MVSFALLWRPMCLFLSCSQTTSPEESSYQIVEQLYGVPDGWTED
                     GVPSPATPMKFHMAVSNDRMAEFEQRVIEIATPGHQLYGQFMTRDEVGDFLRPSNDTV
                     DRIVAWMKSERVPSESIERHANWITFTVPVSQAEDMLKTRFHSFRNDVSQETAIRTLQ
                     YSVPQDIRDFIQMIQPTIKFGQFSAQENQPDLEPVATRFDDLNVNCSTTVTTKCLRRL
                     YGIYDTEAKPDPRNKLGVSGFLDQYARYDDFRAFMRTYEPDHTDANFNVVSINGGRND
                     QDSSFASTEASMDIQYAVALAYNTDTTYYTTGGRGPFVPEVDQPNVGSSSNEPYLEQL
                     HYLLNLPDQDLPAVLSTSYGEYEQIIPESYANVTCNMYAQLGARGVSVIFASGDSGVG
                     GSCVSNDGTGRTRFMPTFPATCPFVTSVGGTYGVDPEKAVGFSGGGFSEYFQRPAYQD
                     ESVHGYLDQLGDKWEGLYNPEGRGVPDVAAQARGFVFVDHGYFMKLGGTSAAAPVFAA
                     IVSRLNAARLERGQGRMGFLNPWLYSLNNTGLTDIVDGGSVGCTGYSDVGGRASIVPH
                     ASWNATQGWDPVTGLGTPDLNTLIKVACSTEGT"
     gene            <1126312..>1127072
                     /locus_tag="ACHE_40400S"
                     /db_xref="GeneID:66982195"
     mRNA            join(<1126312..1126878,1126941..>1127072)
                     /locus_tag="ACHE_40400S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278594.1"
                     /db_xref="GeneID:66982195"
     CDS             join(1126312..1126878,1126941..1127072)
                     /locus_tag="ACHE_40400S"
                     /note="COG:S;
                     EggNog:ENOG410Q2IY;
                     InterPro:IPR038595,IPR025659,IPR007612;
                     PFAM:PF04525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136358.1"
                     /db_xref="GeneID:66982195"
                     /translation="MAAELALLKQPVALRPEHIASAPTTLRIKHANRTGVDYKVTTVA
                     PEASSSKDSESTVLFTVDGEFASWSQRRVFRDANGLPLFNLRRKSTGVTFFIEIPGDE
                     DRPLATFAPRSSVLKDKCDIYLANAAADGEEVMLEVRGQDIWKRWTHVYFNGALVMRT
                     KLADMVAVYVPGKRISWEAEVAEGMDLSLATAITVFLAENLYNSSYPSSYSSNTKKPE
                     DADPTDTVHIAPTK"
     gene            <1127806..>1130975
                     /locus_tag="ACHE_40401S"
                     /db_xref="GeneID:66982196"
     mRNA            join(<1127806..1128426,1128478..1129152,1129241..1129906,
                     1129959..1130345,1130394..>1130975)
                     /locus_tag="ACHE_40401S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278595.1"
                     /db_xref="GeneID:66982196"
     CDS             join(1127806..1128426,1128478..1129152,1129241..1129906,
                     1129959..1130345,1130394..1130975)
                     /locus_tag="ACHE_40401S"
                     /note="COG:S;
                     EggNog:ENOG410Q2NB;
                     TransMembrane:2 (o80-98i118-135o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136359.1"
                     /db_xref="GeneID:66982196"
                     /translation="MSHPLVAAVWEQLGRTDISNILREIIGDHAAQLAVSQVQNGLVA
                     DVEPLVRMVFWIKAIFDLQRSYLQGLTSFRECPPSLLPYLLPLETIYSTLMYLIRVKA
                     ELLPMTAAGVRDRARYRYFLAEAVLAGVRLLLLRGESLHAEMRSNLERAMKTAWQHPG
                     LTNEEGYLVNVLLPRAINDIGGADASNAQSPLAASGRHYLPSFNSGLYPFLSVPETHI
                     TDLLTGLVGSGPDHTLSFWTLFDTLWASESALIQCYVDSRRIPQQQGDPNTTSSNIEE
                     AFVQTGNARKRLARTILAASDGQTDTPALKILASIILSQTGDGNPPLQTRKVRDAWNQ
                     MASFRNELDCSLSHFVRWLINRRVQLWDCNGELEAVSHEYQRHLTLWLHNSLPAGAER
                     QDNEADKAGAVYVVDCPFVHPVPKALLEEQLIRNGSDTDELQTIPELLSIDASCPLCP
                     EGTMIQHARIIEPLEHLSSALQSGSESGSILSRRSAFGSISGRTASRSSSMSHSTRRS
                     IGFGDSKPSSPSNSMPKMKSSQSLYAMANSLNHLSAPWLDKNQQKQAVKSLSRELKSV
                     KLALPVRRASSIRKGLLREQRLSRQPKFCFSSSGKSLFFWGEDSSCISRFDIPMIDGQ
                     KPETLRYDVSGVQCVAAGEQRCAVISLVGQHYELLIFGPNGVSAEALVTIDTPGLTLR
                     SDCMAMSRNDRHIAFILENQIHVYELGNMYDLEARSIRKVTVNESPRWAQEKAATHRK
                     IAFSVDGNGLVLTRLESQSVYFDVWHRQGDVWDIAKGGFYSIKNTSIDGSLTGAFYDN
                     LHHSIFMTAFSSREYPLLFSTSNGEATGSPFSTKILHAAQSPSGSRYAFANGLNEIYI
                     CDYTPDGPFNPIRIKKASSKISSSAFRPGKLLLSFLQGNVLLVFWVKDEKLVLRIARL
                     NDNGEVISDYDLRADLERLMAERTPSASSRTQSPRIGVPSSPVVKRGPSISLRPDLPE
                     LASN"
     gene            <1131578..>1132942
                     /locus_tag="ACHE_40402S"
                     /db_xref="GeneID:66982197"
     mRNA            join(<1131578..1131698,1131754..1131914,1131965..>1132942)
                     /locus_tag="ACHE_40402S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278596.1"
                     /db_xref="GeneID:66982197"
     CDS             join(1131578..1131698,1131754..1131914,1131965..1132942)
                     /locus_tag="ACHE_40402S"
                     /note="COG:O;
                     EggNog:ENOG410PK6J;
                     InterPro:IPR038397,IPR017901,IPR006599,IPR016098,
                     IPR012945,IPR027684;
                     PFAM:PF07986;
                     go_process: GO:0000902 - cell morphogenesis [Evidence
                     IEA];
                     go_process: GO:0007023 - post-chaperonin tubulin folding
                     pathway [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136360.1"
                     /db_xref="GeneID:66982197"
                     /translation="MSVPEFEQSRRLSQAESQTVLRAEIPLKERFFRYFQHEITALQE
                     QMERLADTSLVGGERTDATDHCLAGIARLSNEVKDAASYIPTYDQRIYAEAIKALQDK
                     LAETRAVVEPRSKFSFKTKKNPASISLSDAAEMAFQGYRGVPGYRSPGTSSVGSSANN
                     TPLYPSTPLNEPDKILQQHRPEVVPTSVPSISVGDTEEKPKEKEQKAFAANVLSSVTV
                     NNHHDLHIMLPASGSASAVPASITSLRHCVVDMSIPTANGKPYASLTVKGVEESLLVC
                     GQIDGPAHITGVEHSVIVVSCRQFRMHDCRDVDVYLSSTSNPIIEGCSNIRFGRTPRA
                     YVSHLSSNIFLWKVNNPQALDHDRPDNEDRWSQVEDFEWIKPEPSPNWSLLGPEDAVP
                     EGVWAEIVPGGPGWSLDDILRAIKLIQ"
     gene            complement(<1135032..>1136661)
                     /locus_tag="ACHE_40403A"
                     /db_xref="GeneID:66982198"
     mRNA            complement(join(<1135032..1135120,1135178..1136361,
                     1136423..>1136661))
                     /locus_tag="ACHE_40403A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278598.1"
                     /db_xref="GeneID:66982198"
     CDS             complement(join(1135032..1135120,1135178..1136361,
                     1136423..1136661))
                     /locus_tag="ACHE_40403A"
                     /note="COG:S;
                     EggNog:ENOG410PMQZ;
                     InterPro:IPR027372;
                     PFAM:PF13449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136361.1"
                     /db_xref="GeneID:66982198"
                     /translation="MVAASTVAAKNVVNQTTCGGTTYTYNELAGYGFVPSNATDKYGD
                     TLGGYGSSAAIDQSSWRKTGNGSYAGIVYTLPDRGWNTNGTLNFQSRIHKLAISLTLA
                     PHASAQNPSEPNLRLKYLDTILLTGPDGEPTTGLDADITGHASYPGFPPLPVATYEGD
                     GFGGAGPGGKRISIDSEGLALGHDDTFWISDEYGPYVYKFDKYGKMLLAIQPPDAFLP
                     RRNGSISFNSDSPPIYAPEKISTPEDTETGRNNNQGLEAIAISPDGKTLYTMIQSALD
                     QEGGPEKQHRQPARILEYDISSPDTPVYKHEYAALLPKYRDYTKSADDKKAYRVASQS
                     EIHILPTGDFLVLARDSDFGNGQENTRSVYRHADVFSISNATDLKGSKYDSANGSIAS
                     SKGVLNPGITPVEYCEFVDYNVNSELARFGMRNGGKSGPEALNEKWESLALALLEPES
                     SSSGDGKKEYLLFSFSDNDFMTQDGHMNFGRFDYADELGYSLDNQVLAFKISF"
     gene            complement(<1137121..>1138565)
                     /locus_tag="ACHE_40404A"
                     /db_xref="GeneID:66982199"
     mRNA            complement(join(<1137121..1137203,1137256..1137473,
                     1137535..1138171,1138232..>1138565))
                     /locus_tag="ACHE_40404A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278599.1"
                     /db_xref="GeneID:66982199"
     CDS             complement(join(1137121..1137203,1137256..1137473,
                     1137535..1138171,1138232..1138565))
                     /locus_tag="ACHE_40404A"
                     /note="COG:S;
                     EggNog:ENOG410PHFS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136362.1"
                     /db_xref="GeneID:66982199"
                     /translation="MAATRTSSRQAAQKAKEAITGTAEPKSQGTTGTKRKGATEKAPE
                     SKKGKKGDKEPKKGPGENKEEVDQKAKEEEPPKPSHNEERVKEEEKEAKEEAKEEKKD
                     EGEPSKAGAEAEGKSAEDEKPSDRIEAGVRKSQEREEIVPSNILEKGIIYFFYRPRVN
                     VEEPHSMKEVARSFVVLRPTPIGATIDGKQGSLEPGASCRLIVLPKKKFPTSARERDM
                     AFVEKGGQSMRELKESFISGGKYETSTRGERTVEEARPYAEGVYAITSTKRASHLAYI
                     ITIPDELGSVQEDFGLRGRGSWIVQAKNPKFPGPASAQLPKKPEYPEEIHEKFADYRW
                     VPLEPVFINYPNAQFLMIGEAQDELGKAAIAEPGGKKENQEQPGEELEKLEHENEERI
                     EALQGDATVYQDLGLDAKNYPQVPTTWDDHS"
     gene            complement(<1138818..>1139399)
                     /locus_tag="ACHE_40405A"
                     /db_xref="GeneID:66982200"
     mRNA            complement(<1138818..>1139399)
                     /locus_tag="ACHE_40405A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278600.1"
                     /db_xref="GeneID:66982200"
     CDS             complement(1138818..1139399)
                     /locus_tag="ACHE_40405A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136363.1"
                     /db_xref="GeneID:66982200"
                     /translation="MNGERYPGNYYVQDNPSTHSQFPKNNTFAAYQELVVRPYAVEEP
                     DDETEDRIWETTEPIPQWQRELVESLDELACESDTSASSLRSSPTRGQKRKSASTSSQ
                     DRYPDQSPSLDPDLRSDDSESGTTNMSPKRRRRKGQSKQFRANLDAADAAFLSHHNYG
                     LSMSPSSESQFADASSSGSTSNGVATPDEMDMD"
     gene            <1140063..>1144068
                     /locus_tag="ACHE_40406S"
                     /db_xref="GeneID:66982201"
     mRNA            join(<1140063..1140092,1140158..1140207,1140279..1140598,
                     1140664..1140999,1141059..1142025,1142082..1143762,
                     1143814..>1144068)
                     /locus_tag="ACHE_40406S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278601.1"
                     /db_xref="GeneID:66982201"
     CDS             join(1140063..1140092,1140158..1140207,1140279..1140598,
                     1140664..1140999,1141059..1142025,1142082..1143762,
                     1143814..1144068)
                     /locus_tag="ACHE_40406S"
                     /note="BUSCO:EOG0926074Y;
                     COG:U;
                     EggNog:ENOG410PH6I;
                     InterPro:IPR001680,IPR036322,IPR019775,IPR015943,
                     IPR010714,IPR016391,IPR006692,IPR020472,IPR011044,
                     IPR017986;
                     PFAM:PF00400,PF06957,PF04053;
                     go_component: GO:0030117 - membrane coat [Evidence IEA];
                     go_component: GO:0030126 - COPI vesicle coat [Evidence
                     IEA];
                     go_function: GO:0005198 - structural molecule activity
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136364.1"
                     /db_xref="GeneID:66982201"
                     /translation="MQSSPNMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDY
                     RMGTLIDRFEEHDGPVRGIDFHPTQPLFVSGGDDYKIKVWSYQTRRCLFTLNGHLDYV
                     RTVFFHHELPWIVSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASAS
                     LDQSVRIWDISGLRKKHSAPTSISLEDQIARANNNQADMFGNTDAIVKFVLEGHDRGV
                     NWVSFHPTLPLIVSAGDDRLIKLWRMSETKAWEVDTCRGHFQNASACLFHPHQDLILS
                     VGEDKTIRVWDLNKRTSVQSFKRDMDRFWVIAAHPEINLFAAGHDTGVMVFKLERERP
                     ASTVYQNQLFYITKEKNVKSYDFQKNIESPPMLSLRKLGSAWVPPRTVSYNPAERAIL
                     VTSPTDNGTYELIHLPRDATGAVEPTDVKRGPGSSAVFVARNRFAVFSAAAQQVDIKD
                     LSNATTKSIKPPAGTTDIYFGGTGCLLFITPTSVVLFDIQAKKQLAELAVSGVKYVVW
                     SNDGLYAALLSKHNVTIVTKTLEQVSSLHETIRIKSAAWDDAGVLLYSTLNHVKYSLL
                     NGDNGIIRTLDQTVYLVKVKGRNVYCLDRNAKPKVLEIDPTEYRFKLALVKRNYDEML
                     QIIKTSSLVGQSIISYLQKKGYPEIALQFVQDPQTRFELALECGNLEVAVEMAKELDR
                     PNLWSRLGVEALAHGNHQTVEMTYQKQRHFDKLSFLYLSTGDSDKLGRMAKIAEHRGD
                     FTSRFQNALYRGDVEDRIQMFKEVDLYPLAYLTAKANGLTEEAESILEACGLAEGQIS
                     LPTLEEPIRVAQPVVSTFKSNWPVKAAAHSSFEKALLGEVGLDEEVEADGLQPEEEEE
                     EAGLARETLEDEDDDVDGWDMGEEINVEEDADFVNVESAETGAGSTEADLWTRNSPLA
                     ADHVAAGSFESAMQLLNRQVGAVHFAPLKGRFLEVYKTSKTYLPATTGLPHLVNYVRR
                     TVEETDIRKLLPVIPRDLETIANADLQEGYAAMRANKLEDGVQIFRRILHAVLVNAVS
                     SEAEVEQAKKIIATAREYILAMSIELERRSLDTESPENLKRSLELSAYFTIPKLEVAH
                     RQLALMAAMKFAFANKNYSSALSFANRMLANGGSPKLLDQARKIKPQCERNPQDKIDI
                     EFDQFAEFDICAASHTPIYGGSPSVSDPFTGAKYHEQYKGTVCRISNVTEIGAPASGL
                     RLFVPGQY"
     gene            complement(<1144470..>1145165)
                     /locus_tag="ACHE_40407A"
                     /db_xref="GeneID:66982202"
     mRNA            complement(join(<1144470..1145007,1145086..>1145165))
                     /locus_tag="ACHE_40407A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278602.1"
                     /db_xref="GeneID:66982202"
     CDS             complement(join(1144470..1145007,1145086..1145165))
                     /locus_tag="ACHE_40407A"
                     /note="COG:O;
                     EggNog:ENOG410PP4X;
                     InterPro:IPR036774,IPR017905,IPR039799;
                     PFAM:PF04777;
                     go_function: GO:0016971 - flavin-linked sulfhydryl oxidase
                     activity [Evidence IEA];
                     go_function: GO:0016972 - thiol oxidase activity [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136365.1"
                     /db_xref="GeneID:66982202"
                     /translation="MPEPTRDEQTSEANLPKGVVLDKDGKPCRTCTSAASWRALSKQA
                     AQSNSNSQDKPQSSTSPASFPLAQSITSAASTSTLPSSSYPASDNQCPPDVEALGHST
                     WTLLHSLAAAYPTRATPEKQDEMRTFLNVFSKLYPCWVCADDFRNWMAEPSGRNRPRL
                     GGRSEFGWWMCEAHNEVNRKLGKKEFDCRFWEERWRTGWKDGRCD"
     gene            <1145766..>1146982
                     /locus_tag="ACHE_40408S"
                     /db_xref="GeneID:66982203"
     mRNA            join(<1145766..1146023,1146101..>1146982)
                     /locus_tag="ACHE_40408S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278603.1"
                     /db_xref="GeneID:66982203"
     CDS             join(1145766..1146023,1146101..1146982)
                     /locus_tag="ACHE_40408S"
                     /note="COG:K;
                     EggNog:ENOG410PR9K;
                     InterPro:IPR037647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136366.1"
                     /db_xref="GeneID:66982203"
                     /translation="MPPRKALLDSDSDPDQPLTSSRPSDKQLAKALRDVVANTFKSGK
                     VEELTVKRMRLAAEKALGIEEGFFRADSVWKARSDQIIKDEVTALDRDSQEPEEREEK
                     QEANFKEESLAPAPKPAKPKAQPKKSTPTPRKRQKTATPQPENDEDEASDYKEEEQEE
                     KEVKKLARKRKATPQKTQQRTTTSKDIVEGDSDSEEKQAFQPSKDKEEKQDASESEMS
                     VVLDEEPEPSRKRQKSSEAPKGKRTTTTKKKAAPKAKDADQDPDQAEIKRLQGWLIKC
                     GIRKFWSKELAPYDTSKAKIKHLKEMLADAGMKGRYSLEKAKQIREERELKADLEMVQ
                     EGAKQWGTGSPEAEEASDSVPRRRRLNRGRQSLAFLDDEDGEETD"
     gene            complement(<1147105..>1147367)
                     /locus_tag="ACHE_40409A"
                     /db_xref="GeneID:66982204"
     mRNA            complement(join(<1147105..1147191,1147242..1147319,
                     1147365..>1147367))
                     /locus_tag="ACHE_40409A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278604.1"
                     /db_xref="GeneID:66982204"
     CDS             complement(join(1147105..1147191,1147242..1147319,
                     1147365..1147367))
                     /locus_tag="ACHE_40409A"
                     /note="COG:S;
                     EggNog:ENOG410PU1M;
                     InterPro:IPR035195;
                     PFAM:PF17237;
                     TransMembrane:1 (o27-45i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136367.1"
                     /db_xref="GeneID:66982204"
                     /translation="MANLPNLRRLFVEARSEAEENEYSRTAFYNLVLFISSVAVFSLT
                     AQRMSGAKSGK"
     gene            <1147801..>1150415
                     /gene="APL2"
                     /locus_tag="ACHE_40410S"
                     /db_xref="GeneID:66982205"
     mRNA            join(<1147801..1147877,1147935..1147955,1148018..1148149,
                     1148222..1148859,1148912..1149480,1149533..1149894,
                     1149947..>1150415)
                     /gene="APL2"
                     /locus_tag="ACHE_40410S"
                     /product="beta-adaptin"
                     /transcript_id="XM_043278605.1"
                     /db_xref="GeneID:66982205"
     CDS             join(1147801..1147877,1147935..1147955,1148018..1148149,
                     1148222..1148859,1148912..1149480,1149533..1149894,
                     1149947..1150415)
                     /gene="APL2"
                     /locus_tag="ACHE_40410S"
                     /note="COG:U;
                     EggNog:ENOG410PFBW;
                     InterPro:IPR016024,IPR016342,IPR026739,IPR011989,
                     IPR002553;
                     PFAM:PF01602,PF12717;
                     go_component: GO:0030117 - membrane coat [Evidence IEA];
                     go_function: GO:0030276 - clathrin binding [Evidence IEA];
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     go_process: GO:0015031 - protein transport [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="beta-adaptin"
                     /protein_id="XP_043136368.1"
                     /db_xref="GeneID:66982205"
                     /translation="MAMNRIRGAFAVPRKGETFELRAGLVSQYAYERKEAIQKTIMAM
                     TLGKDVSALFPDVLKNIATNDLEQKKLVYLYLMNYAKSHPDLCILAVNTFVQDSEDPN
                     PLIRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPAMCL
                     ENGFLEMLQEMIGDPNPMVVANSVTALSEIYHSAPETKALQVTSNTLRKLLMALNECT
                     EWGRVTILTTLSEYKAAEVTESEHICERVAPQFQHANPSVVLAAVKAVFLHMRNVNTE
                     LSKNYLKKMAPPLVTLVSSAPEVQYVALRNIDLLLQKQPDILQKELRVFFCKYNDPPY
                     VKFQKLEIMVRIANDRNVDQLLAELREYALEVDMDFVRRAVKAIGQVAIKIESASEKC
                     VNTLLDLINTKVNYVVQEAIVVIKDIFRKYPGYEGIIPTLCKCIDELDEPNARAALIW
                     IVGEYAEKISNAGDILGGFVDGFNEEFSQTQLQILTSVVKLFLKRPDKAQGLVQRVLQ
                     AATAENDNPDVRDRAYVYWRLLSNTTNPGAPKNIVLSEKPPILTTVQSLPPTLLEQLL
                     NELSTLASVYHKPPEQFVGQGRFGADAVQRAAIEEQIQNARENPLAAAAAAAAVTGTT
                     PPPQAQGNVENLLDIDFDGGAPASAQKEPENGLSGLEGLSGTPVRAQSPATPAAAPSN
                     NLDDLLGVFGDGGAPAPSTTAGPSTAAPSGGAGADLLNGLDGLDLGGNSTTSPPPAIS
                     GGQQKKTNEDILSLF"
     gene            <1151409..>1152599
                     /locus_tag="ACHE_40411S"
                     /db_xref="GeneID:66982206"
     mRNA            join(<1151409..1151585,1151640..1152251,1152306..>1152599)
                     /locus_tag="ACHE_40411S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278606.1"
                     /db_xref="GeneID:66982206"
     CDS             join(1151409..1151585,1151640..1152251,1152306..1152599)
                     /locus_tag="ACHE_40411S"
                     /note="COG:Q;
                     EggNog:ENOG410PJ3Q;
                     InterPro:IPR013154,IPR013149,IPR002328,IPR036291,
                     IPR011032,IPR020843;
                     PFAM:PF00107,PF08240,PF13602;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136369.1"
                     /db_xref="GeneID:66982206"
                     /translation="MAQTDYKFEGWMGLDKDSVDGKMVWQEFEPKPWEETDVDIKVEC
                     CGICGTDLHTLRSGWKPTMYPCCVGHEIIGVAVRVGSSVTNGIKIGDRVGVGAQSESC
                     LGRLGDCPDCAMGLEQYCSHKFVGTYNSTYINGGKSYGGYALYNRVPAHFAIKIPDSI
                     PPSHAAPMMCGGVTVYSPLKHGGCGPGKRVGIIGVGGLGHFGLLFAKAMGAEQVVAIS
                     RKADKAADSLKMGADVYIGTDDEPDWATKYARSLDLIVCTVSSSKMPLNDYIGLLRTD
                     GSLVQVGLPDDGVLNAPIPRLMRRLTVGASLIGSPGEIREMLELVAEKNVKPWIEEIP
                     MKDANRGVVDMEAGKARYRYVLVNEQ"
     gene            <1153104..>1154778
                     /gene="THR4_1"
                     /locus_tag="ACHE_40412S"
                     /db_xref="GeneID:66982207"
     mRNA            join(<1153104..1153157,1153222..>1154778)
                     /gene="THR4_1"
                     /locus_tag="ACHE_40412S"
                     /product="threonine synthase"
                     /transcript_id="XM_043278607.1"
                     /db_xref="GeneID:66982207"
     CDS             join(1153104..1153157,1153222..1154778)
                     /gene="THR4_1"
                     /locus_tag="ACHE_40412S"
                     /note="BUSCO:EOG09261B6Y;
                     COG:E;
                     EggNog:ENOG410PGKC;
                     InterPro:IPR029144,IPR004450,IPR001926,IPR036052,
                     IPR000634,IPR037158;
                     PFAM:PF00291,PF14821;
                     go_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA];
                     go_process: GO:0006520 - cellular amino acid metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="threonine synthase"
                     /protein_id="XP_043136370.1"
                     /db_xref="GeneID:66982207"
                     /translation="MSHTLSQKYLSTRGASYGLSFEDVVLKGLASDGGLFIPEHIPAL
                     PVNWQSEWQNLSFEELAFQIMSLYVSESEIPANDLKDIINRSYSTFDHPERTPLIELD
                     SKKNLHLLELFHGPTRAFKDVALAFLGNLFEYFLVRKNQGKEGKERHHLTVIGATSGD
                     TGSAAIYGLRGKKDVSIFILFPDGRVSPIQQAQMTTVLDANVHNLTVQGSFDDCQDIV
                     KALFADPELNSTHNLAAVNSINWARILAQMTYYFYSYFSLTKTPGYNKDSKMRFVVPS
                     GNFGDIMAGWFAKRMGLPAERLVIATNENDILDRFFRSGGQYTKNDSAGAGVKETHSP
                     AMDILVSSNFERLLWFLAFETDSAASEDERRKNACQSVSNWLNQLKSQGGFSVPTAVL
                     EGAKADFESERVSNDETIAQIRSTYLSSFPTNLTPGSARSSKTGGYILDPHSAVGVAA
                     SLRSGERNPTISHISLSTAHPAKFVSSVDLALRDQDGYNFQEVLPKELVGIEQRESRS
                     TPVPAGAGWQGVRELVKAEVDQELQGLR"
     gene            complement(<1155204..>1157159)
                     /locus_tag="ACHE_40413A"
                     /db_xref="GeneID:66982208"
     mRNA            complement(<1155204..>1157159)
                     /locus_tag="ACHE_40413A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278609.1"
                     /db_xref="GeneID:66982208"
     CDS             complement(1155204..1157159)
                     /locus_tag="ACHE_40413A"
                     /note="SECRETED:SignalP(1-17)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136371.1"
                     /db_xref="GeneID:66982208"
                     /translation="MVKGTLALLALAAPAFAGVIERGEGKDHWGVHKDKHSSSPHVKP
                     TPESTNTWEQPSTSATSTWSSSTESSSSITSSTASSPSDSATTSETTSSWEKPSGSSH
                     HHHHHETTTTPHWYTKTTTITTTTCPVTSSVVTSGTHTSTVPVTQTSTITLTTTTLCS
                     TKPTETPTVKPTPVVTPSSSVPDTTVINSTPCTWATIGTSTLPVPVTTHSSSKVTPVP
                     SSSKSSSVPDTTVINSTPCTWATIGTSTVPVPVTTHSSSKVTPVPSSSKSSSVPDTTV
                     INSTPCTWATIGTSTVPVPVTTPQSSSKATPSPEKSTPVITPSSSVPDTTVINSTPCT
                     WATIGTSTVPVPITTPHGSSAQPTPSGSKPEHSSQPSKPEHSDKPSAQPTPSGSKPEH
                     SSYPSKPEHSGVIPSGSSPSTPGHSGKPSNPEQSGQPNKPAPSGGVIPSGSSPSTPAH
                     SGKPSNPEQSGQPNKPAPSGGVIPSGSSPSTPAQSGQPSNPEQSSQPNKPAPSGGVIP
                     SGSSPSTPAHSGKPSNPEQSGQPNKPAPSGGVIPSGSSPSTPAHSGKPSNPEQSGQPN
                     KPAPSGGVIPSGSSPSTPAQSGKPSNPEPSSSEPSGESPVSPGGGSESEQPSGVSPES
                     PAFTGAAGKAQPAVGVLVGLVGLMAFF"
     gene            <1158942..>1160596
                     /locus_tag="ACHE_40414S"
                     /db_xref="GeneID:66982209"
     mRNA            join(<1158942..1159144,1159211..1159408,1159468..>1160596)
                     /locus_tag="ACHE_40414S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278610.1"
                     /db_xref="GeneID:66982209"
     CDS             join(1158942..1159144,1159211..1159408,1159468..1160596)
                     /locus_tag="ACHE_40414S"
                     /note="BUSCO:EOG09261ZI1;
                     COG:L;
                     EggNog:ENOG410PG27;
                     InterPro:IPR014052,IPR002755;
                     PFAM:PF01896;
                     go_function: GO:0003896 - DNA primase activity [Evidence
                     IEA];
                     go_process: GO:0006269 - DNA replication, synthesis of RNA
                     primer [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136372.1"
                     /db_xref="GeneID:66982209"
                     /translation="MPHSVSPGKSRSPDNAEDEVMQDAPATTNAQEGTGVRLEEMFDD
                     DDDDDEFPASSASDNKMDNSEAPASSGPPPAEVDTDTMLAFYQRLFPFRYLFQWLNHG
                     VVPSPDFGNREFALTLQNDAYLRYQSYATADLFRKDILRMNPSRFEIGPVYSTNPRDR
                     KTLRGGQMKPVSKELVFDIDLTDYDDIRSCCTKANICGKCWAFVTMAMKVVDTALRDD
                     FGFEHIMWVYSGRRGAHAWVCDPRARNLPDDRRRAIAGYLDVIRGAGGKRVNVKRPLH
                     PHLSRSLEVLRPYFAQTTLIDQDTFEGSEQEQRLLSLLPDGSLNDALRRKWASSPGRS
                     SKNKWADIDALAESGQSKSLNTTSLKNAKQDIVLEYTYPRLDSEVSKKMIHLLKSPFV
                     IHPGTGRVCVPIDGRKAEQFDPLSVPTVSQLLSEIDAWDAANPSSSAGAEVAEPEGSV
                     ADGSDARGSRKLQDYEKTSLKPYIDYFRSFIAGLLKEERTGKRERNKEGAEVKSESME
                     F"
     gene            complement(<1160936..>1162164)
                     /locus_tag="ACHE_40415A"
                     /db_xref="GeneID:66982210"
     mRNA            complement(join(<1160936..1161548,1161613..1161671,
                     1161730..1161851,1161972..>1162164))
                     /locus_tag="ACHE_40415A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278611.1"
                     /db_xref="GeneID:66982210"
     CDS             complement(join(1160936..1161548,1161613..1161671,
                     1161730..1161851,1161972..1162164))
                     /locus_tag="ACHE_40415A"
                     /note="BUSCO:EOG0926577T;
                     COG:C;
                     EggNog:ENOG410PNBT;
                     InterPro:IPR036561,IPR003428;
                     PFAM:PF02330;
                     go_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136373.1"
                     /db_xref="GeneID:66982210"
                     /translation="MLTLRTFARSVPRTVSRSIASSAPSALRPGSTIPKSLFQSQFKQ
                     VARPSYAAFSTCRAFRQAAEGDVELVAKLEDELSHEKASGLNDLETSVQNIQYVLQNN
                     SFEVKDVPGEQEVVLTKKFNNEEIRLTFTVADLQNLTEQEEFDDALGDELDYEGGHQP
                     ANQGRGGNIAQHSEDRVAPSDREMDPLDRDVEPSFPARVNVTIEKPGNGALLIQTVAQ
                     DGLFQIEEVSYFQKPDLAHAQTAEKDWARQSLYAGPPFENLDEDLQTFLERFLEERGI
                     NAELANMIPDYIQVKEQKEYVRWLESECPPYHYPMLGQLANRTTDVKNFVSA"
     gene            complement(<1162531..>1163189)
                     /locus_tag="ACHE_40416A"
                     /db_xref="GeneID:66982211"
     mRNA            complement(join(<1162531..1162813,1162882..1162966,
                     1163021..>1163189))
                     /locus_tag="ACHE_40416A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278612.1"
                     /db_xref="GeneID:66982211"
     CDS             complement(join(1162531..1162813,1162882..1162966,
                     1163021..1163189))
                     /locus_tag="ACHE_40416A"
                     /note="COG:S;
                     EggNog:ENOG410PRAY;
                     InterPro:IPR021346,IPR038356;
                     PFAM:PF11176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136374.1"
                     /db_xref="GeneID:66982211"
                     /translation="MPKSFNKVHKQISKKRGVIEGLHENSRDAKRLHRANSRDDRVAR
                     MQTKMARGRNSYLERILYFQEHVPEGSGPFSDDDIRELVTRHINRDVPEIEQLQHERR
                     KGRPPSKREEALLQRTDAENKELKTGFWMPDLSNEDVVKALPRWNQVWSSLSAMKFIR
                     FTSDGGKQPSTFPPKGLS"
     gene            <1163610..>1166005
                     /gene="EXO1"
                     /locus_tag="ACHE_40417S"
                     /db_xref="GeneID:66982212"
     mRNA            join(<1163610..1163622,1163675..1163822,1163875..>1166005)
                     /gene="EXO1"
                     /locus_tag="ACHE_40417S"
                     /product="Rad2 nuclease"
                     /transcript_id="XM_043278613.1"
                     /db_xref="GeneID:66982212"
     CDS             join(1163610..1163622,1163675..1163822,1163875..1166005)
                     /gene="EXO1"
                     /locus_tag="ACHE_40417S"
                     /note="BUSCO:EOG09262A65;
                     COG:L;
                     EggNog:ENOG410PFQY;
                     InterPro:IPR006086,IPR006084,IPR006085,IPR019974,
                     IPR019734,IPR029060,IPR036279,IPR008918,IPR037315,
                     IPR032641;
                     PFAM:PF00867,PF00752;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004518 - nuclease activity [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0016788 - hydrolase activity, acting on
                     ester bonds [Evidence IEA];
                     go_function: GO:0035312 - 5'-3' exodeoxyribonuclease
                     activity [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="Rad2 nuclease"
                     /protein_id="XP_043136375.1"
                     /db_xref="GeneID:66982212"
                     /translation="MGIKGLHGLLKSIQKPCHLKKFSGQTLGVDAYGWLHRGTVACAV
                     DLVLDKPTTKHIDFVLNRVRMLLYFGVTPYLVFDGDDLPSKSGTESDRHQRRQQSKAL
                     GLELQRKGRMAEAYQEFQKAVDVTPYMARQLIEELKKMNVQYVVAPYEADAQLVYLER
                     HGMIDGIISEDSDLLVFGAKRLLSKLDQHGDCIEINRADFTACREVSLIGWTDADFRR
                     MCILSGCDYLPNIARLGLKTAYRCIRKYKNVEKALRMLQFEGQYRVPADYLDNFKQAE
                     LTFLYQRVFCPKAGKLVTLTPPEDVNLDELSYIGGDVDADIAVGVARGDLDPTTKEPI
                     VLKPLAPSRPVLGIQRRQTLGSSAELKPKPNKPISTFFTPKRMPLAELDPNSLTPSPS
                     QQRLLERYANSSWDSSPAPAGLNAARSAPSLRRSQTTRVSSPLARSAERSSFLAQASK
                     ASTFQPAKRQRLCAEAEEGPLPTLANCRSRFFVHKDGESSLSGQKSTKSEKARNSTIG
                     VFSDDSAEDIMSELPDPTQPDGSASNEIDTPCKTADQREAGLVAPTPATPVALPADEG
                     QKEEESFENAAVSETTIPEDTVPEPTPEKSVSADSDSETFHQVLNYHVERQNTSILSK
                     FTFKPGDSPGVSRKSSLGAMNAQSPRTSPAGLLLGPRRSPARRQRSTPLQRLGQSALS
                     RSRSMIVPGSKTVPPPPTFSTCSAANQHLAAPKIFSAQGSEDMIIPNSEDESEDDAND
                     SGASQGPVSLDLKQFSFTGSGTD"
     gene            <1167118..>1168112
                     /locus_tag="ACHE_40418S"
                     /db_xref="GeneID:66982213"
     mRNA            join(<1167118..1167148,1167211..1167279,1167344..1167671,
                     1167725..>1168112)
                     /locus_tag="ACHE_40418S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278614.1"
                     /db_xref="GeneID:66982213"
     CDS             join(1167118..1167148,1167211..1167279,1167344..1167671,
                     1167725..1168112)
                     /locus_tag="ACHE_40418S"
                     /note="COG:S;
                     EggNog:ENOG410PM0A;
                     InterPro:IPR016509,IPR033481;
                     PFAM:PF12351;
                     TransMembrane:4 (i21-39o138-163i183-205o235-256i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_process: GO:0000753 - cell morphogenesis involved in
                     conjugation with cellular fusion [Evidence IEA];
                     go_process: GO:0032220 - plasma membrane fusion involved
                     in cytogamy [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136376.1"
                     /db_xref="GeneID:66982213"
                     /translation="MAINIAQGFARFIPMVGYHHVLMIIIAVAIILLSLLLAGCSSSS
                     PQIPDIFLISMYYERYKPTFNLAQVDPGVVTATANIVGGAEMEVRVGYFGICIQPDGG
                     SYICNSNATALAEVVTVDQDPLNLIWVAATFKDAVVFPYLLIIAVILAFFCFILLATF
                     PGWHEEVDGTGSEKEVKPFPSRAVSQVALALIFIASVFILVSVLWQHTASVAASTIAQ
                     DMGNGSVKSGVGSSAMVLGWFGFGLMVVTTIGLLVMILSIRLIRQLTDDEEEA"
     gene            <1169020..>1170912
                     /locus_tag="ACHE_40419S"
                     /db_xref="GeneID:66982214"
     mRNA            <1169020..>1170912
                     /locus_tag="ACHE_40419S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278615.1"
                     /db_xref="GeneID:66982214"
     CDS             1169020..1170912
                     /locus_tag="ACHE_40419S"
                     /note="COG:C,H;
                     EggNog:ENOG410PUMQ;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136377.1"
                     /db_xref="GeneID:66982214"
                     /translation="MHQILIIGGGPTGLTTSLSLSHQSIPHSLLEKHPSTSIFPKAVG
                     LNTRTIEYFRSLGLQNDILNVSAPPETVSQTCWYTSLGLGVGPDGNGTRTRTGTGREV
                     FTRDAWGGGRYKGVYGRASPVRYTICPQIRLEPVLLRRARARGVSPGVVRNCAEVTGV
                     EELDDRVRVRVRYASPSDDDGKEEEEEVVEEARYVIAADGGRFVADTLGIKMQGERDI
                     ASMVSAHIRAPISRYHPNRHALITWFIDPELGESIRTGFMYHVGPYPSTPETEEWIFA
                     CALLPHEKASGFDERAMLERLHRTLKIPGLNVELKSISHWNINAVVAERYRSKGGRVF
                     LVGDAAHRIPPWGALGLNTGVQDVQNLVWKLGIALNARDEREQRKLHKWLDTYEEERK
                     PLAHQVAHTSLSDFRQHTLVVDRALGISPDASPKDNVSSLQAYLDKMNPDGDELRTNI
                     ANAQSILDREFSALGFEVGWFYPSCDVDNEGARTRHGGQLTEDGEFDNTTYRPSAIPG
                     HHLPHAWVLKEGVRVSTRDLVMNPGGKNQCVLVTTAAQPWMALQSDWVHVEVAVEIPP
                     GPEEVDLAGLNGIEKNGAVLVRPDGIVLWRFKGPDQVFKKAREDPGRFVRRLLGIDGR
                     DRAMKM"
     gene            complement(<1171327..>1173302)
                     /locus_tag="ACHE_40420A"
                     /db_xref="GeneID:66982215"
     mRNA            complement(join(<1171327..1172359,1172409..1172677,
                     1172733..1172914,1172962..1173009,1173068..>1173302))
                     /locus_tag="ACHE_40420A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278616.1"
                     /db_xref="GeneID:66982215"
     CDS             complement(join(1171327..1172359,1172409..1172677,
                     1172733..1172914,1172962..1173009,1173068..1173302))
                     /locus_tag="ACHE_40420A"
                     /note="COG:S;
                     EggNog:ENOG410PGXH;
                     InterPro:IPR018812;
                     PFAM:PF10307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136378.1"
                     /db_xref="GeneID:66982215"
                     /translation="MTAKKAQNSDHTTKTATTTSKCSDENGNSLVPDKRDAMKSAKAV
                     VSENRYAAGLDPPQLPLRTITGLKRWSIANRELPATSLVRAIHVYDFDNTLFLSPLPN
                     PQLWNGPTIGFLQAYESFANGGWWHDPNLLAATGEGLEKEEPRAWEGWWNEHIVRLVQ
                     LSMEQKDALTVLLTGRSENGFADLVRRMVDSKKLEFDLVCLKPEVGPNNERFATTMEF
                     KQALLENLVLTYEQADEIRIYEDRVKHVKRFREWLEQLDRRLPALQSTGSRRFLNYDV
                     IQVAEGCTYLSPVVEAAEAQRMINSHNTIISRNPSLNMTKSPFGRLCIKRTIFYTGYL
                     ISNLDSNRLIDQLLLPNLPHGLADSNDLKYMANSILITPRPAPRSILDKVGGMGKKLS
                     WQVTGTAVYENRVWAARLTPIPAHEKYYTDNPYPIVVLAVRRGARPIDAGKIQNWNPV
                     AADRALTLDTVVGEKVVLRVEEEIPNEGEWESQFTNKNNKRRHQQEREEDTLYPQSRQ
                     QPNGYTGPSPNRPRHHDDGPRRGGYRGRGRGNGPRGRGSNRGRGRGRGRDTGAHPFYK
                     SLDDYGHEGGFDDKPGSGVMNY"
     gene            <1173467..>1174656
                     /locus_tag="ACHE_40421S"
                     /db_xref="GeneID:66982216"
     mRNA            join(<1173467..1173710,1173767..>1174656)
                     /locus_tag="ACHE_40421S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278617.1"
                     /db_xref="GeneID:66982216"
     CDS             join(1173467..1173710,1173767..1174656)
                     /locus_tag="ACHE_40421S"
                     /note="COG:O;
                     EggNog:ENOG410PN69;
                     InterPro:IPR001841,IPR013083;
                     PFAM:PF13923,PF13920,PF00097,PF13639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136379.1"
                     /db_xref="GeneID:66982216"
                     /translation="MPDDVELRQEILQRTLEEVAQEKKQHQNHRNENAEEEGAANPCV
                     ICLDAIAEPGIAIPCGHANFDFLCFLSWLEQRPSCPLCKKEVISVKYDLDAAEGPKIY
                     KLPPPAPPTAPTSTTAPPSHRPHRPDFRRGRRPPREAQRPRAPEPDDPLLRRRHVYRN
                     QLYSLRVGSNRLSQYRELTPELFNCDEQLVSRARKWIRRELRVFSFLNPDPEEEDEGP
                     GPSRNNRIAHPGQQRLENRRGNNAEFLLEYVIAILRTVDVKGSAGQAEELLRDFLGRD
                     NARLFLHELSSWLRSPYMSLEDWDRNVQYEDTVGRPSRVPGPRGLEHDRRSTPVFGPD
                     RRSGRGRISKPYSPRRPYDRGRSRDASTQARRIQSARDRYIPD"
     gene            complement(<1174790..>1176464)
                     /gene="SLD2"
                     /locus_tag="ACHE_40422A"
                     /db_xref="GeneID:66982217"
     mRNA            complement(join(<1174790..1176282,1176338..>1176464))
                     /gene="SLD2"
                     /locus_tag="ACHE_40422A"
                     /product="DNA replication regulator sld2"
                     /transcript_id="XM_043278618.1"
                     /db_xref="GeneID:66982217"
     CDS             complement(join(1174790..1176282,1176338..1176464))
                     /gene="SLD2"
                     /locus_tag="ACHE_40422A"
                     /note="COG:L;
                     EggNog:ENOG410PKFZ;
                     InterPro:IPR040203,IPR021110;
                     PFAM:PF11719;
                     go_process: GO:0006270 - DNA replication initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="DNA replication regulator sld2"
                     /protein_id="XP_043136380.1"
                     /db_xref="GeneID:66982217"
                     /translation="MATATLAATDLRAELKEWERAFSAANGGRKAGRHDIKNNPDIAA
                     KYKAYGRMKALESAADKDKHHDQNESTLEERPKKRKHTSPTGPGHEQSNAATPRKSNK
                     GIFATPSRPRVNHPADLDPYDSPSVLRRLFSPSTHQQSTPLKAAVGPTPQRDGKALGL
                     FDLLSESGGSTATPSATRIASLQGAAVQTPSRRNRMETIAEEDEEEEEENPRGGRTPA
                     SSGKKLYLENLFATPTTMKYAAMVEDEEDRKPLTANVYAASEAAASANRKAAGPGETP
                     SFLRRSNAGRSSNGIDPSTGGLSPIAARKPPQFVGKGLSALVQGLRDMEEERMEDDMD
                     VLREMEAEQGAMDNNEIDMEDSQAGDGASRKPYKKKGQKRSTRRVRMKPVVVPKAQTK
                     STEPSGDDEEENEQAAIPETQFQGQSENHFSEDDDADDASLHSISEPELEDSDPDFDE
                     PVTKTKSFAEKMKEAISAGSKNNPQESSQSSELAKAKAKQKEKAKKDKEKEESAKPRP
                     RKVNPEAHANYRSLKIRNKNTKGRGAGRFRR"
     gene            complement(<1176747..>1177684)
                     /locus_tag="ACHE_40423A"
                     /db_xref="GeneID:66982218"
     mRNA            complement(join(<1176747..1177340,1177391..>1177684))
                     /locus_tag="ACHE_40423A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278620.1"
                     /db_xref="GeneID:66982218"
     CDS             complement(join(1176747..1177340,1177391..1177684))
                     /locus_tag="ACHE_40423A"
                     /note="COG:O;
                     EggNog:ENOG410PIKD;
                     InterPro:IPR009737,IPR036249;
                     PFAM:PF06999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136381.1"
                     /db_xref="GeneID:66982218"
                     /translation="MFRSLLSFGGAPREPEYIFPTVRPEEDGPDCRQDCADCTVKYPK
                     FKIDESKPLYGHIKAYSTHVLVATGQSDWIEKVKNDKGSLMEAFAQNSSRSKHGKIMV
                     SASNLQSPEDPAESDADSDAERKSTVLLLPSFTFIDSVRYTDVPELIDRFINSSPDPQ
                     ANGHDGSQMTPRACPHDYVILLCSHRRRDARCGITAPLIKKELERHLRALGLYRDDSD
                     ERPGGVGIYFVSHVGGHKYAANVLVYRKQEQQMIWLARVRPEHCEGIVRYTVMHGKVV
                     HPESQLRGGFDRLRGVTSW"
     gene            <1178398..>1181256
                     /locus_tag="ACHE_40424S"
                     /db_xref="GeneID:66982219"
     mRNA            join(<1178398..1179279,1179331..1180615,1180670..1180971,
                     1181037..1181126,1181182..>1181256)
                     /locus_tag="ACHE_40424S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278621.1"
                     /db_xref="GeneID:66982219"
     CDS             join(1178398..1179279,1179331..1180615,1180670..1180971,
                     1181037..1181126,1181182..1181256)
                     /locus_tag="ACHE_40424S"
                     /note="COG:S;
                     EggNog:ENOG410PKZB;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136382.1"
                     /db_xref="GeneID:66982219"
                     /translation="MNDSTEIPSHDPPSDPPPRARKRRRRTMACTQCRSRKLRCDREY
                     PICGRCQKSKNPAQCTYEDGFLWQQPNTVPATTVFSGAAGGAPGGVPGGVSGTTATTA
                     TNTSSTSNTNTAQETTVNNGCNHANHNPASLPRLADRTPLHTPPDSAITGWASRAQAQ
                     TSGTERRTECEGKKDRFLETVLGAPKSAVNQDSYVNTEVLQRHPPGSSGHSGYYPASS
                     HHSHHHSGPTHLPPLHHHHYSHYGYGHYNPEQDEEDEMGLASPSQQLDLAPRIMMRGK
                     ETRTRFNGSGILANVMAQFPDIKSFAEDIRVSSPHMAQVRPDLERVKRGLWKKYPLNT
                     PFPVPDTFSLVASLPSRRVVDDLVVLYLTYIESTHRILHVPSFLRELDHFWAQKDNPT
                     LVSPAFVVELMLVLACAWNLADPEVLKSKSEDRLQCYTAIEWVLHAEKWLENASIKRP
                     EITALRLYVLLIIAQNSHGMKRSKAWLSTGTLVKQAMLAGYHRDPSRYTKISVFNKEM
                     RRRIWTTIVELDLQVSMDRGMSPTAQVSDYDTGPALNINDNEIQETTTELPQSHPIGE
                     LTDCSFQTVMTQSLPLRLKICQLMHIPRISCHYDEILRMDWELVRYLSKIPTWATSDA
                     DDLQTQHKVIMIRALLETRIGHCLLSLHTPFAIEAPKEPLFTPSARARLEVATMMLST
                     QRRLHETARSLSLCNTGDWTMQAFCSICQALHASVGDGGGGSVTSLTRTLLGFPEALV
                     TLAEAILMCLEARWLLVVKGAKEYFFMSTILALVKTKLWPSQGNMYKQEVIDRVITFA
                     QTLFTRHANCAHLGPLGMGCFQTNQIPTLTPGPPLAPSLTPGFSGLLQASGLGITPPG
                     EFDPFLDVYDFEDLTGITLGE"
     gene            <1181915..>1183308
                     /locus_tag="ACHE_40425S"
                     /db_xref="GeneID:66982220"
     mRNA            join(<1181915..1182708,1182760..1182947,1183001..1183029,
                     1183081..>1183308)
                     /locus_tag="ACHE_40425S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278622.1"
                     /db_xref="GeneID:66982220"
     CDS             join(1181915..1182708,1182760..1182947,1183001..1183029,
                     1183081..1183308)
                     /locus_tag="ACHE_40425S"
                     /note="CAZy:GH43;
                     COG:G;
                     EggNog:ENOG410PUHR;
                     InterPro:IPR023296,IPR006710;
                     PFAM:PF04616;
                     SECRETED:SignalP(1-23);
                     TransMembrane:2 (n6-17c23/24o368-386i393-411o);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136383.1"
                     /db_xref="GeneID:66982220"
                     /translation="MSQNMLFLSILLILATLPQWTAAIPAVRLPNKPHIFSETKNYPL
                     PNLGNIQVHDPNIVELDGAFYLFKGGVHVPIHKASSLDGPWQKIGTVLDGPSVIEKQN
                     RTRPWAPTTVQWKNRFYCFYTISKNGVRNSAIGVASSDSIDQGGWTDHGAVINTEKGH
                     LADIYPLTVSNAIDASFIADQSTGKPYLLYGSYWHGIFQIPLADDLLSVEDEERLNAE
                     HLVFLPEHKVKPQEGSFMTYREPYYYLWFSHGKCCDFHKGFPAMGREYSIRVGRSKDV
                     TGPFVDKSGKKLLDGGGTTVYGSNHGLVYAPGGIGVLPENKDHQDIMYYHYLNTTIGF
                     HNSDAQLGWSYIEYIDGWPVARAKASSAPPRANYTINLMVLMCMCFLILNLLRKHSSG
                     LKLIASVAFLVVWVLVWLVR"
     gene            <1184277..>1187835
                     /locus_tag="ACHE_40426S"
                     /db_xref="GeneID:66982221"
     mRNA            join(<1184277..1184397,1184456..1184701,1184760..1185200,
                     1185259..1186242,1186292..>1187835)
                     /locus_tag="ACHE_40426S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278623.1"
                     /db_xref="GeneID:66982221"
     CDS             join(1184277..1184397,1184456..1184701,1184760..1185200,
                     1185259..1186242,1186292..1187835)
                     /locus_tag="ACHE_40426S"
                     /note="COG:Q;
                     EggNog:ENOG410QDBT;
                     InterPro:IPR002401,IPR001433,IPR036396,IPR017927,
                     IPR003097,IPR017972,IPR023173,IPR029039,IPR001128,
                     IPR008254,IPR017938,IPR039261,IPR023206;
                     PFAM:PF00175,PF00067,PF00258,PF00667;
                     go_function: GO:0003958 - NADPH-hemoprotein reductase
                     activity [Evidence IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_function: GO:0070330 - aromatase activity [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136384.1"
                     /db_xref="GeneID:66982221"
                     /translation="MSTNKPVPIPGPRGVPIVGNLYDIERDVPLNSMELMADNYGPIY
                     RLTTFGISRVFISSHELADEVFNEERFAKMVAGGLKEIRNGIHDGLFTANYPGEENWA
                     VAHRVLVPAFGPLSIRGMFDEMYDIATQLVMKWARLGPKTPIMVTDDFTRLTLDTIAL
                     CSMGTRFNSFYHDEMHPFVEAMVGLLQGSGDRTRRPALLNSLPTSENAKYWSDITYLR
                     ELSQELVNARKENPEDKKDLLNALILGRDPQTGRGLSDDTIIDNMITFLIAGHETTSG
                     MLSFLFYFLLKNPAAYKKAQEEVDTVIGRRKITVEDLSKLPYINAVMRETLRLRPTAP
                     VIAVHAHPTKNKESPVTLGNGKYVLNDDEVIAVVLSKLHRDPEVYGPDADEFKPERML
                     DEHFDKLPKNAWKPFGNGMRGCIGRPFAWQEALLVVAILLQNFNFQLDNPSYDLRIKQ
                     TLTVKPKDFYMRATPREGLDAIKLGTFLSGSDAPETSGATSRDRKAKVAPPPGETKPM
                     HIFYGSNTGTCEAFARRLADDALGYGYSAEVKPLDSAMQDVPKKDPVVFISASYEGNP
                     PDNAAHFFEWFSSLKEKELEGVNYAVFGCGHHDWHATFHRIPKTINQLAEERGANKLC
                     DLGLADVANSDMFSDFDTWGESAFWPAITSKFGGSQTADTSKPKSGFQVEVTSGLRAS
                     TLGLQLQEALVLENQLLTQPSVPAKRIINFKLPTDMTYQCGDYLAVLPVNPRSIVRRA
                     IRRFDLPWDATLKIQKSSQSSGSASIPLDTPISAFELLSTYVELSQPASKRDLNTLAD
                     AAVGDAEVQAELRYIASSPSRFAEEVSKKRASPLDILTRYPSIALPIGEFLAMLPPMR
                     VRQYSISSSPLVNPSECSITFSVLNAPSLAAPPKDEADEEERYLGVASTYLSELQAGE
                     RAHVIVRPSHSGFKPPTNLKTPMIMACAGTGIAPFRGFVQDRAEKIRGRSAGQDLPDE
                     DKPAKAILYVGCRTDGKDDVHASELAEWSKLGAVDVRWAYSRPADGSPGQHVQDRMLD
                     DRDELVEIFEQGARIYVCGSTGVGNGVRKACKDIYLARRKVIREEKRERGEEVEDVDE
                     ETAAERFFEGLKTKERYATDVFT"
     gene            <1188099..>1189316
                     /locus_tag="ACHE_40427S"
                     /db_xref="GeneID:66982222"
     mRNA            <1188099..>1189316
                     /locus_tag="ACHE_40427S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278624.1"
                     /db_xref="GeneID:66982222"
     CDS             1188099..1189316
                     /locus_tag="ACHE_40427S"
                     /note="COG:Q;
                     EggNog:ENOG410PKUV;
                     InterPro:IPR036291,IPR011032,IPR013154,IPR002328;
                     PFAM:PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136385.1"
                     /db_xref="GeneID:66982222"
                     /translation="MPTPKTMKAITWEGKPFHMSLKDTTTPQLKDPTDALIQLTTAAI
                     CGTDLHTYRGLAGSKNPPWIMGHEGIGTVIQIGQGVKTLKVGDRVVIGPTSCGYCNNC
                     VRGKWTYCLTFHPETLLDFPGLGDDFGVGLGGTQAEYIRVPFADSSSFLIPPNSTEHD
                     SDRDIDYVLLSDIFPTAWNGLSSSGFEPGDTVAVFGAGPVGLLCVYSAVLRGASRVYS
                     VDYVPSRLEKAASLGAVPINFKDSDPVQQILAREPPSHPDGTDGGVRRSCDCVGFETL
                     NAKLEREAGIVIRNCINVTQPTGGIGIVGEYPPAGLGASPGAPLATGKEGVFEIPLGT
                     LWAKNLSVGSGAVQVKELQFVLREMIEKGVARPGVVVDEVLYGLGGVVGAYERFERRE
                     VGKIVIRLGHGDD"
     gene            <1191789..>1192724
                     /locus_tag="ACHE_40428S"
                     /db_xref="GeneID:66982223"
     mRNA            <1191789..>1192724
                     /locus_tag="ACHE_40428S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278625.1"
                     /db_xref="GeneID:66982223"
     CDS             1191789..1192724
                     /locus_tag="ACHE_40428S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136386.1"
                     /db_xref="GeneID:66982223"
                     /translation="MKFSGAATVGFVSCALAMPTRVNERGLFPFPGLGDSKPSDLPKP
                     SGTPDLSDLPKSSGFPVLGDLSKPSDFPDLGELAKQFGGDKEKRGLFPLPTGLPSLGD
                     LPKPSGSGISLPSGLPDLSDLFGGGSDSEKRDLPFPIPSDLPKPSGLPSLGDLPKPSG
                     LPDLSDLFGGGSDSEKRGLFPFPIPSDLPKPTGLPSLGDLPKPSGSGLPSLGDLPKPS
                     ELPDLGDLAKLFGGDKEKRGIFPFPIGEFPKPSDLPKPSETSKPSGAPKLGGFPGFGD
                     LPQPTDLPSLPKPSDAPTPTGAVPTPTAPVIPFFG"
     gene            complement(<1195369..>1197672)
                     /locus_tag="ACHE_40429A"
                     /db_xref="GeneID:66982224"
     mRNA            complement(join(<1195369..1195478,1195536..1195972,
                     1196022..1196329,1196434..1197185,1197255..>1197672))
                     /locus_tag="ACHE_40429A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278626.1"
                     /db_xref="GeneID:66982224"
     CDS             complement(join(1195369..1195478,1195536..1195972,
                     1196022..1196329,1196434..1197185,1197255..1197672))
                     /locus_tag="ACHE_40429A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136387.1"
                     /db_xref="GeneID:66982224"
                     /translation="MAAAITSWVLNPIQSLTMSRPRTRKLWCAVPSNLREPFSVACFS
                     DQDDIETLKEKIWEKIKERIKDTAPHYSNLTLYSPVVQLNHEEQFRIDDGEFLHPRRM
                     ITSNPLFPESKDPDVDIVVVVSGGATPQKQKCSESQHANISQTQPITKDPHVCPRERT
                     VSRLAAILDEVNIVHVRGTPASGKTYISELLRHHYRKGGRRVSLIKKWEGLDFKNPWD
                     SLVKLVEKWNEELGDAPITTFTTTSSKSKHDLSWVLTSNTVILVDEAQMTYSDDVLWN
                     TILKGRQSSLFGYNFRLCLFCSYGSPEAGPDQTFFTPVRLSNQQCISLTPQSQQYSPP
                     IGLFYDKEEFRDVVSRSIPVEYQETFTFDEGAQDYIFALSNGHPGAVESILSTLFQAY
                     RHDIKYRHIKTLTEDHVIWFLEDTATVFQKLSTQPVNRSFPKIPEATGGISDVLNKIT
                     EEGSIPFDINDASIKFCYQKGWIHRVALGGHDIAVLPSRLHEKYIEYSIGTMSQRLPV
                     RFNSLPTLCKEILSKFSIMNLRHSAEGKKMSSASQPRPVEAQYQDEFYRGFNHVAGQG
                     VPISSEWSRTKDGRVDFYIPEKKWAVELLRDHGEVDEHISRFKAGGKYHPWLEEKMIK
                     DWIIIDCATSLPTKGFSEPRLWHAVFINDYSELQLYNHQKALIMSVHLYN"
     gene            <1203075..>1203278
                     /locus_tag="ACHE_40430S"
                     /db_xref="GeneID:66982225"
     mRNA            <1203075..>1203278
                     /locus_tag="ACHE_40430S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278627.1"
                     /db_xref="GeneID:66982225"
     CDS             1203075..1203278
                     /locus_tag="ACHE_40430S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136388.1"
                     /db_xref="GeneID:66982225"
                     /translation="MSKASPVQPASFADEAAEADTSIAADPIDNYSLSGELVNFWGIN
                     GLNAKLDFNQVDGAMREKVNWLG"
     gene            complement(<1211804..>1216957)
                     /locus_tag="ACHE_40431A"
                     /db_xref="GeneID:66982226"
     mRNA            complement(<1211804..>1216957)
                     /locus_tag="ACHE_40431A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278628.1"
                     /db_xref="GeneID:66982226"
     CDS             complement(1211804..1216957)
                     /locus_tag="ACHE_40431A"
                     /note="COG:L;
                     EggNog:ENOG410Q09C;
                     InterPro:IPR021109,IPR000477,IPR000953,IPR036397,
                     IPR023780,IPR001878,IPR032549,IPR041373,IPR043502,
                     IPR041588,IPR001584,IPR012337,IPR016197,IPR043128;
                     PFAM:PF16297,PF17917,PF17919,PF00078,PF00385, PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136389.1"
                     /db_xref="GeneID:66982226"
                     /translation="MSAAPRPPFLPGSLEEFTEHAATHHSEWFQYCRLAYEYIEEAEA
                     AITEARGQADQTSLKLQASETEVSRLKEELSALHLKQEKNQARDQGIIEYQKEQLRES
                     QQKYLEALKEKDEALRLATPVVNTPARTPEPTAEIHTVAPVGTPASVDPPSTSSARLS
                     ERLPDPDRFEGDRKDLRRFISQIHEKMNVNHDRYPTPQSRMTYVTNRLRGAPYAQVLP
                     YIKKGICQLKDYEEILKILDRAFGDPNRVNNARNELFRLRQANKEFGMFFAEFQRLAL
                     EGEMSEDVLPTLLEQAINRELRGMLMHNEPPNREYHQFANFLQDLENRRRHYENNPPP
                     AARTYASATKPTNPVRPTEHPATLQPAENNTDVMDLSSAHRHTTSRRDRGECFRCGSK
                     NHLVRNCPLPDNRPVGVCPAYLSPPSSLPRKPRTYTCVRTIPFPIPRPVSKRSESGLS
                     RDQTMNERTIRISAAATQGLTVEEESYRSNLMILPITLSRHEKELLSYAMLDTGAEGK
                     RFIDKEWAQDKGLELLPLKKPIRLETFDGQEAESGPITHYAQMHMRINDHQERRACFL
                     VTQLAHYPVVLGLPWLKIHDPRIGFAEHTVLFDSKYCQEHCNMPMRPAKIRALHDIPQ
                     KTRPKHLPPRPERLKHRDIAAVSMSACCAYARRSYRLFTVTVDDIEAALNPVPDEEDP
                     MAKLPPEFQDFADVFSPREAERLPPHRPYDHDIKLQDGKVPPFGPLYPMSREELKALK
                     EWIEENLKKGFIRPSSSPAASPVLFVKKPGGGLRFCVDYRALNAITVKDRYPLPLTKE
                     TLNNLKGMKYFTKIDIISAFNNLRIKKGLEYLTAFRTRLGLFESLVMPFGLTGAPASF
                     QRFMNDTLRDYLDTFCTAYLDDILIYSKTREEHTRHVCLVLEKLRDAGLFAKLSKCEF
                     AVPETKFLGIIVGRDGLRMDPDKVKTIVDWETPTCVTDVQAFIGFANFYRRFIKDFSK
                     IITPLVNLTKKGIQFKWNTTCELSFNMLKKAFTTAPVLRPFDWNKEVILETDASDYVS
                     AGVLSQYDDDGVLHPVAFFSKKHSVTECNYEIYDKELLAIIRCFEEWRPELEGTPSPV
                     KVITDHRNLEYFMTTKLLNRRQARWSEFLSRFNFKIIYRPGKQGVKPDALTRRSEDLP
                     KEGDERLLHQSQTVLKKENLELAPDSSSVTLNVTTRAQAHSAENPIVNPPRTPAQTRR
                     VRFADETNHNVPEPPQDIKNLLDSAYPLDETVQSILEALDKNATRHPKITLADCQRRG
                     NYLFYRNRLYVPDHGELKAELLRQCHDKPAAGHPGRSKTYELMSREYYWPGMYQYVEQ
                     WTQNCHTCRRITPSREARQGLLRPLPVPERSWQDISMDFITHLPPSHGYDAILVVVDR
                     LTKMKHFIPCKGTCNAEEVAHLYTCNVWKLHGLPRTIVSDRGPQFIAQFWKHLMRRLQ
                     ITNLLSTAYHPETDGQTERTNAVLEQYLRAYVSYLQDDWSEWLPLAEFAANSTRSETT
                     CVSPFFANYGFHPRMGFEPVQPTNQPTRDAEEFACRMKLITEFVRTEIISAQARQEEQ
                     ANRKRQPARCYQVGQYVWLDSRNIRTLRPQKKLDWKNLGPFCITEIVSPHAYKLDLPA
                     SMRIHPVFNVSLLRPAARNPAPGQRQEPPPPVEVDGLEEWQVEDILDSRWERRGRGGP
                     RLKYTVKWTGYDELTEEPASYLEHAQEIVTNYHRRYPYKPGPGLDGARP"
     gene            <1219733..>1224559
                     /locus_tag="ACHE_40432S"
                     /db_xref="GeneID:66982227"
     mRNA            <1219733..>1224559
                     /locus_tag="ACHE_40432S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278629.1"
                     /db_xref="GeneID:66982227"
     CDS             1219733..1224559
                     /locus_tag="ACHE_40432S"
                     /note="COG:S;
                     EggNog:ENOG410QDZF;
                     InterPro:IPR012337,IPR036397,IPR013103,IPR001878,
                     IPR001584,IPR018247,IPR036875,IPR043502;
                     PFAM:PF07727,PF14223;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136390.1"
                     /db_xref="GeneID:66982227"
                     /translation="MMVGTGSESKMPSKEPLEDPGIKIYSFNIEKLNEENARYWFYAM
                     ESQLKVQFAWQAIDYYYEVGKETYNQIRKDNLKWTKVDMKADMIIQQGLTPTIVLEIK
                     DLPNAGAKWDYLKEAYLKSSNAMKAMQLMKMANWYQGSNVNAKDAYREIEQLGRELID
                     MNGSKKIDIDELVVIWYLRGLREEYAMLKGTVMSSDVNLNKSYVLKRAIDFDQLRGGP
                     TEKASRIQKKGTKCFACGKTGHRARNCLSKRDDHDASADESKRQGGRDGRNKKPNRFS
                     KQKGKSAKEGGSMAGNNNDDDDNDDGGYMSEYGTRAIEVADISEETAMHAAECAVEYT
                     AEDAGSCVGDGHVDEDSDVQDGFTCEEAQFPEEHDACATEDVQASPITEYKIEWAKYI
                     IEGAHRVRMDPSRWCFDSGATSMCSGNRSIFEYLDETSRGHLIIASGTEMPIKGRGIV
                     RFNLPNGMSARLGRVVYVPGLAENLLSLEVLHMAGFQSIGSRKGYVLKKDGKVVAQGK
                     RDGRTTYLHSVRHVNALFIGPKAAKRQQYARMALSADEQTRMKQELIHRRLGHAGRSR
                     FNTCVEYMELDELKLGKRDQLLHDNCEVCAKAKKVKKQSHAPIPRARKPLERVYMDFW
                     GPNREGIGQERYYLSLIDDCTRYSWIFIKMDRRAESVMHTLDSWLRQVERQSGKVLLV
                     IRTDNAAEFVALRPWAEEKGIELEFIEAETPAQNGVAERYNRVIMDIARALLIDSGIS
                     KRYWKYAAVTANYLRNRTLLVKRKEDGHEKVDKDEKTPYELWHGHRPDLAHLRAWGCR
                     VLFYHKPESKLESRAMEGTFLMYGKSNKQYLVLPRGGSELKLVTNPEFRERENGNLSE
                     LSAGQVDIQSLLTSTVLPVGPPTEAPAQASIGMTSKRPTEEPAGAGLPVNEPFHTNEP
                     TINSMPELLNMRLNKEDGEKERNSSSSTGGTTDKPLKLSEVQPEGEVEQRAPVEYTNN
                     EVLEKEPREQADETPKDMPKPEPVPEDGRHRSELEMERRSARVRQPSERMMESRQTEQ
                     MYGRKRKAEGEDTGNNDRPAQRMRAHFARLAVAAELLQTDREYEVAEKACAAREKAGI
                     RIPKSYSEAVNDPIYGSKWKEAIHKELSTLISFGTWELIPRKEAEGTISSTRWVFDVK
                     LGPDGRIDRFKARLVARGNEQSDDDFNETFAPVFRIDSLRILLAIAAQLGLLAHVLDA
                     NNAFAGSDLDKPNCMEIPEGLQDFDPDVTSTRGLVLELKKSLYGLRQSANLWHRKISD
                     FLKKIGFKPITADPSVFINGRGLIIAVYVDDIVIFGKDANDIDVVKQKLKEFHPMTDS
                     GLVKKLLGIRFTWGRDRSIQLDQQSYAQQILDEFGMADCKPVSTPIGPSIKLEAPDSS
                     LLGRAEHKLFRRLIGRLIFLVIATRPDIAFAVNQLSQYLAEPRKVHLAAAKHVLRYVK
                     GTMGYGLTFGAKGSPKGLYAYADSAYANSAKNRSTTGFIFFINGTPITWSSRKQSVTA
                     QSSTEAEYMAVSEAAKQAVWIRHFLYAIGKGSIYRDAPTTIYEDNQGAIKIADNPINH
                     PKTKHIAVRYHAIRDHIGNGEICLEHLSTDKMIADGLTKVTNHASQGRLVEDLGLA"
     gene            <1227490..>1228670
                     /locus_tag="ACHE_40433S"
                     /db_xref="GeneID:66982228"
     mRNA            join(<1227490..1227556,1227610..1228098,1228177..>1228670)
                     /locus_tag="ACHE_40433S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278632.1"
                     /db_xref="GeneID:66982228"
     CDS             join(1227490..1227556,1227610..1228098,1228177..1228670)
                     /locus_tag="ACHE_40433S"
                     /note="COG:G,M;
                     EggNog:ENOG410Q8ND;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136391.1"
                     /db_xref="GeneID:66982228"
                     /translation="MANLKKIAVIGGTGAQGMPVVKALAESGKYRLIVLTRSVESSRA
                     KVLAALPNVTLLQGAQDNQQDLHRLFRGVYGAWVNTDGFTLGEKDELFYGFRAYEIAR
                     SERVQHYVWANIEYAMDAANFDEKHHCGHMESKGRVGKFILAQGQEDMKSTLFSTGPY
                     MDMLMDGMFVPIKQPDGSFMWANPAPSDVRIPLIALCDIGVYNLWIFDNPSESAGIDL
                     QVVTDNVSFGEIARIFTEVTGRDAVHKTIPFETYAHLAEPYPGASVNWVLGPEAARDD
                     SIMSWRENFEAWWRYWGDGITKPRDLSILDRIHPNRIKTLAGWMKHVGYDGERKNVLK
                     MVEDWGIKNGAPPAR"
     gene            complement(<1234580..>1234861)
                     /locus_tag="ACHE_40434A"
                     /db_xref="GeneID:66982229"
     mRNA            complement(<1234580..>1234861)
                     /locus_tag="ACHE_40434A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278633.1"
                     /db_xref="GeneID:66982229"
     CDS             complement(1234580..1234861)
                     /locus_tag="ACHE_40434A"
                     /note="COG:E;
                     EggNog:ENOG410PHIF;
                     InterPro:IPR023209;
                     go_function: GO:0003884 - D-amino-acid oxidase activity
                     [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0046416 - D-amino acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136392.1"
                     /db_xref="GeneID:66982229"
                     /translation="MHAGDAGLLLVARDFPSDISVNYISPWAGAYHRPVLDSSLQALK
                     EINQVQRTYGFFKRVAANESAVSILIKGEEHFESPSQEYLDYQSVRTNI"
     gene            <1235747..>1237368
                     /locus_tag="ACHE_40435S"
                     /db_xref="GeneID:66982230"
     mRNA            join(<1235747..1235877,1235970..1236552,1236603..1236965,
                     1237024..>1237368)
                     /locus_tag="ACHE_40435S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278634.1"
                     /db_xref="GeneID:66982230"
     CDS             join(1235747..1235877,1235970..1236552,1236603..1236965,
                     1237024..1237368)
                     /locus_tag="ACHE_40435S"
                     /note="COG:Q;
                     EggNog:ENOG410PHSG;
                     InterPro:IPR020946,IPR036188,IPR000960;
                     PFAM:PF07992,PF13454;
                     go_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136393.1"
                     /db_xref="GeneID:66982230"
                     /translation="MPAKSVAIIGAGPAGAITVDALMQEKTFDSVRVFERQDQSGGCW
                     IYRPNEPRLPLDIDKLSARTADTPIPIPPQLPCHAPAVSQNRFADSHIYPTLETNVDA
                     SVMSFSQEAIPPVRSERSIALHGPDTPFRHHTVVKKYIDDLFNRNGYQDLVEYNTTVE
                     RAVKSPESGKWELTLRRGEKGNVDYWWTESFDGLVIATGHYSVPYIPAIPGLKEFAER
                     YPGSVEHTKQYRGPEGYRGKRIVTVGASVSAADTAVSLIDHAQAPIYTVTRGKYNVYF
                     GGHAFKHPQLSERPPISHISVDNRTVHFEDGTSAAGVDHIIFGTGFTWTLPFLPDIPT
                     RNNRVPDLYQHVFYQQDPSLVFIGAVGTGLTFKIFEWQAVAAARVLAGKASLPPLHDQ
                     RRWETDRIAERGDGPSFTLIHPDFKEYFEEMRRLAGEPGEGQPGRKLPVFEQKWVDDF
                     WAGHERRIKMWTTLNGEGRGYRL"
     gene            <1239551..>1241050
                     /locus_tag="ACHE_40436S"
                     /db_xref="GeneID:66982231"
     mRNA            join(<1239551..1239818,1239891..1240853,1240902..>1241050)
                     /locus_tag="ACHE_40436S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278635.1"
                     /db_xref="GeneID:66982231"
     CDS             join(1239551..1239818,1239891..1240853,1240902..1241050)
                     /locus_tag="ACHE_40436S"
                     /note="COG:S;
                     EggNog:ENOG410PMCW;
                     InterPro:IPR006076,IPR036188;
                     PFAM:PF01266,PF13450;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136394.1"
                     /db_xref="GeneID:66982231"
                     /translation="MPQGNTLPNQAPSLSYWQRTTRSFPHLHANNTNPVPTSAKYVVI
                     GSGIAGALTAFELLEAGVNAKEVVILEAREAAGGASSRNAGHVRPDAFRGFTAYSKVH
                     GKEQALKIIANERLVLQKVDEFVNKHSVACDFHRTMTFDVCMTPEFAKYEAASISAYR
                     DAGGDVSHINYYTGTEAQEKTKVPGAVAAYEWSAGSSHPAKLAQFLLNSVIGRGARLF
                     TFCPAMAITQSSDARPGLWNVHTPRRTLTTEKVIHCTNAHAAFLLPLLDNYITPNRAQ
                     AHSLIPTAAFTGTNILQNTFSLRYSLHHFYSLVQRQADGTLILGVSRSNPTLSRETID
                     GQLSTDDSKYNWEIAQDALRSFGEIFPSYEPGALMHGEGLDHAWTGIIAMTADSVPFV
                     GEVEELPGQFVCAGFNGHGMARIFTCAPGIVKLVLGKQWEETGLPECFQISTERLGRL
                     SSQAVPSVW"
     gene            complement(<1241530..>1242673)
                     /locus_tag="ACHE_40437A"
                     /db_xref="GeneID:66982232"
     mRNA            complement(join(<1241530..1241824,1241877..>1242673))
                     /locus_tag="ACHE_40437A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278636.1"
                     /db_xref="GeneID:66982232"
     CDS             complement(join(1241530..1241824,1241877..1242673))
                     /locus_tag="ACHE_40437A"
                     /note="CAZy:GH16;
                     COG:G;
                     EggNog:ENOG410PJVM;
                     InterPro:IPR000757,IPR013320;
                     PFAM:PF00722;
                     SECRETED:SignalP(1-19);
                     TransMembrane:1 (n5-15c19/20o296-318i);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136395.1"
                     /db_xref="GeneID:66982232"
                     /translation="MLARFFIGLLLACIASVHAQTFTDCNPTKEDCPADPALGTNHTW
                     VFNGTQDENIWTTTNGEIDWTENGAEFSIKKKLDSPTLQSKFYIFFGIVESHVKMAKG
                     GGIISSVVLQSDDLDEIDWEWVGYNTSQVQSNYYGKGNDSSYDRGGYHDVSNADTEFH
                     NYTTYWTKDKVEWWIDQELVRTLNYEDALDGKNFPQTPSNIRFGIWPAGDSGNPLGTI
                     EWAGGEVDYDKGPYTMVVEKVRVHDFSSGKEYEYTDKTGDWESINVVEGNSTTVTELN
                     KPPPKSLSEKWDELPTGAKAGVGIGAGAVGAIGIAAMILYCIRQRRKGRLEHALDDSN
                     WNQDRAEMSNFQSDWKQSEFRNKGYQPVS"
     gene            complement(<1243721..>1244124)
                     /locus_tag="ACHE_40438A"
                     /db_xref="GeneID:66982233"
     mRNA            complement(join(<1243721..1244044,1244122..>1244124))
                     /locus_tag="ACHE_40438A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278637.1"
                     /db_xref="GeneID:66982233"
     CDS             complement(join(1243721..1244044,1244122..1244124))
                     /locus_tag="ACHE_40438A"
                     /note="COG:S;
                     EggNog:ENOG410Q1WJ;
                     TransMembrane:1 (o20-43i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136396.1"
                     /db_xref="GeneID:66982233"
                     /translation="MAPILARQSSDSGNTCPSTISGGGIAGIVIGSIAGTLLLIWLWK
                     VCTLKGAWSGGEPDVGYVPGAGTSSRGRRRRRRTSSPSVVEYVEKGSRSRPRYEPRRP
                     ARVYMT"
     gene            <1248765..>1249411
                     /locus_tag="ACHE_40439S"
                     /db_xref="GeneID:66982234"
     mRNA            join(<1248765..1249273,1249333..>1249411)
                     /locus_tag="ACHE_40439S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278638.1"
                     /db_xref="GeneID:66982234"
     CDS             join(1248765..1249273,1249333..1249411)
                     /locus_tag="ACHE_40439S"
                     /note="antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136397.1"
                     /db_xref="GeneID:66982234"
                     /translation="MNSPVVSSNIHQRSFTITEYILGLQRNYKSYTENQPSCTAITII
                     TTVPPAAVTTAVLEALEAPVALVVLEVLEVLAAPALTIAPVSRNSVHRALVPTITRLH
                     TTTSKVPGPDSAVQVPTTALDSVLGLGLMDIITDPDTMDLDIVVLVRPVSDTMAVHLG
                     TMAITAIMDRTSLTSNTITDFWERFCITVTINHNP"
     gene            complement(<1249707..>1254321)
                     /locus_tag="ACHE_40440A"
                     /db_xref="GeneID:66982235"
     mRNA            complement(join(<1249707..1249802,1249853..1249930,
                     1249978..1250733,1250791..1253717,1253787..>1254321))
                     /locus_tag="ACHE_40440A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278639.1"
                     /db_xref="GeneID:66982235"
     CDS             complement(join(1249707..1249802,1249853..1249930,
                     1249978..1250733,1250791..1253717,1253787..1254321))
                     /locus_tag="ACHE_40440A"
                     /note="COG:D;
                     EggNog:ENOG410PFHT;
                     InterPro:IPR010935,IPR003395,IPR041738,IPR027417,
                     IPR024704,IPR036277;
                     PFAM:PF06470,PF02463;
                     antiSMASH:Cluster_4.2;
                     go_component: GO:0005694 - chromosome [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0051276 - chromosome organization [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136398.1"
                     /db_xref="GeneID:66982235"
                     /translation="MSTIAKGRPSRRSAPRRSYVVESTPDSEDSGNVTPTPSNHGGAD
                     DDDEEEEEEEYTPVPKRTSTSRQSMPRQSMTRQSRRQSTASTASSVSSASRASSRAST
                     ASRPVSRASRASRAPTAEPATPSTTRPARKSRRSMSGEPVQTSQASDSNEDGDSVASM
                     GEEPQSPSQAAAATLKRKKTSASPQSQAPSRRSSIAPLADITDSAVNQTPKPTEEQKS
                     QISIINPNTTVLEKPMDIMMKSRNVAPPEPQEPEGPKTRLMMTTLVLTNFKSYAGQQI
                     VGPFHASFSSVVGPNGSGKSNVIDALLFVFGFRASKMRQGKISALIHNSANYPDLPYC
                     EVEVHFQEVMDLPTGEHEVVPDSQLIISRKAFKNNTSKYYMNGKESSFNTVGAFLRDR
                     GVDLDHKRFLILQGEVESISQMKSKAANEHEDGLLEYLEDIIGTSKYKTPIDEAANEL
                     ESLNDVCVEKNNRVQHVEKEKAGLEDQKNKALSYIRDENEMAEKQSALYQIYINECLD
                     NIRVTEEAILQMQELLNLELEKHEGNQSGIKDIEKTYKRGLKEYESMEKEVQSLTKEM
                     AKYDKESVKFDEKKKFLVGKQKKLEKSMHSTRLAASECQSLVEKHTHDIEKKTAETNE
                     LEKEMKVEEQELSTIRDGLKGKTQGLSDKITAKQRSLEPWDEKINQKQSAIAVAQSEL
                     DILRERSNAGTVLLEEAQSKVSSIEETLAAKQDDLEEHKSQKATLEEEVAKLKSDLKK
                     YTAREPEVRTHVSSARQKADEARASLHSTQNRGSVLTGLMRLKESGRIDGFHGRLGNL
                     GTIDEKYDVAISTACPALENMVVESVEVGQQCIDYLRKNNLGRANFILLDRLPRRDMS
                     SIYTPESVPRLFDLVKPKDPKFAPAFYSVMQNTLVAKDLEQANRIAYGARRWRVVTLD
                     GQLIDVSGTMSGGGTRVARGGMSSKQVADTSREQVAKLEGDLEETERKFLVFQEKQRN
                     IESMMREKTEEIPRIDTKIQKITLEIESASRGLADAQRRVKELGAEHKPSKTDAGQAA
                     VLEKQIASLEEEIEGLREQRGGIEEEIQTLQDKIMEVGGVRLRSQKAKVDGLKEQISM
                     LAEEISNAEVEKSKNEKQIAKHQKSRADAEKELEQVSEGLEKLEADVENQTNDASGWR
                     QRVEDAQEALETKKGELKSMKDELDDKVAGLNESRAIEIEMRNKLEENQKALSENEKR
                     GRYWQEKLSNLTLQNVSDLGDDEQEPAELQTFTKDELDEMNKESLKAIIAALEEKTQS
                     ASVDLSVIEEYRRRTAEHSSRSADLATALASRDSAKARLDGLRSARLNGFMEGFGIIS
                     LRLKEMYQMITMGGNAELELVDSLDPFSEGIMFSVMPPKKSWKNISNLSGGEKTLSSL
                     ALVFALHHYKPTPLYVMDEIDAALDFRNVSIVASYIKERTKNAQFIVISLRNNMFELA
                     SRLVGVYKVNHMTKSVTIENKDYITGR"
     gene            <1254592..>1255645
                     /locus_tag="ACHE_40441S"
                     /db_xref="GeneID:66982236"
     mRNA            join(<1254592..1254745,1254812..1255041,1255100..>1255645)
                     /locus_tag="ACHE_40441S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278640.1"
                     /db_xref="GeneID:66982236"
     CDS             join(1254592..1254745,1254812..1255041,1255100..1255645)
                     /locus_tag="ACHE_40441S"
                     /note="COG:S;
                     EggNog:ENOG410PSEP;
                     InterPro:IPR025151;
                     PFAM:PF13934;
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136399.1"
                     /db_xref="GeneID:66982236"
                     /translation="MAPWDDFDAIFSFNRNFVYDGKVIEQIISNRRALENRLFADRLL
                     GLLGVKAVTKLYPPKSNSDLRTLVGHITSSPLDIHHKQALIYYILKDCRAAGDAATHF
                     ARRCHLPEKYRLFIEGLWNLDRLEFRRAVEFLTEPSIIPTFPDEILYALTLSNLPKHD
                     DSLVMAYYFTVGPPLATEKVQKAFFATICRASITEAFYFTRKNDESLRRSYLEQLIVF
                     VHKTTAGQIRSKRAMELIGLPLDEKEEQWFEEALLQGRAKALHGAKDTVMMRRLATGK
                     LSGLPADLESLGGKKVDGLNWDILKQSMPVRNT"
     gene            <1256119..>1257945
                     /locus_tag="ACHE_40442S"
                     /db_xref="GeneID:66982237"
     mRNA            join(<1256119..1256164,1256219..1256308,1256362..1256395,
                     1256448..>1257945)
                     /locus_tag="ACHE_40442S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278641.1"
                     /db_xref="GeneID:66982237"
     CDS             join(1256119..1256164,1256219..1256308,1256362..1256395,
                     1256448..1257945)
                     /locus_tag="ACHE_40442S"
                     /note="COG:N;
                     EggNog:ENOG410Q112;
                     InterPro:IPR000571;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136400.1"
                     /db_xref="GeneID:66982237"
                     /translation="MVVCNFFLQGRCRFGERCKNEHPGQATMGTSGSRFGALAGGGGF
                     GGRTGPQAQQAQNYSVNADDIKTDLTAGKGRPEWIFSCYGPGRNAPRQLFGGPQREQS
                     FEELRLRHYEAAATGNAEQAVQEAQMLYAESVNQMETALRDISGAIKYVLDGANEHPN
                     RIDITEGKTGPIPGPGPGPFPQPSAIGTSPFGQPSGFGQAGQAAFGKPSGFGQPSAFG
                     QPSAPAQPSSFGQPSALGTGSAFGQPSGLGGGSAFGKSAFGQPSFGQPSTSQPSAVQP
                     SSFDQPAFGQPSFGQPSAPGAGPFGKPTTASPFAQISGQAQQTGGFGQPSGQTASPFA
                     QIAQQQQSSQPAPTGFGQPSTAGFGQPSQTASPVGQPAAPFSQPTQSPFGAVAQRPQQ
                     PTPSPFGQPAGGGFGQPAGAPTGFGQPAQAPVQAPVPSQPTGAGPPPVIKVDDSKELN
                     PIPPLNGQTIRNSITQKPTTWKGQPVKEIDDALCYLHPQDRQTWVRIFFPNGPPEQAS
                     LRDAQGKPEEYTPEVTEQYQFFLQNGYFKDGVIPSVPPKTEWVSFDF"
     gene            complement(<1258229..>1258724)
                     /gene="RPS20"
                     /locus_tag="ACHE_40443A"
                     /db_xref="GeneID:66982238"
     mRNA            complement(join(<1258229..1258313,1258385..1258608,
                     1258683..>1258724))
                     /gene="RPS20"
                     /locus_tag="ACHE_40443A"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_043278643.1"
                     /db_xref="GeneID:66982238"
     CDS             complement(join(1258229..1258313,1258385..1258608,
                     1258683..1258724))
                     /gene="RPS20"
                     /locus_tag="ACHE_40443A"
                     /note="BUSCO:EOG09265CFP;
                     COG:J;
                     EggNog:ENOG410PQ4U;
                     InterPro:IPR036838,IPR001848,IPR018268,IPR005729,
                     IPR027486;
                     PFAM:PF00338;
                     antiSMASH:Cluster_4.2;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_component: GO:0015935 - small ribosomal subunit
                     [Evidence IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_043136401.1"
                     /db_xref="GeneID:66982238"
                     /translation="MSFQKPEKDFGEGPKVHKIRITLTSRKVAALEKVCSELIDRARS
                     KSLQVKGPVRLPTKSLHISTRKTPNGEGSKTWDKYEMRIHKRLIDLLAPTETVKQIII
                     NIEAGVEVEVTIAA"
     gene            <1259121..>1261187
                     /locus_tag="ACHE_40444S"
                     /db_xref="GeneID:66982239"
     mRNA            <1259121..>1261187
                     /locus_tag="ACHE_40444S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278644.1"
                     /db_xref="GeneID:66982239"
     CDS             1259121..1261187
                     /locus_tag="ACHE_40444S"
                     /note="COG:K;
                     EggNog:ENOG410PI70;
                     InterPro:IPR009060,IPR041800,IPR003892;
                     PFAM:PF02845;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0043130 - ubiquitin binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136402.1"
                     /db_xref="GeneID:66982239"
                     /translation="MADLPPLAPVPPPVVRTTLQQAEWEACIDAWTVLLGVRIDVPAK
                     IFQDVASKDESTVLFLLSFYDQLATSGEAGLKLGSKGRTLRKLSFLLTRRILLDLSSP
                     PADLLAWDFLGNLCCCYPSSAALKRLLSDAWNKSHETITASVEKAKSSIIKKLMNNKT
                     AETPAVNADIRTLTILASTLPACGQVLMAGSDYLDTLSDVYQAYPRETLRRVLVANVY
                     VGLTSLLKSKPNLSSLLDQLFGLKATAGVGTVKTRKEPTLLSDLVCSSDLLARLEKHL
                     RDHPQKRGEDLVSSLRTYQTESRVFHHRYQKKKKTVEKGKGRDVPVSGGELHAHRMSL
                     VTQIQDLFPDLGSGYVTRLLDFYGDNPETVVAHLLDFSLPPELQSLDKSEDLSIPQSI
                     INPDHMAPKSPPSEIAEPDESFARKNIFDNDVDLAELAQSNDPNARNKLRFGREDNLT
                     ADDVLADRSKHAANKAAIISALATFDSDEDERDDTYDTADVGGTVDTVPASTDAEAEA
                     QNRRATAEDLDVSLFKSYKSNPGLFARDAATRRSQPRTSLKGETGMTDEAIEGWAVML
                     QRDPKRLSKLEDRLALSAGTPGGAIAQPELPSTSYRRPRADEESEESDAHGGYGGRGR
                     GRGRGGPRGGRGRGRGGGRGGGASGEQNTAAARQRKEENKGSRANHNRRQQRAKKIAR
                     GGGLPG"
     gene            <1261893..>1263677
                     /gene="LPD1"
                     /locus_tag="ACHE_40445S"
                     /db_xref="GeneID:66982240"
     mRNA            join(<1261893..1262031,1262143..1262222,1262301..1262783,
                     1262838..>1263677)
                     /gene="LPD1"
                     /locus_tag="ACHE_40445S"
                     /product="dihydrolipoamide dehydrogenase precursor"
                     /transcript_id="XM_043278645.1"
                     /db_xref="GeneID:66982240"
     CDS             join(1261893..1262031,1262143..1262222,1262301..1262783,
                     1262838..1263677)
                     /gene="LPD1"
                     /locus_tag="ACHE_40445S"
                     /note="COG:C;
                     EggNog:ENOG410PGM9;
                     InterPro:IPR012999,IPR023753,IPR006258,IPR001100,
                     IPR004099,IPR036188,IPR016156;
                     PFAM:PF02852,PF07992,PF13450,PF00070;
                     SMCOG1175:pyridine nucleotide-disulfide oxidoreductase;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0004148 - dihydrolipoyl dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016668 - oxidoreductase activity, acting
                     on a sulfur group of donors, NAD(P) as acceptor [Evidence
                     IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0045454 - cell redox homeostasis [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="dihydrolipoamide dehydrogenase precursor"
                     /protein_id="XP_043136403.1"
                     /db_xref="GeneID:66982240"
                     /translation="MFRSMLPRTSPRAGLRAAAPQSAQSTFAVPSMTFLRTSRRGYAA
                     EAGDHDVVIIGGGVAGYVAAIKAGQAGLKTACIEKRGRLGGTCLNVGCIPSKSLLNNS
                     HLYHQILHDTKKRGIEVGDVKLNLEQMMAAKDTSVDGLTKGIEFLFKKNGVDYVKGTG
                     ALVDPHTVKVNLNEGGEQTLRGKNILIATGSESTPFPGLNIDEKRIVTSTGALELKEV
                     PKKMVVIGGGIIGLEMASVWSRLGSEVTVVEFLGQIGGPGMDAEIAKQAQKILGKQGI
                     KFKTNTKVTSGDDSGATVSLSVEASKGGKEETLDADVVLVAIGRRPYTEGLGLENAGI
                     EKDEKGRLVIDQEYRTKHPHIRVVGDCTFGPMLAHKAEEEGVAAIEYIQKGYGHVNYG
                     AIPSVMYTHPEVAWVGQNEAEVKAAGVNYRVGTFPFSANSRAKTNLETEGIVKFIADA
                     ETDRILGVHIIGPNAGEMIAEATLAVEYGASSEDVARTCHAHPTLAEAFKEAAMATHS
                     KAIHF"
     gene            complement(1263922..1263993)
                     /locus_tag="ACHE_t40005A"
                     /db_xref="GeneID:66987396"
     tRNA            complement(1263922..1263993)
                     /locus_tag="ACHE_t40005A"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:66987396"
     gene            <1264182..>1267870
                     /gene="LYS2_2"
                     /locus_tag="ACHE_40446S"
                     /db_xref="GeneID:66982241"
     mRNA            join(<1264182..1264251,1264316..1264511,1264576..>1267870)
                     /gene="LYS2_2"
                     /locus_tag="ACHE_40446S"
                     /product="putative NRPS-like protein biosynthetic cluster"
                     /transcript_id="XM_043278646.1"
                     /db_xref="GeneID:66982241"
     CDS             join(1264182..1264251,1264316..1264511,1264576..1267870)
                     /gene="LYS2_2"
                     /locus_tag="ACHE_40446S"
                     /note="BUSCO:EOG092603D0;
                     COG:Q;
                     EggNog:ENOG410PIYP;
                     InterPro:IPR000873,IPR009081,IPR036291,IPR036736,
                     IPR010080,IPR014397,IPR013120,IPR042099,IPR010071,
                     IPR020845;
                     PFAM:PF00501,PF01370,PF00550,PF07993;
                     SMCOG1002:AMP-dependent synthetase and ligase;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0004043 - L-aminoadipate-semialdehyde
                     dehydrogenase activity [Evidence IEA];
                     go_process: GO:0009085 - lysine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative NRPS-like protein biosynthetic cluster"
                     /protein_id="XP_043136404.1"
                     /db_xref="GeneID:66982241"
                     /translation="MAGNSSSPLPDPAADLNWSNFNGAIHEIFARNANEHPERLCVLE
                     TKGLRSPERQFTYKQINESSNQLAHFFLSNGCERGDVVMIYAYRGVDLVVAYMGALKA
                     GATVSVLDPQYPHDRQKTLLEVANPRFIVHIQRAAEEAGPISESVSQFIASSLSIKAH
                     VPALKLQDDGQLTGGASVGQDQDCLQPYEPLKQQMPDVAIGPDSVPTLSFTSGSEGKP
                     KGVQGRHFSLTYYTPWMQQRFGLSKDDKFTMLSGIAHDPIQRDIFTPLFLGAQIVVPH
                     RDSIAHELLAEWMKEHRVTVTHLTPAMGQILVGGATAQFPSLHHVFFVGDLLTKKDCR
                     RLQELAPNTSIVNMYGTTETSRAVSFFEIPSKAQQPLYLDDLPDIIPVGQGMLDVQLL
                     VVDRNDRSRICDIGEQGELFLRAGGLAEGYLGDDERTKQLNESKFLTNWFVDPAVWTR
                     EYERTASQAPKDWMKLYKGPRDRIYRTGDLGRFRADGAVECTGRVDNQVKIRGFRIEL
                     GEIDTHLSHHPFIRENITLVRRDKDEEPTLVSYIVPEAKRWFQQLAEDGNLPSEPEPS
                     TEDESLVTMLKRFRSLSEDCKKFLKTKVPHYAVPTMFIPLARMPLNPNGKIDKPALPF
                     PSTSDLALVNRRASRSTSLQPSLTETQQKVAGIWAGVLPNISARMLTPKSNFFEEGGH
                     SILAQQMLFKVRREWKDIDIPMSAIFQSQTLETFAAEIEHAQDPTGLRLDQNVHASST
                     IVDEAYSTDARDLVGKLPATIPKSTSSETAGTAFLTGATGFLGSYILHTLLETNKEMR
                     VIAHVRCKDAAAGLQRLRGIAEAYGLWREEWSGRVEVVPGDIAQPQLGMSSEDWDRIT
                     QEADLVIHNGAQVNWMLPYSSLRPANVLSTMECVTLCTSGKPKRLAFISSTSTLDTDS
                     YVNLSQQSVASGGSGVLETDNLEGSAKGLGTGYGQSKWASEFIVREAGRRGLVGVVIR
                     PGYITGDPVSGFSVTDDFLLRLWKGCIQVQARPDIPGNTINQVPVTHVSRVVVASVLH
                     PPVEPLGVVQVTSHPRLTTNEYLGSLETYGYNVPQVPYREWCNMLQNYVADDRNTGSR
                     ELALLPLFHFVVGDLPSDSLAPELDDANAATSLRAFGVSPEQLSDRAVGTETIGRYLA
                     FLVATGFLPSPSTTGVKAIPSVDTQRLQAMGSLGGRSSKP"
     gene            1268119..1268190
                     /locus_tag="ACHE_t40006S"
                     /db_xref="GeneID:66987397"
     tRNA            1268119..1268190
                     /locus_tag="ACHE_t40006S"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:66987397"
     gene            complement(<1268411..>1269148)
                     /locus_tag="ACHE_40447A"
                     /db_xref="GeneID:66982242"
     mRNA            complement(<1268411..>1269148)
                     /locus_tag="ACHE_40447A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278647.1"
                     /db_xref="GeneID:66982242"
     CDS             complement(1268411..1269148)
                     /locus_tag="ACHE_40447A"
                     /note="COG:S;
                     EggNog:ENOG410Q19J;
                     InterPro:IPR002110,IPR020683,IPR036770;
                     PFAM:PF12796,PF00023,PF13637,PF13857;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136405.1"
                     /db_xref="GeneID:66982242"
                     /translation="MSLLKCPNEILLIIAEDLPPCQGDINALAQTCLRLFYLLNPFLY
                     RYNTRQHHSSALSWGVTQGSGNTVRNSLEAGAPYNKSGRITGTIGRRRCVLGCALSEL
                     AGKSYFCPEFYEQPISSAARNGQLDIVRAFLEFGVDPDYPNPAGHTPLCLAAQGDHLE
                     LVRFLLVNGASPALKNICKIFPLWHATWRRVSRQRLKIKCKEHLQLLHERDRIKWLKP
                     LRERGVNSEQDVGASPVTLEVIPKVLD"
     gene            <1269820..>1271109
                     /locus_tag="ACHE_40448S"
                     /db_xref="GeneID:66982243"
     mRNA            <1269820..>1271109
                     /locus_tag="ACHE_40448S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278648.1"
                     /db_xref="GeneID:66982243"
     CDS             1269820..1271109
                     /locus_tag="ACHE_40448S"
                     /note="COG:S;
                     EggNog:ENOG410PMYC;
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136406.1"
                     /db_xref="GeneID:66982243"
                     /translation="MHNNSSSRSLIVARQHQQLQRQDGLHGMTLNGVGIADVEKEILQ
                     NIYWLCLSSTTWAFMQIDQPFSILGPDGLPGFPSMDENTSTVLRLDQASGNISTLHSQ
                     IQTMRWMWPLSHVTSTVAHVYMLYLNTPTKDRIFQPVNSSTLSLEIRDILNQAIRLVE
                     REVTTTNLQSFLLIAYNTIVIYMLFSPAQIASSSFSVDEFCKSTSTLLDIAQRFPSLL
                     PTGLVFTQRKYIASTLALAFYTCSRALVLSCREHEQQPTDPTTKAQTKFFSLASQLRK
                     ACKSDIVSSCVSIIQPVKKRPKRVQSAFQSLITSDSPAPSLSLDGELNFTFDSVSWSG
                     LGNQDLGDDPAQFEFADPEFFVDDPAWGSLLRFPGFARISTGTTNLDDQVDQPMPICP
                     VESNNDNHDLFLGGQDLTTNHFNAALHDDAAEIDHLR"
     gene            <1271688..>1272375
                     /locus_tag="ACHE_40449S"
                     /db_xref="GeneID:66982244"
     mRNA            join(<1271688..1272219,1272329..>1272375)
                     /locus_tag="ACHE_40449S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278649.1"
                     /db_xref="GeneID:66982244"
     CDS             join(1271688..1272219,1272329..1272375)
                     /locus_tag="ACHE_40449S"
                     /note="COG:S;
                     EggNog:ENOG410PJSS;
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136407.1"
                     /db_xref="GeneID:66982244"
                     /translation="MTPNNNDNDNDGPMVDIIISGIGGKLLFDGPLKLDPTLDNQTIC
                     QDAVRTILTAAREVAASSSSSEASSSSGAGNDGNKPTLIVLNTTGISDKRDLPFAMMP
                     LYYWMLKVPHEDKKVMEALIRDEMAKPIEGRGVGGYAIVRPSLLTEGEGDGLEKVRVG
                     GEEDPAVGYVIAREDVGAAFFLLSQENVRRSP"
     gene            complement(<1272551..>1274293)
                     /locus_tag="ACHE_40450A"
                     /db_xref="GeneID:66982245"
     mRNA            complement(<1272551..>1274293)
                     /locus_tag="ACHE_40450A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278650.1"
                     /db_xref="GeneID:66982245"
     CDS             complement(1272551..1274293)
                     /locus_tag="ACHE_40450A"
                     /note="COG:I;
                     EggNog:ENOG410PFMX;
                     InterPro:IPR001199,IPR012171,IPR005804,IPR036400;
                     PFAM:PF00173,PF00487;
                     TransMembrane:5
                     (i258-279o299-317i377-397o417-436i443-462o);
                     antiSMASH:Cluster_4.2;
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136408.1"
                     /db_xref="GeneID:66982245"
                     /translation="MTKSADIAKTAVQSQKQQILSRRHIEGLIADGKHIIIFENRVLK
                     VDAWIKFHPGGDKSIKHMVGRDATDEINAYVFRRLGVCQRWILTLALNCSLHSKEARQ
                     RMLSFQIGRVQGVWLNFLPPIQGGKFRPYNDESCFEEDSSSGQETSQPPSPVFDAVDG
                     KGTLRRRKSTSTTTSVSTPGSDDEFEPKPFFLDARTQEEIVFDINKYPSLDTTSQESI
                     RQKYRELDQRIHAEGLYNCNYFSYFVECCRYTLFAGLSYYFLHLGWYGTSGFFLGCFW
                     HQLVFSAHDAGHMGITHHFHVDSVIGMIIADYLGGLSLGWWKRNHNVHHIVTNAPEHD
                     PDIEHMPFFAISHRFLTNLTSTYYERIMTFDAAANFLLRFQNYLYYPILLFGRFNLYV
                     LSWQYLLCGQAPKKGPAWWHRWFEIAGQVFFWTWFGYGVLYRTIPDWGSRVLFILISH
                     MVTSPLHVQITLSHFAMSTADLGVNESFPQKMLRTTMDVDCPTWLDFFHGGLQFQAIH
                     HLYPRIPRHNLRRTQKLVLEFCRDTGIPYAIFTFLDGNKEVIGRLGDVAKQVRILEEC
                     RKSCAQQGVFSDHH"
     gene            complement(<1274739..>1275941)
                     /locus_tag="ACHE_40451A"
                     /db_xref="GeneID:66982246"
     mRNA            complement(<1274739..>1275941)
                     /locus_tag="ACHE_40451A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278651.1"
                     /db_xref="GeneID:66982246"
     CDS             complement(1274739..1275941)
                     /locus_tag="ACHE_40451A"
                     /note="COG:S;
                     EggNog:ENOG410PXAB;
                     SECRETED:SignalP(1-20);
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136409.1"
                     /db_xref="GeneID:66982246"
                     /translation="MFGSLLAWIFFLINPYANLSLNPIKPQQRLRPEYQESIPSNGPW
                     EDIITGVYGVPPLLKIHDRRGRIKWTWERSDVTQALPPSIERCLLSSANDATELKWMR
                     NGTSIAAIYSDLVLTINYTPDNPATDKLITWAVCRQNEFLWNAHTLEPLPGDRMAVGN
                     TGQRKWDGILVYDSNPDNPLVDDPPVLQNITGLRAIHNMIWDETEQMLWAAGTDFAAD
                     GSDGVPAYGTLQAYPYNATTGELEKEDSLQYKLSATHDQKIEWGTKYTWWAGPHDLVP
                     VPNQRVFLMSEDHDIHAFDVDRREFTEEGEAVVAKYLPGFETTSHNRHGYNGAGEWEE
                     LPRSDLKSFSVAPDGAYLYVQSLWRKYRGDHTNLVVNGHKNDINIGDEIYRSRWFADI
                     PGWPKPVT"
     gene            <1276593..>1278941
                     /gene="PGM3"
                     /locus_tag="ACHE_40452S"
                     /db_xref="GeneID:66982247"
     mRNA            join(<1276593..1276715,1276767..1276811,1276865..1276943,
                     1276998..1277317,1277368..1277386,1277436..1277445,
                     1277499..1277679,1277725..1278014,1278062..1278729,
                     1278781..>1278941)
                     /gene="PGM3"
                     /locus_tag="ACHE_40452S"
                     /product="phosphoglucomutase-3"
                     /transcript_id="XM_043278652.1"
                     /db_xref="GeneID:66982247"
     CDS             join(1276593..1276715,1276767..1276811,1276865..1276943,
                     1276998..1277317,1277368..1277386,1277436..1277445,
                     1277499..1277679,1277725..1278014,1278062..1278729,
                     1278781..1278941)
                     /gene="PGM3"
                     /locus_tag="ACHE_40452S"
                     /note="COG:G;
                     EggNog:ENOG410PGSN;
                     InterPro:IPR036900,IPR016055,IPR005846,IPR005845,
                     IPR005844,IPR005843,IPR005841,IPR016066;
                     PFAM:PF02879,PF02878,PF02880;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0016868 - intramolecular transferase
                     activity, phosphotransferases [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0071704 - organic substance metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="phosphoglucomutase-3"
                     /protein_id="XP_043136410.1"
                     /db_xref="GeneID:66982247"
                     /translation="MLAHVRENAYSASPRHTYSPAKQCYLQAISIKDLIMATSTEDSL
                     STLIQTWLEWDQDPSTRTEITNLCDSDSTTELTQRLQQRIQFGTAGLRGRMAAGFSCM
                     NSLTVIQASQGLAKYIRDKHPEIAGDGVVIGHDARYNSDKFARLAANAFVALKIPVWF
                     YGEASVTPLVPFGVTDLRAAAGVMVTASHNPAQDNGYKVYFKNGAQINTPMDTEIAQC
                     IEENLAPWPDAWKARQPDEYLRVDAYRKVLAHYRDTVSQYTKSTITEWTPPKPFVYTP
                     LHGVGGLVFPDLCRSMGINEFTPVAEQVKPDPEFPTVSFPNPEETGALDLAMQTADRE
                     GKSLVIAHDPDADRFAAAEKIDNSWFVFTGNQLGVLLASYLFESQDFKENTAVLNSTV
                     STSMLEKMTVAKGIHFQESLTGFKWMGNIARTLEASDYDVPFAFEEALGYMFPKICHD
                     KDGITAAMIFLSAEAQWRSQGLTLYMKLQKLFEEFGYHETLNNYFRSPSPDVTAKLFR
                     AIRNGPYRTDKKLGSFKILRWRDMTEGYDSGTQNNKPTLPVDKGSQMLTLWLDRGVHF
                     TLRGSGTEPKVKIYIEGCGGSREEGINAVCDAFLAVLREWVEPFAPSMTYSKQLPTSS
                     GHVFRVN"
     gene            <1279314..>1280057
                     /locus_tag="ACHE_40453S"
                     /db_xref="GeneID:66982248"
     mRNA            join(<1279314..1279360,1279415..>1280057)
                     /locus_tag="ACHE_40453S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278654.1"
                     /db_xref="GeneID:66982248"
     CDS             join(1279314..1279360,1279415..1280057)
                     /locus_tag="ACHE_40453S"
                     /note="antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136411.1"
                     /db_xref="GeneID:66982248"
                     /translation="MAHPRHYPRVNRGCVAHPPPAAERSPEINHNHNRNYHIHNAHQN
                     PKPKPKPKANPIDPHHQYHQHQHQHQHSMTPPPSPPPETADPPVQHHVHYHTYPIPHN
                     LRLPTPIPTEIAEKVQDTDKEINHHRHSHHHDHQYHHHHHHASRAATTPMPTPKAHLC
                     RHGHRHVHGQFAGHCKHHQRHPRTHMHTHTHTHVHNHGPAPAHAHGQEGRYAYGPPLP
                     VFVMGFPTGRF"
     gene            1280189..1280260
                     /locus_tag="ACHE_t40007S"
                     /db_xref="GeneID:66987398"
     tRNA            1280189..1280260
                     /locus_tag="ACHE_t40007S"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:66987398"
     gene            <1281381..>1283300
                     /locus_tag="ACHE_40454S"
                     /db_xref="GeneID:66982249"
     mRNA            join(<1281381..1281777,1281826..1281979,1282027..1282418,
                     1282469..1282551,1282598..1282924,1282986..>1283300)
                     /locus_tag="ACHE_40454S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278655.1"
                     /db_xref="GeneID:66982249"
     CDS             join(1281381..1281777,1281826..1281979,1282027..1282418,
                     1282469..1282551,1282598..1282924,1282986..1283300)
                     /locus_tag="ACHE_40454S"
                     /note="COG:C;
                     EggNog:ENOG410PJBY;
                     InterPro:IPR005828,IPR003663,IPR036259,IPR020846;
                     PFAM:PF00083,PF07690;
                     SMCOG1169:sugar transport protein;
                     TransMembrane:12
                     (i18-36o74-95i107-129o135-152i164-182o202-219i306-325o331-
                     352i359-378o398-418i438-459o465-485i);
                     antiSMASH:Cluster_4.2;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136412.1"
                     /db_xref="GeneID:66982249"
                     /translation="MADLIPSWNLVHKLEKRSLLVGINCVAALSILFFGYDQGMMAGV
                     NNSKDYIDLMGFGHTKLEDGMLTPVVTNSLLQGGIVSVYYLGTLCGALLGGWVGDRIG
                     RIKTIAMGCGWAVLGAALQCSAMNHNWMICSRFINGVGTGILNAIVPVWATEVADHTS
                     RGQFIAIEFTLNIFGVVLAYWLEFGLSFIDGGKSAFRWRFPIAFQLVFLLVLLTAVWF
                     FPESPRWLVKANREQEARYILGRLRGSTGDDAIRAEAEFQDIQSIVEMENTVGHNYSY
                     LGMLFDYKPGKLHLGRRVQLVAWLQIMQEWVGIAGVTVYAPTIFSIAGFDTMKSQWIS
                     GLNNVFYMFATLVCVFTLDRIGRRWTLWWGAAGQAIAMFLAGGFSRLGIDARAAGEAA
                     KADSYGAAAASFVFIFTAIFGATWLIGPWIYQAEVFPLAVRARGNAWGVVGWSIGNGW
                     LTLLCPIMFDSIGEKTFYVFAACNVISIPMVWALYPESNQRTLEDMDLLFASDSWWVW
                     EAEKTFARLKEENPGYMQTVAWKNSEADAEAGRIKDAENVASVEHRS"
     gene            complement(<1283366..>1283896)
                     /gene="MGT1_2"
                     /locus_tag="ACHE_40455A"
                     /db_xref="GeneID:66982250"
     mRNA            complement(<1283366..>1283896)
                     /gene="MGT1_2"
                     /locus_tag="ACHE_40455A"
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /transcript_id="XM_043278656.1"
                     /db_xref="GeneID:66982250"
     CDS             complement(1283366..1283896)
                     /gene="MGT1_2"
                     /locus_tag="ACHE_40455A"
                     /note="COG:L;
                     EggNog:ENOG410PREP;
                     InterPro:IPR014048,IPR001497,IPR036388,IPR036217;
                     PFAM:PF01035;
                     antiSMASH:Cluster_4.2;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003908 -
                     methylated-DNA-[protein]-cysteine S-methyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="XP_043136413.1"
                     /db_xref="GeneID:66982250"
                     /translation="MSTTITTATLPSSLSTSTSKPACPSSSPNTTFTTPNPNTSLTKT
                     LHRISLHPTLTPYRRRLYRTLLSIPPGRWTTYSALSAYLGSSPRAVGNALRTNPFAPG
                     VPCHRVLGSGGCLGGYKGFWAGRSGGATGANGKREGKGEEKRELLEEEGVVFDGEGKA
                     RGVCFRGFVEVGGKGK"
     gene            <1285567..>1286150
                     /locus_tag="ACHE_40456S"
                     /db_xref="GeneID:66982251"
     mRNA            join(<1285567..1285834,1285912..>1286150)
                     /locus_tag="ACHE_40456S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278657.1"
                     /db_xref="GeneID:66982251"
     CDS             join(1285567..1285834,1285912..1286150)
                     /locus_tag="ACHE_40456S"
                     /note="TransMembrane:2 (i12-29o71-93i);
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136414.1"
                     /db_xref="GeneID:66982251"
                     /translation="MYLHRELSRQNVPYYFLGGFACINVAMTARTTADIDIAVPNGQN
                     GYGVLLDILQRAPFVQDTEGFISRDSYYFLLNSQAALSKLAAFWCAGLLKLKISSWAN
                     KSRRSGLKRDGDIIDINSIQNLLIQNGEKMPLKGLEGDAANGLWDWIQEFKDLKMWQL
                     LDSSYKGH"
     gene            <1286864..>1287436
                     /locus_tag="ACHE_40457S"
                     /db_xref="GeneID:66982252"
     mRNA            <1286864..>1287436
                     /locus_tag="ACHE_40457S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278658.1"
                     /db_xref="GeneID:66982252"
     CDS             1286864..1287436
                     /locus_tag="ACHE_40457S"
                     /note="COG:S;
                     EggNog:ENOG410Q1H7;
                     antiSMASH:Cluster_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136415.1"
                     /db_xref="GeneID:66982252"
                     /translation="MSGSDQVTRRLRLYNRILQFGSPVEPRCEFCFLRGHTCIMDSKY
                     QKCAECTRRGRKCERQFHDEKEWNRLEKSRKELRDKIRKVRESIATSYATLNRLERQE
                     EYLNERGSRMLVHDSNMLERLDEENPPSAEDLQELERSANEEAARIAAVSKDLSLSQV
                     MDSPSFWENFDSAVAGGIPSPTGGNQSSSR"
     gene            complement(<1295738..>1296313)
                     /locus_tag="ACHE_40458A"
                     /db_xref="GeneID:66982253"
     mRNA            complement(join(<1295738..1295847,1295902..>1296313))
                     /locus_tag="ACHE_40458A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278659.1"
                     /db_xref="GeneID:66982253"
     CDS             complement(join(1295738..1295847,1295902..1296313))
                     /locus_tag="ACHE_40458A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136416.1"
                     /db_xref="GeneID:66982253"
                     /translation="MSITLPARFDSLPKLCKEILREFSIRILRHSAEGKKISSASQPR
                     PVEAQYQDEFYRGFTHVAGQGVPISSEWSRTKDGRVDFYIPEKKWAIELLRNHYKVDE
                     HISRFKEGGKYHPWLKENIIKDWIIIDCATSLPTKEFSEPRLWHAVFINDYSELQLYN
                     YQKVLMMSVHLRN"
     gene            complement(<1296384..>1298030)
                     /locus_tag="ACHE_40459A"
                     /db_xref="GeneID:66982254"
     mRNA            complement(join(<1296384..1296695,1296809..1297545,
                     1297610..>1298030))
                     /locus_tag="ACHE_40459A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278660.1"
                     /db_xref="GeneID:66982254"
     CDS             complement(join(1296384..1296695,1296809..1297545,
                     1297610..1298030))
                     /locus_tag="ACHE_40459A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136417.1"
                     /db_xref="GeneID:66982254"
                     /translation="MAAAITSWVLNPIQSLTLTMSRPRTRKLWCTLSNDLQQSFHMEC
                     VADQDDIDTLRKKIWEEIKEESKNTAARNLKLYCPVVQLNYEEEFDVKNGEFLHPRRM
                     ITSNPLFPESKDPNVDIVVVVVVSGDTTTRKRKRSESQANIPRTLPIAEHQLICPRER
                     TVSKLAAILDDMNIVHVRGTPASGKTRLSELLRDYYRKEGRKVSLIKRWEGLNFKNPW
                     GSLVKLVEKWNDEAQDAPTTTSQSEQDLSWVLTSNTVIIVDEAQMTYNDDTLWNTILK
                     ERQNPNVYYKFQLCLFCSYGSPAAGPDQTFFTPVKLSNRQRISLTPQSQQNSPPIGLF
                     YDKEEFKDVISRMLTFQYEERFNFDEGALEYIFALSNGHPGAVTSIVDVLYEAYRQDI
                     KHGHIRTLTEDHVIWFLEDAATVFDKLSTRPIYRSFPDIPRATNGISNTLCKITEEGS
                     IPFDINDASINFCYQKGWIHRVALDGDDIAVLPSRLHEK"
     gene            <1298626..>1301929
                     /locus_tag="ACHE_40460S"
                     /db_xref="GeneID:66982255"
     mRNA            join(<1298626..1298721,1298780..1298956,1299016..1299257,
                     1299316..1299412,1299471..1299669,1299724..1299945,
                     1300003..1300199,1300270..1300450,1300509..1300685,
                     1300755..1300970,1301037..1301235,1301294..1301415,
                     1301494..1301656,1301734..>1301929)
                     /locus_tag="ACHE_40460S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278661.1"
                     /db_xref="GeneID:66982255"
     CDS             join(1298626..1298721,1298780..1298956,1299016..1299257,
                     1299316..1299412,1299471..1299669,1299724..1299945,
                     1300003..1300199,1300270..1300450,1300509..1300685,
                     1300755..1300970,1301037..1301235,1301294..1301415,
                     1301494..1301656,1301734..1301929)
                     /locus_tag="ACHE_40460S"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136418.1"
                     /db_xref="GeneID:66982255"
                     /translation="MENTFISEDPGFILQDDLFRSIETDLSQPQQEEENILIQLSDAS
                     TKPLKVLKLEYTSDLPEYPSTDPNGYGYVINVPPNQQRETVEDMVNSIQYCVRQNYRN
                     RPSSHSSFLGTSYTSSSYRCSGIKICEYAGIQLKNMHHTHVTDDLWTILQDIRQRIHE
                     MERDTTKDAAYRFYRSAKNLFKNQLSCYHFQNSCQPKLTQSSIPNPLGGFDFYVRCIN
                     APSDPAGHYTYRVPKNGSVHLQFLEGLLNNEIIMDMEECGAVESIKSKSLYCAYDHPQ
                     GPGKLVHAKCNVTFHWLIPTDLSQNPYFVFMSHGVHTHVPPPPRKAPAKIMNGILQLI
                     NQARSPSLTLGTFLKSPALQSFCAEHNCHTIQQIHESFSNMDPIQAVIRKQRLLHYPA
                     GQNVNGVMFELGKNKDLQEYIHEVYQQNDQIMIICILKEQAELLHTLSSIEIDMSFKR
                     VQSKEMKEVVFATYLADQKKIMTLCRVFTTEDTTEGYYILFKKIYHIVYKLTGKRITF
                     RALHGTGLHALVMDMDNKQIEGLAQFLMEIDPDHHSRIWLLKNVLLLCRVHFLRGIRE
                     TLQTHSLNPYIGTRMAALLECESEEDYHKWCDLLIKHEHPAIQNWARHKKSAVIAAGL
                     NKYCSLIPHHIFDMVRKSTNAVEQTHNKSNRRGKQLTLLQAILESLKLDIQDVQQNRS
                     YNSYGLRHRYATQTLEASFLRHMARSESARQTESNSPELNIQDQDQDHIFFPSSSSGR
                     PLQRTPSRRGSMSRRGSSRARSSSSQVSLQRVATANSHEQYQNTELQNLEEELKINNL
                     KAELLAKQIEIKKRERELRELELENGGQH"
     gene            complement(<1303212..>1304918)
                     /locus_tag="ACHE_40461A"
                     /db_xref="GeneID:66982256"
     mRNA            complement(join(<1303212..1304351,1304424..>1304918))
                     /locus_tag="ACHE_40461A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278662.1"
                     /db_xref="GeneID:66982256"
     CDS             complement(join(1303212..1304351,1304424..1304918))
                     /locus_tag="ACHE_40461A"
                     /note="COG:G;
                     EggNog:ENOG410PVXD;
                     InterPro:IPR005829,IPR005828,IPR003663,IPR036259,
                     IPR020846;
                     PFAM:PF00083,PF05978,PF07690;
                     TransMembrane:12
                     (i45-68o97-117i124-143o149-171i183-202o214-235i316-
                     338o350-373i380-400o412-432i453-471o483-501i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136419.1"
                     /db_xref="GeneID:66982256"
                     /translation="MDDENKYQLQYSQAKGDTPMAEHDEGKAAEIPNEMLSYGPEGVK
                     GLISSGFVFGAAFLASLGGFSFGYDQGVISIINVMSQFHEAIPGTETAFGKGFMTGML
                     LLGAFVGCLFMPYLVDKISRKWALTLVVVIFDIGAIIQTIAQNYGMLVAGRAIGGMGV
                     GTLAMGAPLYISEISPPNLRGTLLVLESVSVVSGVVIAYWITFGTRMIESEVSFRLPF
                     GLQMVSATFLGIFIHFFPYSPRWLALVDRHDDCLKSLSKLRRLPQTDERVQAEFRDII
                     TEVKFQQLIEERQHTGASGVKREALIWLSIFNRRTWKRTIVGCGVAFFQQFLGINAFI
                     YYAPTLFESIGQTGDMSLILSGVFNCLQLVTVIVCFFIIDKIGRRPLAIFGGFGTCAC
                     YIVIAALSAVYRQDWSVNTAAGWACVAMAFLFILIFGVSYSPLGWALPSEVFPNAIRS
                     KGVALSTCVNWLSNFVVGVITPPMMSDIGYRTYIFFAVWCFLAGIWAFFLVPETSGKT
                     LEQIDEVFGNSSSHEEREVMRMAAYSVDIGQGKPDV"
     gene            complement(<1307900..>1311772)
                     /locus_tag="ACHE_40462A"
                     /db_xref="GeneID:66982257"
     mRNA            complement(<1307900..>1311772)
                     /locus_tag="ACHE_40462A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278663.1"
                     /db_xref="GeneID:66982257"
     CDS             complement(1307900..1311772)
                     /locus_tag="ACHE_40462A"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR021109,IPR000477,IPR000953,IPR036397,
                     IPR012337,IPR041373,IPR043502,IPR041588,IPR001584,
                     IPR016197,IPR043128;
                     PFAM:PF17917,PF17919,PF00078,PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136420.1"
                     /db_xref="GeneID:66982257"
                     /translation="MDLPTWRPAPTAQIDLQKEWNDFRKRVKFDRPEFRVSALVNGEQ
                     VSRTLVDTGCTTYGMVSENFTRKHQLERVTIKPRAIDDYKGPTDDCIKEVAKISLNVG
                     GNHQNTAWLYVVPKLGRGLDMILGLAWIDDQQVFIDPNGPKLRFTNGIVVSSMEDQPR
                     MDIQPIGANAFALWNRQKKKDSSVQIFAASLKDIEKALRPKLPTDPRTKLPPHYHKFL
                     SVFDRKEADKQPPHRGPNIDHKIELNKNADGTTPEPPWGPLYNMSRDELLVLRKTLTE
                     LLEKNFIRVSNSPAAAPVLLVKKPGGGLRFCVDYRALNAITKKDRYPLPLINETLERI
                     GKAKWFTKLDVIAAFHKIRVAAGDEWLTAFRTRFGLFEWLVTPFGLANAPSTFQRYVN
                     WVLRDFLDEFASAYLDDILIFTDGTLPEHQEHVRKVLGRLQEAGLQIDIDKCEFEVKS
                     TKYLGFIIEAGKGVSMDPAKVEAIMNWAAPTTVKGVRSFLGFANFYRRFIRNYSELTT
                     PLTALTQKDKPFVWDDKCEESFQQLKRMFTTAPILMQFDPDRETVVETDSSGWATGGV
                     LSQYDDDGVLRPCAYFSKKNTPAECNYQIHDKELLAIINALKEWESELISVVNFQILT
                     DHRNLRYFTTMRRLNERQMRWADLLSRYDFTLHYRPGKLAGRPDALSRREQDVPALGD
                     ERLKHREQRLFDPEILKDGPVEGSSKRGLVEEPHPINVSRILLAPVGTEPYNSEPSTP
                     QGYEQANEPTNLNSEQPSLEELLDMTLDEHWARVEPLDEKYGRIREAVQVGAPQFPCE
                     LGIKASISECSIELNNRLCYRGRRWVPDIESLRTRLLQETHDSVLTGHPGRSAMYAIL
                     ARRVYWPAISEDVRRFVRNCDKCSANNVWRDRRQGLLKPLPIPDRKWRYIAIDFIEKL
                     PTSNGYENIMVIVDRLGKGVIPVPCEKINTYTVAQKLIQSFIGYHGIPASIVSDRGRQ
                     FTNEMWKRFCELLGIKRQLSTAYHAETDGQTERMNATLELFLRSFCDHTQSNWASLLP
                     MAQLAICSRDAASTGVSPFFLDHGYHVDPFQLEEDVEINLSAPDLGTMRERGERIAAK
                     LRGALDIATTELAVAQQKQEDYANRRRDVAPEYQVGQKVWLDLRNIQTERPSKKLGSR
                     QAKFTVLEKIGSHAYRLNTPGTIHDVFHTALLRPAAMDPFPSQRKDDYQPPAEMINGN
                     EEYMVERILDERFRRWGRGERHEFLVKYIGWQEPEWNDARNMEDTIALDDWETYKTMN
                     GIVIQSALSIPNEPPHAGGRSRRRRGGG"
     gene            complement(<1313957..>1314562)
                     /locus_tag="ACHE_40463A"
                     /db_xref="GeneID:66982258"
     mRNA            complement(<1313957..>1314562)
                     /locus_tag="ACHE_40463A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278665.1"
                     /db_xref="GeneID:66982258"
     CDS             complement(1313957..1314562)
                     /locus_tag="ACHE_40463A"
                     /note="COG:S;
                     EggNog:ENOG410PSTF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136421.1"
                     /db_xref="GeneID:66982258"
                     /translation="MSKFLDSGFEAAVEVIDISHASIDGAAIADFLKNTPRLRILTYS
                     HKAGRNVGFQDWDLCQFIMAIENEVGGHLEELSIRIGELHGSIVPGKVSICGFQNLQK
                     LEPMCNLTSAASASHELLLSDLIPASVSKLSLVSHGKSHHEKALDALFCDLAARKDDQ
                     VPALEKIYLSYPRDADSLYKEQCEKLAAETEKAGVLLHLKS"
     gene            <1316181..>1316987
                     /locus_tag="ACHE_40464S"
                     /db_xref="GeneID:66982259"
     mRNA            join(<1316181..1316566,1316624..>1316987)
                     /locus_tag="ACHE_40464S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278666.1"
                     /db_xref="GeneID:66982259"
     CDS             join(1316181..1316566,1316624..1316987)
                     /locus_tag="ACHE_40464S"
                     /note="COG:S;
                     EggNog:ENOG410PYKK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136422.1"
                     /db_xref="GeneID:66982259"
                     /translation="MALEGLYEIMKGHATGTRDLHILDGMPNGKNYFTLVTKEFFQSN
                     PNCIGKDDATDDVLAFTSLVLSYAKAVSDDLKADKSPKLRTAFMPRTDFNTFFKQVES
                     KLPGNDLSLSSTFSPATRQTTKARFRKIDTALCSGKASEPKPNNKFGGLGFKNPAAIP
                     HATMKIKSWIEGIGKSSGSTDMLSTFDKPIDGSIGGIGTKMESMLSAKRQVPLFEFQG
                     LNTVQTNQLESWTNKVDATIQDIHKKHKDAP"
     gene            complement(<1319336..>1320176)
                     /locus_tag="ACHE_40465A"
                     /db_xref="GeneID:66982260"
     mRNA            complement(join(<1319336..1319588,1319647..1320062,
                     1320120..>1320176))
                     /locus_tag="ACHE_40465A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278667.1"
                     /db_xref="GeneID:66982260"
     CDS             complement(join(1319336..1319588,1319647..1320062,
                     1320120..1320176))
                     /locus_tag="ACHE_40465A"
                     /note="COG:S;
                     EggNog:ENOG410PTEP;
                     InterPro:IPR036236,IPR013087;
                     PFAM:PF00096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136423.1"
                     /db_xref="GeneID:66982260"
                     /translation="MDLYLSNTQSNMMFSHSTMTQTPGLSCPMEHSYSQGSEASTQSS
                     FTYSDVCSSSPMQELEFLPCQSPFESSYDYEFSPPPSQCQYGFADAYQDVYPAANSSY
                     VSSIPIPGSGCGYFDPFLATSASSISSSPPVQWPPQDVQLFPDPCHDISFETTFPKSN
                     KPFPCSDCGKSFTRSADLKRHQTSVHYPIFQDCPIADCSRKGHNGFPRKDHLLEHLRA
                     YHHVPVPKRGASKRVAKAQYPCL"
     gene            complement(<1322122..>1324094)
                     /gene="NOT5"
                     /locus_tag="ACHE_40466A"
                     /db_xref="GeneID:66982261"
     mRNA            complement(join(<1322122..1322182,1322245..1323743,
                     1323840..>1324094))
                     /gene="NOT5"
                     /locus_tag="ACHE_40466A"
                     /product="general negative regulator of transcription
                     subunit 5"
                     /transcript_id="XM_043278668.1"
                     /db_xref="GeneID:66982261"
     CDS             complement(join(1322122..1322182,1322245..1323743,
                     1323840..1324094))
                     /gene="NOT5"
                     /locus_tag="ACHE_40466A"
                     /note="COG:K;
                     EggNog:ENOG410PIR5;
                     InterPro:IPR012270,IPR007207,IPR007282,IPR040168,
                     IPR038635;
                     PFAM:PF04065,PF04153;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0030015 - CCR4-NOT core complex [Evidence
                     IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 5"
                     /protein_id="XP_043136424.1"
                     /db_xref="GeneID:66982261"
                     /translation="MTSRKTQQEIDKTFKKVAEGIQAFDGIYEKIKSTTNAAQRDKLE
                     DNLKREIKKLQRFRDQIKSWAAGNEVKDKSPLLEQRRAIETCMEQFKAVEKEMKTKAY
                     SKEGLSAASRLDPREKQKVETCDFLSNMVDELQQKIEAMEAEEETLHMQMKKGKKDIN
                     KSNRLSDITHLTERHKWHVNKLELLLRALQNGNVETGQVLDLKESIKYYVEDGHNIDY
                     SGEDETLYDDLNLEVDAEGQFGLGDNDRVSSQDTQSLQDDELETKPKSKGETPGPRRS
                     STQMKSPLPVLATLHPSTSTSSTSGMKPAPPPTRLPGETLKYASAAAAAAASDKNGVG
                     IAPLPPPPGASPAFPAAVPVSKPSSVASPSVAPAQPTPKPASAAALAAEERSRTPAFS
                     SPKVAPAPAPVVEKKEPPSKEPITAATNGETGKPEQRDAEESIYHLPPGLQDLIQSFE
                     VTKNRASTNPAPSAQRLLAASLTTCPEPADAEKPRHYKPQNPYNTPLYYPQEPLAIFD
                     DPRLYDTGRIDTDTLFYLFYYRQGTYQQFLSAKALKNQSWRFHKQYQTWFQRHEEPKA
                     ITEEFEQGTYRFFDYESTWMNRRKADFKFVYKYLEDEL"
     gene            <1324640..>1325545
                     /gene="DTD1"
                     /locus_tag="ACHE_40467S"
                     /db_xref="GeneID:66982262"
     mRNA            join(<1324640..1324646,1324696..1324874,1324936..1324978,
                     1325031..1325257,1325342..>1325545)
                     /gene="DTD1"
                     /locus_tag="ACHE_40467S"
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /transcript_id="XM_043278669.1"
                     /db_xref="GeneID:66982262"
     CDS             join(1324640..1324646,1324696..1324874,1324936..1324978,
                     1325031..1325257,1325342..1325545)
                     /gene="DTD1"
                     /locus_tag="ACHE_40467S"
                     /note="BUSCO:EOG09264ZQC;
                     COG:J;
                     EggNog:ENOG410PPBZ;
                     InterPro:IPR003732,IPR023509;
                     PFAM:PF02580;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0002161 - aminoacyl-tRNA editing activity
                     [Evidence IEA];
                     go_function: GO:0051499 - D-aminoacyl-tRNA deacylase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="XP_043136425.1"
                     /db_xref="GeneID:66982262"
                     /translation="MKAVIQRVKSASVTVDNQLVSSIGRGLLVLAGVGKGDDEKEADS
                     LISRIIRCRLWPDDNGKQWKKNVQDIEGEILCVSQFTLYAQLNKGKQPDFHEAADVET
                     ARRLYDYFYQRLREAYKPERVKNGVFQAMMDVELKNDGPVGLDYRSDEEAVTIEVNTK
                     LPKKEKTPEGDKQTGKKPEKPEKSGNAENTGKAEGDSDKGGQTEGQKSYEFKLPATLL
                     E"
     gene            <1325837..>1327209
                     /gene="CPR6"
                     /locus_tag="ACHE_40468S"
                     /db_xref="GeneID:66982263"
     mRNA            join(<1325837..1325849,1325935..1326002,1326063..1326072,
                     1326129..1326215,1326269..>1327209)
                     /gene="CPR6"
                     /locus_tag="ACHE_40468S"
                     /product="peptidyl-prolyl cis-trans isomerase cpr6"
                     /transcript_id="XM_043278670.1"
                     /db_xref="GeneID:66982263"
     CDS             join(1325837..1325849,1325935..1326002,1326063..1326072,
                     1326129..1326215,1326269..1327209)
                     /gene="CPR6"
                     /locus_tag="ACHE_40468S"
                     /note="COG:O;
                     EggNog:ENOG410PHJ3;
                     InterPro:IPR011990,IPR002130,IPR020892,IPR019734,
                     IPR029000,IPR013026;
                     PFAM:PF00160;
                     go_function: GO:0003755 - peptidyl-prolyl cis-trans
                     isomerase activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0000413 - protein peptidyl-prolyl
                     isomerization [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase cpr6"
                     /protein_id="XP_043136426.1"
                     /db_xref="GeneID:66982263"
                     /translation="MVESHRPRVYFDIKIGKQPMGRIALELFNDVVPKTAENFRALCT
                     GEKGVGQQGKPLSFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFDLQH
                     DRPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVVNGKSVVRKIENMNTQAD
                     KPITDVTIVDCGELTGQAYDDAAKQVPDATGDPYEDFPDDHQGEELSAPVCYKIASEL
                     KNFGNTAFKGGDHLLGLEKYQKGLRYLNEFPEADENDPKELEGQLKALRFTLHSNSAL
                     LANKIGQFRNGKSWATYALEVAGPAGAKDADKAKALYRRAVASSGLKEEEDALKDLQE
                     ASKLAPSDAAIINEVAKVNKAIKDRAAKEKAAAKKFFS"
     gene            complement(<1327445..>1329433)
                     /locus_tag="ACHE_40469A"
                     /db_xref="GeneID:66982264"
     mRNA            complement(join(<1327445..1327678,1327756..1328014,
                     1328093..1328556,1328806..1329168,1329235..1329317,
                     1329376..>1329433))
                     /locus_tag="ACHE_40469A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278671.1"
                     /db_xref="GeneID:66982264"
     CDS             complement(join(1327445..1327678,1327756..1328014,
                     1328093..1328556,1328806..1329168,1329235..1329317,
                     1329376..1329433))
                     /locus_tag="ACHE_40469A"
                     /note="COG:G;
                     EggNog:ENOG410PMPF;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i55-71o98-115i122-141o147-179i264-290o310-330i351-
                     371o377-402i414-437o449-467i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136427.1"
                     /db_xref="GeneID:66982264"
                     /translation="MVPSNDIMTDVPGTVYLVDASGSLDAARSGRDILLVPQPTHTQA
                     DPLNWPKYKKYWSLFLISAYACIMSFGENNWGAAWTTISEETGVTLNNMNGGSALNYL
                     LLGFVNIIWIPSAMKFGRKIIYILSLLFILAGGVWGGFFEGTAQYYLMMVVTGIGTAA
                     YQALIQLTAILILLFIFTFDDTIFPRYRFRNEASTEPSKHDKTAQPSPTKDEKDEKPD
                     PSQTITASHSAGEISMPPRTYLQKLAPIHYFKDDQTTWFQYFRRPFYLFLFPNIVLAG
                     IQFAFGCTAGIVSFNTISEIMTEPPYNWSAGSAGLLFLAALVGNFIGMAIGSLSDYLV
                     LTLTRRNKGYKEPEMRLYAYIFSLFLAAVGYFTYGWGATAGSHWMAIAVGLCCMIAQQ
                     VSATSIATAYAMECFDQISGELVIVLAICSSVINFAISFSVQNFIDATSYGWTFTFYG
                     IWVVLSMLMGAPMIVWGKSWRRRCKGRYEAFLAEMR"
     gene            <1330105..>1331493
                     /locus_tag="ACHE_40470S"
                     /db_xref="GeneID:66982265"
     mRNA            join(<1330105..1330294,1330343..>1331493)
                     /locus_tag="ACHE_40470S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278672.1"
                     /db_xref="GeneID:66982265"
     CDS             join(1330105..1330294,1330343..1331493)
                     /locus_tag="ACHE_40470S"
                     /note="COG:E;
                     EggNog:ENOG410PH30;
                     InterPro:IPR006076,IPR036188;
                     PFAM:PF01266,PF00890;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136428.1"
                     /db_xref="GeneID:66982265"
                     /translation="MTPSLNPSSSILIVGAGTWGCSTALHLARRGYTKVTVLDPHQVP
                     SPIAAGNDINKIMEHRELKDPNSDSISLAFATCTRAALNGWKTDPVFQPYFHETGAIV
                     SGHTPELIKHIQEDEIDPTKSGNLVKLESAEDFRKTMPPGILTGGFPGWKGWLNKTGA
                     GWIHARKAMVSTYSEAKRLGVSFVTGSPQGNVISLVYENGDVIGAETEDGIVHRAQHT
                     ILAAGAGSDRLLDFKNQLRPTAWTLCHIRMTPEEAQRYRNLPVLFNIAKGFFMEPDED
                     KHELKICDEHPGYCNFVPDPQHSGEIRSIPFARHQIPLEAEARARDFLSDTMPHLARR
                     PLAFARICWDADTVDRAFLIDRHPDHASLLLAVGGSGNGAMQMPTIGGFIADALEGVL
                     QKELKHVVRWRPEIADHRDWRSTQNRYGGPFKVMDFQEVGEDEWTKIVDAKSRL"
     gene            complement(<1331768..>1332377)
                     /gene="DIB1"
                     /locus_tag="ACHE_40471A"
                     /db_xref="GeneID:66982266"
     mRNA            complement(join(<1331768..1331879,1331941..1331983,
                     1332033..1332060,1332129..>1332377))
                     /gene="DIB1"
                     /locus_tag="ACHE_40471A"
                     /product="U4/U6-U5 snRNP complex subunit dib1"
                     /transcript_id="XM_043278673.1"
                     /db_xref="GeneID:66982266"
     CDS             complement(join(1331768..1331879,1331941..1331983,
                     1332033..1332060,1332129..1332377))
                     /gene="DIB1"
                     /locus_tag="ACHE_40471A"
                     /note="BUSCO:EOG0926506U;
                     COG:A;
                     EggNog:ENOG410PMYK;
                     InterPro:IPR036249,IPR004123;
                     PFAM:PF02966;
                     go_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="U4/U6-U5 snRNP complex subunit dib1"
                     /protein_id="XP_043136429.1"
                     /db_xref="GeneID:66982266"
                     /translation="MGSVILPHLHSAWHVDQSILSEDDRLVIIRFGKDGHPDCLRQDD
                     VLAKIAEKVKNFAVVYLCDIDEVPDFNSMYELYDPMTIMFFFRNKHMMCDFGTGNNNK
                     LNWLLEDKQELIDIIETIYRGAKKGRGLVVSPKDYSTRYRY"
     gene            1332514..1332630
                     /locus_tag="ACHE_t40008S"
                     /db_xref="GeneID:66987399"
     tRNA            1332514..1332630
                     /locus_tag="ACHE_t40008S"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:66987399"
     gene            <1333036..>1334498
                     /locus_tag="ACHE_40472S"
                     /db_xref="GeneID:66982267"
     mRNA            join(<1333036..1333110,1333165..1333183,1333238..1333526,
                     1333579..1333855,1333911..>1334498)
                     /locus_tag="ACHE_40472S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278674.1"
                     /db_xref="GeneID:66982267"
     CDS             join(1333036..1333110,1333165..1333183,1333238..1333526,
                     1333579..1333855,1333911..1334498)
                     /locus_tag="ACHE_40472S"
                     /note="COG:C;
                     EggNog:ENOG410PKCF;
                     InterPro:IPR004304;
                     PFAM:PF03069;
                     go_function: GO:0016811 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds, in linear amides
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136430.1"
                     /db_xref="GeneID:66982267"
                     /translation="MGTGQIRTALKIDRGKPAWEQPGLHNRWHPDVPSVSTIAQNEVV
                     KIECIDWTGGQIKNDDSADDIKNVDLTRIHYLSGPFDIESAEPGDVLVVEIQDVQPLQ
                     DEPWGFGGIFDRNNGGGFLDEIYPKPAKAIWDFEGIFCSSRHIPGVRFPGLIHPGILG
                     CAPTAEILAEWNRREGELIAANASADRDVAKPPEPKGAHAGAAQESLIEKIAREGART
                     IPGRPENGGNADIKNLSRGSKIYLPIHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGE
                     ITLKFSVLKDGMAKMAMKSPIYIPGPVEPHFGPGRYLTFEGFSVDDQGKQHYLDTTVA
                     YRQTCLRAIEYLRRYGYNDYQLYLLLSSAPVQGHIAGIVDIPNACTTMGIPMDIFDFD
                     VRPEAEVVKRDMGSCAFASSSFL"
     gene            complement(<1339246..>1340700)
                     /locus_tag="ACHE_40473A"
                     /db_xref="GeneID:66982268"
     mRNA            complement(join(<1339246..1339608,1339659..1340052,
                     1340101..1340273,1340321..1340427,1340643..>1340700))
                     /locus_tag="ACHE_40473A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278676.1"
                     /db_xref="GeneID:66982268"
     CDS             complement(join(1339246..1339608,1339659..1340052,
                     1340101..1340273,1340321..1340427,1340643..1340700))
                     /locus_tag="ACHE_40473A"
                     /note="COG:S;
                     EggNog:ENOG410PIEN;
                     TransMembrane:5 (i38-67o87-106i175-194o214-235i269-294o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136431.1"
                     /db_xref="GeneID:66982268"
                     /translation="MANFEPNAIIRGAQLTAVGTVRALRNAELFKYDHFRQAALAVAV
                     GVIIHVIIQIPIIGLKFIIWIASIFVDMQEATWDDTILNGINYLNKSVLQVPFLLMTL
                     MRYVTPTLDEIFMESLKWVDQTYVQKHKAEDPSTLRAMYYPNLSQYSTKGSSSSSKPI
                     GKSVMLFVQRYGRKVAMLFGVYLLSLLPVVGRFVMPAVSFYTFKQNVGTTPAAVIFGT
                     GLVLPKRFIVTFLHTYFASRSLMRELLEPYFCRVPFTPEQKRRWFKDRQGVLFGFAFA
                     FTVVIKTPFIGVLMYGVAEASTAYLITKITDPPPTPDEGPQFAETQVRWKNKHDFLHL
                     SLENIDRLNLPSHHKGEETESPGFPGKKFS"
     gene            <1341131..>1342684
                     /locus_tag="ACHE_40474S"
                     /db_xref="GeneID:66982269"
     mRNA            <1341131..>1342684
                     /locus_tag="ACHE_40474S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278677.1"
                     /db_xref="GeneID:66982269"
     CDS             1341131..1342684
                     /locus_tag="ACHE_40474S"
                     /note="COG:S;
                     EggNog:ENOG410PQID;
                     InterPro:IPR024758;
                     PFAM:PF12634;
                     TransMembrane:1 (o454-474i);
                     go_component: GO:0005780 - extrinsic component of
                     intraperoxisomal membrane [Evidence IEA];
                     go_process: GO:0045033 - peroxisome inheritance [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136432.1"
                     /db_xref="GeneID:66982269"
                     /translation="MSDFSNAPSVRIQPPRRSATLPSKLSLQKQRSSDSLRPSEDDLF
                     FHPCAKVVHFAPRALAPIPSSTAPSDFDYPVDTIETLPWRSPTERTVAFAPLRLQNVH
                     GLTVFLKCGGVVHAILKNSQCWCVDGESTFVLRVRPLTYYRIELPSSTENNENYVIQL
                     KNVLPRILRYEITPCPFQRGFTVEIPEEFKMKKRRKAWRPKGRRESAPASSTASQGSS
                     PKGDEDGCKGISVMKRGSACTVLETIPDENQLLSPTSVPEGWNIPRRSITDTQSFQTL
                     LARFDNTKAESQVDPDTSYSSSADSFHSMDDYMHPESSARSTSTSPSSVDHNELDQDQ
                     HYEPGKFFKDVDYSDNRPSTSYSDGSLSQAPESPTTRRKPESTPLKIPATSTEKPSAL
                     SPIEANKDKMSREFRRRAKASTEREISPMPPPSALRRSNSFRKNDAKSIVQKTCTVVL
                     VPSVQLLIILIHIAAQIVIGPALISMGEAHQGLEYQAPDSEDTVDDFDLPLQRSDSQD
                     KKYDVWALD"
     gene            complement(<1343139..>1343612)
                     /locus_tag="ACHE_40475A"
                     /db_xref="GeneID:66982270"
     mRNA            complement(join(<1343139..1343528,1343586..>1343612))
                     /locus_tag="ACHE_40475A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278678.1"
                     /db_xref="GeneID:66982270"
     CDS             complement(join(1343139..1343528,1343586..1343612))
                     /locus_tag="ACHE_40475A"
                     /note="COG:U;
                     EggNog:ENOG410PR8H;
                     InterPro:IPR003210,IPR009018;
                     PFAM:PF02290;
                     go_component: GO:0005786 - signal recognition particle,
                     endoplasmic reticulum targeting [Evidence IEA];
                     go_component: GO:0048500 - signal recognition particle
                     [Evidence IEA];
                     go_function: GO:0008312 - 7S RNA binding [Evidence IEA];
                     go_function: GO:0030942 - endoplasmic reticulum signal
                     peptide binding [Evidence IEA];
                     go_process: GO:0006614 - SRP-dependent cotranslational
                     protein targeting to membrane [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136433.1"
                     /db_xref="GeneID:66982270"
                     /translation="MAPHLSNEEFFASLTTLLSTTSQKTRGSVYLTQKPLLNTTTSTN
                     GDDPSPVSRPSILIRATDGNTNAPNPKNPKNKIEKSKAKSSKVKISTVVAPEELEGFY
                     GRYAEICKAGMTGLKKRDRKRGKAKGKGGAGKGAKA"
     gene            <1343947..>1346607
                     /gene="SGD1"
                     /locus_tag="ACHE_40476S"
                     /db_xref="GeneID:66982271"
     mRNA            join(<1343947..1345339,1345391..>1346607)
                     /gene="SGD1"
                     /locus_tag="ACHE_40476S"
                     /product="suppressor of glycerol defect"
                     /transcript_id="XM_043278679.1"
                     /db_xref="GeneID:66982271"
     CDS             join(1343947..1345339,1345391..1346607)
                     /gene="SGD1"
                     /locus_tag="ACHE_40476S"
                     /note="BUSCO:EOG09261I1G;
                     COG:T;
                     EggNog:ENOG410PFVN;
                     InterPro:IPR016024,IPR016021,IPR003890,IPR003891;
                     PFAM:PF02854,PF02847;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="suppressor of glycerol defect"
                     /protein_id="XP_043136434.1"
                     /db_xref="GeneID:66982271"
                     /translation="MKRPMKLTTALPRELRAELGIRDTYGEKKNRRNGPASRKERRRE
                     ERSAGRKPQVQQRPAWEKNAMRYEEEDDEDEDENMLDEGDESDETPPAKSKSKATKPE
                     QKQPKSILKKNKPVEQSDGSDDDEDNINLDEDEDEDEPAPRKVSKAVQDQLDEDDAEI
                     AALEKRLGLKKGKKLPQSFQDDGLDDLLGDLGDGSEDEGKKRKREADEWLQSKRRKAQ
                     GLQQAEPEGDDDEDDSDLASDEEADLLDDDDDGEMDDDAAEGEDSEFDGFDEEEEKPA
                     PKKKENPYVAPVPQESQPAKYIPPSLRAASNSEDESLIRLRRQAQGQLNKLSEANLIS
                     ILAEFEKLYREYPRQNVTSTIISLLMGLICERSALQDTFMILHAGFIAALYKVMGMDF
                     GAELVQKIVQTLDSQGDERGKFEGKEHLNLISLISQLYNFHVIGHALVFDYIRIYVQD
                     ITEDNTELLLKIIRNSGPQLRQDDPSSLKDIVLLIQPAIAKAGEQSLSVRTKFMIDTI
                     TDLKNNKVKTVGSSISTEHITKMRKILGSLNNTRVIRASEPINISREDIHNSAKKGKW
                     WLVGASWREDPLETARKELSSLPGAQTTQTQVQEDEDESEAEPDLASIAKSHRMNTDV
                     RRSIFVAIMSATDFQDAHVRLLKLRLKRAQEYEIPRVLTHCIMEEDAYNPYYTLIARR
                     VCGDLGRRLKISFMYTLWNILRRMGEKGDFDDEDGMSDDEGDESTQLPLKSIVNIAKM
                     YGSLIADNTLTLSILKTLNFAYLQSKAKTFVELLIISIIQQSQKSKRNKNTESKSKKE
                     DDEGRDEKALMDIFMRVQDTPQIVKGLIYFIRKVVAKTDIVPEKELKVVKWGCRVALD
                     ALKVISSKDGVVG"
     gene            complement(<1346719..>1348087)
                     /locus_tag="ACHE_40477A"
                     /db_xref="GeneID:66982272"
     mRNA            complement(join(<1346719..1348026,1348076..>1348087))
                     /locus_tag="ACHE_40477A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278680.1"
                     /db_xref="GeneID:66982272"
     CDS             complement(join(1346719..1348026,1348076..1348087))
                     /locus_tag="ACHE_40477A"
                     /note="COG:S;
                     EggNog:ENOG410PYXU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136435.1"
                     /db_xref="GeneID:66982272"
                     /translation="MTPSTPFRHPASRSNAGPQFASTPRFVFSQPQSSSTQHRGDEKE
                     LVDDISNDSPSTVRYADRDAARGDVIEDAENERDIGDSRRDILHEELDSTSIASVELD
                     SEFEDLFEPPERTKKRRRISPAPEPDNTPSRDYGGIQNDTILTSSPGAGPDSRLWNEE
                     PPVTPFPRCPRPTQQPQFQDGPMPTGTPKPTTPATAKPAFRHYPRFLLSQKPPPSTQT
                     SPASAPVFASQPPSSTPRRKPAFVLPRSPSPSATQDTAPLPTPFSPSSRTLRRRGRAR
                     NDVPGYVPGGMAAEVRGWVLEMGTKREQLDGPVARSDMQAGVDVRKYFVTVRVVRMVK
                     GVLRSSGAVASVEAELITKDTEGGEGGSRRILLMGSPRSRSRGSDLQEGSVIGIYRGL
                     MWEIELDGGGVNDLVRGNLGVADLDDRRPSSSDDCERWLVVMAWDLL"
     gene            complement(<1348395..>1348726)
                     /locus_tag="ACHE_40478A"
                     /db_xref="GeneID:66982273"
     mRNA            complement(join(<1348395..1348435,1348487..1348545,
                     1348605..>1348726))
                     /locus_tag="ACHE_40478A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278681.1"
                     /db_xref="GeneID:66982273"
     CDS             complement(join(1348395..1348435,1348487..1348545,
                     1348605..1348726))
                     /locus_tag="ACHE_40478A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136436.1"
                     /db_xref="GeneID:66982273"
                     /translation="MGFFRTLQQKAHEHKSSTITAAKEAEENASYAGSYAALISEKQK
                     APPKTLGGGNRTYNYNPGDQCFGSCCRNY"
     gene            complement(<1349072..>1351401)
                     /locus_tag="ACHE_40479A"
                     /db_xref="GeneID:66982274"
     mRNA            complement(join(<1349072..1349328,1349394..1349878,
                     1349936..1350607,1350659..>1351401))
                     /locus_tag="ACHE_40479A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278682.1"
                     /db_xref="GeneID:66982274"
     CDS             complement(join(1349072..1349328,1349394..1349878,
                     1349936..1350607,1350659..1351401))
                     /locus_tag="ACHE_40479A"
                     /note="COG:S;
                     EggNog:ENOG410PNMF;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (o521-540i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136437.1"
                     /db_xref="GeneID:66982274"
                     /translation="MSSRPYRSKRQRPCDQCRERKLGCQTDAGLPCARCRSADLRCTF
                     AKPPPKRPRRQLREGDEIGFTDSVDSRSQSQVHPSIEGGSTPSHPPSHQHQHQHQQHQ
                     EEYPYPQPPVAAHSSAATTPANQILSSSWPQQLISSGRAPTQFVQSLDQLEGFSAQLF
                     GASAESDPWLLRHCSFDDAGVKCFYKVHFRNAGGVPVPLRIPVHFMIAADDLAADSKT
                     ETRVAAPGMNSREELNSLVPDEYGVRLVGLFVKYIWPALPLVSRYQLGLTPSCTVPTA
                     EILDKIPAHLLAAIYATALPFAGQDDYLCVLHTYNNAPVDRLWRIVYELIAEEIHTPH
                     LSVLQAGLLYLHKPLDEGRSATADTPFVWSWVGSMVGLACSLGLHIECRMWGIPAWEK
                     RLRRRLWWAVYAEDKWRSLLMGRPPYIRREEWDVSELDGGDFFLQVQGAQGCTSISDV
                     DVPFRYLVDLAQIAETIHESFYTLRAAQYLSENFAASHDTGLPLLEKLNIWYASLPET
                     FRLPNWSKSVSGLAPYPASIHFAYLILVVYVYRAMLRPMARSSSPPLIFDVDEMPSTT
                     TLPIEETSILDFADVPEIESFPAVDVDLSEVHGTGETTLNAAERCASIVISFTRRLTS
                     SDFTGFWYSWSRIGFATVSNFTMLLLVQAPNAERAVKGKHLVDSWLRVLRTQSPSFPL
                     MKLGLTRLDAMHWVGLGQTFVLPQHVQDIILGSGSL"
     gene            <1351712..>1352991
                     /locus_tag="ACHE_40480S"
                     /db_xref="GeneID:66982275"
     mRNA            join(<1351712..1352805,1352856..>1352991)
                     /locus_tag="ACHE_40480S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278683.1"
                     /db_xref="GeneID:66982275"
     CDS             join(1351712..1352805,1352856..1352991)
                     /locus_tag="ACHE_40480S"
                     /note="COG:G;
                     EggNog:ENOG410PVSH;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i12-38o50-73i80-98o104-126i138-157o169-189i223-243o263-
                     282i294-311o317-342i354-372o384-405i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136438.1"
                     /db_xref="GeneID:66982275"
                     /translation="MAHPEGGLIANLVVLGSFCSITGGLGLMNSIGIYQAYISTHQLS
                     SLSHSQISWIFGVYNFLIFFGGLQIGPIFDAKGPRALMWIGSGLLVVMFVALGFCEKY
                     WHFFVVLGVLGGIGTSFIFIVPVASIGHFFLRRRGAATGLAMAGGSIGGVIFPIMLEK
                     LAPKIGFAWATRAIGLVTLVLLFIGCLLVRGRQPEPLPSPESPPEKPKPKHELIRSLL
                     PDLTILANPLLALTTAGVFLIEWGFFIPLEYITSYALYYSISPDLAYLMVVFFNAGSF
                     PGRWIPGILADKVGRYNMLIYTNVLALVAVLGIWMPAQGNVAATIVFAVVFGFASGSN
                     ISLVPVCVGELCPTEAYGRYYTTVYTIVSLGALTGVPIAGEIIQRTNGEYWGLIAFAG
                     CSYAAGLLCFIAVKLLQ"
     gene            complement(<1353140..>1354520)
                     /locus_tag="ACHE_40481A"
                     /db_xref="GeneID:66982276"
     mRNA            complement(join(<1353140..1354224,1354274..>1354520))
                     /locus_tag="ACHE_40481A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278684.1"
                     /db_xref="GeneID:66982276"
     CDS             complement(join(1353140..1354224,1354274..1354520))
                     /locus_tag="ACHE_40481A"
                     /note="COG:I;
                     EggNog:ENOG410PH9Z;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF13450;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136439.1"
                     /db_xref="GeneID:66982276"
                     /translation="MSQSPQDLRIAILGAGMGGLTCALALAQRGFKNIDVYEYASDLG
                     FVGAGIQLAPNMARVLDNLGVWKGIEAEAVNILDTSVRVGATDTQLAHVDLKYIEKTY
                     GYPHMVGHRHSLANGLYSGCKQHPAINFHFSTEAETIDSFGPKPSFTATPRNGSGSYR
                     IEADVILAADGIKSKSRVEMLKRLNINVGIKDTNQAAYRIMIHKDQIKDDPELLDLIN
                     STRVTRWIGEKRHIIAYPVSNNNIYNLSTTQPDSNFAAATNATYTTKGSKSAMLGVFS
                     DFCPMVQRMLNYVPEGEVCEWKLRVHDPLPTWIHGSVALVGDACHPTLPHLAQGAAQA
                     IEDGAVLAVVLSRLPNTQPDSINKALRVYEKVRKQRAYALVDLAAASGRALHLGEGAA
                     KEQRDKQFAALRQGKGPVPDKWADADVQREIYGFDCTKVTEEEFEGLFNGM"
     gene            <1362769..>1363290
                     /locus_tag="ACHE_40483S"
                     /db_xref="GeneID:66982278"
     mRNA            <1362769..>1363290
                     /locus_tag="ACHE_40483S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278685.1"
                     /db_xref="GeneID:66982278"
     CDS             1362769..1363290
                     /locus_tag="ACHE_40483S"
                     /note="COG:Q;
                     EggNog:ENOG410PPBW;
                     antiSMASH:Cluster_4.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136440.1"
                     /db_xref="GeneID:66982278"
                     /translation="MTIPTTIRSLLSLLRSILLRSDGGDAKISKHSQALFETTKRLLA
                     EVVNEGLVDATIGGSKNNPYLYLHRRSPAMENDRKWLKVGLQPGIMLETRDGKVTAVV
                     RPDSLQQPVVISNGSGEEEELDPGILFQFLSPWLVEDADEDILNEIALELGNSARNQG
                     KPYIPVRESLDTC"
     gene            <1363465..>1364703
                     /locus_tag="ACHE_40484S"
                     /db_xref="GeneID:66982279"
     mRNA            join(<1363465..1364553,1364608..>1364703)
                     /locus_tag="ACHE_40484S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278687.1"
                     /db_xref="GeneID:66982279"
     CDS             join(1363465..1364553,1364608..1364703)
                     /locus_tag="ACHE_40484S"
                     /note="COG:Q;
                     EggNog:ENOG410PPBW;
                     InterPro:IPR037455,IPR007310,IPR022770;
                     PFAM:PF06276;
                     antiSMASH:Cluster_4.3;
                     go_process: GO:0019290 - siderophore biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136441.1"
                     /db_xref="GeneID:66982279"
                     /translation="MLTPTLAFLSVPRTDLRVTGAFEATIQPLLSKLEIPSTSADRVV
                     VPCLSRQLPSVHQRFPNAVVLKTVDNVADAQASMRTLTLRPEYDFGYHLKLSLACQIT
                     SALRTITPWTTCGGPVQTALLEKFLPTDLWVFREVAAVSGAQDNFADAKHLSCILRDD
                     LESRADANNERLVIAAALAQQPYNNTRSYAEIIYNMHTTTDKQSWLRTYVTRLFTLVL
                     PPLARYGIGLEAHGQNLVARICRTTGEVKGFAVRDFGGVRMHVPTLKKFGVNFDSLPP
                     GGATLTEDLHNVWSKVHHALVQNHVGLIVSALGLERAGGWGIVREVLGGVLEQEEKGM
                     GREVAEYFMQDTMPFKCFLRMRMEGKYRDYVEREVPNVLLMDSPRWEKVLRSYEPTLH
                     YT"
     gene            complement(<1364778..>1366337)
                     /locus_tag="ACHE_40482A"
                     /db_xref="GeneID:66982277"
     mRNA            complement(<1364778..>1366337)
                     /locus_tag="ACHE_40482A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278688.1"
                     /db_xref="GeneID:66982277"
     CDS             complement(1364778..1366337)
                     /locus_tag="ACHE_40482A"
                     /note="COG:S;
                     EggNog:ENOG410PMZJ;
                     InterPro:IPR038921;
                     SECRETED:SignalP(1-20);
                     antiSMASH:Cluster_4.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136442.1"
                     /db_xref="GeneID:66982277"
                     /translation="MRSQFLSLALLASFSTSTVAHEESTKNANHIFNAIHSSMRQWGS
                     SLYHNGMSFFLASVPAGTQLYHGGMSPDHVIGIEWLAFEPEHAMLFARMPPMGSQPGI
                     PPGRGGHKGGRPGRGGPGGPGGQKPLSLEPPEDGEPKKSGWLQTYVPVRDLRLLYIDG
                     MSAGKTSNGTLDSQNRVLFNDTVHDDRIMNEFERAKDFCRLSREVWDDRLDGVLRMEA
                     GFEIILCSFERDLHLLREVEVQANKGGIPRHLPRPGKDHNKTMHEIIPDAGPWMKAIT
                     ARYHGIGGNRVKLNYDHFVTAYTYDLDIFGGASKPLRPRLNHIDSTKLEPVRQDLKAL
                     IMGHDTDESSFDWQSVTDMVVERYARTLKSLVSADITTNTKQLHDNLKKVLDPFFDFG
                     GRNITVEAERCATQFIPFTAPTQGIAARAVRSIADSICFTLLEAFEQPEYETAVSKIQ
                     DLVEYLAWTTWKECQGCAYNEICVIPVWPMGIIEDWENPPCRDVRNPQGSGVEYWGWD
                     FIPGPTELDDS"
     gene            <1366622..>1367530
                     /locus_tag="ACHE_40486S"
                     /db_xref="GeneID:66982281"
     mRNA            <1366622..>1367530
                     /locus_tag="ACHE_40486S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278689.1"
                     /db_xref="GeneID:66982281"
     CDS             1366622..1367530
                     /locus_tag="ACHE_40486S"
                     /note="COG:S;
                     EggNog:ENOG410PMWN;
                     InterPro:IPR036412,IPR023214;
                     antiSMASH:Cluster_4.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136443.1"
                     /db_xref="GeneID:66982281"
                     /translation="MSPRSLLLTIDAFGTIFHPRLPVPEQYASTAHAFGLSRSLVTPE
                     SLQPAFKEVFKAHAKRYPNYGRELALRGQYGGPRQWWEEVIRGSFGKVLNDNNGDLPE
                     GLVKRLLDRFASKEGYALYADAEEFLMRMREVKKGLLQKQRFGPFEKVLVGVISNSDD
                     RVPGVLKSLGLAVGDTRADQGVPSMRLAGFEERSSSSKQEDSEINDLDFIITSYEAGE
                     EKPGQAIFDVAKQQAMRDAGADSENFSQWTCVHVGDDYSKDYQAAIDAGWDGYYVPRD
                     GEVQGHQGVGTMRSLIELLSLLKGYK"
     gene            complement(<1367895..>1371877)
                     /locus_tag="ACHE_40485A"
                     /db_xref="GeneID:66982280"
     mRNA            complement(join(<1367895..1368993,1369047..>1371877))
                     /locus_tag="ACHE_40485A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278690.1"
                     /db_xref="GeneID:66982280"
     CDS             complement(join(1367895..1368993,1369047..1371877))
                     /locus_tag="ACHE_40485A"
                     /note="COG:D;
                     EggNog:ENOG410PM0Z;
                     InterPro:IPR018564,IPR024146;
                     PFAM:PF09444;
                     antiSMASH:Cluster_4.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136444.1"
                     /db_xref="GeneID:66982280"
                     /translation="MSAPSTPRSTRTASPPGDSPAILTPGQKIKAMMAQFDSDSESDN
                     ETTSKAQRPIARPNFTNNTSTNEPAQRKGAENADSDGDDEADDIIMPRGRMAARLQAE
                     GQDGEANKPETAYDRIKKTLKEQEKGNQDDEEDDLPMAGPRRRQANKQNDSEDEESDR
                     SPSPARSFSPLFMSSPATQRLALLEDNGSDGPDDEEPQPKNDTRLQALIAQKRKEREE
                     RERIEAEKKAARAKQNEQFSSDVLSGEDSGDDNDRGSAKKLSQQARPSRKASKKALEE
                     MNRETQRMSRNMQLAHQAQTKKKITKESFFARFNFGQPKTDNAGPLAENSSTTASQNS
                     SDGEAQKDRETPRTSPVMGPADKPVSPQTAGDKGKETETEAMEFTMPPLEEVLAGTHL
                     QHEEPIVAQAEVQTEEPQQKAPESKPQRKTLTKPPVRVQLSRQSVAEHQQEDSDSDLE
                     VVTSPAKCRRVAAFENIKTKRSEESASMLKLKALAHLTSPDRQATSTNFAQLSADLLA
                     QARKQAADERKQRIDELRAQGVFIETAEERQAMEDEIENLMEKARQEADDIAKQERKE
                     KKQAQCDDDDDSDEGDYEPSGSEDEVQGDNDEVDEEEEEDEEETGETGAQNDENMIDA
                     EAGEDEESVDEQSEAMSADEAAVPSTRRKRPIRVIEDEDDEDEQQHEPRAPATPINPI
                     TPHKGSAARPEFPGLEGSGGLTMGLTQAFAGTLAGSGQDTQPNTPSVIPSLPDPANMV
                     NGVEQSDSEILVRDSQGQQEQTADIFAGYALSEGGASESPAPRAMSEFSQVPEPTQDA
                     GFVYSPFDPSKRFRPPPSTIETVVVERHETPDSPVVIKKNKHLRRGRTDDNQGTEEQS
                     KGDFEIDSSAFDIMRKASKKKNIVPFDKQKSRAKDVVEDAAEESEDEYAGLGGASDDS
                     DGEEDAYDQSMINDNSGEVVDEKLLARLNAARQRDDDAKQVEKLMRDITTGALRRRRG
                     ADDDLDLDDPEDELLARRREKQREFARMRRALLADEKVNEIAENPKKAAFFKAIEDRD
                     EEDDVDLEFLEYENEGGSQERSSQDVASEGQKEPATPETENNDNKRKRPLEPSAEDIA
                     NRPPPHLRRKPASHMSKKPATLAEIRETVSFLTETHEYDSFHEDAAIDEEGDHDEKMA
                     EAETPTAEEPKEDFVPRTHNHNHPRRTRGPVVDRLALLRQASSNSAQSSASTRFAFHA
                     GAGNDAAASIGFRPPPLLRKNTANSSSSGSVSSGHSDSRKTMKAPAGASTAKKGAVNY
                     YTAAREKERERAIRAKERSSGSNVAALLNKHAANRRGLGALGEGQWE"
     gene            complement(<1372421..>1374377)
                     /locus_tag="ACHE_40487A"
                     /db_xref="GeneID:66982282"
     mRNA            complement(join(<1372421..1373301,1373359..1374080,
                     1374178..>1374377))
                     /locus_tag="ACHE_40487A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278691.1"
                     /db_xref="GeneID:66982282"
     CDS             complement(join(1372421..1373301,1373359..1374080,
                     1374178..1374377))
                     /locus_tag="ACHE_40487A"
                     /note="BUSCO:EOG09264XOZ;
                     COG:K;
                     EggNog:ENOG410Q10W;
                     InterPro:IPR004343,IPR036128;
                     PFAM:PF03126;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136445.1"
                     /db_xref="GeneID:66982282"
                     /translation="MADDFDAELLALAGDDSDEETSPQVKQSAASPAPSQSRSPEPTN
                     RKGTAKSARRGRKSRRDEEDGEVSDAESASMSESDSEAESSPDVDGDGPIFPYDKLYY
                     SAKDKQEIMAMPEIQREEILSERAQQVDRHNQDIALRRLLASREREEARQAKKNKRKA
                     SSAGIDDVQRKSSRQKTTLGGRKVGEASGAIEAYKRQREQKGKRDELRRRDPGKDVGR
                     TKDESASEDDAEGESEAEWDDRDRSPSPPKDDPPAELRDIQRARVGRSNFAQVCFYPG
                     FDNSISGCYVRVNVGPNRDTGINEYRLCLIKKFSEGKPYAMEGSNGRPFVTNQYAVLA
                     HGKSEREFPFVACSDSPITDHEFNRYRQTMAVEDCKMATKSMLADKVADINRLLNHKF
                     TNEELNEKLRKQGSLDSKTFVFKRMETEKQLAFARASGDDSEVDKLQAQLAELTGPKL
                     AFGSSLNKPQPKKQSEHERLAELNLRNQRLNYENVRRAQLEERKATKKAAAAIARGEA
                     AQDPFMRVRTLAKTHHDANGTSSVPPPKPDAPVDSRDATPTTGPDTPGKATPKRSDTP
                     TQKKPVKGGIAGIRHRNMDDENIAALDLDLDVEI"
     gene            <1374907..>1375617
                     /locus_tag="ACHE_40488S"
                     /db_xref="GeneID:66982283"
     mRNA            <1374907..>1375617
                     /locus_tag="ACHE_40488S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278692.1"
                     /db_xref="GeneID:66982283"
     CDS             1374907..1375617
                     /locus_tag="ACHE_40488S"
                     /note="COG:H;
                     EggNog:ENOG410PIYJ;
                     InterPro:IPR009078,IPR011566;
                     PFAM:PF03232;
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136446.1"
                     /db_xref="GeneID:66982283"
                     /translation="MYTNRTLRSCALACTASPLFLDFLVPSTLRVNRVRYNSTTTKKP
                     IYQLSQRQREFLDSALRVNQAGELAATLIYDAQKPPVVRSHPHLRPLMKHMYDQEAGH
                     FSTFNKYIAKHQVRPTAMYPVWEVAATVLGWSTAVMGREAAMACTEAVETEIGSHYNE
                     QVREILSWAAEAERRGEELDDELKEMVATFRRIRDEELEHLDHAVENDSKEAKPYDPL
                     VNFIRAGCRAAINVSERV"
     gene            <1376360..>1377115
                     /locus_tag="ACHE_40489S"
                     /db_xref="GeneID:66982284"
     mRNA            <1376360..>1377115
                     /locus_tag="ACHE_40489S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278693.1"
                     /db_xref="GeneID:66982284"
     CDS             1376360..1377115
                     /locus_tag="ACHE_40489S"
                     /note="COG:S;
                     EggNog:ENOG410PS0X;
                     InterPro:IPR023213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136447.1"
                     /db_xref="GeneID:66982284"
                     /translation="MRMPWQQIYPGYYERPPDVLESLHFHAARVVSHLGKTQHTISTS
                     LQLSTAPPAEDVRRAWIALRVKHPQLGALTDEAGTKVTYIVPSGEDLEEWLQESLTIY
                     DTTDTRTADDVDANIQECRWLALYYFPSSRELLIRTPHWRADSIGLLLLQHDLLDILT
                     HGPPSDTPVFDGSELARFPPTFTEGAGMPTEATPEMNKAVDESLAVMLVGSPPVTLRE
                     VRPGTVPETSQRAVTRFSQDLSRRSSRPPRPEG"
     gene            <1377142..>1377738
                     /locus_tag="ACHE_40490S"
                     /db_xref="GeneID:66982285"
     mRNA            <1377142..>1377738
                     /locus_tag="ACHE_40490S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278694.1"
                     /db_xref="GeneID:66982285"
     CDS             1377142..1377738
                     /locus_tag="ACHE_40490S"
                     /note="COG:S;
                     EggNog:ENOG410PSN3;
                     InterPro:IPR023213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136448.1"
                     /db_xref="GeneID:66982285"
                     /translation="MAITILAHAAPVEEKSRLIFFNPVNTRDHLPEQWSGAAGAAGIY
                     HTGRACSIDLGSSQTNKDNNFDRFADLLSAHYRQDIKTLFGYMVPYLQRLEQAFTVPY
                     EVGLHNPGTARPDLSSLGILEKYLNPRYEGPNASFEIQDWWLGMQVMGRSLHTYLWTR
                     DDMLHIGCSYNETFYERKFVEGFLEDWKTALVDRLLLT"
     gene            complement(<1378234..>1379455)
                     /locus_tag="ACHE_40491A"
                     /db_xref="GeneID:66982286"
     mRNA            complement(join(<1378234..1379012,1379065..>1379455))
                     /locus_tag="ACHE_40491A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278695.1"
                     /db_xref="GeneID:66982286"
     CDS             complement(join(1378234..1379012,1379065..1379455))
                     /locus_tag="ACHE_40491A"
                     /note="COG:C;
                     EggNog:ENOG410PMCP;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136449.1"
                     /db_xref="GeneID:66982286"
                     /translation="MFESVFRHIKRRTISHLEYSCNPFQFVKFIPRHIFIKASSYTMS
                     VQRAIQIQRPKVAKLVTDAPIPSIRDDYVKVKTVAVALNPTDWKHIDFLATEGAIVGC
                     DYSGIVEEVGSAVTNLKVGDKVAGFVHGSNGDNIEDGAFAEHIVAKAAIQIKIPDNIS
                     FEEASTLGVGITTVGQGLYQSLELPWPSTTSITTDKSPAILIYGGSTATGTLAIQFAK
                     LSGFKVLATASPHNFNLLRSLGADEVFDYHSPTVGAEIRAATNDRLAHVFDCIASESS
                     VAISAEAISSTGGAYSSLLLVKEFPRADVENKRTLAYTGIGETFHKGGTEFPADQSHL
                     DFQVKFWELSRELLAQGKVKVHPPEVREGGLEKILEGAEDLKHNRVSGVKLVYRV"
     gene            complement(<1380221..>1380997)
                     /locus_tag="ACHE_40492A"
                     /db_xref="GeneID:66982287"
     mRNA            complement(join(<1380221..1380715,1380764..>1380997))
                     /locus_tag="ACHE_40492A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278696.1"
                     /db_xref="GeneID:66982287"
     CDS             complement(join(1380221..1380715,1380764..1380997))
                     /locus_tag="ACHE_40492A"
                     /note="COG:G;
                     EggNog:ENOG410QDAJ;
                     InterPro:IPR011701,IPR036259;
                     TransMembrane:7
                     (o15-35i56-76o96-116i123-141o147-167i188-208o214-235i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136450.1"
                     /db_xref="GeneID:66982287"
                     /translation="MQIAQQLSPKIGYPWAIRVMGFIIVFDSVLIVLLARPRQFKRTK
                     GPLVDPKAFKEPTYLFFAIGIFFTLWGVYIAYFYTTTFGKEIIGISENNSLTLLMILN
                     AVGVPGRIVPSLLADNYFGTFNTLLPFVCAVSALLYGWIGVHSTGGFYGFVVIYGICA
                     NAVQTLFPSALSQLTTDLSKVASRVGMVFTVGSFACLTGPPIAGALISKKGGDYLWAQ
                     LFGGTSVILGFVLLSVARWTKGRS"
     gene            complement(<1381026..>1381598)
                     /locus_tag="ACHE_40493A"
                     /db_xref="GeneID:66982288"
     mRNA            complement(<1381026..>1381598)
                     /locus_tag="ACHE_40493A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278698.1"
                     /db_xref="GeneID:66982288"
     CDS             complement(1381026..1381598)
                     /locus_tag="ACHE_40493A"
                     /note="COG:G;
                     EggNog:ENOG410QDAJ;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     TransMembrane:5 (i39-60o80-98i110-132o144-161i168-188o);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136451.1"
                     /db_xref="GeneID:66982288"
                     /translation="MASTSTSSSSLAAKEPFVSSESEETPAENTQTTVPEGSLLACSQ
                     VLVSHLIVVNGFGYFSSFGIFQSHWIDTLNRSNSDISWVGSLSLFLLFFLGTLSGPIM
                     DRGYLRHLLVAGCGFQILGVFTTSAVSQYWQLLLSQGIVQGIGNGLLFTPCIALVSTY
                     FTKRRAFALSLAACGAPVGGVVFPIVSLCT"
     gene            <1382154..>1383799
                     /locus_tag="ACHE_40494S"
                     /db_xref="GeneID:66982289"
     mRNA            join(<1382154..1382388,1382446..1382708,1382764..1382914,
                     1382964..>1383799)
                     /locus_tag="ACHE_40494S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278699.1"
                     /db_xref="GeneID:66982289"
     CDS             join(1382154..1382388,1382446..1382708,1382764..1382914,
                     1382964..1383799)
                     /locus_tag="ACHE_40494S"
                     /note="COG:Q;
                     EggNog:ENOG410PVSI;
                     InterPro:IPR007817;
                     PFAM:PF05141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136452.1"
                     /db_xref="GeneID:66982289"
                     /translation="MASLSLPVERKLFNPLWWREMLFQWQSQSHKISSASDVDAGTPE
                     SKVVEVHQVNAPSKASSAYDFAKVPKDGVTITVTELESEDDLEVEEDRAVTIISEPEP
                     TDWDKLASDILDVIGDYGLHTQPKDVDGPVTGWAGKSFFMDRVRTQVAKGHAIEMILP
                     AFPWKSINQVDKVTGVLPDLGEELALSRLHQLCEDIKVVYPPGGEVHIATDGLLFDDV
                     VGISDDNTWAYGDGLVQMAKSKGYDKSIKLFRVMDILGYTADTPLNKESYLSLAQKCR
                     NEILEKYGRTEEEVREMMRDDPDTLLTYCGFIRFLETDLRHSPVAAHATSGQKYRKIV
                     KKVAISMMIRAESFTKFLQAMKPEHVRLSIHPSSGNVKLSIPLIVQGSGDFPKSPWHS
                     SIAVALDGTYTTVHSKAVRDTHRLMYKDGRPYFYREKSELWDWEDEDVVFEAQYPNTM
                     LLYPRAGIKKSLTEEQLDKVKQLRGVHKGPVKVIGFENAAAGAA"
     gene            complement(<1384443..>1386586)
                     /locus_tag="ACHE_40495A"
                     /db_xref="GeneID:66982290"
     mRNA            complement(join(<1384443..1385054,1385105..1385849,
                     1385898..1386060,1386111..1386310,1386372..1386407,
                     1386459..>1386586))
                     /locus_tag="ACHE_40495A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278700.1"
                     /db_xref="GeneID:66982290"
     CDS             complement(join(1384443..1385054,1385105..1385849,
                     1385898..1386060,1386111..1386310,1386372..1386407,
                     1386459..1386586))
                     /locus_tag="ACHE_40495A"
                     /note="CAZy:AA1;
                     COG:Q;
                     EggNog:ENOG410PKCR;
                     InterPro:IPR008972,IPR011707,IPR011706,IPR001117;
                     PFAM:PF00394,PF07732,PF07731;
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136453.1"
                     /db_xref="GeneID:66982290"
                     /translation="MTTIIEALCCDTINRQTCMTLLCLNMKQLFSSLLFATAACAAKL
                     SQGLTQAQTNGLSTWGTLDNPQFPDFLPSHDGSTDNPWENLSNKRRDNDPYPEVPYTG
                     VTRYYYFEVARDILSPDGYEKNGIFVNGQFPGPAIEANWGDWVEVTVHNNITGPEEGT
                     AMHWHGISQKGTQWADGVPGVSQCPIAPGSFFTYRFRASEYGTSWWHSHYSAQWTAGA
                     FGPLIVYGPKHIPYDVDLGPIMLGDYYHRDYFEVVEDAASNSTDLNVYAPWSDNNLIN
                     GKNNYNCSMSKTNATCVDDAGLAQFRFQPGKVHRLRLMNIGAAALLHFSIDGHKMQVI
                     AQDFVPVVPYEADVVTLGAAQRTDVLVMGDADPRETYWIRSNISTNCSNTYTSMAWAV
                     LSYEGNDDIQEPTTDSTDAVKEADRKDFLCRNDDLNKTVPFFPQALKEPDITTTIQVD
                     LYTNETGHHLWTMNNRTQRTDYNNPLLLLANEGNFSIPDPDWNVYDFGTSKTVRIVLN
                     TVYQSAHPMHLHGHSFQVLAEGDGPWDGTIVNPRNPTRRDTHMQRRYGHLVIQFEADN
                     PGVWSYHCHIAWHASMGYNIMILEQSRDIEDVEIPVYMEQTCKDWDRWSKYNVVEQID
                     SGI"
     gene            complement(<1387462..>1388326)
                     /locus_tag="ACHE_40496A"
                     /db_xref="GeneID:66982291"
     mRNA            complement(join(<1387462..1387656,1387709..1388109,
                     1388170..>1388326))
                     /locus_tag="ACHE_40496A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278701.1"
                     /db_xref="GeneID:66982291"
     CDS             complement(join(1387462..1387656,1387709..1388109,
                     1388170..1388326))
                     /locus_tag="ACHE_40496A"
                     /note="InterPro:IPR004827;
                     go_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136454.1"
                     /db_xref="GeneID:66982291"
                     /translation="MAGAQTSPNSHPDQYPLQPNVEFIFTSDESWSHIEDMALRRRIQ
                     NKAAQRRYRRKIREQAASTAGHRIPVPLTMEPPPDLPWYPNSAQGPNTTRTREHTPAL
                     SWNPETSAFRNGTPSEPWQYQGQDDLLFPPSGDLSRPSSASSCFSANAFSQDAGYLDQ
                     TERGFYGALPIDDPFLAVGVPERNFQSSPLPLCSKDTNADRLAKRIKKTLDELSLLYD
                     IGIELELVPQDNDMFTQLESLKKAFCKAMKVA"
     gene            complement(<1389092..>1390010)
                     /locus_tag="ACHE_40497A"
                     /db_xref="GeneID:66982292"
     mRNA            complement(join(<1389092..1389280,1389333..1389492,
                     1389541..1389648,1389703..>1390010))
                     /locus_tag="ACHE_40497A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278702.1"
                     /db_xref="GeneID:66982292"
     CDS             complement(join(1389092..1389280,1389333..1389492,
                     1389541..1389648,1389703..1390010))
                     /locus_tag="ACHE_40497A"
                     /note="COG:Q;
                     EggNog:ENOG410PQAK;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136455.1"
                     /db_xref="GeneID:66982292"
                     /translation="MASYLVTGSSKGLNLGFCNILASKPASEVSKVFATARRHTDALK
                     DLISRYPQRVEFVLMDVLSEESVQKATEQVEKSLGGKGLDVLINGVGIMPFAPEGVHT
                     VNNLDFILNSNVLGAHLVTRNILPLLRKGNLKKVANISTSLGSITLAPKYHTHMPTPA
                     YKISKAALNMLTVQYAMDFADQGFTFFAICPGWVKTDLGGEFADLTIEQSVNAILNVV
                     FNSTPQANNGKFMNIHVPGWERSEGINQYNGGEIPW"
     gene            <1392173..>1393046
                     /locus_tag="ACHE_40498S"
                     /db_xref="GeneID:66982293"
     mRNA            join(<1392173..1392204,1392257..>1393046)
                     /locus_tag="ACHE_40498S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278703.1"
                     /db_xref="GeneID:66982293"
     CDS             join(1392173..1392204,1392257..1393046)
                     /locus_tag="ACHE_40498S"
                     /note="COG:S;
                     EggNog:ENOG410PWVF;
                     InterPro:IPR011333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136456.1"
                     /db_xref="GeneID:66982293"
                     /translation="MNNESTSYYTSIIKSPQFTFLVGKDRTPMTIHASIVQGKSDPLA
                     AMINNGLMKESTTGVAILDDVDVDVFGGLCEHLYTGRYTTPICTVNDAEKTYPEDKKV
                     TRSRFPWIPYLNRRAMTSTNPRSPDFNDNNMRHAQLCISYYLTVSFRELNFDACRCAS
                     KTSTPDIIFHARLYVLATRFLVESLREQSLASLHRDLEQLIDKTSDIGLIIDLLHVTY
                     SLTGKSEPGGGSALRELVSHYAASKAPELSKHAMFRELLEASSDIGTDIIMNLTT"
     gene            <1393868..>1394687
                     /locus_tag="ACHE_40499S"
                     /db_xref="GeneID:66982294"
     mRNA            join(<1393868..1394237,1394287..>1394687)
                     /locus_tag="ACHE_40499S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278704.1"
                     /db_xref="GeneID:66982294"
     CDS             join(1393868..1394237,1394287..1394687)
                     /locus_tag="ACHE_40499S"
                     /note="COG:O;
                     EggNog:ENOG410PHRJ;
                     InterPro:IPR024079,IPR039124,IPR029482;
                     PFAM:PF13933;
                     SECRETED:SignalP(1-16);
                     go_function: GO:0008237 - metallopeptidase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136457.1"
                     /db_xref="GeneID:66982294"
                     /translation="MASLIPFLLLSSAVSAIPTPVQNQTTTSPSPWDSDAVSQYPIHS
                     SCNATQRLQIETGLNESIALAAHAKEHILRWGNKSSIYRKYFGNRPLFEPIGIYELLN
                     SGDKGSVLFRCDNPDGKCEIDGYAGHWRDTAAPNETVICDLSYIERRSLTTMCSLGYT
                     VSNSETNTFWAADLLHRLFHMPPIGQNWVDHFADGYDEVIELAASNKSVSTRDSETLQ
                     YFALEAYAFDIVVPGVGCPGEHDHEHDHEHTEDIIIII"
     gene            complement(<1394943..>1396541)
                     /locus_tag="ACHE_40500A"
                     /db_xref="GeneID:66982295"
     mRNA            complement(<1394943..>1396541)
                     /locus_tag="ACHE_40500A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278705.1"
                     /db_xref="GeneID:66982295"
     CDS             complement(1394943..1396541)
                     /locus_tag="ACHE_40500A"
                     /note="COG:S;
                     EggNog:ENOG410QDNB;
                     InterPro:IPR012337,IPR036397,IPR002156;
                     PFAM:PF13456,PF00075;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004523 - RNA-DNA hybrid ribonuclease
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136458.1"
                     /db_xref="GeneID:66982295"
                     /translation="MRKARAAENRIQRLCQSHGLAPGLARQVQVAAVQSVALYGAELW
                     WQGQKDRLVGIQLMINRQARAITGMMKSTPVGPLVREAGLAPAEALLEARQLKYTTRL
                     LSLPENHPAKEILPVSFREGDQHAQPGEQTPGNRQWAERNNRGPWSLGQHLARQLANI
                     LPVDPSGGFESTTQTTSSQFPGQIEMLPGPEALAAAQSLPPELAIWSDGSRLENGKSG
                     AGIAWQEPGGTWKTWGFPLGKGYEVFDAELLGVVRALQLAEKVGDQRPVTILLDSQAA
                     IARMRHTQPGPGQALVIQAHAIAKRLHARGCQTTIQWVPGHAGIEGNERADQAAKQAA
                     SKPPGRGPREISLAFTCRARTEAITAQRQRWLNKELGQRSQQGQRTYRPQRNWRLDRA
                     AATAPKRLASRYFQLKSGHAAIGTYLHRIQVREDATCEGCGISRETIHHLLFECREWR
                     HQRNRLYKDLETDGVLRPTTAEEYPQGRLLGEPKATRALLQFLASTSIALPRAHLQQT
                     AERARRDDEWGLEALEEAVRTGEG"
     gene            complement(<1397544..>1398193)
                     /locus_tag="ACHE_40501A"
                     /db_xref="GeneID:66982296"
     mRNA            complement(join(<1397544..1398085,1398142..>1398193))
                     /locus_tag="ACHE_40501A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278706.1"
                     /db_xref="GeneID:66982296"
     CDS             complement(join(1397544..1398085,1398142..1398193))
                     /locus_tag="ACHE_40501A"
                     /note="BUSCO:EOG09265A08;
                     COG:T;
                     EggNog:ENOG410PN7B;
                     InterPro:IPR036196,IPR023485,IPR017867,IPR002115;
                     PFAM:PF01451;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0003993 - acid phosphatase activity
                     [Evidence IEA];
                     go_function: GO:0004725 - protein tyrosine phosphatase
                     activity [Evidence IEA];
                     go_function: GO:0004726 - non-membrane spanning protein
                     tyrosine phosphatase activity [Evidence IEA];
                     go_process: GO:0006470 - protein dephosphorylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136459.1"
                     /db_xref="GeneID:66982296"
                     /translation="MSNSNSVNVLFVCLGNICRSPMAEGVFRNVAASHPQINEIDSAG
                     TGAYHVMEPPDPRTMSTLRSHGIKNYNHAARKVTREDFLTFDYLLAMDKYNLRDLLDE
                     RAAVLASLGKGGGAGKKGSKAAAAAAAAEAKGEDVKVAEVRLFGDFGKEGVVHERVGG
                     GEVVQDPYYGGTNGFEEVYQQVVRFSQGFLEHLEKRK"
     gene            <1399166..>1402244
                     /gene="CHS1"
                     /locus_tag="ACHE_40502S"
                     /db_xref="GeneID:66982297"
     mRNA            join(<1399166..1399190,1399379..1399542,1399590..1401617,
                     1401664..1402161,1402230..>1402244)
                     /gene="CHS1"
                     /locus_tag="ACHE_40502S"
                     /product="chitin synthase I"
                     /transcript_id="XM_043278707.1"
                     /db_xref="GeneID:66982297"
     CDS             join(1399166..1399190,1399379..1399542,1399590..1401617,
                     1401664..1402161,1402230..1402244)
                     /gene="CHS1"
                     /locus_tag="ACHE_40502S"
                     /note="CAZy:GT2_Chitin_synth;
                     COG:M;
                     EggNog:ENOG410PF8Q;
                     InterPro:IPR004835,IPR004834,IPR013616;
                     PFAM:PF01644,PF08407,PF13632;
                     TransMembrane:7
                     (o556-575i596-619o631-653i665-689o709-731i837-857o877-
                     903i);
                     go_function: GO:0004100 - chitin synthase activity
                     [Evidence IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_process: GO:0006031 - chitin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="chitin synthase I"
                     /protein_id="XP_043136460.1"
                     /db_xref="GeneID:66982297"
                     /translation="MSYNRLDPDPYGEDEHAHMMHPYAQRTPSPGHPLNGYQLADNPY
                     APPGHLEMPSSDRLAEQPTYSVTRLPNSYGHNEAYEDHGPNVGYPGYDYTLDPEAHHD
                     AYYTEPYRPTATPEEDYDLGHQQNFQDDHTPILQHPENPFGPEKYSDEYHDDPGLAHT
                     PSPAPLRRWKTVKEVQLFNGNLVLDCPIAPRLLSQVPHAEPPGRDEFTHMRYSAATCD
                     PNDFFEERFTLRQKLFAKPRHTELFIAVTMYNEDDFLFARTMGGVFKNIEHMVSRTSS
                     KTWGKDAWKKIVVCVISDGRAKINPRTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEY
                     TTQMAVELKGQHVSLKRGAVPVQMIFCLKEKNQKKINSHRWFFQAFGRVLDPNICVLL
                     DAGTKPGKDSIYHLWKAFDVEPMCGGACGEIKVMLSHGKKLLNPLIAGQNFEYKLSNI
                     LDKPLESSFGFITVLPGAFSAYRYVALQNDKNGQGPLERYFLGEKMHGSNAGIFTANM
                     YLAEDRILCFEIVSKRNCRWLLQYVKSSTGETDVPDRMAEFIMQRRRWLNGSFFAAVY
                     AIAHFYQIWRSDHSFIRKTMLMVEFIYQTIAMLFAWFGIGNFFLVFHILTTYLGDKEL
                     LGTAGKVLGVIFEWLYLATLVTCFVLALGNRPGGSNKFYMTMVYFWIGIMIYLAFAAV
                     FVTVRSIQQQVEKHSFTFSDLFTNKQFFSIIVSLGATYVMWFIASFIFLDPWHMFTSF
                     IQYILLTPTYINVLNIYAFCNTHDITWGTKGDDKAEKLPSANLKPGGKVDVNIPQDDG
                     DLNAQYEAELAKFAVKPPKEEKTIPEEERQADYYKGFRSAVVLVWVFCNFALAAVVLN
                     AAGMEQFSSDSDSTENQRAEIYMAVILWSVAGISIFKFMGAMWYLVVRMFRGV"
     gene            <1403240..>1403626
                     /locus_tag="ACHE_40503S"
                     /db_xref="GeneID:66982298"
     mRNA            <1403240..>1403626
                     /locus_tag="ACHE_40503S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278709.1"
                     /db_xref="GeneID:66982298"
     CDS             1403240..1403626
                     /locus_tag="ACHE_40503S"
                     /note="COG:S;
                     EggNog:ENOG410PR8N;
                     InterPro:IPR036875,IPR001878;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136461.1"
                     /db_xref="GeneID:66982298"
                     /translation="MERQKQNSLAILNTADVLTKGTRKIMHKMDLMEAEIHDLRAANE
                     ALSKRRRAKKTRLRKGGSLSILEAQELGDQMEVEVQLKEETRIRAGRRPRTETRARRC
                     GNCGKAGHNARSCQIVVETSEEDDSE"
     gene            complement(<1405712..>1406146)
                     /locus_tag="ACHE_40504A"
                     /db_xref="GeneID:66982299"
     mRNA            complement(<1405712..>1406146)
                     /locus_tag="ACHE_40504A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278710.1"
                     /db_xref="GeneID:66982299"
     CDS             complement(1405712..1406146)
                     /locus_tag="ACHE_40504A"
                     /note="TransMembrane:1 (o37-64i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136462.1"
                     /db_xref="GeneID:66982299"
                     /translation="MACRPKVTPPYYKRFYSTVGDMVSGIFEIIFEGILPFFVAVVLI
                     LVILFVCFLVCMMVAGALGYDVGMDEKKKTEQEKGERRNKEDSQSSNECEKKAPGAAG
                     CDGSGTGGNGEVDEKTRLRVEIEMLEGILRARKERLGELNKD"
     gene            complement(<1407887..>1408572)
                     /locus_tag="ACHE_40505A"
                     /db_xref="GeneID:66982300"
     mRNA            complement(join(<1407887..1408044,1408095..>1408572))
                     /locus_tag="ACHE_40505A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278711.1"
                     /db_xref="GeneID:66982300"
     CDS             complement(join(1407887..1408044,1408095..1408572))
                     /locus_tag="ACHE_40505A"
                     /note="COG:S;
                     EggNog:ENOG410PPBU;
                     InterPro:IPR018908;
                     PFAM:PF10639;
                     TransMembrane:3 (o14-35i137-157o163-183i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136463.1"
                     /db_xref="GeneID:66982300"
                     /translation="MDPDASILEPPPSVYNYILSFLLVGVAWGFTTPFIRRAAADFNA
                     RQEAQRDTQPESPEKEVPLKNRGGKNKVKHDDTPAEHEEDSEQSNGLRLRKVPRSPPT
                     KQPAWKNPNPSKQSWLKQKLITLLWTVFNLLRTPAYSIPLVINLTGSVWFFLLVGKHE
                     LSLTVPLANSSAFLFTVLGEWYVEKKMIAKETWLGMGLVLGGIALCVQSKQ"
     gene            complement(<1409061..>1409795)
                     /locus_tag="ACHE_40506A"
                     /db_xref="GeneID:66982301"
     mRNA            complement(<1409061..>1409795)
                     /locus_tag="ACHE_40506A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278712.1"
                     /db_xref="GeneID:66982301"
     CDS             complement(1409061..1409795)
                     /locus_tag="ACHE_40506A"
                     /note="COG:Q;
                     EggNog:ENOG410PWPI;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF00106;
                     TransMembrane:1 (i9-31o);
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136464.1"
                     /db_xref="GeneID:66982301"
                     /translation="MSLSGNRNIVIVGVGSLMSKSFAIWLAILGWNIALVSRSEKDLS
                     AIADEVRRAQKGKDVSVIYQAVDASEPSILKAMLDWCVRELGCKLDVLSYNAARVAMT
                     DIAKTAPEELEKDFRASAVGTMVASQWFAEGNSRVDRIAEGEWPLFLVTGGILDKEPQ
                     PTFGSLSCAKAASQTVSRIFAKVLPDKANILVGMPLVAGRVVSPMSEEYHPRARQRRH
                     RRHHPQALLIAYERFMHLHFHGAYFK"
     gene            <1413484..>1415719
                     /locus_tag="ACHE_40507S"
                     /db_xref="GeneID:66982302"
     mRNA            join(<1413484..1413850,1413912..1414648,1414759..1415066,
                     1415116..1415552,1415610..>1415719)
                     /locus_tag="ACHE_40507S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278713.1"
                     /db_xref="GeneID:66982302"
     CDS             join(1413484..1413850,1413912..1414648,1414759..1415066,
                     1415116..1415552,1415610..1415719)
                     /locus_tag="ACHE_40507S"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136465.1"
                     /db_xref="GeneID:66982302"
                     /translation="MSRPRTRKLWCAVPSNLREPFSVVCFSDQDDIETLKEKIWEKIK
                     ERIKDTAPHYSNLTLYSPVVQLNHEEQFRIDDGEFLHPRRMITSNPLFPESKDPNVDI
                     VVVVSGDTTARKRKRSESQGANIPWTRPITKNQLICPREHTVSKLATILDEVNIVHVR
                     GTPASGKTRLSELLRDYYHKEGRKVSLIKEWETLNHMNPWHSLVKLVEKWNEETQDAP
                     TMTSLQSEQDLSWVLTSNTVILVDEAQATYNDDALWNTIFKERLTPSVYKFKLCLFCS
                     YGSPVTGPDQTFFTPVRFSDQQRISLTPQSQEDSPPIGLFYDKEEFKDVVSRLLTFYY
                     EERFNFNEGALEYIFALSNGHPGAVTSIVDVLYEAYRQDIKHGHIRTLTEDHVIWFLE
                     DAATVFDKLSTRPIYRSFPDISRATNGISNTLCKITEEGSIPFDINDASINFCYQKGW
                     IHRVALDGDDIAVLPSRLHEKYIEYSIGTMSLPLPARFDSLPKLCKEILSKFSIMNLR
                     HSVEGRKMSSASQPRPVEAQYQDEFYRGFNHVAGRGVLISSEWSRTKDSRVDFYIPEK
                     KWVIELLRNHDKVDEHISQFKEGGKYHPWLKENMVEDWIIIDCATSLPTKGFSEPRLW
                     HAVFINDYSELQLYNHQKALMMSVHLHN"
     gene            <1417623..>1418462
                     /locus_tag="ACHE_40508S"
                     /db_xref="GeneID:66982303"
     mRNA            <1417623..>1418462
                     /locus_tag="ACHE_40508S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278714.1"
                     /db_xref="GeneID:66982303"
     CDS             1417623..1418462
                     /locus_tag="ACHE_40508S"
                     /note="COG:S;
                     EggNog:ENOG410Q1KJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136466.1"
                     /db_xref="GeneID:66982303"
                     /translation="MYEEFVPEWNDPIPDSPPASFNHDQFAGWFHLPALKHLEIWLWD
                     TARLKERPQDLNNLQTLVLARSTIPEEDVPFILNRTTSLQNLHLGLAYSYYCGYVFEK
                     SDCIVRALDSVSNTVERLSVGLDHYPVVFNERDFNGTEVTRYEHVQEALKKFTCLKTV
                     ELPICLSVSYDVYPDNDVDLSTIWPDTLCEVGLRIDMKAGHENEWDELRMVDWVYDVL
                     LKQRDAVPHLQWIIIRFWEPFYDDLWQEDEKRLQAKCEEIGIPLEFVNDDLSWGLWTR
                     TIP"
     gene            complement(<1419109..>1420706)
                     /locus_tag="ACHE_40509A"
                     /db_xref="GeneID:66982304"
     mRNA            complement(join(<1419109..1419211,1419262..1419365,
                     1419421..1419659,1419708..1419763,1419819..1420654,
                     1420701..>1420706))
                     /locus_tag="ACHE_40509A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278715.1"
                     /db_xref="GeneID:66982304"
     CDS             complement(join(1419109..1419211,1419262..1419365,
                     1419421..1419659,1419708..1419763,1419819..1420654,
                     1420701..1420706))
                     /locus_tag="ACHE_40509A"
                     /note="COG:C,H;
                     EggNog:ENOG410PH8B;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136467.1"
                     /db_xref="GeneID:66982304"
                     /translation="MVLKERLDITIVGAGLSGIAAAISCAASGHSVRMVEQAKELAEV
                     TSNPYTHYMHNSNHRQVGAGLQITPNASRLFNYWQLPSSIWETAAEPKSVTVHRYSGQ
                     VLAHEDNFGINIREKYTAPFVDLHRVDLQQALFARAKQLGVTFHLNERVERIDFNTTT
                     VHAASGNTYTGDLIIAADGLWSRCRECFLGRKDEPLPTGDLAYRIVLSVEQIEDPELR
                     KLVENPEVHFWVGPGAHAVAYSLRGGRMFNVVLLVPDNLPPGVAREVGSVEEMRGLFG
                     GWDPILTRFLSHVDHVDKWKLMHHAEMETWVNEKSNLVFIGDACHPMLPYLAQGANSS
                     LEDGAVLGHLLGHMKNKSQLPEILRLYESLRKSRGEAIVRETFKQRHDFHMPDGEEQR
                     KRDEIFLSQLGKEIKGAFPSRWTCPEVQPWLYGYDAIKEAEDAVGRNMEMFKSVL"
     gene            complement(<1421103..>1422512)
                     /locus_tag="ACHE_40510A"
                     /db_xref="GeneID:66982305"
     mRNA            complement(join(<1421103..1422181,1422233..>1422512))
                     /locus_tag="ACHE_40510A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278716.1"
                     /db_xref="GeneID:66982305"
     CDS             complement(join(1421103..1422181,1422233..1422512))
                     /locus_tag="ACHE_40510A"
                     /note="COG:S;
                     EggNog:ENOG410PIY8;
                     InterPro:IPR021889;
                     PFAM:PF12006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136468.1"
                     /db_xref="GeneID:66982305"
                     /translation="MFQLNSSIHSAIGNCWDHCRSAATMTVTSEKPTGEYRQYLPDLS
                     IPRFQNMREQDAHEYARDFKTLARPPWLHALYLHWLELLQEPFKGVTNDGNVRPGLFT
                     LQDEDVPIDSIVTATQTVLTLCDQSQQKALSYHIDSPEWRTWSNPEFLLSHKGLRLDE
                     VKPQLRDAILTVLKTTLSPEGYDKAIKAMRINHFLGELVESPRVMNELSYNFVLFGTP
                     STTRPWGWSFYGHHLCLNIFLYKGQIIASPWFTGAEPNEIDEGPHAGTRIMQVEEELG
                     LRLMQSLSPELQKQAQVYEQMHDPAMPPGRWNKDDQRHVCGAYRDNRVVPYEGINVGS
                     TFTDAQRELLYGILEQYLLYLPKRSRELKIQHIKQFEAETWFSWIGGFGNEDPFYYRV
                     QSPVVLIEFDHHSGVFLTNEEPKKFHIHTLLRTPNGGDYGHALRGAIPSVEGIVGKEI
                     TW"
     gene            complement(<1422976..>1425494)
                     /gene="SNF1"
                     /locus_tag="ACHE_40511A"
                     /db_xref="GeneID:66982306"
     mRNA            complement(join(<1422976..1423508,1423561..1424136,
                     1424195..1425030,1425091..>1425494))
                     /gene="SNF1"
                     /locus_tag="ACHE_40511A"
                     /product="protein kinase"
                     /transcript_id="XM_043278717.1"
                     /db_xref="GeneID:66982306"
     CDS             complement(join(1422976..1423508,1423561..1424136,
                     1424195..1425030,1425091..1425494))
                     /gene="SNF1"
                     /locus_tag="ACHE_40511A"
                     /note="BUSCO:EOG09261IOS;
                     COG:T;
                     EggNog:ENOG410PGMD;
                     InterPro:IPR017441,IPR032270,IPR008271,IPR028375,
                     IPR000719,IPR011009,IPR013896;
                     PFAM:PF16579,PF07714,PF08587,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="protein kinase"
                     /protein_id="XP_043136469.1"
                     /db_xref="GeneID:66982306"
                     /translation="MAAAFDDEDLSVSLPPIERDHRRDRDRAAVPPPSGDNPAAMAMP
                     PHARPIAKGHEVKQSPATTRDMQRLDQYQTMKILGEGSFGKVKLAIHQPSGRQVALKI
                     INRRKLLSRDMVGRVEREIQYLQLLRHPHIIKLYTVIATKTDIIMVLEYAERELFDYL
                     VKRGRCNDAEARKFFQQIICAVEYCHRHKIVHRDLKPENLLIDANKNVKIADFGLSNI
                     MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLVGRLPFDDDYIPA
                     LFKKIAAGNFHMPPYIHSGAARLIKSMLQVHPVHRLTIPEIRQDPWFLQDLPPYLQPP
                     PEEVIATGSDPNKAIDIRKIAPGKPLSAQHKIHQIAISKLERSMGYARDDIEDALKNP
                     EPSAIKDAFFIIVENEMMQTNSPTDDNLMASVAPSPPSKNPLPSPAVAKQSAATRPHG
                     APTVPSPQRFAQLPPEDEEPVRVSHVRILPTSIPYVHDQLMEQREREREQRARAAHLD
                     AQARAENPDDPAWGERSINDQEATARALKPHSRSIVDLDKLRFEPPEGHHSTAHMPKR
                     SRKWQFGIRSRNQPYEAMLYLYRAIDAQGGVWDILPGDTGGDIGADEEKPLQTKYAHL
                     PSDYYIPKDPWFIRARLLKEGMRIPGPSPRVHGRTSSTVSKSEVEELRRRFNITKIPR
                     DDRNSLAVETASGPPSRRTSSSRVNHGVWVFVDIQLYQLEQNSYMVDFKCDGYQNVVR
                     EEGDAEWRPISRRFRNKEKEVTSPYPFLDVASDLVAQLAVAS"
     gene            <1426924..>1428964
                     /locus_tag="ACHE_40512S"
                     /db_xref="GeneID:66982307"
     mRNA            join(<1426924..1427727,1427780..>1428964)
                     /locus_tag="ACHE_40512S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278718.1"
                     /db_xref="GeneID:66982307"
     CDS             join(1426924..1427727,1427780..1428964)
                     /locus_tag="ACHE_40512S"
                     /note="COG:S;
                     EggNog:ENOG410PYG0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136470.1"
                     /db_xref="GeneID:66982307"
                     /translation="MATNTLFQEYPAREFGPNDVFDYHLGDLSLSPEDCDLIARMNGF
                     DTDPASEFSSEPWFSDFVNYDAPDGLLPGALGNLGAFPDAGPMGNVGMVPNGGFFDPS
                     FDCNTNNGQFQDMVLYDQPYDLTTTIRQAVEAQAAVNTSCSSQKEKRMEASIAFHMQR
                     LQESPLTDPYTSPEFSSPSSSYMGQGSASPTSTGASQTPASATTDGVSTPTLSGPDQP
                     GGVELVLDLNMNATTNLPKKHKPRSQAQRDNYIKVRKHGACEKHKKQHKRCNCLEKKA
                     SLVDVHDGTIIQPPKHATLQSFAPRSTQSSLPSRSTPRDTAHDTLLDLAHNPTHIPRP
                     PRPSIQPISRNDTDIQPHSSTPRCPRSEILWSLYRRHDRPSLDYAAQHSVSVNDKRAK
                     LPTGPQIQLASNSRVVNTDTQQLGKNEISRRLQSRSTLQNHDTAQSTCHTYTKGSRIE
                     HIHQRQSHEKIQSTGTRAGMLPVRPPATANAPGTTPFANNAQNHTLPKYAGRLQRTLV
                     SDKAPSIITSGTLPSGSNGKNRTPECAGRKVQRTLESTRSFWQAPAITTLPGSNGKIR
                     TAREDVGKRTVVSMHSQAPATTSGKILPGSNAQSTLPEYAGRVIQRMLGSVFSLWQAP
                     SALTSLVGSYFGKAIIGCLKQYWSARKSLGICGSSRIV"
     gene            <1429413..>1430567
                     /locus_tag="ACHE_40513S"
                     /db_xref="GeneID:66982308"
     mRNA            join(<1429413..1429499,1429549..1429773,1429849..1430088,
                     1430175..>1430567)
                     /locus_tag="ACHE_40513S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043278720.1"
                     /db_xref="GeneID:66982308"
     CDS             join(1429413..1429499,1429549..1429773,1429849..1430088,
                     1430175..1430567)
                     /locus_tag="ACHE_40513S"
                     /note="COG:G;
                     EggNog:ENOG410PKMG;
                     InterPro:IPR013078,IPR029033;
                     PFAM:PF00300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043136471.1"
                     /db_xref="GeneID:66982308"
                     /translation="MASFHFNLTTVPGYFLQDDPDTDPDAFNYVSSNFGLINRTYNTD
                     TDLDAKNTTQWQRFAYHLHHLNQESHHKTPNVTYRLLFLGRHGEGFHNVAEEKYGTKL
                     WDCYWSLQNGDSNLTWFDAHLTTAGIKQAQVANEAWEKQIERKVPFPQSFYVSPLHRC
                     LATAEITFKGLNATPVPFRPVVKELLRETIGIHTCDKRSPASNITASYPKYILEKGFA
                     NGTDPLWEPDARESNSMRDVRLRDLLYDIFEHDENTVLSLTAHSGAIASILNVVGHQE
                     FALATGAMIPVLVRVEKVAGPKPEMEVDPPIGVPSCGE"
     gene            complement(<1430778..>1431910)
                     /gene="MRPL22"
                     /locus_tag="ACHE_40514A"
                     /db_xref="GeneID:66982309"
     mRNA            complement(join(<1430778..1431805,1431862..>1431910))
                     /gene="MRPL22"
                     /locus_tag="ACHE_40514A"
                     /product="54S ribosomal protein L22, mitochondrial"
                     /transcript_id="XM_043278721.1"
                     /db_xref="GeneID:66982309"
     CDS             complement(join(1430778..1431805,1431862..1431910))
                     /gene="MRPL22"
                     /locus_tag="ACHE_40514A"
                     /note="BUSCO:EOG09264LC7;
                     COG:J;
                     EggNog:ENOG410PNW5;
                     InterPro:IPR036394,IPR001063,IPR005727;
                     PFAM:PF00237;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_component: GO:0015934 - large ribosomal subunit
                     [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="54S ribosomal protein L22, mitochondrial"
                     /protein_id="XP_043136472.1"
                     /db_xref="GeneID:66982309"
                     /translation="MASMGALYPYGNLLRSTRAGVTFVPRRTLTYTTPRRAQEDNSNN
                     GNNENPSKPSALSSIKNFFGFGGKPSDAPKPTITRRANAPPKREGSLSADSIFAEDEA
                     TPKLIASGRTPGRRPTAEQPAEGEGEEQDVSLETRNRENMQAALDPRPQARTRWERKM
                     VVREIRRRGRLSKTEQVMRTERESLSKSHWFKTSIKKLGPLARQIAGKNIDEAILQMR
                     FSKKKAAKDVLEHLQHAKNVAVVRSGMGLGAAAGDEAQKPISIVSKSGERKTITDPTS
                     IYISQAWVNRGPYGVDYDHRARGQINLLRPPYTSLSVLLKEEHTRIREWQDRENTAQR
                     KRKTHLWTQLPDRKISAQNQYYSW"
     gene            <1433124..>1437185
                     /gene="PRP24"
                     /locus_tag="ACHE_40515S"
                     /db_xref="GeneID:66982310"
     mRNA            join(<1433124..1435673,1435731..1435958,1436013..1436369,
                     1436421..>1437185)
                     /gene="PRP24"
                     /locus_tag="ACHE_40515S"
                     /product="splicing factor"
                     /transcript_id="XM_043278722.1"
                     /db_xref="GeneID:66982310"
     CDS             join(1433124..1435673,1435731..1435958,1436013..1436369,
                     1436421..1437185)
                     /gene="PRP24"
                     /locus_tag="ACHE_40515S"
                     /note="COG:A;
                     EggNog:ENOG410PM4Y;
                     InterPro:IPR000504,IPR031766,IPR011990,IPR035979,
                     IPR012677,IPR034397,IPR034398,IPR003107;
                     PFAM:PF16842,PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006396 - RNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="splicing factor"
                     /protein_id="XP_043136473.1"
                     /db_xref="GeneID:66982310"
                     /translation="MDINSLLSPQESNSQSGRSTPGSAPTSAPSSGPSQKGFRRGGRA
                     TGGRGGMTSSPLAQHVLAPPNIPEPSPPAVSPSVGPNMGGGSGTPPATELPPSRQPST
                     PGMDTLADLASMQHHQPPRSNAPILRGESYESQLSPSTMFPNVNPIVHNTPTPRSSFD
                     IAMSDGPKRDYAKTSIKSDAQLATELFQQIQENPHSYTAHVSFIRLLHAGFMNHVYPP
                     NNPEIHGDPHRYDLLKDMRTAREEMDKLFAMGEDLWAEWIQDESMLASNVNERIAVMD
                     LCQRSVEEEYGSTKLWSIYGEWVLYLYNAANGEAGHSQWTEEDRMIGREVFTFQLVLD
                     VWQRGAEATRWRINDSHLVWDRFLELQIRELSHVPSQEKLNHVRGLFEVRLHTPHATW
                     EQTFQAFSSFVSTYYNANYEEIMSNTAAHTSEAKNKYRAREDIEIRLRNVVEAGDMAQ
                     EWAVYTEYLDWELSRNRRRRQFSFDLVNAVYQRAVLRFPTDANMWEDYVMFLIDESTH
                     KNTNMTTTSTLDRATRHCPSSGTLWSQYLLSSERELQSFSKIADIKHKATSTGLLDVG
                     GMEEVLKVHTTWCSYLRRRAFATDSTDEDIDVAEVGIRSAIEDVQDLGEKKYGRSYQG
                     DPLFRLERIYIRYLSESGSWDSARETFKGLVGRRGNSYEFWLTYYSWELISWSKFVQG
                     DSTADAARRTPNPSFATAVLKQAIKRTDLDWPEKIMQAYIAHCEDYEDSDELQLAMLA
                     TRKATRAVNARREREAREAAAQQEALVQQAAVLAEPVQQEKRKREDEAESNGLPEQKK
                     ARAEEPVPVVKTEPQPEPESVPLRRDRENATVIVKNLPHHITEHRVRQFFRHYGNING
                     VKMLPGEDGNSEVAIIEFDTKDEALMAQTRDQKMIDENTIQVQLGSGSTLYVTNFPPS
                     ANEEYIHNLFRGHGEIVDIRWPSLKYNTHRRFCYVQFRDPIQARKATELDGSKVGTDQ