GenomeNet

Database: RefSeq
Entry: NC_057368
LinkDB: NC_057368
Original site: NC_057368 
LOCUS       NC_057368            2801472 bp    DNA     linear   CON 15-SEP-2021
DEFINITION  Aspergillus chevalieri M1 DNA, chromosome 7, nearly complete
            sequence.
ACCESSION   NC_057368
VERSION     NC_057368.1
DBLINK      BioProject: PRJNA727462
            BioSample: SAMD00269937
            Sequence Read Archive: DRR262018, DRR262019, DRR262020
            Assembly: GCF_016861735.1
KEYWORDS    RefSeq.
SOURCE      Aspergillus chevalieri
  ORGANISM  Aspergillus chevalieri
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1
  AUTHORS   Kadooka,C., Mori,K. and Futagami,T.
  TITLE     Aspergillus chevalieri M1 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2801472)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2801472)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus chevalieri M1 genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP024422.
            Please visit our web page
            URL:https://chem.agri.kagoshima-u.ac.jp/honkaku/index.html.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Canu v. 2.0; Flye v. 2.8-b1674
            Assembly Name         :: AchevalieriM1_assembly01
            Genome Coverage       :: 357.6x
            Sequencing Technology :: MinION; Illumina NovaSeq 6000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2801472
                     /organism="Aspergillus chevalieri"
                     /mol_type="genomic DNA"
                     /strain="M1"
                     /db_xref="taxon:182096"
                     /chromosome="7"
                     /country="Japan:Kagoshima, Makurazaki"
                     /collection_date="2018"
     gene            <4785..>5120
                     /locus_tag="ACHE_70001S"
                     /db_xref="GeneID:66985516"
     mRNA            <4785..>5120
                     /locus_tag="ACHE_70001S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282285.1"
                     /db_xref="GeneID:66985516"
     CDS             4785..5120
                     /locus_tag="ACHE_70001S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139680.1"
                     /db_xref="GeneID:66985516"
                     /translation="MVLANPPSLCLLTPTPTQPPDSPAAANKTPQTTGYGPPGCAAPA
                     TQSPPQCPRRRPAIPPVAAAMPPECPPPMAHAASSPPWGSKPPGTDTGRPAPTRRISS
                     AASHRKNTR"
     gene            <5193..>5957
                     /locus_tag="ACHE_70002S"
                     /db_xref="GeneID:66985517"
     mRNA            <5193..>5957
                     /locus_tag="ACHE_70002S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282287.1"
                     /db_xref="GeneID:66985517"
     CDS             5193..5957
                     /locus_tag="ACHE_70002S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139681.1"
                     /db_xref="GeneID:66985517"
                     /translation="MNINRAGHPPGPWRRYNIDPATAEPPAPQTPHPAMPGTVAGGIE
                     CRPRPTGAGVGGGLRTGAAAGGGSGSGAGAGVGSGSGSGSGYGLGLSYRCGAGADLGL
                     GSGLGSGSGSGYGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADL
                     GLGSGSGYGSGSGVGCGSGYGYGSGVGNGSGVGNGYGSGSGSGYGLSLGCGAGADLGL
                     GCGSAYGSGSGVGYGSGFGLGCMSPLLCWNHTPFRA"
     gene            <6052..>6402
                     /locus_tag="ACHE_70004S"
                     /db_xref="GeneID:66985519"
     mRNA            <6052..>6402
                     /locus_tag="ACHE_70004S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282288.1"
                     /db_xref="GeneID:66985519"
     CDS             6052..6402
                     /locus_tag="ACHE_70004S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139682.1"
                     /db_xref="GeneID:66985519"
                     /translation="MVQAHTPGLMPSLMPGLITTHVPYMPLHITPITCLLVPVIPAML
                     PPVSIHCPIQIIVQYHPPAPPTCHHPHVLLHQLHLRCAQLSLILRPPRRLDNDRLAGL
                     PIPPGSPAFLCIIQ"
     gene            complement(<6609..>11956)
                     /locus_tag="ACHE_70003A"
                     /db_xref="GeneID:66985518"
     mRNA            complement(join(<6609..8438,8483..10225,10281..10765,
                     11033..11385,11928..>11956))
                     /locus_tag="ACHE_70003A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282289.1"
                     /db_xref="GeneID:66985518"
     CDS             complement(join(6609..8438,8483..10225,10281..10765,
                     11033..11385,11928..11956))
                     /locus_tag="ACHE_70003A"
                     /note="COG:L;
                     EggNog:ENOG410PI7H;
                     InterPro:IPR027417,IPR014001,IPR011545;
                     PFAM:PF00270;
                     TransMembrane:1 (o1285-1308i);
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139683.1"
                     /db_xref="GeneID:66985518"
                     /translation="MLNAPSGPIREICNNLQTKLNVISWRHAAIAISRAHLQCGGFKR
                     DYSADDGLIDQQAGHGSWAAGTVYARGLQEAPGHIQARRVQYRAISREWHAFLGFQVS
                     LGPRKRGWGREKGRSQQQSGSGSSSRLPVHGRQQVLGFIARTQATQAGQGMQEWCGPL
                     PVYGMTARQQRKWQILWQLAMPTMARPQQAPHRARARAVHMFPGAGRILEQGGNPGSY
                     RATEGRGVSPGDQPTAGHGVSPEHVEEAEETGNAGSTEPAWMMSPMERACLEFCIELL
                     NQRHRAHEYESPLLPPILSRMIKLARFMVVQKALWLDPHVGDIIQMWQAQASTANGTV
                     NGTVNGTVNGTPASPIAWPLASADAQLADIDEGCDSASPTRHTPTTVHDRPSFHDHVQ
                     QMVSRFMIRGTHGPMQTLLDWRTYGLKIHYNSTAPGHVAWMGADELLYKDLHFTMGEF
                     RGFIHGLVGATRELLCELLCIADGSSSAHTPSTMPLPAIPWQGLYDDPTQGHPGWNFL
                     HDRRTRWPVDGRWWMIQRLRTERPVQQQFMRRGAIHGPLVAQYLARVARFKEKLAVAI
                     HMTAGQPARAPELLSVQYVNTPNNQFRNVFIEDGMVTLVTAYHKGFHASNDSKLIHRY
                     VPRAVGELVVWYMWLAMPFIGQLTAWQAGTAHGTVNGTSNGMSNGTSNGTWNGMSNGT
                     SNGMSNGTSNGTLNGTRAGTVNGTVNGTVNGMSNGTSNGTLNSTLNSTWNGTQAGTLN
                     GTLNGTANGILNGTLIGTQAGTANGTRASTVNGTSNSTLNGTWNGTRAGTVNGTLNGR
                     ANGTLNGTSNGTANGISNDTLNGTSNSTLNGTSNSMLNGTTNSIPIGTRAGTVNGTSN
                     STLNGTWNGTPNGTHIEQHTDWHTDWHTGRHIKCHVEWHNDWHTEWHGERHTEWHIDW
                     HVERHTGMAAPQPIFMGPRPGHAAAMDPERFREVLKRETQARLGQALNIPAYRDIAIG
                     ISRRFLRASSTFTSDRQDETEQAAALDADCEDGMDADQWMAHMTDLQAGHSSHVAGMV
                     YGRQLMEQAGTTSHRRAMFRQSSVDWHQFLGFGCGTGVPGDVHADIDAGGLRAGLVDE
                     GSCPSRRPGQEQVRARLVDDPGQEWVRACLVDDPGQEWVRACLVNDPGQERVRARLVS
                     DPSQEGVRARLVDEGNRPIHHPGQERVRARLVDEGSCPIHHPGQERVRACLVNDPGQE
                     RVRARPVLGKRKRAPWQVEAEEHHMERRHQLQTMDMAAALQQMTGQAGMQFQGIQAPA
                     MAAIQQGKSPVVAVMPTGGGKSMLFMLPAWAVPGGTTIVVVPLISLRQDMQQRCRRLG
                     IPCMAWDRQQPCDEAAIVLVTPESAVTPDFHSFINRLVVMQRLDRVVIDECHIIMNQQ
                     KNFRSAMAQLGKLVRARTQMVFLTATLPPRWNRSSASAFTTHRIRSIYIGPARAAAMW
                     HMGCGGHRFHTLHHMDMDGSRMPGLFSSCRRSSSGPGPGGGRW"
     gene            complement(<17923..>18501)
                     /locus_tag="ACHE_70005A"
                     /db_xref="GeneID:66985520"
     mRNA            complement(<17923..>18501)
                     /locus_tag="ACHE_70005A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282290.1"
                     /db_xref="GeneID:66985520"
     CDS             complement(17923..18501)
                     /locus_tag="ACHE_70005A"
                     /note="COG:S;
                     EggNog:ENOG410Q1H7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139684.1"
                     /db_xref="GeneID:66985520"
                     /translation="MPKSNPRRDRLADKIDKEGFFSPPCLRCSEMSASNMSCECKRIS
                     SNRKCNNCVRSGVKCERDFHNERKWQNLERDRMRLAADLEDAERSNDEALARLSETSA
                     KLARLRKHKRFLEARNKAMLENDVALLEELDSQVSWPVAETASLDAQLAAVTDDPSLS
                     QMMNSPSFWENFDSAVAGGIPSPTGGNQSSSQ"
     gene            complement(<19249..>20034)
                     /locus_tag="ACHE_70006A"
                     /db_xref="GeneID:66985521"
     mRNA            complement(<19249..>20034)
                     /locus_tag="ACHE_70006A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282291.1"
                     /db_xref="GeneID:66985521"
     CDS             complement(19249..20034)
                     /locus_tag="ACHE_70006A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139685.1"
                     /db_xref="GeneID:66985521"
                     /translation="MAGLRGFVRTQVELAQLELEGLFLLHEEETREAVVPRLALVELA
                     DDPTNNRRGWNFLQDHRTRAALPTTGEQWLMDRVVATDWLRAEWVGVRPHDHQVMWHT
                     TVVDAYLGQVDQFLERLLLLMHLTAGQPARATELLGIRHSNTVCGQHRNLFIEHGVVS
                     LVTAYHKGYSMTGSTKIIHRYLPAEVSELVVYYLWLILPFARAVQALAHGTRQARSPF
                     LWPRGPNLAAGAWDSGRLRGVLQREAHIHLCHNLASLVSYLGF"
     gene            complement(<20072..>21421)
                     /locus_tag="ACHE_70007A"
                     /db_xref="GeneID:66985522"
     mRNA            complement(join(<20072..20848,21110..>21421))
                     /locus_tag="ACHE_70007A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282292.1"
                     /db_xref="GeneID:66985522"
     CDS             complement(join(20072..20848,21110..21421))
                     /locus_tag="ACHE_70007A"
                     /note="COG:S;
                     EggNog:ENOG410PMWZ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139686.1"
                     /db_xref="GeneID:66985522"
                     /translation="MGEVEFIRRQVAGALAEDAAAAEAGAQQVPDPDAKAPTEISPWL
                     ELTRWPEFLHGHAFTAVAPLAAPPDPTAEPLLTVFSASVERLIEAAYQSIKTRRINEF
                     DQIRINSFLQRPRVWDRPILIQLRPSTYRAYRQVWQRLICFAYRTSRPNAAVQLGHQL
                     TTAQLAALDRMETAAAELLSLPSPPLCTPGPGAADHPPWTTGGGPWVVIQTPRGGDRD
                     RDPEGDRRTERRHAAYEQLDHACLDLSIALLDHPLKGDLFESAVVAFLAVLGVDVEKQ
                     TFRDPYAFTSSLSGLIKMAQMLVAQRAVQMADHGQVEHPADALEAMRERFLLPGVAAP
                     FNWLTRAAHVWQAHPEHHHQSGIYLLER"
     gene            complement(<21618..>21932)
                     /locus_tag="ACHE_70008A"
                     /db_xref="GeneID:66985523"
     mRNA            complement(<21618..>21932)
                     /locus_tag="ACHE_70008A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282293.1"
                     /db_xref="GeneID:66985523"
     CDS             complement(21618..21932)
                     /locus_tag="ACHE_70008A"
                     /note="COG:S;
                     EggNog:ENOG410QEA6;
                     InterPro:IPR022698;
                     PFAM:PF12013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139687.1"
                     /db_xref="GeneID:66985523"
                     /translation="MDLFLYNDTHRLWICGPCGFAVRPAHLAAHLANRHPKHPSAATP
                     ALRRAACALMLKRPCWDPAREPDRPVPPPPGPGESAGPGAPRPPGLSLPPPRLCLHRV
                     QS"
     gene            <27329..>28372
                     /locus_tag="ACHE_70009S"
                     /db_xref="GeneID:66985524"
     mRNA            <27329..>28372
                     /locus_tag="ACHE_70009S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282294.1"
                     /db_xref="GeneID:66985524"
     CDS             27329..28372
                     /locus_tag="ACHE_70009S"
                     /note="COG:S;
                     EggNog:ENOG410PZ3X;
                     InterPro:IPR032567,IPR001878,IPR036875;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139688.1"
                     /db_xref="GeneID:66985524"
                     /translation="MPTYEAPTISDHEESTLSAEPETTDSQETPSTMSQSNDNNSVHQ
                     RPRQILPDPEVFKGDIASYQNFKHLLKAKLHVDRKALGGPYECLWYAYGRLSGNAASH
                     ILPWMIANADSPTMVNDDTVTKLFEHLDFNYMDKELQRKAMYNLSTLKQSNKTINELL
                     ATFDRYLMEAGQQNQPDNMKIFWLENTLNDDIFNRLVNAPTCKTFSEYCVQLQGIYDR
                     HQKYQQRSAEHRRPPNRRTTTPMFPPPATSPTATPTQGDPMDWEPTISHARNPQRKRA
                     RWVSGKEIERRKQERCCFRCGSAGHQISQCPFLPAQRPTARVAEFTAEDVTDAVLDDT
                     QTTPVPDVPSGKA"
     gene            <30088..>32106
                     /locus_tag="ACHE_70010S"
                     /db_xref="GeneID:66985525"
     mRNA            <30088..>32106
                     /locus_tag="ACHE_70010S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282295.1"
                     /db_xref="GeneID:66985525"
     CDS             30088..32106
                     /locus_tag="ACHE_70010S"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR012337,IPR000953,IPR036397,IPR023780,
                     IPR041373,IPR043502,IPR041588,IPR001584,IPR016197,
                     IPR043128;
                     PFAM:PF17917,PF00385,PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139689.1"
                     /db_xref="GeneID:66985525"
                     /translation="MMTMGYCAHVPSSQKKNSPAECNYEIHDKELLAIINCLKEWESE
                     LISTPKFIIITDHKNLRYFMKLRRLNERQMRWADILSRYDFYLQYRPGKLALTPDALS
                     RRDQDMPNDPGDERLQMREKRLLDPNAFVETSECTICCVSAVQVDKSIQILPIHTSNG
                     TTENENTTSDLEQQWSHAEAEDTTMPILCDAIRAGLPHFPPELGIRVSIGECELDSDG
                     RILFRKRRWVPNNEPLRTRLMQEAHDSPLSGHPGSNALYSLLARQLFWPNMSADVKRF
                     VKNCDQCGATNIWRDRRQGLLKPLPIPDRKWRELSMDFIEGLPESNGYSAILVIVDRL
                     TKGTILIPCARTGSDYIVPKFLQHVVAYHGLPAAITSDRGSQFVGELWERMCSLLKIN
                     RRLSTAYHPQTDGQTERMNAVVESYLRNFCNFAQDNWSEILPMAQLAIANQTAASTGF
                     SPFFLDHGFHLETLQLVEPVTEELQQSSSGSAGARIADKLKNALEVAQSELAAAQERQ
                     EQYANRYRNLAPHYKPGDKVWLALHNIRTSRPSKKLDVRQAKYTVLAQISPYAYRLNT
                     PEGIHPVFHVDLLRPAANNPFPSQRNDDYQPPAVLVDGEEEYQVERILDYRQIRRGRG
                     FQRQYLVKWTGYLHPEWTAAHNMENTAALDEWEQRHGSQSPVRDGDDS"
     gene            <33736..>34679
                     /locus_tag="ACHE_70011S"
                     /db_xref="GeneID:66985526"
     mRNA            join(<33736..33778,33829..>34679)
                     /locus_tag="ACHE_70011S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282296.1"
                     /db_xref="GeneID:66985526"
     CDS             join(33736..33778,33829..34679)
                     /locus_tag="ACHE_70011S"
                     /note="COG:E;
                     EggNog:ENOG410PM1P;
                     InterPro:IPR028939,IPR036291,IPR000304,IPR029036,
                     IPR008927;
                     PFAM:PF03807,PF14748;
                     go_function: GO:0004735 - pyrroline-5-carboxylate
                     reductase activity [Evidence IEA];
                     go_process: GO:0006561 - proline biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139690.1"
                     /db_xref="GeneID:66985526"
                     /translation="MTELNSATLCVLGCGNLGTAIINSLASNPPTIKNSALFTHFIAC
                     VRTENSENRLRDRLSHLNNLSISRNNNVKAIDDSAVIILATDPADVERTLTQPGFRDA
                     ITGKLLISVAAGWTQQRLYTTLYGNDTPQARVVRALPNIAALVSQSLTAVESSVDSPL
                     PFECVEITDAIFNRIGRTVHVSPTQMEVITAVGGSTPAFFAVIVDAMIDAAVAVGLPR
                     DLAHTAVFQAMQGTAGMLQSGIHPALLKDQGTSPEGCTIGGLMVLEEAGVRGHVGKAL
                     REAVTVARLMGKVPHVNDTRQ"
     gene            complement(<34703..>35580)
                     /locus_tag="ACHE_70012A"
                     /db_xref="GeneID:66985527"
     mRNA            complement(join(<34703..35426,35486..>35580))
                     /locus_tag="ACHE_70012A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282299.1"
                     /db_xref="GeneID:66985527"
     CDS             complement(join(34703..35426,35486..35580))
                     /locus_tag="ACHE_70012A"
                     /note="COG:S;
                     EggNog:ENOG410PV0T;
                     InterPro:IPR038781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139691.1"
                     /db_xref="GeneID:66985527"
                     /translation="MRQETQLHLAGDLIASAVSATIVTPAVTIIDRALVEKASCNWPI
                     LRGLRSHCLDALKRPGRFVFSRPFGLIWTLYAATYAVANGADTITKETIPTSPARDPI
                     VFGSTFAINVPLGVWKDMRFAQLFSNCSKEATVALRNVPTRPFSSLGTAIFLLRDGIT
                     ISGSFTLPSYCAGVIPDSLAADPHSRTVITQIVVPVLSQLMATPVHLLGLDLYNRPKV
                     AAASERVTLMTRHLPSATVVRCIRIIPAFGFGCLTNMELREYFHSKIRLEHIDQ"
     gene            <36121..>37923
                     /gene="ALD5_2"
                     /locus_tag="ACHE_70013S"
                     /db_xref="GeneID:66985528"
     mRNA            join(<36121..36179,36230..36281,36334..36344,36397..36733,
                     36793..36828,36882..37435,37485..>37923)
                     /gene="ALD5_2"
                     /locus_tag="ACHE_70013S"
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ald5"
                     /transcript_id="XM_043282300.1"
                     /db_xref="GeneID:66985528"
     CDS             join(36121..36179,36230..36281,36334..36344,36397..36733,
                     36793..36828,36882..37435,37485..37923)
                     /gene="ALD5_2"
                     /locus_tag="ACHE_70013S"
                     /note="COG:C;
                     EggNog:ENOG410PFKN;
                     InterPro:IPR015590,IPR029510,IPR016160,IPR016161,
                     IPR016162,IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ald5"
                     /protein_id="XP_043139692.1"
                     /db_xref="GeneID:66985528"
                     /translation="MTAVALTTPTGLSYQQPTGLFINNEFVGGSDGGSIDVVNPATEQ
                     RICAVSEARENDVDKAVAAARKALNGPWKLATPTERSQYLYKLVTLMEESLEKLAAVE
                     SMDNGKPINSARGDIGEAIGCLRYYAGWADKIEGRVIDTSPKNFNYTRREPIGVCGQI
                     IPWNFPLMMWAWKIGPAIACGNTVVIKTAEVTPLSALVAAELIVQAGFPPGVINIITG
                     YGNIAGSALSRHMGVDKVAFTGSTAVGRQILKDAASSNLKKVTLELGGKSPNIVFNDA
                     DLDQAVPWIHNGIFSNMGQNCCAGSRIYVQSGIYDAFIQKLRENVQQRVIGPPEDEKT
                     AHGAQVSKTQLDRILGYVDSGRKAGAKVEIGGNRVNCPGYFMEPTIFSGVSSDMDIVR
                     EEIFGPVGVIAKFDKTEEIIEAANDTAYGLASGIHTENLKTAIEVSNKIKAGTVWVNQ
                     YNGVHWQLPFGGFKQSGIGRELGEEALFNYTQTKTVSVNLGTPVV"
     gene            <38232..>39482
                     /locus_tag="ACHE_70014S"
                     /db_xref="GeneID:66985529"
     mRNA            <38232..>39482
                     /locus_tag="ACHE_70014S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282301.1"
                     /db_xref="GeneID:66985529"
     CDS             38232..39482
                     /locus_tag="ACHE_70014S"
                     /note="COG:E;
                     EggNog:ENOG410Q1RB;
                     InterPro:IPR022662,IPR022665,IPR006395,IPR036849,
                     IPR029017;
                     PFAM:PF05034,PF13378,PF07476;
                     go_function: GO:0050096 - methylaspartate ammonia-lyase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139693.1"
                     /db_xref="GeneID:66985529"
                     /translation="MKPFDVEFVIGLSGYFVKDLEAVRQSPTYDPLVDNIAPRTPGFQ
                     QVVQAGQVISILLWLPNGQLAVGDCVDVIFSGAASRDPLFIANEHLPLLESVVKPWLL
                     NCDITHFRPNSIRVDSPWPELQDLRLHSAIRYGLSQVLLSATALVHSCSAAEIITREW
                     GTSIIDRPVDILASCHRNDFLQLDRMIMKQVSMLPHASFIHVHDLGPQGTTLLEFVEK
                     VSRRVQERGVSGYRPRLHFDVYGTMGDLFPDVDELVSFLGEVQRVAQPYDLLIESPII
                     ADTKAAQTQLLRDLRLRLRERSIPVQIVADEWCNTLEDIREFADAGAVDFVQIKMPDL
                     GAIHNSIDAILYCRERKVGCCLGGSANETDVSARITAHVAMATQPDFLLSKPGIGADE
                     GVMILTNEMLRTSAVARKSRLYKI"
     gene            complement(<39766..>40996)
                     /locus_tag="ACHE_70015A"
                     /db_xref="GeneID:66985530"
     mRNA            complement(join(<39766..40688,40748..40849,40900..>40996))
                     /locus_tag="ACHE_70015A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282302.1"
                     /db_xref="GeneID:66985530"
     CDS             complement(join(39766..40688,40748..40849,40900..40996))
                     /locus_tag="ACHE_70015A"
                     /note="COG:Q;
                     EggNog:ENOG410PG3J;
                     InterPro:IPR026992,IPR027443,IPR005123;
                     PFAM:PF03171,PF14226;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139694.1"
                     /db_xref="GeneID:66985530"
                     /translation="MATQTEEKPSVTLGSTNGHLEKYTHPPETKHKLDYADLTTIDLS
                     EFDLPGGKEKLAAQLKDAAHEVGFFYVKNFGLTQEEIDRQFAIGREFFALPEEERIQY
                     RAPLEEGIYNGYRPLGSIEILPGLRDNIEFYNVMKFLPQYDRKHPDVYRQHWAEIERF
                     HRHVHEHVAYRLFRLLAMILEIPEDEFENGHRYEANCDSGLRYMMYRARSAEENNNFK
                     DLYSRGHTDNGTITFVFQQPVAALQVKKYENSDWEWLRIPPGTIAVNIADMLSILSNG
                     YLKSGIHRVVVPPDDQACNDRLGLLYFVRPSDRLMLKTVDSPLLRRLGYYKEGKNNEI
                     DVPAIEWTRARVRKNWSRSPTDPNAGTTLAGFSVKHFHD"
     gene            complement(<43983..>45520)
                     /locus_tag="ACHE_70016A"
                     /db_xref="GeneID:66985531"
     mRNA            complement(join(<43983..44296,44345..44802,44853..44976,
                     45032..45158,45206..>45520))
                     /locus_tag="ACHE_70016A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282303.1"
                     /db_xref="GeneID:66985531"
     CDS             complement(join(43983..44296,44345..44802,44853..44976,
                     45032..45158,45206..45520))
                     /locus_tag="ACHE_70016A"
                     /note="COG:S;
                     EggNog:ENOG410Q2ND;
                     InterPro:IPR001077,IPR036388,IPR016461,IPR029063,
                     IPR036390;
                     PFAM:PF00891;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0008171 - O-methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139695.1"
                     /db_xref="GeneID:66985531"
                     /translation="MTIRNGSANDTANGISNALANGKTNSAGAVKNRHLNGNFSVDEV
                     AISANSPEKVSGLLKDILANGLAFSVDHDASARSTLLDAARSLVHALETPRETMIRYC
                     WSQSTAYAAIETGVDLGLFAILSRDDRPKRAAYLSEETGADLTLLSRLLKHLSAVGVV
                     DETGPDEYRRTGFSITLGVPRYSDAYACMTGCITDGVLALPAYLRRNNHRNPTNGKDC
                     PFQLGFRTGSHFFEFLRDHPEHASQFNNHMSAYHQGRPSWMDVGFYPVPELVMDLKES
                     DDVLLVDVGGSLGHDLSEFQRKWPDMPGRLVLQDLPAVVEQAQSMSLHPRVEVMPHDF
                     FTEQPVKGARAYYMHSILHDWNDDNCRKILSNLVPAMKRGYSKVLINENVIPDTNAYW
                     ETTSLDIIMMADFASQERTERHWRSLVESVGLKITNIWTAQRGVESLIECELL"
     gene            <46087..>47619
                     /locus_tag="ACHE_70017S"
                     /db_xref="GeneID:66985532"
     mRNA            join(<46087..46434,46484..46868,46920..47037,47083..47150,
                     47199..47229,47277..>47619)
                     /locus_tag="ACHE_70017S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282304.1"
                     /db_xref="GeneID:66985532"
     CDS             join(46087..46434,46484..46868,46920..47037,47083..47150,
                     47199..47229,47277..47619)
                     /locus_tag="ACHE_70017S"
                     /note="COG:S;
                     EggNog:ENOG410Q1WG;
                     TransMembrane:6
                     (o76-97i109-135o155-175i187-208o239-261i273-291o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139696.1"
                     /db_xref="GeneID:66985532"
                     /translation="MGLLLDYDQGFSDAGAVMDALVSHAPGLGGGAFRQGLFRFHLRC
                     RQGQNLFHQQLLFVLLCPKMTVTEDDNRGPKILGVLWALTGLTTFIVAARMVIRGKLL
                     KNFGPDDWLIAASMCMGLAYCGVTTANVIIGYGKHAVFLDQHTLETATLLNTISFLFG
                     ILSFTLPKLAVSAMLNRILNPSLPHRIALWFLTGFAAVVSVICILILFTMCDPPKALW
                     QTHLVMEGVATCKDVWMLIDYAIFTGALSALVDLYLAIYPTTVLLNLHMSLRKRLALS
                     AALGLGSIASAMAIIKCTQLKGLADESDYTYGTADLVMWTNIESNVVIVASCIPTLQP
                     ILELILGKRSLGSYSNNSSRQKNSKYMHSTSYARSRRSMVRKPEPTITDVESQESILH
                     AEDDQHRDAHPLGQIRRTDNVTVEYETRANDSDRRPSW"
     gene            <48008..>49424
                     /locus_tag="ACHE_70018S"
                     /db_xref="GeneID:66985533"
     mRNA            join(<48008..48585,48637..49244,49294..>49424)
                     /locus_tag="ACHE_70018S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282305.1"
                     /db_xref="GeneID:66985533"
     CDS             join(48008..48585,48637..49244,49294..49424)
                     /locus_tag="ACHE_70018S"
                     /note="COG:I;
                     EggNog:ENOG410PKBI;
                     InterPro:IPR006091,IPR009075,IPR013786,IPR009100,
                     IPR036250,IPR037069;
                     PFAM:PF02770,PF00441,PF02771,PF08028;
                     go_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139697.1"
                     /db_xref="GeneID:66985533"
                     /translation="MTEIDTTPFAEPPYLRGLPSPYYTPAHRRFQKACREFLWEHLLC
                     HAMDWERQGTVPEHVFETFCQHNMLLPNLPAPLPVGWLKRLGIHDILGVRVEDWDYMY
                     TGIYCDELARSGLAGPGASLNAGFAFGIPPIIKYGSEELQERFLPELLTGKKRACIAI
                     TEPEAGSDVANLTTTAKKTPDGKHYIVNGSKKWITNGIWSDYTTMAVRTGGPGAAGLS
                     VLLVPLKGHPGVTMRRLNVAGQKTGGTTYIELDDVAVPVSNLIGREGEGMRIIMTNFN
                     HERLTIAVGVTRQARVALSAAVQYCLKREAFGKTLMDQPVVRHRLAKAGAELETMHAW
                     VEQILYQLCHMSKEEGDLRLGGITALAKAKSAMVLNECAQCAVLLFGGNGFTASGQGE
                     LVEAIYRDVPGARIPGGSEDVLLDLSVRQLVKVYRAEEKKLGRLKI"
     gene            complement(<49558..>49899)
                     /locus_tag="ACHE_70019A"
                     /db_xref="GeneID:66985534"
     mRNA            complement(join(<49558..49645,49705..49769,49828..>49899))
                     /locus_tag="ACHE_70019A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282306.1"
                     /db_xref="GeneID:66985534"
     CDS             complement(join(49558..49645,49705..49769,49828..49899))
                     /locus_tag="ACHE_70019A"
                     /note="COG:S;
                     EggNog:ENOG410Q1AV;
                     InterPro:IPR028144;
                     PFAM:PF12734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139698.1"
                     /db_xref="GeneID:66985534"
                     /translation="MSYPPQEGYYPPPPGGQYPPQPPPMQYQPPPPQESQSKDRGCLT
                     ACIAAMCCCFLCEETCECCIDMVECLCCGC"
     gene            complement(<50579..>52091)
                     /locus_tag="ACHE_70020A"
                     /db_xref="GeneID:66985535"
     mRNA            complement(join(<50579..50746,50792..50876,50926..50951,
                     51000..>52091))
                     /locus_tag="ACHE_70020A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282307.1"
                     /db_xref="GeneID:66985535"
     CDS             complement(join(50579..50746,50792..50876,50926..50951,
                     51000..52091))
                     /locus_tag="ACHE_70020A"
                     /note="COG:Q;
                     EggNog:ENOG410PJTA;
                     InterPro:IPR036396,IPR001128,IPR017972,IPR002401;
                     PFAM:PF00067;
                     TransMembrane:1 (o12-33i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139699.1"
                     /db_xref="GeneID:66985535"
                     /translation="MELLRLVLVNPFTSAIVLVTAYVVGVAVYRLWLSPIASFPGPRL
                     AALTSLYEFYYDTVCCGQFTFHIGRLHEKYGPIVRIGPDELHVNDPDYYEVLYARDTP
                     RNKYEYYQRPFGAPFAVINAIEHSRHRLLRSHMNPFFSTARIRQQEPVLRALLDKLCR
                     RLEEWKETGRPVNIEYPYTCFTTDVITDYTMGDGYHYLDEPDFIPAWNHTMMGTAKTL
                     VFFRPIAWVLPVLFAMPEWLTAWLNPGMELFFAFQRRCRTMIRDITDDYHQNIDTGKV
                     NDGDRQKTFFHDILGSSLPEQDKSAERLAQEMQILVSAGAETTAKAMSYITFYLLNDP
                     AIMKKLMDELNTLDPERNASLVQLEQMPYLNGVMLEGLRLSYGVSARLPRTAPYHALQ
                     FKDWTIPPGTPVSMSCLLMHHNEKVFPDSYQFKPERWTEPHERKRLEKYMVAFSKGSR
                     QCIGIK"
     gene            complement(<52554..>53125)
                     /locus_tag="ACHE_70021A"
                     /db_xref="GeneID:66985536"
     mRNA            complement(join(<52554..52858,52912..52959,53011..>53125))
                     /locus_tag="ACHE_70021A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282308.1"
                     /db_xref="GeneID:66985536"
     CDS             complement(join(52554..52858,52912..52959,53011..53125))
                     /locus_tag="ACHE_70021A"
                     /note="COG:S;
                     EggNog:ENOG410Q26X;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139700.1"
                     /db_xref="GeneID:66985536"
                     /translation="MKLSIAAVSSFIAAAVAASLPESFTLVADGGKTVLTDGSNAFIG
                     GSTDDKKILVLRGGSGGSQVTYTADDQTPTGWQNLYAITNANKPIALTVPHSGATPEG
                     ANINGWGVNDDGYFTFNGKQAFAVQSDDGAQKIYYLGAGEGQFQKTPLYVKKY"
     gene            complement(<55350..>56367)
                     /locus_tag="ACHE_70022A"
                     /db_xref="GeneID:66985537"
     mRNA            complement(join(<55350..56138,56191..>56367))
                     /locus_tag="ACHE_70022A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282310.1"
                     /db_xref="GeneID:66985537"
     CDS             complement(join(55350..56138,56191..56367))
                     /locus_tag="ACHE_70022A"
                     /note="COG:G;
                     EggNog:ENOG410Q195;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     TransMembrane:9
                     (n5-10c14/15o24-42i54-73o85-104i125-149o161-183i190-
                     211o217-240i252-273o293-315i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139701.1"
                     /db_xref="GeneID:66985537"
                     /translation="MVMMSLSLAASSYATNVTHLALSQGVLYGIGGCLAFTPAIIFTT
                     EWFVKRRGFAFGLVWGGSGLTGMVFPIAIQALLDRYGWETTLRVSSVGLFILGGPFLF
                     FLKPRIPTRTSTRRSLNLKFQFNRVYIIYQLANIIEALGYFLPAVFLPSHAAAIGTHG
                     ILASLTVVLFNFTTVIGCAIMGYMTDRYHVTNCIMVSTVGTIVSVFLVWGLSTNIGVL
                     YVFSSLYGLFAGAFSSTWSVVAREVEKSEPSADLSMVFSFLEAGRGIGNILSGPLSSA
                     LINGHPWQGTVGGAYGSGYGVLIVFTGFTALLGGLSLFARIVRWV"
     gene            complement(<59100..>60822)
                     /locus_tag="ACHE_70023A"
                     /db_xref="GeneID:66985538"
     mRNA            complement(join(<59100..60000,60051..60380,60431..60504,
                     60552..60573,60623..>60822))
                     /locus_tag="ACHE_70023A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282311.1"
                     /db_xref="GeneID:66985538"
     CDS             complement(join(59100..60000,60051..60380,60431..60504,
                     60552..60573,60623..60822))
                     /locus_tag="ACHE_70023A"
                     /note="COG:G;
                     EggNog:ENOG410Q1QE;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i53-71o91-111i123-142o148-167i179-205o211-230i285-
                     303o323-341i362-383o389-409i421-446o458-480i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139702.1"
                     /db_xref="GeneID:66985538"
                     /translation="MSSLGSTEIVKSEQPWAEAVLSEHELELTPDGQLVRWRRDNKRH
                     PRNWPLPRRVYDISIIFFLDLFLTASSTAGSSAASVARHEYHMGQTLSTFCFVTVFLL
                     GQVVGSIVLSPWSETFGRKKLYIVSSALSCICCVIVGVVPHIAAVIVARVAAGLLSAI
                     PYTVASGSTEDLFNSRERIWVIFGWTVASNCGLIIGPIMGTHIIAGLGWRWIFYIFAI
                     MIAALTGLLCLIRESRPSYLLAHKVAAISRETGLKLQPLNHDHAPDFQTFAKDALFRP
                     AQLFCTEPVVFVVALMTAVAFGLLYIFTEAIEIIYESMGFSSTQASLAFLAIAVGVCV
                     STLTRWLDHYIFDMRHRQGRPVKPEDKLVGLALGAAAFAGGLWWLAWTIPPKIHGVHW
                     IVPTIALAFIGYALNEFDTVLQGYLADSYLSYSASGTAAVQFLRALLSGVFPLFTPQM
                     FHNLGSNIAVSILAIVATLFCAVPPLFIFYGEKIRARSKFARYSLVVEAELGKDAGEL
                     "
     gene            complement(<61477..>62262)
                     /locus_tag="ACHE_70024A"
                     /db_xref="GeneID:66985539"
     mRNA            complement(join(<61477..61744,61800..62011,62083..>62262))
                     /locus_tag="ACHE_70024A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282312.1"
                     /db_xref="GeneID:66985539"
     CDS             complement(join(61477..61744,61800..62011,62083..62262))
                     /locus_tag="ACHE_70024A"
                     /note="CAZy:CE5;
                     COG:G;
                     EggNog:ENOG410PXCY;
                     InterPro:IPR011150,IPR043580,IPR043579,IPR029058,
                     IPR000675;
                     PFAM:PF01083;
                     SECRETED:SignalP(1-17);
                     go_component: GO:0005576 - extracellular region [Evidence
                     IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0050525 - cutinase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139703.1"
                     /db_xref="GeneID:66985539"
                     /translation="MMLKSVLVSALLSLAVATPVPQPADLEVRQLLGSSNDVESGNCK
                     DTMFIFARGSTEIGNMGTVVGPPVCQNLQQKLGSVGCQGVGGAYSGGLVQNALPQNTD
                     PGSINEAVKMFQDASSKCPKANIVAGGYSQGSAVIDNAIQKLDDDIKNKVKGVVLFGF
                     TRNLQDHGQIPNYPKDQVKVFCAVGDLVCDGTLVVTAAHLTYGLNAGEAASFLASKVQ
                     G"
     gene            <64457..>66306
                     /locus_tag="ACHE_70025S"
                     /db_xref="GeneID:66985540"
     mRNA            join(<64457..65069,65123..>66306)
                     /locus_tag="ACHE_70025S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282313.1"
                     /db_xref="GeneID:66985540"
     CDS             join(64457..65069,65123..66306)
                     /locus_tag="ACHE_70025S"
                     /note="COG:G;
                     EggNog:ENOG410PFTW;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:11
                     (o68-89i101-123o135-154i193-216o228-253i301-320o340-
                     359i380-399o405-426i438-458o470-492i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139704.1"
                     /db_xref="GeneID:66985540"
                     /translation="MASSGKDIEAARPQGIPYWRVVFDQGAVTPEIIEYPYPGKGTED
                     EPYIVDWIPDDPRNPMLFSNTTKWGYTVVVAFATFAVSLSSSAYAGAIQEVIKSFTVV
                     QEVATLGVSLFVLGFALGPLIWAPLSELIGRQIVFSFTFFALAVFCAGGAGVQNSWSL
                     IILRFFAGSFGSSPLTNAGGVIADIFTADKRGLAMSLFAGAPFLGPTLGPVIGGFLGQ
                     GAGWRWVQGFMAIFSGLIWMLGSILVPETYAPLLLRKRAQRLTKITGHAYCSKLDLER
                     GEISIKDAFGAALLRPWILLFAEPIVLSLSIYMAIVYGTLYMLFDAYPIVFQEIRGWN
                     EGVGSLPFLGVMVGMMIAVIGNMWDNQRYVRVNKKYNGFAPPETRLVPTMIGGLAVPI
                     GLFWFAWTNGTNVHWIVSIIAGAPFGFGMVLVFLSIMTYLVDAYTIYAASVLAANSVI
                     RSCFGAGFPLFTTYMYHNLGIHWASCIPAFLGVACLPFPFLFYRYGPQIRRRCKYAAE
                     ADDFKRKLVQNVVQPEEKKPIPKDQVDGTVDEDHVDDSESILTASTERQNEALYQESP
                     YDIDRVNTRNSAITQRSRSRSTRSQRKSFLHF"
     gene            complement(<69174..>71403)
                     /locus_tag="ACHE_70026A"
                     /db_xref="GeneID:66985541"
     mRNA            complement(join(<69174..70046,70101..71208,71264..>71403))
                     /locus_tag="ACHE_70026A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282314.1"
                     /db_xref="GeneID:66985541"
     CDS             complement(join(69174..70046,70101..71208,71264..71403))
                     /locus_tag="ACHE_70026A"
                     /note="COG:G;
                     EggNog:ENOG410PFPE;
                     InterPro:IPR029061,IPR020826,IPR033248,IPR033247,
                     IPR009014,IPR005474,IPR005475;
                     PFAM:PF13292,PF02779,PF00456;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139705.1"
                     /db_xref="GeneID:66985541"
                     /translation="MAIQTVPVSQSALPLVQRLSKDHDLVLKTFRMLIADLCQQFGGG
                     HPGGAIGMAAIGVALWRYVMRYAPHTPDYFNRDRFVLSNGHTCLFQYTFLHLTGYKAM
                     TFEQLKSYHSDRVDALCPGHPEIEHEGIEVTTGPLGQGIANAVGLAIANKNLSATFNR
                     PGYDVVSNHTWCMIGDACLQEGVGLEAISFAGHLKLNNLTVIYDNNQITCDGSVDLTN
                     TEDVNAKMRACGWDVIDVNDGCYDIEALVRALEQARASQDKPTFINIRTVIGLGSSVE
                     GKAAAHGAAFGVDNVGEMKKANGFNPDEHFVIGDTVRGFFEDLPARGEKLVQEWNQLV
                     ELYTAQYPELGAEFQRRMRGELPANWKELIPTSFPEKPTASRASSGLVFNPLAQNVPT
                     FMVGTADLSPSVNMIWKDKVDFQHPDLRTNCNINGNYSGRYIHYGIREHAMAAISNGL
                     AAYAPNTIVPVTSSFFMFYLYAAPAVRMGALQHLQVIHVATHDSIGMGEDGPTHQPIE
                     LAALYRAMPNLLYIRPGDSNETAGAWIAAIEAKHTSTIISTSRHALPQLKQTRRDGVA
                     LGAYVLEEDSDAKVTIIGVGAELSFALEVAQRLKETRGIAARVISFPCQRLFEQQPIE
                     YKRSVLQRHSGTPAVVIEPYAPNGWERYADAGISIRRFGQSLPGKVAYKFFGYDTDVM
                     TNKVAGYLDQLAGGQALKGEFADL"
     gene            <71674..>72196
                     /locus_tag="ACHE_70027S"
                     /db_xref="GeneID:66985542"
     mRNA            join(<71674..71855,71905..>72196)
                     /locus_tag="ACHE_70027S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282315.1"
                     /db_xref="GeneID:66985542"
     CDS             join(71674..71855,71905..72196)
                     /locus_tag="ACHE_70027S"
                     /note="COG:Q;
                     EggNog:ENOG410PJR0;
                     InterPro:IPR011032,IPR013154,IPR002328;
                     PFAM:PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139706.1"
                     /db_xref="GeneID:66985542"
                     /translation="MAPSIETEHIVTSKPGVIHMPLPNPSLQVTADHRLKQVDAPVYA
                     PNPGEVLLQIKATGICGSDIHFWKAGRIHTLVFEDDCIIGHEAAGVVLQCGEGVTNLQ
                     PGDRVAVEPGVPCEQCFLCDDGRYNLCEDVQFAGVYPYSGTIQRYKVHPAKWLHK"
     gene            <72308..>72769
                     /locus_tag="ACHE_70028S"
                     /db_xref="GeneID:66985543"
     mRNA            <72308..>72769
                     /locus_tag="ACHE_70028S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282316.1"
                     /db_xref="GeneID:66985543"
     CDS             72308..72769
                     /locus_tag="ACHE_70028S"
                     /note="COG:Q;
                     EggNog:ENOG410PJR0;
                     InterPro:IPR013149,IPR036291;
                     PFAM:PF00107;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139707.1"
                     /db_xref="GeneID:66985543"
                     /translation="MRGIQVARLHLGRGVVVCGAGPIGLIALAAARASGAHPIVVTDL
                     DENRLAFAKEFAPTCTPYQINRNLDAEANAKAIRALFGDEEYSAPETVLECTGVESSI
                     CTAAYTARRGGNVVVIGVGKSIMNNLPFMHLSLAEVRYSFSTRSSVYTHSG"
     gene            <76312..>78169
                     /locus_tag="ACHE_70029S"
                     /db_xref="GeneID:66985544"
     mRNA            join(<76312..76815,76877..>78169)
                     /locus_tag="ACHE_70029S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282317.1"
                     /db_xref="GeneID:66985544"
     CDS             join(76312..76815,76877..78169)
                     /locus_tag="ACHE_70029S"
                     /note="COG:S;
                     EggNog:ENOG410PHWY;
                     InterPro:IPR039535;
                     PFAM:PF05935,PF14269;
                     TransMembrane:2 (i21-45o552-572i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139708.1"
                     /db_xref="GeneID:66985544"
                     /translation="MSRWYRILPCLRRPQHRRAKGAWPNVFSKTWLLTLCTIVSLLYL
                     FCHFVLPHLLKFRLRTDLSWYDLGLYGFGPTRSYASFEYESPVVEITQWGSGCDPRYT
                     FLAPRGDSIPHPGPTILDAAGNLIWMKYNHDITQDFKLQRYQGEDYLTYWEGEEVAGG
                     LGQGSWFMLDSTYTQRYEIHPIGDFDGGDLHEFTLTDDGTALITIYEPIPADLTAIGG
                     PALGWLYDGLFQEIDIETKELLFEWRASNHFPVNVTYEALHTKGYEKDTAFDYYHINS
                     VEKDIQGNYLISARHAHSVSYIDGSTGAVLWTLGGKANDFTDLSDGIATNFRWQHDAR
                     WRDNSTLTLFDNTAHSNEDPEASSRGMRIHLDFESRTAELQVAYHHPQVLKSTSQGNM
                     QILKDTGNVFIGWGHSAAYTEFTPDGSAVCDVHFGASLYYTFGRVVSYRAFKDSWIGR
                     PLTNPDAVVDDNVVYVSWNGATEIAAWQLEVWDGHDLDNMTFNAAVQVDKDGFETEIE
                     IPEDLDSGILRVAALDAHGTVLGRSTSLQRSLGLDRFLNLQSCALGIAFLMAGSGLLL
                     GLYRYCYCRLWRRRSSDYQLVDMSENEGDRSV"
     gene            <79252..>80592
                     /locus_tag="ACHE_70030S"
                     /db_xref="GeneID:66985545"
     mRNA            join(<79252..80103,80158..>80592)
                     /locus_tag="ACHE_70030S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282318.1"
                     /db_xref="GeneID:66985545"
     CDS             join(79252..80103,80158..80592)
                     /locus_tag="ACHE_70030S"
                     /note="COG:I;
                     EggNog:ENOG410PT1I;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     TransMembrane:1 (o6-25i);
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139709.1"
                     /db_xref="GeneID:66985545"
                     /translation="MSAKNFTVAIVGGGIGGLSLAVGLLRRNISVQIYEAAPEFKEVG
                     LGLTIGPAAHRTMPLIDPQIRHIYDSLITTHADSPGYERFRETWFEVVWATGNEEKSG
                     DVLLDLKALPSGQTTVRRADFLDALVSLIPPEIAHFGKRLVSLEETANGGVELRFEDG
                     TAATADVVVGCDGIKSKVKESMISPEEYQRVLPRYSGMYGYRAVLDMDTMVKAVGDHR
                     ARVSTMYVGKGAYGISYPIMRAQKVNVGLYVLNDEWNDYAWVRPASKEEMRRDAEHMG
                     DYVKLLVEYMPDPTQWAIFEHPHISTYARSRVAILGDAAHASTPHQGAGAGQAIEDAH
                     VLAELLGDPRVTTAEHIVSAFKGYDAVRRPRSQKVVTTSKENAHLLCLCLNGVGDDEE
                     RLKTTFQERLRWLWDVDIEDQAERARNIMLECIYHS"
     gene            <80789..>82047
                     /locus_tag="ACHE_70031S"
                     /db_xref="GeneID:66985546"
     mRNA            join(<80789..81348,81397..81962,82010..>82047)
                     /locus_tag="ACHE_70031S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282319.1"
                     /db_xref="GeneID:66985546"
     CDS             join(80789..81348,81397..81962,82010..82047)
                     /locus_tag="ACHE_70031S"
                     /note="COG:C;
                     EggNog:ENOG410PJGZ;
                     InterPro:IPR029061,IPR033248,IPR009014,IPR005475;
                     PFAM:PF02779,PF02780;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139710.1"
                     /db_xref="GeneID:66985546"
                     /translation="MIPRSSLQRLLRNPPCRRYSAAPTPSSRLNLPIDYKSTPLLHHT
                     ASSVPRAYGLPESATSKSLNLYQAINSALRTALSTSDKVLLFGEDVAFGGVFRCSMDL
                     QTEFGSERVFNTPLTEQGIVGFAIGAAAEGMKPIAEIQFADYVFPAFDQIVNEAAKFR
                     YREGGTGGNAGGMVVRMPCGAVGHGALYHTQSPEALFAHVPGVQVVMPRSPAQAKGLL
                     LSSIFQHNNPVIFMEPKILYRAAVEHVPNEYYTIPLSKAEVLKPGTNVTVISYGQPLY
                     LCSAAITAIEKSMPGVSIELIDLRTIYPWDRPTVLESVKKTGRAIVVHESMINYGVGA
                     EVAATIQDGAFLRLEAPVKRVAGWSTHTGLQYEKFIMPDVARIYDAIKQTLEY"
     gene            <82470..>83333
                     /locus_tag="ACHE_70032S"
                     /db_xref="GeneID:66985547"
     mRNA            join(<82470..83085,83131..>83333)
                     /locus_tag="ACHE_70032S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282321.1"
                     /db_xref="GeneID:66985547"
     CDS             join(82470..83085,83131..83333)
                     /locus_tag="ACHE_70032S"
                     /note="COG:S;
                     EggNog:ENOG410PSZ8;
                     InterPro:IPR021765;
                     PFAM:PF11807;
                     TransMembrane:1 (i37-59o);
                     go_process: GO:0043386 - mycotoxin biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139711.1"
                     /db_xref="GeneID:66985547"
                     /translation="MTGSRRRPSEDTMYELLSEKQGGSGGSILPTRSIKRWVIATFVL
                     IVISLIEICVIVKLASQDPPKGFENGFATELPEAKDAISVEQVRFTSPLRVDENGTLH
                     QVNDPSERRYTGNSSEVDQAWEDLVFGRYLRLRESEVNWLDSDEESDNLEVIPEDVSV
                     ITKAGMYGGVDMLYSLHCLNMLRKHLHSDHKNMQYFSDEEDSMHLDHCIDQLRQSIMC
                     AGDLTPVTLRHVWMENPRRSVLLGETERMHTCRNFDAIRDWATERGVKEGRIEA"
     gene            <84719..>86190
                     /gene="ACO1_3"
                     /locus_tag="ACHE_70033S"
                     /db_xref="GeneID:66985548"
     mRNA            join(<84719..85227,85344..>86190)
                     /gene="ACO1_3"
                     /locus_tag="ACHE_70033S"
                     /product="aconitate hydratase mitochondrial"
                     /transcript_id="XM_043282322.1"
                     /db_xref="GeneID:66985548"
     CDS             join(84719..85227,85344..86190)
                     /gene="ACO1_3"
                     /locus_tag="ACHE_70033S"
                     /note="COG:C;
                     EggNog:ENOG410PGE5;
                     InterPro:IPR001030,IPR018136,IPR036008,IPR015931,
                     IPR015928,IPR000573;
                     PFAM:PF00694"
                     /codon_start=1
                     /product="aconitate hydratase mitochondrial"
                     /protein_id="XP_043139712.1"
                     /db_xref="GeneID:66985548"
                     /translation="MRMNDSKEHRCRQLFYEGAEYDQTIDIDLSTLEPHVNGPFTPDL
                     ATPLSRFGQAVEEQKWPETLTVGLIGSCTNSSFEDLSRAANIAQQAVDAGLTPAMPFL
                     LSPGSLQTRETLEKSGILQTFKKVGVKMLPNACGPCCGSWDRTDTPKVVLQPHYPRKQ
                     RINLKWLGHETLLSNPSVDNLVTPVGEQFHFEPPTGDSLPEQGYLDSNAAYQAPPIGD
                     RSGLDVQIDPSSQRLQKLAPFAPWFGNDYEDCLILIKTKGKCTTDHITPAGPWFRFRG
                     HLENISNNTLIGAINAENDKVNTVHNQLTQKNADVPGTARHYQAQGRPLVVIADHNYG
                     EGSSREHAALQPRYLGGIAIIAKSFARIHEANLKKQGMLALTFANEFDYDRIKASDCV
                     SIIGLAELAPGKPLTLQVKPIDRESWDAKLLHTFTPEQIEYFKAGSALNTMAKGNDAV
                     E"
     gene            complement(<86298..>87500)
                     /locus_tag="ACHE_70034A"
                     /db_xref="GeneID:66985549"
     mRNA            complement(<86298..>87500)
                     /locus_tag="ACHE_70034A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282323.1"
                     /db_xref="GeneID:66985549"
     CDS             complement(86298..87500)
                     /locus_tag="ACHE_70034A"
                     /note="COG:S;
                     EggNog:ENOG410PF8G;
                     InterPro:IPR007400;
                     PFAM:PF04303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139713.1"
                     /db_xref="GeneID:66985549"
                     /translation="MLRPILRASPRGIFSVPRQLRTLATKKQHSLPAAYYRGGTSRAV
                     FFKQDDLPHDREQWAHIFRSVIGSPDPYGRQLDGMGGGISSLSKVCVVGKSTHPDADV
                     DYTFIALGVNTPEVDYSSNCGNMISAVGPYAVDAGLFSTTGDSCSVTVRIHNTNTGKI
                     IHSSFPIVDAEAATSGDFSIDGVAGTAARVQLDFVDPAGSRTGKLLPTGQVRDTFDGI
                     TATCIDVANPCVFVQAAELGVPANMTPDEITVHPDLLPRLDSIRRQAGVKMGLAEALE
                     KVPGSVPKICLVSSPTNDARAKEQNQTAEKVDLVARALSVGQPHKAVPITVALALASA
                     ARLSGSTVNEVASTDRVDDAGVTIGHASGNLLVGAMFDKNGGLNAATVFRTARRVFEG
                     RIFWKNES"
     gene            <88471..>88941
                     /locus_tag="ACHE_70035S"
                     /db_xref="GeneID:66985550"
     mRNA            <88471..>88941
                     /locus_tag="ACHE_70035S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282324.1"
                     /db_xref="GeneID:66985550"
     CDS             88471..88941
                     /locus_tag="ACHE_70035S"
                     /note="COG:G;
                     EggNog:ENOG410PJ3A;
                     InterPro:IPR005828,IPR036259;
                     TransMembrane:2 (i92-110o116-137i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139714.1"
                     /db_xref="GeneID:66985550"
                     /translation="MSLFTVESPRWLVSQNKRDTALTALVRLRSLPSHDQYLQDEYQG
                     ITSETEDNESNSFWQIVKETFMVRSNLRRLQLTITAYILAQMSGANSITNYLPTIFGI
                     VGVTGLNIKLYTTGLYALTKLVCCIAASLVLVDLAGRRLSLLLGLASKSFAIPI"
     gene            <88980..>89455
                     /locus_tag="ACHE_70036S"
                     /db_xref="GeneID:66985551"
     mRNA            join(<88980..89347,89398..>89455)
                     /locus_tag="ACHE_70036S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282325.1"
                     /db_xref="GeneID:66985551"
     CDS             join(88980..89347,89398..89455)
                     /locus_tag="ACHE_70036S"
                     /note="COG:G;
                     EggNog:ENOG410PVZC;
                     InterPro:IPR005828,IPR036259;
                     TransMembrane:2 (i12-31o73-94i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139715.1"
                     /db_xref="GeneID:66985551"
                     /translation="MTKGASDAAIAMIFFHAMGWAIGLYSLPYLFGAELWPNHIRSFG
                     GTISQCFHWFFYFAITKATPSLLSGLHQWGAFILFDGFCLLAFVYMYFFVPETTGLGL
                     EKINALFERPLYMLGRPLDTRRESPLSDEKPESMWVEKV"
     gene            complement(<89589..>91603)
                     /locus_tag="ACHE_70037A"
                     /db_xref="GeneID:66985552"
     mRNA            complement(join(<89589..91445,91493..>91603))
                     /locus_tag="ACHE_70037A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282326.1"
                     /db_xref="GeneID:66985552"
     CDS             complement(join(89589..91445,91493..91603))
                     /locus_tag="ACHE_70037A"
                     /note="COG:K;
                     EggNog:ENOG410PUUR;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (o511-530i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139716.1"
                     /db_xref="GeneID:66985552"
                     /translation="MSEASTSSSSPLVPRRHRRGLTRIAAACERCRRRKQKCDGRTPT
                     CGACETAGASCIQSGRLVVHQSNSERDALRSQLKHLQQQHNSLLQQFDQLRAEVPRRD
                     SGSVSDVLSKGTLTMVPSVLQQHDRALNSDIPYFGRILRPTFSRRSTVRNLDWSALSS
                     AWDLWGDDAVPTHVHQASFVPVDFDVNAYRSLVDTFFDGRWPYLPVLHRPSFTSKHLT
                     PFLSKSTTSPISNFMVNMVCAIAATEKSWLQHEDGQSHRAFFSRAVQDLHIVMGIDDL
                     ECVQCLLLLCMYGHNEPQSVNMWYTTSLALQLAIGTDLHRKESLTGQSLLCTEMSKRV
                     FWCSYVMSCNMAINMGRPLGIHESDITTPLPLPLADDQLSDSCIHPSLSQTAISQVPD
                     TSAFIHIIQLRKINAAIYQSFHSIGRCTNDSQGLDSLRTRYFSELNQWLMTAPRYPRP
                     FCTFQTNEWFHIAFHHAMLSLYRPSRAIPMPSSEDLRICMESAIGLISSYTSLYARNR
                     IKYTFVAIHSLFMAAVAMLYALRASPPLRQELTHPVVQTNIVTFLTLFRGISNGRAVG
                     KKCCRIIERLGNSILSLFDDVTIPSAEVDTEFQSWFGLQTHTFPAATENQRGGLLDNE
                     TPQFSEIDLPWADLFVEGIDMGSTDVSGFFC"
     gene            <101000..>101572
                     /locus_tag="ACHE_70038S"
                     /db_xref="GeneID:66985553"
     mRNA            <101000..>101572
                     /locus_tag="ACHE_70038S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282327.1"
                     /db_xref="GeneID:66985553"
     CDS             101000..101572
                     /locus_tag="ACHE_70038S"
                     /note="COG:S;
                     EggNog:ENOG410Q1H7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139717.1"
                     /db_xref="GeneID:66985553"
                     /translation="MSGSDQVTRRLRLYNRILQFGSPVEPRCEFCFLRGHTCIMDSKY
                     QKCAECTRRGRKCERQFHDEKEWNRLEKSRKELRDKIRKVRESIATSYATLNRLERQE
                     EYLNERGSRMLVHDSNMLERLDEENPPSAEDLQELERSANEEAARIAAVSKDLSLSQV
                     MDSPSFWENFDSAVAGGIPSPTGGNQSSSR"
     gene            <112224..>113387
                     /locus_tag="ACHE_70039S"
                     /db_xref="GeneID:66985554"
     mRNA            <112224..>113387
                     /locus_tag="ACHE_70039S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282328.1"
                     /db_xref="GeneID:66985554"
     CDS             112224..113387
                     /locus_tag="ACHE_70039S"
                     /note="COG:S;
                     EggNog:ENOG410PZ3X;
                     InterPro:IPR032567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139718.1"
                     /db_xref="GeneID:66985554"
                     /translation="MTTFSAEISDHESNDQTDGNMGDNIHSGGTTTPVPQDLVAVIAG
                     LQRQLQQMEERRIEDLRRLKEELTSPPREPLPQPTIEEIAPQPMADPVRRPRPKLTDP
                     EVFDGRNRSLYRPFRSKLRAKLEVDKEALGNAYDRMWYAFGRLTDGAAMQVLPWMERF
                     AKKGATESQLDGMLDQMDFIFLDRNLEEKAVRDLASLKQNNKPFTVFLTEFNRLLMEA
                     DGHNWPENTKRSYLDNALNREMNTRLETVEKKNGFEDYCRQLQQIADRMEKNQLRYSR
                     NNKHTTSTSPAHPVNTTRASSPPQDMDWEPTTTTSARSQPRRVAKHVSREEMERRRQE
                     RRCLRCGDSTHFISHCPYDSPRNSTRMARSHIHGPELEDEEEQLREQPKLGKE"
     gene            complement(<117491..>117965)
                     /locus_tag="ACHE_70040A"
                     /db_xref="GeneID:66985555"
     mRNA            complement(join(<117491..117689,117752..117875,
                     117929..>117965))
                     /locus_tag="ACHE_70040A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282329.1"
                     /db_xref="GeneID:66985555"
     CDS             complement(join(117491..117689,117752..117875,
                     117929..117965))
                     /locus_tag="ACHE_70040A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139719.1"
                     /db_xref="GeneID:66985555"
                     /translation="MEANYLRHMSRERRGHKRQRLSSTAESERQASSQNFEISHENSR
                     GSSSQVADNESTTSSRNLRRVASTNILTIEQRRQELELRDLEAEVKRKEEEVRLKQLQ
                     NEQLELELIVMGRSLAI"
     gene            <121056..>123667
                     /locus_tag="ACHE_70041S"
                     /db_xref="GeneID:66985556"
     mRNA            join(<121056..121130,121189..121356,121410..121651,
                     121703..121799,121849..122050,122098..122319,
                     122371..122567,122632..122673,123392..>123667)
                     /locus_tag="ACHE_70041S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282330.1"
                     /db_xref="GeneID:66985556"
     CDS             join(121056..121130,121189..121356,121410..121651,
                     121703..121799,121849..122050,122098..122319,
                     122371..122567,122632..122673,123392..123667)
                     /locus_tag="ACHE_70041S"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139720.1"
                     /db_xref="GeneID:66985556"
                     /translation="MDPQPEIFNLEDFTSSSPETDPNVEGIPVQLTNSKSHSLQTSKI
                     EYIDDLPEYPTSHIHGYSYVVASRGRSQNEMEQLVHEIQYSRRQQHGPRRPVKCPFFN
                     CLVKRWTWKCSGIYACEFLNPFLQSYHHTFVDEDCWDVIRNTQRNIQILEANIGKRNA
                     YSYYRSKNEFFNKGYACIDQLPTCKPVFKRHTQMNVHGEFPPYIGCSNGSNEFLTKHH
                     RGSIQGHTSIDLQFLEDLFNHDIMPPTEECGVFESLASRRKYCDRDHLQGPGRLQHTS
                     CGVIFTALVPVDINECPYILFTSHGIHQHPPPPPSKAPERILQGVKRIIQQIQDPSLT
                     TAQFLRSPQLEAFCQQYGASTLAEIHSSFCNKDRIATIIQKQRLLSYPNGQDINGLLF
                     LQNRDSLINEYIQEKYHDSQGTMIMDPFQELRNEFSSTIRALQNEIESVKNEPKPLQR
                     PKPCLPDPEKFNGQSLKFDTWLASMKAKLRIDAPAIGDAVAQFYYVYLNLESKSKL"
     gene            <124768..>125915
                     /locus_tag="ACHE_70042S"
                     /db_xref="GeneID:66985557"
     mRNA            join(<124768..124789,124835..125050,125107..125305,
                     125356..125477,125531..125654,125717..>125915)
                     /locus_tag="ACHE_70042S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282332.1"
                     /db_xref="GeneID:66985557"
     CDS             join(124768..124789,124835..125050,125107..125305,
                     125356..125477,125531..125654,125717..125915)
                     /locus_tag="ACHE_70042S"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139721.1"
                     /db_xref="GeneID:66985557"
                     /translation="MDTKQYTGLGQYLSEIDPQHQDPTWQLQHIIIFCRVHFQRSILK
                     AIGTKNKGSGLWSRMMSLLDCQSEAEYDELIKLLIQYESPAVQTWAIQKKSAVIKAGL
                     NESCSKIQPHYFNILRNHTNAVEQSHQKSYASGKYLTLAEAARNSAKLDKDDILQYHN
                     FQQFNIHHSYRASTMEANYLRHMSRERRGHKRQRLSSTAESERQASSQNFEISHENSR
                     GSSSQVADNESTTSSRNLRRVASTNILTIEQRRQELELRDLEAEVKRKEEEVRLKQLQ
                     NEQLELELIVMGRSLAI"
     gene            <134681..>135487
                     /locus_tag="ACHE_70043S"
                     /db_xref="GeneID:66985558"
     mRNA            join(<134681..134877,134928..135049,135103..135226,
                     135289..>135487)
                     /locus_tag="ACHE_70043S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282333.1"
                     /db_xref="GeneID:66985558"
     CDS             join(134681..134877,134928..135049,135103..135226,
                     135289..135487)
                     /locus_tag="ACHE_70043S"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139722.1"
                     /db_xref="GeneID:66985558"
                     /translation="MNRQQSRPGPYKKKSAVIKAGLNESCSKIQPHYFNILRNHTNAV
                     EQSHQKSYASGKYLTLAEAARNSAKLDKDDILQYHNFQQFNIHHSYRASTMEANYLRH
                     MSRERRGHKRQRLSSTAESERQASSQNFEISHENSRGSSSQVADNESTTSSRNLRRVA
                     STNILTIEQRRQELELRDLEAEVKRKEEEVRLKQLQNEQLELELIVMGRSLAI"
     gene            <149182..>149671
                     /locus_tag="ACHE_70044S"
                     /db_xref="GeneID:66985559"
     mRNA            join(<149182..149313,149366..>149671)
                     /locus_tag="ACHE_70044S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282334.1"
                     /db_xref="GeneID:66985559"
     CDS             join(149182..149313,149366..149671)
                     /locus_tag="ACHE_70044S"
                     /note="COG:C;
                     EggNog:ENOG410PHBV;
                     InterPro:IPR018108,IPR023395;
                     PFAM:PF00153;
                     antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139723.1"
                     /db_xref="GeneID:66985559"
                     /translation="MMEYLEEIIRGITGKSKEDKLRFGERILASTIGGALSCWNQPFE
                     VLRVEMQSIKNDPTRPAHPTMVSSFTHIIKTSGIKGIFQGIVPRIGVAAWATICMVGF
                     GDTVRSYCYDPHRSRKSNNFLFRWDCVEIYYVYNAIRDCSTFN"
     gene            complement(<151503..>154064)
                     /locus_tag="ACHE_70045A"
                     /db_xref="GeneID:66985560"
     mRNA            complement(<151503..>154064)
                     /locus_tag="ACHE_70045A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282335.1"
                     /db_xref="GeneID:66985560"
     CDS             complement(151503..154064)
                     /locus_tag="ACHE_70045A"
                     /note="COG:S;
                     EggNog:ENOG410QDH4;
                     InterPro:IPR024528,IPR010619;
                     PFAM:PF06738,PF12821;
                     TransMembrane:10
                     (i526-545o551-568i575-595o607-631i643-667o687-705i712-
                     729o735-755i767-789o818-843i);
                     antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139724.1"
                     /db_xref="GeneID:66985560"
                     /translation="MSQDTPLDHPDFQDLRLTPDHHAQDPFLSPTPTLNRVNSIELGL
                     QDDRRGLAHDHNERPQPPEESPGQPHRGLRVRFRSFSHSSRDRVVSDRSDTSSRPLLP
                     THDHSRDLTEISFAERQNGDVEQGRKGQQDQLSPSSVISNPFESNEDISARTNSTKER
                     FRAAGQLLRQKTTRLTERLGRPADEGEALGASLLPDDLEGGLTMEDLPNEKRPIEEEK
                     TDDESPLPAPSAEAHRLVRTMTQAQARRRKPRPAYIRSGQSTPEGSHRPSSWYGSSRA
                     VGGILGQLLRLQATQTNSNSTSRESLVTDTESDSESAISSGAATPGTATPGAGAVTPS
                     AIIPGAPTPGTATPKKEKLKWYKKPQHQSTASLVEASMNLSKPTLPVNEASFAPKPKK
                     GKKRKTRLEDEIRVTVHIAEIIARQRYIIQLCRALMRYGAPTHRLEEYMKMTARVLSV
                     EGQFLYLPGCMIMSFDDPATRTAEVKLVRMVQGVDLGRLADTHNVYKNVVHDLIGVEE
                     ATQELDEIMQRKPRFNKWMLVFIYGLASAAVGPFAFGARPVDMPISFFLGSLVGFMQH
                     VLSPKSVLYSNVFEVTAAVLTSFLARAFGSIRVNGEPLFCFSALAQSSIALILPGFLV
                     LCSSLELQSHQIIAGSIRMVYAIIYSLFLGYGITVGITIYGLMDSSATSQQKCTNQDV
                     YGNEYLQHFPFVPIFAAFLAVINQAKWKQMPVMIFIALCGYITNYFSTKKLGSNSEVA
                     NTVGAFTIGVLGNLYSRVWHGHAATAILPGIFVLVPSGLASSGSLIAGLKYADQVRDN
                     LHTSGDSNISSTQDLSLASLGFGMIQVAIGITVGLFIAALIVYPFGKRRSGLFSF"
     gene            complement(<154863..>155484)
                     /locus_tag="ACHE_70046A"
                     /db_xref="GeneID:66985561"
     mRNA            complement(join(<154863..155296,155382..>155484))
                     /locus_tag="ACHE_70046A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282336.1"
                     /db_xref="GeneID:66985561"
     CDS             complement(join(154863..155296,155382..155484))
                     /locus_tag="ACHE_70046A"
                     /note="COG:T;
                     EggNog:ENOG410PN2S;
                     InterPro:IPR004307,IPR038330;
                     PFAM:PF03073;
                     SECRETED:SignalP(1-13);
                     TransMembrane:5 (o12-33i54-73o98-116i123-143o149-173i);
                     antiSMASH:Cluster_7.1;
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139725.1"
                     /db_xref="GeneID:66985561"
                     /translation="MSWSFALPQAVFASPILSTATPLAGGMLTGYLVNRGGTTKAKYG
                     SIRQPPFRPPTWLFPAVWTLLYPLMGYAAHHASMTGLSAATFSPELRDLTKKSQTLYT
                     VQLVFNYLWMPLFFGLRRPDLALADLVAIGGNVAGLLHLWWQIDRTAFWMLVPYASWV
                     GFAMYLNIGVGWLNNWRI"
     gene            <155967..>156745
                     /locus_tag="ACHE_70047S"
                     /db_xref="GeneID:66985562"
     mRNA            join(<155967..156014,156063..156081,156144..>156745)
                     /locus_tag="ACHE_70047S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282337.1"
                     /db_xref="GeneID:66985562"
     CDS             join(155967..156014,156063..156081,156144..156745)
                     /locus_tag="ACHE_70047S"
                     /note="COG:S;
                     EggNog:ENOG410PYKZ;
                     InterPro:IPR005645,IPR029058;
                     PFAM:PF03959;
                     antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139726.1"
                     /db_xref="GeneID:66985562"
                     /translation="MPLRLLCLHGWGTSIKILQSQLGPLMSDLRRDNTATFHFLEGEC
                     DSDPGPGIAGYFDGPYYSYYKFPRSFSDVDDSDVLDAYDQLYTVIEEEGPFDGILGFS
                     HGGTLAAGFLIQHAKRFPHDPPLVRCAIFINSLPPFRMNPGEKPVIDMSLEGYLSLPT
                     VSIAGAQDSLLEYSRALHELCSPTSAWIVHSKGHDIPGDRTNVAQMATAIRKLAVLVN
                     LPTG"
     gene            <157058..>164929
                     /locus_tag="ACHE_70048S"
                     /db_xref="GeneID:66985563"
     mRNA            join(<157058..157303,157351..157437,157484..157881,
                     157932..158457,158506..159079,159156..163687,
                     163734..164051,164102..>164929)
                     /locus_tag="ACHE_70048S"
                     /product="type I iterative PKS"
                     /transcript_id="XM_043282338.1"
                     /db_xref="GeneID:66985563"
     CDS             join(157058..157303,157351..157437,157484..157881,
                     157932..158457,158506..159079,159156..163687,
                     163734..164051,164102..164929)
                     /locus_tag="ACHE_70048S"
                     /note="COG:Q;
                     EggNog:ENOG410PM4M;
                     InterPro:IPR016036,IPR016035,IPR016039,IPR042104,
                     IPR014030,IPR011032,IPR013968,IPR001227,IPR032821,
                     IPR014031,IPR014043,IPR020806,IPR020807,IPR020843,
                     IPR020841,IPR009081,IPR029063,IPR036736,IPR036291,
                     IPR013217;
                     PFAM:PF16197,PF00109,PF00550,PF13561,PF13489,
                     PF02801,PF00698,PF13847,PF13649,PF08659,PF14765,PF00106,
                     PF08242,PF08241;
                     SMCOG1093:Beta-ketoacyl synthase;
                     antiSMASH:Cluster_7.1;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_function: GO:0031177 - phosphopantetheine binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="type I iterative PKS"
                     /protein_id="XP_043139727.1"
                     /db_xref="GeneID:66985563"
                     /translation="MTSNTFDAASYSVAMPYVSDLDTDKSMPIAVVGMGFRGPGDATN
                     VEKLWQMILEGREARTRIPQSRWNNDAFYHPDHSRHGTINVQDGHFLTEDVSLFDAPF
                     FNMTSDEAASMDPQQRLLLEVTYEGLENAGIPLPRITGTKTSCFVGSFNADYTDLLLR
                     DPEAVSMYQCTNAGQSRAMTANRVSYFYDLKGPSVTVDTACSGSLVALHLACQSLRTG
                     DATMAIAAGVNVVLSHEFMTTMSMMKFLSPDGRCYTFDDNANGYARGEAVDCLILKPL
                     EDAIRDKDTIRAVIRGSGSNQDGRTPGITLPNGAAQEALIRDVYNTAGLDPRETEFVE
                     AHGTGTQAGDPIETSALSRVFGPGRAPDAPLRIGSIKTNVGHLEGSSGVAGVMKAVFM
                     LENRTFLPNRNFTTPNPRILLDEWKLKIQLEPEAWDSPGPHRVSVNSFGYGGSNAHII
                     LEDAAGYLSRRGLNGLYRKLQSPLAIPNDIAKHNSQSSRSRVFMISGFDEASCTKQAE
                     SLREYLLEKESLIDDAFMNNLASTLNEHRTRLPCKVAVTGGTIAEVAGALTSKVKVKR
                     NTKKPTVGFVFTGQGAQSPGMGRELLDAYPVFRKSIENIDAYLKHEIWTNKDPSRLSR
                     PLHSQPLCSALQIALVDLLASWGIVPDSVTGHSSGEIASAYAAGALSMEDAMSIAYHR
                     GVSASKISTEGLIKGGMLALGMSAEDVQPYLEKLQSGQAVVACVNSPSSVTISGDVPA
                     ITELESFLIDKQVFSRRLAVDVAYHSHHMEQIAAQYLDSIAHVKPRKANHQDKTVSFF
                     SSVTGTELSPAELGAQYWVRNLLGQVKFSDSLRTLCFEAGQKQRNSNTKRAKRAQKVS
                     VDTLIEVGPHSAMSGAIKQIFKPDPKLSVAEIAYGSILVRKQNAVSTALSVAAMLAAS
                     SYPVNFQAVNNPTDDELRLLVDLPPYAWNHSRSYWSESRVSKAYRNRKFPRTDLLGVP
                     DPVACPFEPRWRNYIRVVEIPWLRDHKIQSNIVYPAAGYIAMAIEAASQHSSGTLLNS
                     ATTGYLLRDVSIQSALVINEMSAVEVLISLREHAADGPDKSYEFHVYSASDDNRWTQH
                     CKGFVSVQYTSPRYIEPRTELMTNGYSSTTLDVAQFYKTLAAAGLEYGPTFANMTAAR
                     YLLHSCVAEIAVPDTAAVMPTNYQHPHIIHPCTLDAIFHSIFPGLPGTLDGTLEPPIP
                     VSIGEMYVSSDITTAPGSKLNVSTQVHEQGEQDVLASIQVSNAQTSETAVSISDLRCR
                     RLASDSPKSTAKETRIAYRIDWQIDPDLLSKDGILYVLGNGCARRPVNGLLERCALQY
                     IRQAIEVLSDAEIPPKNQAIWRSFVDIAKRHSSMESDITQPQIQQVLKTGPTGELLVA
                     VGENIPAILQGKVDAATLLHSSGLLEKRLYDCYDSAAVYLRAVGHKNPSMSVLQIGAG
                     TGGAIQSQFQILFLEGRNITPRFLDYTVTDADQSVLEDAAKNLSEYEEWIDFKTLDIE
                     ADPEPQGFASHHYDAIVIPHGIYAASSMEHVLKNIHQLLKPGGHLVLIDPASRHDGLV
                     ESAIFGCLPGWPHGEWDQVLRGAQFSGVDHLIDFDDTSLILSSPLRQPPSVTPAGILI
                     IAEESNSVCLPYLRDMLSAVQLTAEITDLAHAKPEGRLCIVLSDILTPSMTDADDATF
                     ETVKTIFLQSSGVLWVTRGGDTLSPRDPDASIITGFARTARSESGVEPIVTLDLDARD
                     VLSPERTAEVIFRLFQYRFFVNSSMHADTEYSESGGILSIPRVVEEPRLNKHLATALN
                     PRVLTEQPFYQHDRPLRANVSSRDRSERVYFVNDTRASELPPDHVGIRVQVVGLTKHD
                     TRIQPGEENVGTQCSGTVYAIGNAVQGFEIGDQVACLGTGTVASIYHDRVEAYQKIPP
                     GTSLDIAATLPVPFCTAFYVLYHLARVGPNDTILINGAASAYGQAMVKVANGTGARIF
                     AIVADEKQKTFLFFTAKIPADQILVRDVDDFTDRVERATGGDVDVVVDCNDSDQDVKL
                     LANRVNTYGRFIKLEGADSKNIRFSSFNQEAMFTVFSLETLRREKPGVLYDVFRQVMD
                     LFRDGTLQGPPLLQSANISELNNVLDSFDPDSSHFTTITAAPDDLIRATRRKADLLLR
                     SDASYMLVGGLGGIGRATALWMAERGAQNLIFVNRSGLSRESSKETVRVLEERGVRVI
                     VYACDISDSRQMQTMVSELAQQAPPIRGVIQAAMVLKDTHIEKMTSETYHAVLQPKYS
                     GTWNLHRHLPSENLDFFLLLSSISGIIGNATQAAYAAGSTFMDAFASYRSRNLGLPTV
                     SLDLGVITDVGYVAEHQGLAAAMEQQGFQGTDTPTLLALIEMAISQPIEFHQVITGLG
                     EWKGSGKSLTNFDAPLFARYRRLFTSSDSIDSDNDVSAVDRLREDLAAAKTLDDATVL
                     VYTALSAKIAAHLSLSVESIDPSSPISEYGVDSHVAVELRNWITEKMESTVPILEILA
                     SGSVGELAAKIAGKSKLVKLED"
     gene            complement(<165220..>169523)
                     /locus_tag="ACHE_70049A"
                     /db_xref="GeneID:66985564"
     mRNA            complement(join(<165220..167742,167790..>169523))
                     /locus_tag="ACHE_70049A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282339.1"
                     /db_xref="GeneID:66985564"
     CDS             complement(join(165220..167742,167790..169523))
                     /locus_tag="ACHE_70049A"
                     /note="COG:Q;
                     EggNog:ENOG410PHHW;
                     InterPro:IPR034001,IPR043926,IPR027417,IPR003593,
                     IPR010929,IPR017871,IPR029481,IPR003439,IPR013525,
                     IPR034003;
                     PFAM:PF01061,PF00005,PF06422,PF14510;
                     SMCOG1000:ABC transporter ATP-binding protein;
                     TransMembrane:11
                     (o539-557i569-591o597-616i706-727o1125-1142i1154-
                     1171o1191-1221i1233-1254o1260-1282i1294-1314o1389-1407i);
                     antiSMASH:Cluster_7.1;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_function: GO:0042626 - ATPase-coupled transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139728.1"
                     /db_xref="GeneID:66985564"
                     /translation="MQERPPFLHAASEVREDTDSAATMKPEDTSSSHSHSHEGTSKAD
                     DWSLMPQIKQQHQRDVASGFKRRELGVTWRNLNVEVVSAEAAVNENFLSQFNIPQHIK
                     EARHKAPLRKILQDSHGCVRPGEMLLVLGRPGSGCTTLLKMLANQRRGYKSIQGDVRF
                     GSMTPEQAAQYRGQIVMNTEEELFFPSLTVGQTMDFATRLKVPFNLPEGTKSPEAYRQ
                     ETKKFLLESMGISHTEDTKVGNEFVRGVSGGERKRVSIIECLATRGSVFCWDNSTRGL
                     DASTALEWTKAIRAMTDVLGLSSIVTLYQAGNGIYDLFDKVLVLDEGKQIYYGPMAQA
                     RPFMEDLGFVCREGSNVADFLTGVTVPTERKIQPGYENRFPRTAEALRTEYEKSPIHA
                     SMIAEYDYPTSSLAQERTDEFKDAVLHEKAKLPNNSPWTVSFVDQIKTCIQRQYQILW
                     GAKETFIIKQVSTLVQALIAGSLFYDAPNNSGGLFVKSGALFFSLLYNSLLSMSEVTD
                     SFSGRPVLIKHKNFAFFHPAAFCLAQITADIPVLLFQISIFSIVVYFMVGLTMSADAF
                     FTYWVIVFATTMVMTALFRAIGAMFSTFDGASKVSGFLISALIMYTGYMIHKPQMHPW
                     LGWIYWIDPLAYGFDALLSNEFHGKTIPCVGSNLVPTGPGYMDTEFQSCAGVGGAIQG
                     QNYVTGDNYLKSLSYSHGHVWRNFGILWAWWALFVVVTIIATTGWKAASESGNTLLIP
                     RERLESVRQASRADEESQMVEKPGKSAEAEQKKQEDIDKQLIRNTSVFTWKNLSYTVK
                     TPSGDRLLLDDVHGWVKPGMLGALMGSSGAGKTTLLDVLAQRKTEGTIKGSIMVDGRP
                     LPVSFQRSAGYCEQLDVHEPFATVREALEFSALLRQPRHVPREEKLQYVDTIIDLLEL
                     HDIADTLIGRVGAGLSVEQRKRVTIGVELVSKPSILIFLDEPTSGLDGQSAYNTVRFL
                     RKLADVGQAVLVTIHQPSAQLFAEFDTLLLLAKGGKTVYFGDIGDNGQTVKDYFARYG
                     APCPKETNPAEHMIDVVSGHLSQGRDWNQVWLESPEHHQVVQELDQTIDEAASKPPGT
                     QDDGFEFAMPLWQQTKIVTQRMCLAIFRNIDYIDNKLALHIGSALFNGFSFWMIGDGV
                     SDMQLRMFTVFNFIFVAPGVINQLQPLFLERRDIFETREKKSKMYSWIAFVTALIVSE
                     LPYLCLCAVLYFVCWYYTVGFSSDSDKAGAMFFVMLMYEFVYTGIGQFIAAYAPNAVF
                     AALTNPLVIGTLVSFCGVLVPYAQIQAFWRYWIYYLNPFNYLIGSMLVFGVYDTDVNC
                     KKNELAIFDTPNGTTCGDYLSTFMQGMGSRMNLLNPDATSGCEVCEYRRGSDYLYTVN
                     LKEYYYGWRDAGIVCIFAISSYALVYLLMKLRTKQSKKAE"
     gene            complement(<170470..>172062)
                     /locus_tag="ACHE_70050A"
                     /db_xref="GeneID:66985565"
     mRNA            complement(<170470..>172062)
                     /locus_tag="ACHE_70050A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282340.1"
                     /db_xref="GeneID:66985565"
     CDS             complement(170470..172062)
                     /locus_tag="ACHE_70050A"
                     /note="COG:S;
                     EggNog:ENOG410PQVY;
                     InterPro:IPR004875,IPR009057,IPR006600,IPR001878;
                     PFAM:PF03221,PF03184;
                     antiSMASH:Cluster_7.1;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139729.1"
                     /db_xref="GeneID:66985565"
                     /translation="MTEIPKEKRLELAIEAFHKGQFPSKTACAKAFDVPPRTLMTRLD
                     GTVSRQHTIANCRKLSNTEEESLKNWILDMDKRGLPLRVSNVRHLAQLLLSARSKPSK
                     DISISEKWVSRFIQRHPELKSKYTRQYDYQRAKCEDPELIKGWFNRVQETILRYGIAE
                     QDIYNMDETGFQMGVASTAKVICGSETRDSHAKSIQPGNREWITIIIAINASGHALPP
                     QIIMAGKKHQSQWYSAIPKEYRISLSDNGWTNDILGFEWLQEMFEKHTASQTAGRYRL
                     LILDGHSSHATASFDQFCTERRIIPLYMPPHSSHLLQPLDISCFAPLKHYYGQKVREM
                     AENNIHAIDKQDFISIYSSIHGRAFSKANILSAFAAAGLIPFKPERVLAKLNIKTPTP
                     PSSSSSNQSFYLGRTPVNLYQLNQQKKQIQELQSQSLSSVVAEQMLEKFIKSTEVAMQ
                     DAILLRQGFHQLHTSNKHQKGKKNMTRAFIQDGGSLTGSEGQQRLIEREAIQEPSRRP
                     RRPARCSNCNEEGHNRLKCPAK"
     gene            complement(<173324..>173651)
                     /locus_tag="ACHE_70051A"
                     /db_xref="GeneID:66985566"
     mRNA            complement(join(<173324..173462,173515..>173651))
                     /locus_tag="ACHE_70051A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282341.1"
                     /db_xref="GeneID:66985566"
     CDS             complement(join(173324..173462,173515..173651))
                     /locus_tag="ACHE_70051A"
                     /note="COG:S;
                     EggNog:ENOG410PSSD;
                     InterPro:IPR007648;
                     PFAM:PF04568;
                     antiSMASH:Cluster_7.1;
                     go_component: GO:0005739 - mitochondrion [Evidence IEA];
                     go_function: GO:0042030 - ATPase inhibitor activity
                     [Evidence IEA];
                     go_process: GO:0032780 - negative regulation of ATPase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139730.1"
                     /db_xref="GeneID:66985566"
                     /translation="MINLSARAARIGANRQAFPLRSFSIAVPARKEGDLGSPKPRGFL
                     AEKDSFSRREAAHEAMYIRSHEAEKLKLLHRQLKEQRRHLDAMEEHM"
     gene            complement(<174441..>175448)
                     /locus_tag="ACHE_70052A"
                     /db_xref="GeneID:66985567"
     mRNA            complement(<174441..>175448)
                     /locus_tag="ACHE_70052A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282343.1"
                     /db_xref="GeneID:66985567"
     CDS             complement(174441..175448)
                     /locus_tag="ACHE_70052A"
                     /note="COG:G;
                     EggNog:ENOG410PM6W;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     SMCOG1106:major facilitator transporter;
                     TransMembrane:7
                     (n3-14c19/20o35-57i110-129o141-160i172-192o198-219i231-
                     250o262-285i);
                     antiSMASH:Cluster_7.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139731.1"
                     /db_xref="GeneID:66985567"
                     /translation="MSIFYSGSLLSGAFGNLIAAGILDGLAGKRGLSSWQWLYIIEGA
                     ITMFIGLVIMVMLPDFPDTWRFLNSEMKAVANRRLAIEAAEADVDEGGKRSQIKGLKL
                     AFTDIKTYVLAIAYMSMTGASGFQNYFPTLTSTLKYDETISLVLVAPPYLFMVAYSMA
                     HARLSDHFANRFWFFVYPIPITMVGYIIFMTTESFGPRYFSFFLMVFVFAQNSTIYSW
                     IANAIPRPPAKRAAAYAFINSVGNSASIWTPYTYRDQDEPFYRPAMGVCIALQCVSAI
                     MALFMHFHLRQLNKRQERLEDEDVTLTDAELQRLQRTAEIEGIDIAAARQLQRGFRYM
                     I"
     gene            complement(<175520..>176052)
                     /locus_tag="ACHE_70053A"
                     /db_xref="GeneID:66985568"
     mRNA            complement(join(<175520..176016,176046..>176052))
                     /locus_tag="ACHE_70053A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282344.1"
                     /db_xref="GeneID:66985568"
     CDS             complement(join(175520..176016,176046..176052))
                     /locus_tag="ACHE_70053A"
                     /note="COG:G;
                     EggNog:ENOG410PM6W;
                     InterPro:IPR020846,IPR036259;
                     TransMembrane:4 (i45-62o89-108i115-132o138-157i);
                     antiSMASH:Cluster_7.1;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139732.1"
                     /db_xref="GeneID:66985568"
                     /translation="MSSKMEKETMERELEKADVTHEEAIHLAELTDDERRVEKKLLRR
                     IDALIMPLVILVYLMNYIDRNNYAAARLQGLERDLSLNDAQYQTGLSILFVAYILMQV
                     PSNLLLNYMGKPSLYLGGFTTAWGLVSTLTSQTKNYGDIVACRFLLGLVGAYYLTASF
                     KAMTDSK"
     gene            <177518..>179651
                     /locus_tag="ACHE_70054S"
                     /db_xref="GeneID:66985569"
     mRNA            join(<177518..177616,177722..177881,177958..178116,
                     178178..178692,178746..>179651)
                     /locus_tag="ACHE_70054S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282345.1"
                     /db_xref="GeneID:66985569"
     CDS             join(177518..177616,177722..177881,177958..178116,
                     178178..178692,178746..179651)
                     /locus_tag="ACHE_70054S"
                     /note="COG:S;
                     EggNog:ENOG410PVFN;
                     InterPro:IPR036864,IPR021858,IPR001138;
                     PFAM:PF00172,PF11951;
                     antiSMASH:Cluster_7.1;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139733.1"
                     /db_xref="GeneID:66985569"
                     /translation="MSLLETSHRKKQSPPVNNRQSRSCKVCRLRKVKCDRVKPCHACC
                     AHGYPSQCVYEAIPGDEPISQADEIRNLRAEIHELKSRLDNRDHCIRNQQRYEHLRQF
                     FNSIRFAPLQEVDHIIGNIRNPRRGWRRPNGAVGKDTATRAINRVSSDDEDELIPLGD
                     GTWSYGSSAGGCSSSSSSSSSSSSIRSTPSDETEASYGRPLSPFNSNISAIDVFVERF
                     VDAFSPEVNAKAGQAGALRRAAEIRMFSPIIGDAFDAVSVAFFGRSTQDRHIEAAGFQ
                     LYPKVLRNLQQALLDPERSKAESTLVTVILLMAFESVERTSDAGVVAHLNGAVRLIQH
                     RGPENHMYGVEHLLFTELRPYYVGAALVARQPSFLAEEEWKAIPWSAGTTKKDILHHL
                     LDLAVEIPALLGQSDDFQAAIQQPGMLSPHEKATKQAALWNGVADLTDRFLQWKRNWV
                     DQYPDGPPREVDPSTPFSPKEDDEPFPIFHCRDLRTGAVFAPTKFLYPDLRLSQTMCV
                     YYAFRLILSTVDSRAPGQAISPVEQYALGCGICRSLEWYILTAPGNMINRLAFPVRVA
                     WEVFPAGGPEQRFLYDVLKLVERRHALGLWGSSMPELSPRTGSPPR"
     gene            <180749..>181837
                     /locus_tag="ACHE_70055S"
                     /db_xref="GeneID:66985570"
     mRNA            <180749..>181837
                     /locus_tag="ACHE_70055S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282346.1"
                     /db_xref="GeneID:66985570"
     CDS             180749..181837
                     /locus_tag="ACHE_70055S"
                     /note="antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139734.1"
                     /db_xref="GeneID:66985570"
                     /translation="MDQLPSWLWVRGADQFHPFIYPEMVLASRAMVPRDGEYDVVCRN
                     CYSTIDNLHRSVSQSYGPSPPPAPVPKNANLSDPLGHCKTEYPVMPGFRLPFVDLSVP
                     GVGAYVEDPYVGMCLVECPWLLSTSSRLSSVFPTSMVPKGSFSPESDDSIGSRLNPEA
                     VPHEPSLPAPYALSDPTWAQPIDDAISHLSRSNSRSLFSVEYTGANEESTSTPAQKFH
                     AALEQLKSTIGVRRDLTSPELEQLRNNIDVRRNLASPELELEPALPMTRYLVGKEGGR
                     RPWKNDRHCRGGSVRKPSRHVRKPSRRVRKPSVKRLGSLKVASPRQVNAATKRQDRRE
                     KLKARINHGRGNGRRYSHRPWRTQMANR"
     gene            complement(<182182..>182843)
                     /locus_tag="ACHE_70056A"
                     /db_xref="GeneID:66985571"
     mRNA            complement(join(<182182..182689,182746..>182843))
                     /locus_tag="ACHE_70056A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282347.1"
                     /db_xref="GeneID:66985571"
     CDS             complement(join(182182..182689,182746..182843))
                     /locus_tag="ACHE_70056A"
                     /note="COG:S;
                     EggNog:ENOG410PKP8;
                     TransMembrane:2 (i21-42o62-81i);
                     antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139735.1"
                     /db_xref="GeneID:66985571"
                     /translation="MWIVFLPMPVLVRLKLPRRHKVAVVLVFGLGIFVCIVSVVRIPA
                     LAKLASHNDVTRYNSLAAIWSSIEANVAIICSSLPPLRPLIVRLLPSSLRISSASDQE
                     RPVVRPYLSFVGNNNFLHFGDGCAGYEASVTAAERRTGVQHRESSLEASLEMSREQSR
                     EGQRQKEDRVGSATPGDAYSGIQVVKELRLDSDLRRSKQGV"
     gene            complement(<182856..>183462)
                     /locus_tag="ACHE_70057A"
                     /db_xref="GeneID:66985572"
     mRNA            complement(join(<182856..183187,183247..183283,
                     183331..>183462))
                     /locus_tag="ACHE_70057A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282348.1"
                     /db_xref="GeneID:66985572"
     CDS             complement(join(182856..183187,183247..183283,
                     183331..183462))
                     /locus_tag="ACHE_70057A"
                     /note="COG:S;
                     EggNog:ENOG410PQIW;
                     TransMembrane:4 (o6-25i37-60o80-103i115-138o);
                     antiSMASH:Cluster_7.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139736.1"
                     /db_xref="GeneID:66985572"
                     /translation="MSNTVAIFSIFTGLATVAVALRLFTRLRVVKTAGWDDWLIVVAL
                     LTDYVFFAFAILETHYGLGTSRNDLTQSQITKQLKAFYLTIPFYNLTISFTKISMLAL
                     YLRLLPMMSKYRLTVTISLCIIPLIALWLVLSSFMFCIPVSDFWSPVSKQRCLPQSLW
                     FLNAAL"
     gene            complement(<183844..>185839)
                     /gene="IDP1"
                     /locus_tag="ACHE_70058A"
                     /db_xref="GeneID:66985573"
     mRNA            complement(join(<183844..184268,184318..184851,
                     184901..185073,185129..185139,185199..185234,
                     185492..>185839))
                     /gene="IDP1"
                     /locus_tag="ACHE_70058A"
                     /product="isocitrate dehydrogenase [NADP], mitochondrial
                     precursor (oxalosuccinate decarboxylase)"
                     /transcript_id="XM_043282349.1"
                     /db_xref="GeneID:66985573"
     CDS             complement(join(183844..184268,184318..184851,
                     184901..185073,185129..185139,185199..185234,
                     185492..185839))
                     /gene="IDP1"
                     /locus_tag="ACHE_70058A"
                     /note="COG:C;
                     EggNog:ENOG410PFHR;
                     InterPro:IPR019818,IPR024084,IPR004790;
                     PFAM:PF00180;
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0004450 - isocitrate dehydrogenase (NADP+)
                     activity [Evidence IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0006102 - isocitrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NADP], mitochondrial
                     precursor (oxalosuccinate decarboxylase)"
                     /protein_id="XP_043139737.1"
                     /db_xref="GeneID:66985573"
                     /translation="MAAALRASSAFARRSLAASSTPLPAAPLGSFIVSSSSSSSSSYH
                     SSSSNTTSSPSSIRAYSSRASVLSRSLGSSPLSTTSRWSGVLPTNLNQVRTMAFDGKK
                     IKVQNPVVELDGDEMTRIIWKEIREKLILPYLDIDLKYYDLGLEYRDETNDQVTIDSA
                     EAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNILGGTVFREPIIIPTIPR
                     LVPGWTKPIIIGRHAFGDQYRATDRVIPGPGKLELVYTPEGGQPETVKVFDYPGGGVA
                     QTQYNTDESIRGFAHSSFQVALLKGLPLYMSTKNTILKKYDGRFKDIFQEIFEKDYKK
                     EFDAKGIWYEHRLIDDMVAQMIKSEGGFVMALKNYDGDVQSDIVAQGFGSLGLMTSTL
                     ITPTGEAFESEAAHGTVTRHYREHQKGNETSTNPIASIFAWTRGLVQRGKLDNNPELV
                     TFAEELERACVDVVNDEGIMTKDLALSCGRKNREAWVTTKEYMAAVERRLQSNLKSRL
                     "
     gene            complement(<187011..>190339)
                     /gene="ADE3"
                     /locus_tag="ACHE_70059A"
                     /db_xref="GeneID:66985574"
     mRNA            complement(join(<187011..187119,187179..189744,
                     189801..189821,189889..>190339))
                     /gene="ADE3"
                     /locus_tag="ACHE_70059A"
                     /product="tetrahydrofolate synthase"
                     /transcript_id="XM_043282350.1"
                     /db_xref="GeneID:66985574"
     CDS             complement(join(187011..187119,187179..189744,
                     189801..189821,189889..190339))
                     /gene="ADE3"
                     /locus_tag="ACHE_70059A"
                     /note="COG:H;
                     EggNog:ENOG410PFGE;
                     InterPro:IPR020628,IPR020867,IPR020631,IPR000672,
                     IPR027417,IPR036291,IPR000559,IPR020630;
                     PFAM:PF02882,PF01268,PF00763;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004329 - formate-tetrahydrofolate ligase
                     activity [Evidence IEA];
                     go_function: GO:0004488 - methylenetetrahydrofolate
                     dehydrogenase (NADP+) activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="tetrahydrofolate synthase"
                     /protein_id="XP_043139738.1"
                     /db_xref="GeneID:66985574"
                     /translation="MPLLPARLAALPRRGVPSKSFSLRPYHRTPDGHPQPLSRLFCSL
                     PFFFSSSSTSYSPHTSSPPCQFHQSLIAGGVRARGYCAPLFFRTDPLRRQDSDSIQTR
                     YYTQRGTMTATKIDGTAIAKSIRDGLKTEIEQIQQANPRFKPSLVIFQVGGRSDSSTY
                     VRMKLKAAEEANITCKIVNFPESISQPELLQEITKANNDTTVHGILVQLPLPAHLSEH
                     AVTSAVADEKDVDGFGAINIGELAKKGGAPHFVPCTPQAVMELLHVSGVNPAGKEAVV
                     LGRSDIVGSPVSYLLRNADATVTLCHSKTPDMPRIVKNADIVVAAIGQTEFVKGEWLK
                     PGAVVIDVGINYKPDATKKSGQRLVGDVEFESAAQVSSQITPVPGGVGPMTVAMLMKN
                     VVNAAKVYFQNQKNRHLTPLPIKLAEPVPSDIAISRAQYPKQITDLAAEIGVAPHELE
                     PYGHTKAKISLDILDRLAHRRNGRYILVCGITPTPLGEGKSTTTLGLTQALGAHLDRI
                     SFANVRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIDT
                     RMFHEATQKDAPLYKRLVPPKGGKREFKPIMFKRLQKLGITKTNPDDLTEEEVNRFAR
                     LDIDPETITWRRVLDVNDRHLRSITVGQAPSEKGLTRETGFDISVASECMAILALSNS
                     LEDMRERLGRMVVATSRRGEPVTCDDIGAGGALAALMKDAIKPNMMQSLEGTPVMVHA
                     GPFANISIGASSVLADKLALKLAGTEPDEDHETKTGFVVTEAGFDFTMGGERFFNIKC
                     RSSGLSPDTVVIVATVRALKVHGGGPAITAGAPLPEVYRTENTEVLRKGCINLKKHIE
                     NAKQYGVPVVVAINRFSTDTEAEIAIIREEAVAAGAEDAVPANHWAEGGAGAVDLAKA
                     VVQASSKPKEFKLLYELEGTVQERIEKIAQTMYGAEKVEFSELAQKKVDTYIKQGYGN
                     LPICIAKTQYSLSHDPELKGVPTGFTVPIRDVRLAVGAGYLYALAADIQTIPGLPTAP
                     GYLNIDIDPETGEIDGMF"
     gene            <190910..>192170
                     /gene="TIF34"
                     /locus_tag="ACHE_70060S"
                     /db_xref="GeneID:66985575"
     mRNA            join(<190910..190936,191057..191575,191636..191752,
                     191811..>192170)
                     /gene="TIF34"
                     /locus_tag="ACHE_70060S"
                     /product="translation initiation factor eIF3 subunit"
                     /transcript_id="XM_043282351.1"
                     /db_xref="GeneID:66985575"
     CDS             join(190910..190936,191057..191575,191636..191752,
                     191811..192170)
                     /gene="TIF34"
                     /locus_tag="ACHE_70060S"
                     /note="BUSCO:EOG09262W7C;
                     COG:J;
                     EggNog:ENOG410PH6Q;
                     InterPro:IPR027525,IPR036322,IPR015943,IPR019775,
                     IPR001680,IPR017986;
                     PFAM:PF00400;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_component: GO:0005852 - eukaryotic translation
                     initiation factor 3 complex [Evidence IEA];
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="translation initiation factor eIF3 subunit"
                     /protein_id="XP_043139739.1"
                     /db_xref="GeneID:66985575"
                     /translation="MRPILLSGHERSLNQIKFNRDGDLLFSVAKDKIVCAWWSANGER
                     LGTYNGHQGAIWTVDVSPNTVLLATGSADNTVRLWNVKSGECVKVWDFPTAVKRVEFS
                     PDGSRLLAVTEKRMGFLGTIAVLDIAYGDGQGGNLEAQAEEPTLKITCTEAKATVAGW
                     SYLGKFIIAGHEDGSVSQYDSKTGDQVENVQAHEFDHQINDIQFSADRTYFITASKDK
                     TAKLMSTRNLAILKTYVSDTPLNSATITPKKEYVILGGGQAAMDVTTTSARQGKFEAR
                     FYHKIFEDEIGRVRGHFGPLNTVGVHPKGTAYASGGEDGYVRVHHFDKPYFDFLYEVE
                     REQLKR"
     gene            complement(<192844..>193376)
                     /gene="MBF1"
                     /locus_tag="ACHE_70061A"
                     /db_xref="GeneID:66985576"
     mRNA            complement(join(<192844..193158,193221..>193376))
                     /gene="MBF1"
                     /locus_tag="ACHE_70061A"
                     /product="multiprotein-bridging factor 1"
                     /transcript_id="XM_043282352.1"
                     /db_xref="GeneID:66985576"
     CDS             complement(join(192844..193158,193221..193376))
                     /gene="MBF1"
                     /locus_tag="ACHE_70061A"
                     /note="BUSCO:EOG09264MN3;
                     COG:K;
                     EggNog:ENOG410PN0T;
                     InterPro:IPR013729,IPR010982,IPR001387;
                     PFAM:PF08523,PF01381;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="multiprotein-bridging factor 1"
                     /protein_id="XP_043139740.1"
                     /db_xref="GeneID:66985576"
                     /translation="MSDWDSVTRIGQKHTGGGAPRETTVRGKSALNAAQRQGLVVGTE
                     KKYATGNAASKSGGSEGQHLTKVDRSDDIVKPKTVGPRVANAIKQRRNEEPYKMTQKE
                     LATKCNTTATVIQEMEKGTATPDQKVLSTMERVLNVRLRGADIGKERFAKSNKQ"
     gene            <203984..>204940
                     /locus_tag="ACHE_70062S"
                     /db_xref="GeneID:66985577"
     mRNA            join(<203984..204043,204118..204529,204582..>204940)
                     /locus_tag="ACHE_70062S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282354.1"
                     /db_xref="GeneID:66985577"
     CDS             join(203984..204043,204118..204529,204582..204940)
                     /locus_tag="ACHE_70062S"
                     /note="COG:T;
                     EggNog:ENOG410PPWP;
                     InterPro:IPR001452,IPR036028;
                     PFAM:PF07653,PF00018,PF14604;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139741.1"
                     /db_xref="GeneID:66985577"
                     /translation="MSGDNFTAAMANRSRRTVETELKFLAELSEITHEQLSSILGLLA
                     GEQSRQLSQSQPPQPAPVPLPVQQTVPPPPIQQPIVPPPAPYSPPTNQFANTSLNEKA
                     PVQQHPPPPGPPPGPPPAYGLCTATALYAFEVKDHGDLELQPYDKIQVLKYENDQWWY
                     GRNERTNQEGIFPRAWVNVVQEKGPPPPPPATNYGNMPLEVSQSGSAPPGPEGDGKGN
                     KFEQHGKKFGKKMGNAGTLLRDSPNAALYVNRANSLLSFLAIFGAGATMGSNIVNSIF
                     "
     gene            <210184..>211550
                     /locus_tag="ACHE_70063S"
                     /db_xref="GeneID:66985578"
     mRNA            join(<210184..210232,210289..210303,210374..210832,
                     210887..211272,211338..>211550)
                     /locus_tag="ACHE_70063S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282355.1"
                     /db_xref="GeneID:66985578"
     CDS             join(210184..210232,210289..210303,210374..210832,
                     210887..211272,211338..211550)
                     /locus_tag="ACHE_70063S"
                     /note="COG:S;
                     EggNog:ENOG410PKQ4;
                     InterPro:IPR016031,IPR036983,IPR002838;
                     PFAM:PF01987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139742.1"
                     /db_xref="GeneID:66985578"
                     /translation="MAQQVAYQPYADQAHVAAFELKNYPFQPPPSNPPSVFSYQQPPQ
                     QQAYSQYGQPTAVTSTDQPWDEKNNGVQQQAPAQVDHDATTQLQNFRKDKDDLMDEQL
                     KERVRKAVEEQLKPHVEGLEQSRGISKKLEEGYTLRDIPGEYNGGSYLASNNDSGSIL
                     TVSLGGSVPLIAKPGAMVAKDPGITLRGQLSFSWMKLLTRSGFGKSKFTGKGDVLLAP
                     SSLGSIGVIQVNTVRQPVTDDDIPLTAEWKVGRDSFLAATHAVESDYQTQNLTQAVFS
                     GEGLFVYTFSGWGPLFVQGLGAVIEKKIEAGKTFTIDNGYLVAWNCQYKIERVASGGI
                     ISGISSREGLACKFTGPGTVYYQTRKIQDVAAHLKKANR"
     gene            complement(<212064..>213264)
                     /locus_tag="ACHE_70064A"
                     /db_xref="GeneID:66985579"
     mRNA            complement(join(<212064..212230,212280..212891,
                     212960..213080,213253..>213264))
                     /locus_tag="ACHE_70064A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282356.1"
                     /db_xref="GeneID:66985579"
     CDS             complement(join(212064..212230,212280..212891,
                     212960..213080,213253..213264))
                     /locus_tag="ACHE_70064A"
                     /note="BUSCO:EOG09264OQ8;
                     COG:J;
                     EggNog:ENOG410PG7A;
                     InterPro:IPR002735,IPR000048,IPR016190,IPR016189;
                     PFAM:PF01873;
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139743.1"
                     /db_xref="GeneID:66985579"
                     /translation="MAEAVEQKQRKSVAFSEGSVIMDTNGEVTEAPKAVEKPVEEKPT
                     GADQQVDEVTEMFKGLSKKKKSKKPKDADEGEEAAATPDGEFDPGLKKKKKKTTKKAD
                     TGDFEAKLAEANVAEQGAEKKEDEIPEGDLEAGTGIWAHESTQAIPYSLLVNRFFSLI
                     QSHHPDLLSSGTKSYKIPPPQCLREGNRRTIFANIADICKRMKRSDDHVMQFLFAELG
                     TSGSVDGARRLVIKGRFQQKQIEHVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTC
                     NSCGSRRSVAAIKTGFRGQVGRRKRQG"
     gene            <213706..>214135
                     /locus_tag="ACHE_70065S"
                     /db_xref="GeneID:66985580"
     mRNA            join(<213706..213976,214041..>214135)
                     /locus_tag="ACHE_70065S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282357.1"
                     /db_xref="GeneID:66985580"
     CDS             join(213706..213976,214041..214135)
                     /locus_tag="ACHE_70065S"
                     /note="COG:S;
                     EggNog:ENOG410PS2H;
                     InterPro:IPR037652;
                     PFAM:PF19117;
                     go_process: GO:0045040 - protein insertion into
                     mitochondrial outer membrane [Evidence IEA];
                     go_process: GO:0070096 - mitochondrial outer membrane
                     translocase complex assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139744.1"
                     /db_xref="GeneID:66985580"
                     /translation="MAAEPVASNPSLAASGYMVSSVDKYSYGSDDEVASLPSESTSSS
                     DLDALSDDYSDAEEEWRESIEQLELLLSMVLVPFVGKYLGRKCAYWSWTRFMQWKYPV
                     EVVVNNQASFKGTGAMAAL"
     gene            complement(<214598..>215130)
                     /locus_tag="ACHE_70066A"
                     /db_xref="GeneID:66985581"
     mRNA            complement(join(<214598..215002,215056..>215130))
                     /locus_tag="ACHE_70066A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282358.1"
                     /db_xref="GeneID:66985581"
     CDS             complement(join(214598..215002,215056..215130))
                     /locus_tag="ACHE_70066A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139745.1"
                     /db_xref="GeneID:66985581"
                     /translation="MKPARGSTHRLTESSLEQYGQLLQRELNTRTVSWAEKVIKDEQI
                     HQFYSQSHLRGLEHRHPQDPIRDIHLAATSVSTSDSSLTSLKLFESQQGMCLEDPLER
                     FLTPVGLDHRTRPALREMEFSLGCMDEKEQRQQIAQQRADAVVKSKVRERTVDSRRS"
     gene            complement(<218671..>220510)
                     /locus_tag="ACHE_70067A"
                     /db_xref="GeneID:66985582"
     mRNA            complement(join(<218671..220010,220060..220129,
                     220178..>220510))
                     /locus_tag="ACHE_70067A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282359.1"
                     /db_xref="GeneID:66985582"
     CDS             complement(join(218671..220010,220060..220129,
                     220178..220510))
                     /locus_tag="ACHE_70067A"
                     /note="COG:S;
                     EggNog:ENOG410PU30;
                     TransMembrane:1 (o555-574i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139746.1"
                     /db_xref="GeneID:66985582"
                     /translation="MLFSPRSPFARLSEGHGAQIFRRSFRTQQQSSVSLHQRTPLSEI
                     ANPKQETHRYERKPRRKTRDDRYEYKGHDHRVDSERSKKQKKTAKQSRRHTLNRDFHA
                     PNVSQIRLTLASRPKMGIFGKGRTSSPIKSRELPDLTFSEMNFLSRRSRSNPNGLLVE
                     QQGETNGAARREHDSQAQIPQYFSNDYPDEHDVIDETVYPSAQDPDQPEPAAMATEAH
                     GSCTMRPADLSPKLSRSATPYTWYESDRREHERRASSKNCTKGILCVDLNHQHISDEE
                     KANRRYWDLDELKLILVIRQQVRNRSRANKEPEACDHLKRRHQPDEVDDEPRSPKKAK
                     LSNAIASIQKPLSSPASSSTERDTPSHGHPKPGTYTPERQTSRDIDHHELELTPKQVC
                     FSNYCSMSQNCNRAIAPHQNPHPKRNVDSAGSDEIDLDAEFNSIVSICSRETAYGKNE
                     DVIMKDFDAVYDSIVLDDKDPAHGDLSRIPSNQSYFVPIQDGSTPLPDSIDDGWNLSL
                     PSGITNHSSSNNFLAACTHCQPHNINEGVQASNNSKYDTWNGFSQPIMFAVGMGAAAF
                     GTSTGFCWRQNKLY"
     gene            <221293..>221878
                     /locus_tag="ACHE_70068S"
                     /db_xref="GeneID:66985583"
     mRNA            join(<221293..221312,221365..221437,221502..221608,
                     221671..221798,221862..>221878)
                     /locus_tag="ACHE_70068S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282360.1"
                     /db_xref="GeneID:66985583"
     CDS             join(221293..221312,221365..221437,221502..221608,
                     221671..221798,221862..221878)
                     /locus_tag="ACHE_70068S"
                     /note="COG:A;
                     EggNog:ENOG410PQQ1;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139747.1"
                     /db_xref="GeneID:66985583"
                     /translation="MAKLFVGGLSWHTTDESLRAGFEQFGVVEDAIVVKDRDSGRSRG
                     FGFVRFASEQEADIAQQNLNNQEFDGRTIRVDKAAERAPRGNGGGYNGRGGYNSRGGE
                     GDYSGGYGGGYY"
     gene            complement(<222088..>223324)
                     /locus_tag="ACHE_70069A"
                     /db_xref="GeneID:66985584"
     mRNA            complement(join(<222088..222615,222662..222746,
                     222796..222802,222868..222921,222997..223028,
                     223115..223202,223279..>223324))
                     /locus_tag="ACHE_70069A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282361.1"
                     /db_xref="GeneID:66985584"
     CDS             complement(join(222088..222615,222662..222746,
                     222796..222802,222868..222921,222997..223028,
                     223115..223202,223279..223324))
                     /locus_tag="ACHE_70069A"
                     /note="COG:P;
                     EggNog:ENOG410PN6U;
                     InterPro:IPR013024,IPR006840;
                     PFAM:PF04752;
                     go_function: GO:0003839 - gamma-glutamylcyclotransferase
                     activity [Evidence IEA];
                     go_process: GO:0006751 - glutathione catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139748.1"
                     /db_xref="GeneID:66985584"
                     /translation="MDLGCQPSRSFLFELTEIEEKHTTIEGRTWRNYFPNGDLWVFGY
                     GSLIWKPPPHYDQRVPGYISGYVRRFWQVGMRTDHRGTTENPGRVVTVIEREFWETLD
                     DPLAHLEVPSSLSKAAVWGAAYHIPASHAEEVHDYLDDREIDGYTVHYTPFYPTPTAT
                     TSKADTPTTPITCMVYIGLPTNPQFLREPARREPQDVAEVISGSCGQSGRNAEYLYLL
                     EKALDGLGLGSADVHVTDLVGRVKAIEKEAAKADEEEAEKDLTRSLSISDAEAHEDFP
                     RTE"
     gene            <223677..>224738
                     /locus_tag="ACHE_70070S"
                     /db_xref="GeneID:66985585"
     mRNA            join(<223677..224557,224612..>224738)
                     /locus_tag="ACHE_70070S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282362.1"
                     /db_xref="GeneID:66985585"
     CDS             join(223677..224557,224612..224738)
                     /locus_tag="ACHE_70070S"
                     /note="COG:Q;
                     EggNog:ENOG410PVJM;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139749.1"
                     /db_xref="GeneID:66985585"
                     /translation="MTGLFRLLRSQYSPPKDPTDVSFARKTILLTGATSGLGYEAAIK
                     FLNQGVETLIIGCRNVQRGDAVKTELEKRTNRPDVIRIWELEMSSFQSIKSFADRVDT
                     ELSQLDVAVLNAGLWNRDYTVSPEGWEETLQVNTLSTALLAILLLPKLRDSSSISHPA
                     HLTVVSSQLFCRVRPTHLRTDGSLLEHVNDRSNFSGPMQYAISKLLLEYMLKRAADRV
                     RHENGTLPVIVNTVSPGFCASSLGRQYNRFHEQSMIWLEFKLFARTSEQGSRSLVSAT
                     YQGAESHGRCWRSDGYLDESNALTTGMEGWQFQEKAWREILQVLVEQAGEVEEIVGEP
                     N"
     gene            <225270..>226400
                     /locus_tag="ACHE_70071S"
                     /db_xref="GeneID:66985586"
     mRNA            join(<225270..225282,225351..225376,225459..226320,
                     226378..>226400)
                     /locus_tag="ACHE_70071S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282363.1"
                     /db_xref="GeneID:66985586"
     CDS             join(225270..225282,225351..225376,225459..226320,
                     226378..226400)
                     /locus_tag="ACHE_70071S"
                     /note="COG:T;
                     EggNog:ENOG410PI12;
                     InterPro:IPR011992,IPR002048,IPR018247;
                     PFAM:PF00036,PF13499,PF13202,PF13833;
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139750.1"
                     /db_xref="GeneID:66985586"
                     /translation="MRSRLYRHAEPEQVAQMIGAMQTGPSHPAQPKAARPVIPHSSSS
                     GVPPRVPVSSASSHSLHPAHNGRPPVSAPPSQYRPSHTLHPSPPPQNYGFGPPPAHPV
                     RNRPPPVSRPPQSPHPPPLSVTSDDPQQLFPLFRAANVSHSGALTELELGSALVNGDY
                     TSFHPKTVKMMIRMFDRNGSGTISFDEFVSLWRYLAAWRELFDRFDEDRSGRISLQEF
                     EKSLVAFGYRLSQPFVTVLFTTFESKGRQRNASAMMGPAKLGMSFDLFVQACISLRRM
                     TDVFKRYDDDRDGYITVSFEEFLTEIIQLQD"
     gene            <227014..>229039
                     /locus_tag="ACHE_70072S"
                     /db_xref="GeneID:66985587"
     mRNA            join(<227014..227337,227403..227432,227486..>229039)
                     /locus_tag="ACHE_70072S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282365.1"
                     /db_xref="GeneID:66985587"
     CDS             join(227014..227337,227403..227432,227486..229039)
                     /locus_tag="ACHE_70072S"
                     /note="COG:G;
                     EggNog:ENOG410PKJQ;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:14
                     (i100-132o138-157i169-192o198-215i227-248o254-277i298-
                     317o323-343i364-384o396-421i430-452o458-477i497-517o571-
                     589i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139751.1"
                     /db_xref="GeneID:66985587"
                     /translation="MSGLPPSREGNHSLSDFTFNKPAFAQSHTEVCSSRQTSAPSTPT
                     DMSTTPFRRGEQEKLQGQEGGSPPDTPVNGDENANGDGAPLDRTQSQSNQLGTKQIAV
                     IMTALCLALFLAALDMTIVSTALPVMAAYFGASESGYSWMASSYLLANASCIPLWGKV
                     SDIWGRRYVILLANFIFLIASLICALSTNLAMMLAGRAIQGIGGGGIVVLTNISVSDL
                     FSVRQRPMYYGIFGAIWAIAGALGPIIGGAFTTSVTWRWCFWLNLPVGGVSFVALFFF
                     LKIESPKTPFMAGIRSIDWAGVLLIIGGTLMFLFGLEFGGIDYPWTSPTVICLIIFGV
                     VTWVVAMLNEWKLAKYPIIPLRLFNNWHNVLILTVNFCHAFSFIAGNYYLPLYFQTVL
                     QASPILSGVYVLPLCLSLSFTSIATGAIIKITGRYRELIVAGLVFMTLGYGLFINLQP
                     YASWPRIIIYQIIAGIGVGPIFQSPLVGLQANIHRADVATATATFNFIRQASASMAVV
                     LGTVVYQNVLGKQTASLSGKVGSETAQKLANSFSGSSKSLIASLGPEQERAVLETFTY
                     VLSRLWIFYTAVIGFALIVSFFIRPVTLSKAHTFAKTGLEEQERARQEILAAERAKKG
                     KDGSAVEKGGA"
     gene            complement(<229760..>231727)
                     /locus_tag="ACHE_70073A"
                     /db_xref="GeneID:66985588"
     mRNA            complement(join(<229760..231394,231460..231616,
                     231672..>231727))
                     /locus_tag="ACHE_70073A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282366.1"
                     /db_xref="GeneID:66985588"
     CDS             complement(join(229760..231394,231460..231616,
                     231672..231727))
                     /locus_tag="ACHE_70073A"
                     /note="COG:K;
                     EggNog:ENOG410QEEN;
                     InterPro:IPR033896,IPR036879,IPR002100;
                     PFAM:PF00319;
                     TransMembrane:1 (i32-50o);
                     go_function: GO:0000977 - RNA polymerase II transcription
                     regulatory region sequence-specific DNA binding [Evidence
                     IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     go_process: GO:0045944 - positive regulation of
                     transcription by RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139752.1"
                     /db_xref="GeneID:66985588"
                     /translation="MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELAVLCSVDVA
                     VIIFGHNKKLYEFSSCDMRETLGRYQYFGPPHEHKGPEDFAGRRDDDDEEDETTPAPD
                     EAQQTQQTHQGPPPMAPPHIPSHPGFQHVNHAPSASPPISNGMPFAPRHGTPQPQVVS
                     RPSSRNHIRRVSSNLAPHQHATPPPAPPPAPQNGFPYMPNPMYNPSAHPNMTQHPHRP
                     APFPHFGHPPVTHHQTPPPQPPHQSLTPQTMPTHTMPSQSIPQHPMAPPHAHPFAQPP
                     PPMTLSHPPVPQVAHAYIHDQGRSSMPPAFTSETPQPQPAPPRTVSLPDASAADQVKP
                     EEDPSPPTHQRSLSSKSRSIFTPIDDRGSVLARHFGVGPPNEPPREDSHVKSESTKED
                     ANDESTTPVIPPPPPPRVVTEASRTQSISSVSSDIKPPTRTNSVQSKRPQLKVQIPSE
                     NSDRDTATADSSSRDSAGKALTPAKANLETNHSGVVLPPPSPSAGAILSAGAQGPPNP
                     FARPPPPGTATQNNSAYANNNNIETPISALPSRFVSDALLPSPSSFFPEWGFGRSGPD
                     TNMLPSPLTFPTPAAQTGPGFAREDEQDRKRKTPDSGPSGEGASKKTKT"
     gene            <235634..>238966
                     /locus_tag="ACHE_70074S"
                     /db_xref="GeneID:66985589"
     mRNA            join(<235634..235826,235946..236197,236259..236487,
                     236549..238839,238893..>238966)
                     /locus_tag="ACHE_70074S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282367.1"
                     /db_xref="GeneID:66985589"
     CDS             join(235634..235826,235946..236197,236259..236487,
                     236549..238839,238893..238966)
                     /locus_tag="ACHE_70074S"
                     /note="COG:S;
                     EggNog:ENOG410PGC4;
                     InterPro:IPR037508,IPR012965;
                     PFAM:PF08101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139753.1"
                     /db_xref="GeneID:66985589"
                     /translation="MPFFTRVFRGKESSAAKKAAKTPVPENITTPAKPTWTDAWQRTE
                     VAPEEVQELLRGCTHELKARALDTPFLLLPYRPSSDATTARSFIRNYFNNSQARGSPV
                     NGDDLAQELRLTDPMILCSVLKWCWSRLPGGVVTWEAYELFKVGEQDSQLARDAFSTF
                     IPISIDSDARSKIIFDFFDLLTAIAAHGKSNGLGGRKLSRYAGWWAFEHMDTGNGFEA
                     AYKNWASAADATSHLFFAYLRSISPDLPRGMSGIATLPIALQSLVQATEYPPETPTLL
                     QMTTTKVVMIVDTVSPTPFALLRRAKNFEYRDSDRHLQEFSGYEDPIRALTDECLRVL
                     KCIASTNQAEVSKEKTSPNQDESWSRFEDIGFGNTLESDLEDNTVQHEFGNSLKSAPQ
                     SSGGDLGRPTTPSWADFMSSGFSGDENILKAPVAPLLLPPDKVLPPLSTGRGMSSQSH
                     KRTLESEPDLEPGELASIATLELDDSFWWVWISSLAGEEPATRKAVFGRCALIETVIH
                     GAKWLVLEEQVRGAAPEPDAGAYIVEKKRFFGLSTRMGKLGRRRSSAKKVTPVGEPYK
                     RTDNPAPQSKTSIGPDQHARIQAAAAALQRKHRDQTQEENANTTKVDSSDAAKSAKTN
                     SVMTLQPSIMNEASQAMKWAKNYDKHADRNAFRTAYLGDSNAGKGASVENLKPQTVNE
                     PSTPVSLAPSQIPEPIPEEDTTPMPSSPAAPASIKSNAVAADQPSTSRPGSIASVAVE
                     RSGSESQPKASIDSTDSSRKLKKKPVATGFKSMFAKKKNDTEMKPPMKPTGAETSAVA
                     AARAALESKAKESQVPVSRPVPNGPSVLKKKPVPGTTPAAPEKPATPEVVEITETERE
                     STPKAESPAQNGSPESKPEPEQQESLSRVNTKEQVAADQEFSRFDQGPLVEQPAFVPE
                     SPVSPVSESIPERESVSPEMNEAEEPRKTQEETTPKGTANGNQFNPEIKDRWAQIREN
                     AARRAAEDDGDTSEEENYQHRAARIKARVAELTRNMEAAR"
     gene            complement(<239369..>240334)
                     /locus_tag="ACHE_70075A"
                     /db_xref="GeneID:66985590"
     mRNA            complement(join(<239369..239841,239937..240186,
                     240254..>240334))
                     /locus_tag="ACHE_70075A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282368.1"
                     /db_xref="GeneID:66985590"
     CDS             complement(join(239369..239841,239937..240186,
                     240254..240334))
                     /locus_tag="ACHE_70075A"
                     /note="COG:S;
                     EggNog:ENOG410PNCK;
                     InterPro:IPR029062;
                     MEROPS:MER0031431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139754.1"
                     /db_xref="GeneID:66985590"
                     /translation="MSKPKFLIVLSSQGMIPSNRATTGWYLSELAHPYTILSPHLDLT
                     ISSPQGGEAPLDPASASQQILETDPVAREFLEQNRGLWTRTVPLREVVSRVTEGKFMG
                     VFFVGGHGPMYDLPTHPSNLAILQSLASTFTPYPKVIAAVCHGPAALLNATTPAGIPL
                     LSGSTVTGFSNEEEEIVGMHNVLPFELQTELERVTASASAPATAPGAGRGGGKGGYLK
                     AEKAWGEKVVVSKSADTGAGMGGAFVVTGQNPASAAGVARRVLEVLGLG"
     gene            complement(<240571..>242608)
                     /locus_tag="ACHE_70076A"
                     /db_xref="GeneID:66985591"
     mRNA            complement(join(<240571..241579,241627..241816,
                     241863..241934,241983..242049,242099..242343,
                     242408..242433,242511..>242608))
                     /locus_tag="ACHE_70076A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282369.1"
                     /db_xref="GeneID:66985591"
     CDS             complement(join(240571..241579,241627..241816,
                     241863..241934,241983..242049,242099..242343,
                     242408..242433,242511..242608))
                     /locus_tag="ACHE_70076A"
                     /note="COG:G;
                     EggNog:ENOG410PKCY;
                     InterPro:IPR036259;
                     PFAM:PF13347;
                     TransMembrane:12
                     (i20-38o58-79i91-109o129-154i175-193o205-224i259-279o310-
                     333i367-385o391-413i489-513o541-558i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139755.1"
                     /db_xref="GeneID:66985591"
                     /translation="MPQAARWVGTPSIKGRNESARMALLTFSLLGLQFTWSIEMTYCT
                     PYLLQLGLTKSRTSLVWIAGPLSGLVIQPLIGVIADRSRSKYGRRRPFMIVGSFIVAA
                     CLLLLGWTSEIVNAFVKDPEKSQSATIALAVLSIYAVDFAINIVQACCRSLIVDTLPI
                     PLQQSGSAWAGRMSAIGQLVGYAVGSIDTVRIFGSLIGDTQFKQMTVIAALFLIGSVL
                     VTSYSVKERILITARDSDGEAGAMQVISQLLKTTMELPPRIQAICWAQFWAWIGWFPF
                     LFYSTTWVGETYFRYEVPKGTTQSDDILGEVGRIGSLSLVVFSSITFIGSVILPFCVQ
                     SPDHKRSRFTPRPPPGVAALLTKITAIRPDLQTTWWMSHFVFAVTMIMAPFARSRAFA
                     TALVAVCGVPWAVASWAPFAFMGVEINKLAMDPSLTARYSGVQMITSSSIRTGNYADP
                     NTDTEMDILRLNHHHDMDSDSDDEDPTSSVPSTGELAGIYLGVLNVYTTLPQFVGTFI
                     SWIVFSILEPANAKRDDNSQEAMWMNLDKNSPNAISVCLFIGALSALVASEATRRMRY
                     AR"
     gene            complement(<243671..>245910)
                     /gene="ZWF1"
                     /locus_tag="ACHE_70077A"
                     /db_xref="GeneID:66985592"
     mRNA            complement(join(<243671..243780,243830..244201,
                     244252..244536,244595..244679,244735..244932,
                     245003..245347,245411..245431,245504..245576,
                     245867..>245910))
                     /gene="ZWF1"
                     /locus_tag="ACHE_70077A"
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /transcript_id="XM_043282370.1"
                     /db_xref="GeneID:66985592"
     CDS             complement(join(243671..243780,243830..244201,
                     244252..244536,244595..244679,244735..244932,
                     245003..245347,245411..245431,245504..245576,
                     245867..245910))
                     /gene="ZWF1"
                     /locus_tag="ACHE_70077A"
                     /note="BUSCO:EOG09261N64;
                     COG:G;
                     EggNog:ENOG410PHEK;
                     InterPro:IPR019796,IPR022675,IPR022674,IPR001282,
                     IPR036291;
                     PFAM:PF00479,PF02781;
                     go_function: GO:0004345 - glucose-6-phosphate
                     dehydrogenase activity [Evidence IEA];
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0006006 - glucose metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="XP_043139756.1"
                     /db_xref="GeneID:66985592"
                     /translation="MASTITRTDERQNAGTIELKDNTVIVVLGASGDLAKKKTFPALF
                     GLYRNKFLPKDIKIVGYARTKMDQEEYLKRVRSYIKVPTKEIEEQLDSFCKLCTYVSG
                     QYDQDDSFINLNNHLDEVEKGQKEQHRVFYMALPPSVFITVSDQLKRNCYPKNGLARI
                     IVEKPFGKDLQSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILIMRFGNEFFNATW
                     NRHHIDNVQITFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSAED
                     IRDEKVRVLRAMDAIEPKNVIIGQYGKSLDGSKPAYKEDDTVPKESRCPTFCAMAAYI
                     KNERWDGVPFIMKAGKALNEQKTEIRIQFRDVTSGIFKDIPRNELVIRVQPNESIYTK
                     MNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAYESLILDALKGDHSNFVRDDELDAS
                     WRIFTPLLHYLDDNKEIIPMEYPYGSRGPAVLDDFTASFGYKFSDAAGYQWPMTSAPN
                     RL"
     gene            <248316..>249050
                     /gene="RPL35B"
                     /locus_tag="ACHE_70078S"
                     /db_xref="GeneID:66985593"
     mRNA            join(<248316..248340,248495..248504,248637..248732,
                     248785..248885,248953..>249050)
                     /gene="RPL35B"
                     /locus_tag="ACHE_70078S"
                     /product="60S ribosomal protein L35B"
                     /transcript_id="XM_043282371.1"
                     /db_xref="GeneID:66985593"
     CDS             join(248316..248340,248495..248504,248637..248732,
                     248785..248885,248953..249050)
                     /gene="RPL35B"
                     /locus_tag="ACHE_70078S"
                     /note="COG:J;
                     EggNog:ENOG410PPN6;
                     InterPro:IPR001780,IPR038661,IPR018266,IPR009000;
                     PFAM:PF01247;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L35B"
                     /protein_id="XP_043139757.1"
                     /db_xref="GeneID:66985593"
                     /translation="MPSEHGHRLYVKGRHLSYQRSKHQVNPNTSLIKIDGVDNTDAAN
                     FYLGKKVAFVYRAKREVRGSNIRVIWGKVTRSHGNSGVVRAQFRHNLPPQSFGASVRV
                     MLYPSNI"
     gene            <252841..>254028
                     /locus_tag="ACHE_70079S"
                     /db_xref="GeneID:66985594"
     mRNA            join(<252841..253009,253076..253153,253206..253346,
                     253400..>254028)
                     /locus_tag="ACHE_70079S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282372.1"
                     /db_xref="GeneID:66985594"
     CDS             join(252841..253009,253076..253153,253206..253346,
                     253400..254028)
                     /locus_tag="ACHE_70079S"
                     /note="COG:S;
                     EggNog:ENOG410PQFF;
                     InterPro:IPR018809;
                     PFAM:PF10295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139758.1"
                     /db_xref="GeneID:66985594"
                     /translation="MPKHNRGFSFGSKSSKSHRSSTSANRVALTESAEEKQRRNLQTK
                     ADPTLAMSELQPMAVALEKSNLGSLRDMAHKDQYGNVITDPDLSNPTRPRLERPLDTI
                     RSFEVAIDGTYASNNANASRPASFVRNDEPSPGDFSRRTSYFGANAHPSRRGSYNDYN
                     QPNNHYPYHQNTHPPRPRHPRMTSNQPYGTPRNAYAQNGRQNSYQNGYQNGSYDNITA
                     MSGSGSGSGSHSEPYNGTDPSSVNSSIDQLQQQQQMQPQQGKGYGPGYDQPIAQPMAP
                     PAPRHVFGLAPASDPSAGGPVGGQQAAAMGNRRHLRKATNDSEASAGSGKRKSWFKRK
                     FSKS"
     gene            complement(<254298..>255022)
                     /locus_tag="ACHE_70080A"
                     /db_xref="GeneID:66985595"
     mRNA            complement(join(<254298..254429,254489..254614,
                     254688..254757,254824..254854,254920..>255022))
                     /locus_tag="ACHE_70080A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282373.1"
                     /db_xref="GeneID:66985595"
     CDS             complement(join(254298..254429,254489..254614,
                     254688..254757,254824..254854,254920..255022))
                     /locus_tag="ACHE_70080A"
                     /note="COG:S;
                     EggNog:ENOG410PS0S;
                     InterPro:IPR022024;
                     PFAM:PF12223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139759.1"
                     /db_xref="GeneID:66985595"
                     /translation="MGERDNVKTHTHIPSLDSRPHNERNEPIVSHGRGGQGNIAPDPT
                     PYVDAAIVREGPYGDQGDGAYSAGRGGAGNINSQHVPPTTSVPHDAVIVPEPAIVPTS
                     GEGDFHVGRGGQGNVHLDKEHAKEKEEKKEERKRIGMSLLDKVKHLFGFGK"
     gene            complement(<255448..>256782)
                     /locus_tag="ACHE_70081A"
                     /db_xref="GeneID:66985596"
     mRNA            complement(join(<255448..255537,255606..255951,
                     256000..256253,256299..256463,256513..>256782))
                     /locus_tag="ACHE_70081A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282374.1"
                     /db_xref="GeneID:66985596"
     CDS             complement(join(255448..255537,255606..255951,
                     256000..256253,256299..256463,256513..256782))
                     /locus_tag="ACHE_70081A"
                     /note="COG:C;
                     EggNog:ENOG410PFFI;
                     InterPro:IPR018108,IPR023395;
                     PFAM:PF00153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139760.1"
                     /db_xref="GeneID:66985596"
                     /translation="MLPSEDTVNAIFPNPLQNRMQPADPAPTKRQPFPAWSAIEETKK
                     ATNAVTSEASREFDLASQKAQSKTGHIEPWSGKYYAACTFGGLLACGLTHTAVTPLDL
                     IKCRRQVDANLYKGNLEAFSKIRAVEGMRGVFTGWSPTFFGYSAQGAFKYGGYEYFKK
                     FYSDLVGPEKAAQWKTSLYLAASASAELIADVALCPFEAVKVRTQTTIPPDIRGTFTG
                     LADVISKEGYGGLYKGLYPLWGRQIPYTMMKFASFETIVEKIYSYLPGQKSDYNKGAQ
                     TAVAFSGGYLAGILCAVVSHPADVMVSKLNAGRKPGEAFGAAMGRIYKDIGFGGLWNG
                     LFVRIVMVGTLTGLQWMIYDSFKIFMGLPTTGGGQEKQSK"
     gene            <257367..>257979
                     /locus_tag="ACHE_70082S"
                     /db_xref="GeneID:66985597"
     mRNA            join(<257367..257462,257548..>257979)
                     /locus_tag="ACHE_70082S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282376.1"
                     /db_xref="GeneID:66985597"
     CDS             join(257367..257462,257548..257979)
                     /locus_tag="ACHE_70082S"
                     /note="COG:S;
                     EggNog:ENOG410PNSC;
                     InterPro:IPR000644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139761.1"
                     /db_xref="GeneID:66985597"
                     /translation="MASYVASEALAQQQSADTAKVPQGRWADKYRGATVEDLDPPPAL
                     SVSPKDSISSALLAAYERDYTHLTVISSTRSLIGYLSIPHLKKLLQDGTVKESETVSS
                     AMQRFNRKRGIYRVITMETPLEELEEFFETEIGGNGEKREKQGFAVVTDASRKFVLGV
                     ATKADLEEFVKRRPT"
     gene            complement(<258111..>258534)
                     /gene="VMA21"
                     /locus_tag="ACHE_70083A"
                     /db_xref="GeneID:66985598"
     mRNA            complement(join(<258111..258235,258291..258382,
                     258437..>258534))
                     /gene="VMA21"
                     /locus_tag="ACHE_70083A"
                     /product="vacuolar ATPase assembly integral membrane
                     protein vma21"
                     /transcript_id="XM_043282377.1"
                     /db_xref="GeneID:66985598"
     CDS             complement(join(258111..258235,258291..258382,
                     258437..258534))
                     /gene="VMA21"
                     /locus_tag="ACHE_70083A"
                     /note="COG:U;
                     EggNog:ENOG410PS81;
                     InterPro:IPR019013;
                     PFAM:PF09446;
                     TransMembrane:2 (i35-56o68-89i);
                     go_process: GO:0070072 - vacuolar proton-transporting
                     V-type ATPase complex assembly [Evidence IEA]"
                     /codon_start=1
                     /product="vacuolar ATPase assembly integral membrane
                     protein vma21"
                     /protein_id="XP_043139762.1"
                     /db_xref="GeneID:66985598"
                     /translation="MSSRRPEKSYADAVASAPKDAPANSDVTPAVPANVIFKLLGFTL
                     AMVAAPIGMYFLTVNSIFSGNSTWAGVTAAVAANVVLFAYIFVAWQEDQGERAAEGKK
                     AQ"
     gene            <259145..>262525
                     /locus_tag="ACHE_70084S"
                     /db_xref="GeneID:66985599"
     mRNA            <259145..>262525
                     /locus_tag="ACHE_70084S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282378.1"
                     /db_xref="GeneID:66985599"
     CDS             259145..262525
                     /locus_tag="ACHE_70084S"
                     /note="COG:B;
                     EggNog:ENOG410PG2X;
                     InterPro:IPR038718,IPR000330,IPR027417,IPR014001,
                     IPR001650;
                     PFAM:PF00176,PF00271,PF04851;
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139763.1"
                     /db_xref="GeneID:66985599"
                     /translation="MDDSVPGSPVSKKVVRSTPPTDDQPATLPLSDQPQPVTTQKPGE
                     TQPLTPASQRFTTQPTQLVDDPRAVVQVAASSPPGPTSTTTAILSSSPFRPTPQQGGP
                     LSNSLAPAGTQFRPPTSAGPARRAPVVDLDDDGPTYRGGSSDEEEDEENTDIKPAQFT
                     KNSRSPEQIMESPVNNGAGAAPNDRFKQITSSSVYDPNSSHGAKRPASEMGGSMKGMA
                     VKKQRQDGPSRAQPVVAQISSLDEIADYPTRSKVERMMKIMTNKSIQQCFEAMVVRRG
                     IFNDALEYLVAAEEQGGKESDDELSVKASGAAPAKQQIKARGTIQDKWSSMRMPNAIP
                     RPSSPQDDKPRRRLVRGPKNREPSPASPIRSEAIPPKKTGRLVKGRRQPSPARSESPE
                     EPVAMTEDDSDSGVEETQGDSELELKVLRFFNTCQTLELADIAATTEELANAVIAKRP
                     FGSLDEVRIVPAPTAEQTAKPKGSRGRKTPKPIGDKIVDKCLDMWVGYEAVDSLCAKC
                     EELGKPLATEMKKWGVDIYGKKDGDFELTSIDPAASHDSGIGTPASQRSEDDEDGPKS
                     RKGRFIGQPGIMVENLKMKDYQVVGINWLSLLFEKELSCILADDMGLGKTCQVIAFLA
                     HLYEKGIKGPHLVVVPSSTIENWLREFQKFCPTLSVMPYYAGQAERAVIRETIEDNRD
                     SINVIITTYTIAKAKVDASFLRSMDFCACIYDEGHMLKSSTSVLYEKLIRIPAQFKLL
                     LTGTPLQNNLQELASLLGFILPKVFQERKDQLQYIFSNKAKTNESHTTLLSAQRIERA
                     KSMLKPFVLRRKKHQVIDLPAKISRVEWCELNASQKEIYEHEKEEVRKLVADRAAGKK
                     TGSKSANILMKLRQAAIHSLLYRRHYNDSVLKQMSKACLKEPQWSLSDPNVIFEELQP
                     YNDFECHTMCTTYPKSLGKFALKNGEWMDSGKVNKLCELLERFKDDRILVFSQFTMVM
                     DILEHVLENQHVGFVRLDGRTNVEDRQSILDAFHERTDIPVFLLSTKAGGAGINLACA
                     NKVIIFDSSFNPQEDVQAENRAHRVGQTREVEVIRLVTKDTIEEQIYALGQTKLALDQ
                     AVAGDEADSKKGEEAGMKVVEDMVFADMETKDKGEKST"
     gene            <262944..>264695
                     /locus_tag="ACHE_70085S"
                     /db_xref="GeneID:66985600"
     mRNA            join(<262944..263019,263078..263139,263196..263297,
                     263357..263492,263553..263645,263692..>264695)
                     /locus_tag="ACHE_70085S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282379.1"
                     /db_xref="GeneID:66985600"
     CDS             join(262944..263019,263078..263139,263196..263297,
                     263357..263492,263553..263645,263692..264695)
                     /locus_tag="ACHE_70085S"
                     /note="COG:E;
                     EggNog:ENOG410PGFT;
                     InterPro:IPR001948,IPR023358;
                     MEROPS:MER0003374;
                     PFAM:PF02127;
                     go_function: GO:0004177 - aminopeptidase activity
                     [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139764.1"
                     /db_xref="GeneID:66985600"
                     /translation="MTSALAKNLKQPALDFLSFVNASPTSFHAVQSAKELLSKAGFQE
                     IKEKDSWASTCRPGGKYYLTRNHSTIVAFAVGKKWQPGNPISMIGAHTDSPVLRIKPV
                     SNKREAGYVQIGVETYGGGIWHSWFDRDLGVAGRAMVRTGDGSIVQKLLKIDRPILRI
                     PTLAIHLDRQADFSFNKETQLFPIAGLVEAELNRTAGASASAEAESGGFSPLKAITER
                     HHPYLVELIAAEAGVKPADVLDFEMILFDTQKSCLGGLLEEFIFSARLDNLNSSYCAT
                     AGLIDSVADSSALDEETSIRLVALFDHEEIGSRSAQGADSDMLPAVIRRLSVLQASSN
                     NADMSTAYEQTLSSSFLLSADMAHAVHPNYTAKYEADHRPQINKGPVIKVNANARYAT
                     NSPGIVLLQEVARKAAEDGGEGVPLQLFVVRNDSSCGSTIGPMLSALLGARTLDLGNP
                     QLSMHSIRETGGTHDVAHSIRLFSSFFKHYSDVSKNIFVD"
     gene            <265027..>266137
                     /locus_tag="ACHE_70086S"
                     /db_xref="GeneID:66985601"
     mRNA            join(<265027..265235,265294..>266137)
                     /locus_tag="ACHE_70086S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282380.1"
                     /db_xref="GeneID:66985601"
     CDS             join(265027..265235,265294..266137)
                     /locus_tag="ACHE_70086S"
                     /note="COG:S;
                     EggNog:ENOG410PQJQ;
                     InterPro:IPR013715,IPR038967;
                     PFAM:PF08508;
                     TransMembrane:3 (o57-82i102-122o153-172i);
                     go_component: GO:0044695 - Dsc E3 ubiquitin ligase complex
                     [Evidence IEA];
                     go_process: GO:0035103 - sterol regulatory element binding
                     protein cleavage [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139765.1"
                     /db_xref="GeneID:66985601"
                     /translation="MTTPDIYRDAEYITDVFTTPSGASESEYDFGQDARMKKVQATAK
                     VALIDRVLRDLDILIYCELSALYYMDCSILLFLFRAIIQLIFFTPKASPFDPTRNQPY
                     IGAIFSSNIFCMIFHAFFIWPEVDETTRGYLHGGLFIDFIGQKGPVSVGRLISFDLLV
                     MVVDFVMLGLVIERVRTVDSTSESQSQSQSQSGAGAEAEAERQQDHDSEERGVLRDQN
                     RDDGIELDELVRGEHTPSTQTNNPNTTANDIDDERTNLLAEPSSNAHTKPTHPLDIFS
                     SGEYMLMDIGLIDIIRDQWHYSPSSMSSGRSTTTSSARTSRTSRYVPSAETAAFLRER
                     FGLQVSADGSVERIER"
     gene            complement(<266365..>267341)
                     /locus_tag="ACHE_70087A"
                     /db_xref="GeneID:66985602"
     mRNA            complement(join(<266365..266777,266848..266989,
                     267036..267061,267110..267128,267183..>267341))
                     /locus_tag="ACHE_70087A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282381.1"
                     /db_xref="GeneID:66985602"
     CDS             complement(join(266365..266777,266848..266989,
                     267036..267061,267110..267128,267183..267341))
                     /locus_tag="ACHE_70087A"
                     /note="COG:O;
                     EggNog:ENOG410PXHM;
                     InterPro:IPR029045,IPR001907,IPR018215,IPR023562,
                     IPR033135;
                     MEROPS:MER0006046;
                     PFAM:PF00574;
                     go_function: GO:0004176 - ATP-dependent peptidase activity
                     [Evidence IEA];
                     go_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139766.1"
                     /db_xref="GeneID:66985602"
                     /translation="MNTRSLLRLGRVARRSYSPLQTGLLRSFSSSAPSLSSSPPRAWT
                     PTPFVTETVGGGWHTYDIFSRLLKERIICLNGEVDESMSASIVAQLLFLEADNPQKPI
                     HLYINSPGGSVTAGLAIYDTMSYIAAPVSTICVGQAASMGSLLLCGGHPGKRYCLPHS
                     SIMIHQPSGGYFGQATDIAIHAKEILRVREQLNKIYQRHLTGNKKWSLDEIEKLMERD
                     YFMGAQEALDMGIIDEILDRRVKPEEGEGKPPAT"
     gene            <267515..>268654
                     /locus_tag="ACHE_70088S"
                     /db_xref="GeneID:66985603"
     mRNA            <267515..>268654
                     /locus_tag="ACHE_70088S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282382.1"
                     /db_xref="GeneID:66985603"
     CDS             267515..268654
                     /locus_tag="ACHE_70088S"
                     /note="COG:S;
                     EggNog:ENOG410PXT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139767.1"
                     /db_xref="GeneID:66985603"
                     /translation="MECSRQRISYASWRLRVFRHLFVRPTTLSPVPSRRNLSSSKQHL
                     RKNDHDLDNEPSIRPSQLLPKSPLASIPTEKKRKLRAPPERFQELSRNPWAMALASPL
                     RMCTVTGTRVPKAFLGDWGMIRRSDAADPEKLWIMPVGLLKDELSRTLKGPLNFLKLR
                     IVDRLPLLKQLTRPLSRSTGGKKSPLVKLVPQRWKHPFGPMTSREDRLLVWRGDMPDF
                     VFGRLRKDALKKLKRAGDEHEQGKDNNSRVWSIVGLDGESGEALVEALKSVETIERMS
                     SGAVLVMGQTSQTDSQSREIEGPQKLVSNFPDYVTLPQVQSKVPVFDISVLLSESDMR
                     DLRAHDQRFQTKALFLRPDDSTSVDAILALWKLKGFIRHDEQYRP"
     gene            complement(<268734..>270125)
                     /locus_tag="ACHE_70089A"
                     /db_xref="GeneID:66985604"
     mRNA            complement(join(<268734..269497,269547..269615,
                     269726..269747,269841..>270125))
                     /locus_tag="ACHE_70089A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282383.1"
                     /db_xref="GeneID:66985604"
     CDS             complement(join(268734..269497,269547..269615,
                     269726..269747,269841..270125))
                     /locus_tag="ACHE_70089A"
                     /note="COG:P;
                     EggNog:ENOG410PFJB;
                     InterPro:IPR006349,IPR036412,IPR006357,IPR023214;
                     PFAM:PF13242,PF13344;
                     go_function: GO:0016791 - phosphatase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139768.1"
                     /db_xref="GeneID:66985604"
                     /translation="MKSSLLVALRYQAAKPFVFPRSSLLTGQLDSLSTCFWSRPSHQK
                     LAYKFPYLNERKIFKTTRTMAASSEYPAMTTKPRYLTGDKAGLQEFLDKFDVFLFDCD
                     GVLWSGDHLFPGTVETLELLRNNGKQVVFVTNNSTKSRADYKKKLETLGIPSSTEEIF
                     SSSYSSSIYISRILNLPENKRKVFVVGETGIEQELKSENVPFIGGTDPAFLRDVKPED
                     YKRIAAGDPSILDPEVGVVLVGLDFHLNYLKLALAYHYIRRGAVFLATNIDSTLPNSG
                     TLFPGAGSMSAPLIMMLGQEPVSLGKPNQAMMDAIEGKFQFDRSRACMVGDRANTDIR
                     FGLEGKLGGTLAVLTGVSTKEDFVAGPIKPLAYLDKLSDLLEVQS"
     gene            complement(<270363..>271697)
                     /locus_tag="ACHE_70090A"
                     /db_xref="GeneID:66985605"
     mRNA            complement(join(<270363..270527,270583..271389,
                     271443..271521,271579..>271697))
                     /locus_tag="ACHE_70090A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282384.1"
                     /db_xref="GeneID:66985605"
     CDS             complement(join(270363..270527,270583..271389,
                     271443..271521,271579..271697))
                     /locus_tag="ACHE_70090A"
                     /note="COG:L;
                     EggNog:ENOG410PH5Y;
                     InterPro:IPR003959,IPR027417,IPR003593,IPR013748,
                     IPR008921;
                     PFAM:PF13177,PF00004,PF08542;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_process: GO:0006260 - DNA replication [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139769.1"
                     /db_xref="GeneID:66985605"
                     /translation="MAANFFNNKARAAAAAASSSTKQKPTDPREEQLQPWVEKYRPKT
                     LDDVAAQDHTTKVLSRTLNASNLPHMLFYGPPGTGKTSTILALAKSLFGPALYRSRIL
                     ELNASDERGIGIVREKVKGFARTQLVQPTGLDAEYLSKHPCPPFKIIILDEADSMTQD
                     AQSALRRTMEQYSRITRFCLVCNYVTRIIEPLASRCSKFRFKALDNSAAGTRLGYIAE
                     KEGLNLENGVVDRLITCGEGDLRRSITYMQSAARLVGAHRAAGKKDGDEDSEMTDDNS
                     KIITVRMVEEIAGVIPEDVLDSLTQAIQPKKIGSSYGAVSAVITDIVADGWSAAQLLT
                     QFYRRVVYNDAIPDIQKNKIVTAFSEMDKRLADGADEHLSILDLALQISGILGGS"
     gene            complement(<272470..>272694)
                     /locus_tag="ACHE_70091A"
                     /db_xref="GeneID:66985606"
     mRNA            complement(<272470..>272694)
                     /locus_tag="ACHE_70091A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282385.1"
                     /db_xref="GeneID:66985606"
     CDS             complement(272470..272694)
                     /locus_tag="ACHE_70091A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139770.1"
                     /db_xref="GeneID:66985606"
                     /translation="MSRRKRSPCSTGSTLSPQPRKAAEAELDTSAYKPNTVDANMRDK
                     FIALGQDKCHFIYQLCLATGAKTIVEAGTS"
     gene            <273016..>274728
                     /locus_tag="ACHE_70092S"
                     /db_xref="GeneID:66985607"
     mRNA            <273016..>274728
                     /locus_tag="ACHE_70092S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282387.1"
                     /db_xref="GeneID:66985607"
     CDS             273016..274728
                     /locus_tag="ACHE_70092S"
                     /note="COG:K;
                     EggNog:ENOG410PZEQ;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139771.1"
                     /db_xref="GeneID:66985607"
                     /translation="MVQTTGQLKRKRARVACEPCRERKRKCDGENPCDTCSNWGYECY
                     YQSSRNSKYRALVSSAESSSSGAPPSGSGVSAASTEHNRSINPHGVVRSLSANSGAAF
                     VRKMGLKVDPANAPRLNLFGWNVGARQLSSGLATAACLPIVDIVALGDMVHLAHIYFN
                     KVDPCYGFIDKQVFFDHLNTRWRSNSGSSIYDSVLAGVAALGLLFSERKVKVTELHLM
                     ESARFILESYDGSTAPSVDLVTGWMLRVIYMRMTAPPYSTWLASSTLMHLIEAAGLHH
                     EAPDGMSLSDAKCDPDIRRRLVGVAQHQNMWPSYDLGLSRVSLKVDLSLPLSPRPGDY
                     TAELLGLLPISTSLDPEETQDDCDLQWSLVQTLDRVHTQPPSVLAQTNLVLCMLRRLH
                     LLNINTSPAIADRVLDLIQRALRSARSMLTNCCPWQHVANVPFHIITILLEMDTFASL
                     AQLPEAMQTLKLVASTYNTATMREAYATARLLVFLYQQRRCHDARLLGNVLDVDSQQE
                     PGSAGSKAQMPRVSPNSEEMPLLEELVADMPSLQGFDFDQFLNMDMLRSAQGMDVGSL
                     GEDG"
     gene            <274952..>276037
                     /locus_tag="ACHE_70093S"
                     /db_xref="GeneID:66985608"
     mRNA            <274952..>276037
                     /locus_tag="ACHE_70093S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282388.1"
                     /db_xref="GeneID:66985608"
     CDS             274952..276037
                     /locus_tag="ACHE_70093S"
                     /note="COG:C;
                     EggNog:ENOG410PM0S;
                     InterPro:IPR013785,IPR004136;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0018580 - nitronate monooxygenase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139772.1"
                     /db_xref="GeneID:66985608"
                     /translation="MSRSVQLAKKLSSLYPWATNPMIIGAPMRVMSGPALAVAVSRAG
                     GLGFIGPGAKTQDMLADLEEASSLIEKEKTLRAATTSSPALPVGVGFQLWSDDIDTAV
                     SAIQKFKPCAAWLYAPRKGQIDLDQWSRRIRNVSPRTQIWVQIGTIAEAQGLIGSSEH
                     PDVIVVQGAEAGGHGRCKDGLGLISLLPEVSDALAKKGSQIPLVAAGGIADGRGATAA
                     FCLGASGIAMGTRFLAATEARISRGYQQEVVRASDGAVSTTRTLLYNHLRGTYGWPEE
                     YSPRTIINQSFIEHQAGKAFEELKELHDQALNIGDSGWGPEGRLATYAGASIGLIHGV
                     LDAGTIVTDIRRYIAEETGSSKKEPKL"
     gene            complement(<276233..>278348)
                     /locus_tag="ACHE_70094A"
                     /db_xref="GeneID:66985609"
     mRNA            complement(join(<276233..276515,276575..276998,
                     277053..277474,277525..277813,277868..>278348))
                     /locus_tag="ACHE_70094A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282389.1"
                     /db_xref="GeneID:66985609"
     CDS             complement(join(276233..276515,276575..276998,
                     277053..277474,277525..277813,277868..278348))
                     /locus_tag="ACHE_70094A"
                     /note="COG:C;
                     EggNog:ENOG410PGND;
                     InterPro:IPR039556,IPR006254,IPR040442,IPR015813;
                     PFAM:PF00463,PF13714;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004451 - isocitrate lyase activity
                     [Evidence IEA];
                     go_process: GO:0019752 - carboxylic acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139773.1"
                     /db_xref="GeneID:66985609"
                     /translation="MRHYQLTDCEDDIVDIVLRIKHGNFTCSEMSFRMSTRLLARYLT
                     CSSTTAIRTFATHSPRMLLKPAEPPLSTNLPRDAFQLLSTAEKAGTFEDALYEQQIRD
                     VKAWWASERFDGVKRPYSAADIVTKRGSLQQIYPSSLMARKLLDLLNERAAEGLPLHT
                     MGTIDPVQMTQQAQHQEALYVSGWACSSLLTSTNEVSPDMGDYPYNTVPNQVQRLMNA
                     QKMHDRKQWDERRQLTSDQRRNTPYVDFLRPILADGDTGHGGITAVMKLAKLFAEYGA
                     AAVHFEDQLQGGKQCGHLSGKVLVPMREHIKRLVAARFQWDMMGTENLLIARTDSQSG
                     SLISSTVDGRDHEFILGVMMNEGEVEPLAETLQEMERQGAAPVEIDAFEADWIHAHRL
                     VTFDEAANAHFETQGTSPAIRQEYHRQVQESPDISLSQRQKLAEGCAKSPVKWSCDIP
                     RTREGYYHYRAGLPAAIKRAREYAPYADLLWVETSSPSLDEAAQVASNVHAVYPGKKL
                     VYNLSPSFNWLGQGFTDESLKSFVWDLAKLGFVLQLVSLAGLHSTATITTELSRAFKD
                     EGMLAYVRLIQAREKELGVEVLTHQKWSGATYMDGILGAIQSGSSSNRGMGEGNTEAG
                     ELSTWYSD"
     gene            <278598..>280062
                     /locus_tag="ACHE_70095S"
                     /db_xref="GeneID:66985610"
     mRNA            join(<278598..278827,278888..279874,279927..>280062)
                     /locus_tag="ACHE_70095S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282390.1"
                     /db_xref="GeneID:66985610"
     CDS             join(278598..278827,278888..279874,279927..280062)
                     /locus_tag="ACHE_70095S"
                     /note="COG:G;
                     EggNog:ENOG410Q1TP;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:10
                     (i78-103o115-133i145-163o169-192i204-223o235-255i306-
                     326o346-367i388-409o421-444i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139774.1"
                     /db_xref="GeneID:66985610"
                     /translation="MESSKSSRTGQIDHEHNGLDTSELGQAYGSVGKHQGALSMGAGK
                     PIPPPLPDSKEYIVEFDGPDDPVHPLNWSFTVKLYISSIACLGTFTASFTSAIFAPGT
                     VGASKAFGVSSEVGTLGTTLYVLGFACGPLIWAPASELVGRRWPLTIGMLGGAVFTIA
                     TAVAKDIQTLIICRFFAGMFGASQLSVVPAVLSDIHNNIDRGIAIALYSLTVFVGPFS
                     APFIGGFISTSSLGWRWTLYIPAFMGFASGSLFIFSLRETYAPVLLMSKAAAMRRQTL
                     NWGIHTKQDELELDFGELLRKYFTRPLQMLVTEPTILLISLYMSFIYGIVYALLEAYP
                     YVFETVYDMSPGIAGLAFIGLIIGQVLACGFILSQHSVYAKMLAANNNVPVPEWRLLP
                     ATIGAPVFTVGIFWFGWTGFTASIHWMAPIAAGIFIGFGVLCIFLPCFNYLVDSYLPL
                     "
     gene            complement(<281564..>282830)
                     /locus_tag="ACHE_70096A"
                     /db_xref="GeneID:66985611"
     mRNA            complement(join(<281564..282150,282200..282447,
                     282520..>282830))
                     /locus_tag="ACHE_70096A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282391.1"
                     /db_xref="GeneID:66985611"
     CDS             complement(join(281564..282150,282200..282447,
                     282520..282830))
                     /locus_tag="ACHE_70096A"
                     /note="COG:U;
                     EggNog:ENOG410PMMI;
                     InterPro:IPR005606;
                     PFAM:PF03908;
                     TransMembrane:2 (i226-244o256-276i);
                     go_function: GO:0005484 - SNAP receptor activity [Evidence
                     IEA];
                     go_process: GO:0006890 - retrograde vesicle-mediated
                     transport, Golgi to endoplasmic reticulum [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139775.1"
                     /db_xref="GeneID:66985611"
                     /translation="MSPTTLHSRLKDLSASLGQIHPLVNRLRNFTTAVGQGDEARLEL
                     GTEIHTLLKEAEEQMELLRVEVEALESSMENRRKGLDSEKEAEKERVVVLAGRLAEDL
                     KRTRGDFRNAQLQAKRNAELAKRKERELLFSRSQSSEARKQPSEKLTQDDLMVNASND
                     VTLALKRTHQLMQAELSRSHFAQQTLEQSTAAISSLSESYTSLDTLLSSSRKLANSLL
                     RSQKSDTWYLETAFYIIVGTIAWLLFRRILYGPLWWLVWLPFRLMFRTVFAILGIVGI
                     TSKAVQSSQAVDAVTVQQTPALAHEAQRAVPEGDAGDTAWEREAAREETDQDRMIDKV
                     GRMVEEGDKQEGTNIDDISPEERKQRDDIPRNPKKRMYEEESVKDEL"
     gene            <283381..>283812
                     /locus_tag="ACHE_70097S"
                     /db_xref="GeneID:66985612"
     mRNA            <283381..>283812
                     /locus_tag="ACHE_70097S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282392.1"
                     /db_xref="GeneID:66985612"
     CDS             283381..283812
                     /locus_tag="ACHE_70097S"
                     /note="COG:S;
                     EggNog:ENOG410Q26N;
                     InterPro:IPR019716;
                     PFAM:PF10780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139776.1"
                     /db_xref="GeneID:66985612"
                     /translation="MRTVEANFRTTDLIYLIYRPRLPNHLRKHQPTTTITKMSVPVRT
                     ITSFRTTFNPFSPVSRPCRLFLNLIRQPSTIPASSPNHIDIKVTQLPRTSKQLPEMTI
                     GFKGGKEVKLEVGKRQMKIGDVIEEVARVGRIIEREETLKG"
     gene            complement(<284210..>285664)
                     /gene="IPP1"
                     /locus_tag="ACHE_70098A"
                     /db_xref="GeneID:66985613"
     mRNA            complement(join(<284210..284351,284410..284493,
                     284552..284895,284959..285078,285164..>285664))
                     /gene="IPP1"
                     /locus_tag="ACHE_70098A"
                     /product="inorganic pyrophosphatase"
                     /transcript_id="XM_043282393.1"
                     /db_xref="GeneID:66985613"
     CDS             complement(join(284210..284351,284410..284493,
                     284552..284895,284959..285078,285164..285664))
                     /gene="IPP1"
                     /locus_tag="ACHE_70098A"
                     /note="COG:C;
                     EggNog:ENOG410PFM5;
                     InterPro:IPR008162,IPR036649;
                     PFAM:PF00719;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0004427 - inorganic diphosphatase activity
                     [Evidence IEA];
                     go_process: GO:0006796 - phosphate-containing compound
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="inorganic pyrophosphatase"
                     /protein_id="XP_043139777.1"
                     /db_xref="GeneID:66985613"
                     /translation="MLLSAPFAQQPWRIVASPTPLTRLPTAFRSWSFRSPVRRTSATV
                     APPTKHDAPPLSSSSSSLLPSHLSASFPSPSRINTKVSSASDRATLVSRHISSTSTLP
                     QQPQNTMSYTVRKIGQPNTLEHRVYIEKDGVPVSPFHDIPLYANEQQNILNMIVEIPR
                     WTNAKQEISKEEFLNPIKQDVKKGKLRYVRNCFPHKGYLWNYGAFPQTWEDPHNVHPE
                     TKAKGDNDPLDVCEIGEVVGYPGQVKQVKVLGVMALLDEEETDWKIIVVDINDPLAAK
                     LNDVEDVERQLPGLLRATNEWFRIYKIPDGKPENQFAFSGECKNKKYALDVIRECADA
                     WEKLVSGKTPKGDISLANSTVESSSDRVDQGALASIPKGQDLPPAPIDSTVDKWFFIS
                     GAAV"
     gene            complement(<286564..>291318)
                     /locus_tag="ACHE_70099A"
                     /db_xref="GeneID:66985614"
     mRNA            complement(<286564..>291318)
                     /locus_tag="ACHE_70099A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282394.1"
                     /db_xref="GeneID:66985614"
     CDS             complement(286564..291318)
                     /locus_tag="ACHE_70099A"
                     /note="COG:S;
                     EggNog:ENOG410QDZ4;
                     InterPro:IPR012337,IPR036397,IPR013103,IPR001584,
                     IPR043502;
                     PFAM:PF07727;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139778.1"
                     /db_xref="GeneID:66985614"
                     /translation="MESNSVVSAMKGDKLKDSPQWRNWFARVKLFARQKKVWDLVNPQ
                     IEEDYLEQPMRKPKRPQYPEGGSESVKREWRDRLDIYKLDLAEWEQQAKGLDAVNEWI
                     ITNLDPIHHASLLDYETPYERLVYLTTRFARSNAYEEDIRAQWKWFSSSPPRKGVDIN
                     HWLADWNTLREQAVSLDLPEVKSANKDFLRAVKDVLPTWWQAKYESIIMNHEDWETRD
                     LIENFRGFYQEMVPQKPTSTISKASFSTFQDFEEAETDQLQKPPQKQGNKPPIPKRWC
                     PCGNRGHKPWLCYIINEAIRPQGWTVQKAKKQKVDKALKDDPQWKDWIETKVKENNER
                     QQKEEKPNESANSALPSQISFFTSTDIAALNSAPESFQDLRSRWILDNASSMHVCNDR
                     SRFVTYTSTSSSLKTGDSTTRVEGLGTVKLQGVDPTTGKEKAITLSNALYSPGFHTNL
                     VSYGALKKKGGRWDEDGDCIRDPNGTPVVSLKPIDSLNLWAFDIPYTAAGHAHAVRKS
                     EQPLVAEAPAEIWHRRLGHVAPQVIQKAADMVDGVKIKGELPDSTAPESTETSICEVC
                     KLSHAPRQISRRPIGQTFGWCGRIHFDLVQFSPGYNGHQWMTHFYVEGIRFHWLYTHT
                     FKSECREAVRKFIALVKNWWNLPIRAFHYDNEQSAGDNVEAFLNNCGIIVSHSIVGHP
                     EQNGPAERSGGVILEMARHLRIEGGQLPKQLWPEFVSAAAWILNRIPTYLKDEKRWIV
                     PWEEARHEFAGDRMKKTSLANLRVYGALSYCRIRSIPCKEKTHPRAEIGFLVGYIASN
                     IWKIWFPARGKVEVVRDAFFDESRKWKPDMQYWQDVDLPTQEPVILTEYQQLDAIRQD
                     LSMPASVLPLEEDQNRNRTDDQHEEPVDSQKVQIPKEDEIIAQESATPEKRYEAQETM
                     PQASPQDTLPGAFPTEEQVPLPPTPPYEALQNTLQETDLSPVTAQGVEDQLEHQTQEL
                     DNQEQTPELQVNEEEEQLSDSEQQLQQELQAPRSGDDGIDISNIISGGRRRKAREDHE
                     YVAYATTETEDPPELLRAFAAALYTEKPIQRHRDDLPPPPENWKEMLKHPHAEGFMEA
                     CAREIHTLTEKSTFTIIEKPKDVSKQVLPLRWVFAYKFNQDGYLVKLKARICARGDLE
                     MISPEEKRAATLAARTARMIFALVAAFNLDLRQRDAVGAFLNSKLLKEIYTQMPQGFE
                     QPRKCWKLNRALYGLRISPKLWQQEASKVLTKLGLKVVPEDPCVFVKEGIIVFFYVDD
                     ILIANHPSVRNQARQLERDLEAHWELTDHGEAEWFLNIRILRDRQQHKLWLCQDTYIS
                     SVAMRYHLTHRAPVYTPLPVEELMPYEGTASAEDIKLYQQKVGSSQYATTITRPDAAK
                     AAAKLSQFLMNPGPQHQNAVDRVICYLYTTRFRAIEFGIGSGLESIEFASDASYGDNP
                     DRKSSAGYICQVYGGPVDWKASKQPTVTTSTTEAELLGLSETARSLQWWKRFVSRIQF
                     NPDHTISIRCDNRQTVELLTSEQAKISTKLRHVDIHGHWLRQEVREGRIKVIWVPTGQ
                     MVADGLTKLLPRQKHEHFVKMLRMADISHMID"
     gene            <291709..>292863
                     /locus_tag="ACHE_70100S"
                     /db_xref="GeneID:66985615"
     mRNA            <291709..>292863
                     /locus_tag="ACHE_70100S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282395.1"
                     /db_xref="GeneID:66985615"
     CDS             291709..292863
                     /locus_tag="ACHE_70100S"
                     /note="BUSCO:EOG092628FW;
                     COG:J;
                     EggNog:ENOG410PH64;
                     InterPro:IPR001269,IPR018517,IPR035587,IPR013785;
                     PFAM:PF01207;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0017150 - tRNA dihydrouridine synthase
                     activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0008033 - tRNA processing [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139779.1"
                     /db_xref="GeneID:66985615"
                     /translation="MLRFLRSAMTAMTTARVPIPANGVDYRGKIVLAPMVRSGELPSR
                     LLALKYGADLVWGPETVDRALIGTSRRVNPRNGIIEFTRGQGSIIYRIDPVREKGKLV
                     FQIGTASPELAVEAAKLVAADVNGIDVNSGCPKPFSTSGGMGAALLRNPDKLVSILTA
                     LVDEVGKPFQIGVSVKIRILETPEETKALVSRLVKTGITGLTVHCRTTPMRPRERAIR
                     DQLRMVADVCHEAGVACVMNGDVTTRNEGLELMKEYGVDGAMIATSAEANSSCFRPEG
                     GLLPWKDVVHAYLRFCMETENRFGNTKYLLNMLIPSKEFHHSKSSKSYYDFCHVLGFD
                     DLVPAALQVDEIMNLTHKSIFKNSAASQNQEPEGVDFSLPSQPTKQAVAV"
     gene            complement(<296398..>298009)
                     /locus_tag="ACHE_70101A"
                     /db_xref="GeneID:66985616"
     mRNA            complement(join(<296398..296855,296911..297096,
                     297155..297595,297658..297859,297920..>298009))
                     /locus_tag="ACHE_70101A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282396.1"
                     /db_xref="GeneID:66985616"
     CDS             complement(join(296398..296855,296911..297096,
                     297155..297595,297658..297859,297920..298009))
                     /locus_tag="ACHE_70101A"
                     /note="COG:S;
                     EggNog:ENOG410PSMP;
                     InterPro:IPR021264;
                     PFAM:PF11001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139780.1"
                     /db_xref="GeneID:66985616"
                     /translation="MNPAFAAVTTGPEMPHQSLSYDDGMASRSTQIATTQQTMLNIPY
                     SHYAILYMDGDGKLGVEVSPSIEGSEKAIFTQDVRGRFLRSVTGGPYGLQGYSNPIMQ
                     TQDGILPSSTSLAWYHHSRTKRDGLIPCEWQSQRSKRQRRRDSDSASASPCPTIRRTA
                     LRVGDHDLLRRYYEKAFDNFQQLNCRMIAKAWIKLVEPRKQVNHPYNGRKNVGGTSQR
                     VDPELTKPRWWPTGVTHKEPDHLPKPERVRLLIHILCELRASHDITAEKLKEAGQDVR
                     RQISPAERLEVLDEIYYIRQMEEHYLAGDIGSDTILHVSHVHLPEASFEFDQHDFQST
                     DHHDTLSSIPTTLPKVPAMRGTSDDGSPEYCLPLTPSSSCPSNGPRSPAQTHPSYSPE
                     MVSSMMSTGAHASAAYVTSKDESQPGSCMPDYFSQPFLVPTTAPSTQAGYWGHPAQTH
                     APVYPTGY"
     gene            302991..303063
                     /locus_tag="ACHE_t70001S"
                     /db_xref="GeneID:66987445"
     tRNA            302991..303063
                     /locus_tag="ACHE_t70001S"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:66987445"
     gene            complement(<303308..>307404)
                     /gene="SMC1"
                     /locus_tag="ACHE_70102A"
                     /db_xref="GeneID:66985617"
     mRNA            complement(join(<303308..303325,303392..303758,
                     303814..304121,304178..307163,307227..307320,
                     307374..>307404))
                     /gene="SMC1"
                     /locus_tag="ACHE_70102A"
                     /product="structural maintenance of chromosomes protein 1"
                     /transcript_id="XM_043282398.1"
                     /db_xref="GeneID:66985617"
     CDS             complement(join(303308..303325,303392..303758,
                     303814..304121,304178..307163,307227..307320,
                     307374..307404))
                     /gene="SMC1"
                     /locus_tag="ACHE_70102A"
                     /note="BUSCO:EOG092606CY;
                     COG:D;
                     EggNog:ENOG410PH43;
                     InterPro:IPR010935,IPR003395,IPR027417,IPR036277,
                     IPR028468,IPR024704;
                     PFAM:PF06470,PF13555,PF02463;
                     go_component: GO:0005694 - chromosome [Evidence IEA];
                     go_component: GO:0008278 - cohesin complex [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0007064 - mitotic sister chromatid cohesion
                     [Evidence IEA];
                     go_process: GO:0051276 - chromosome organization [Evidence
                     IEA]"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein 1"
                     /protein_id="XP_043139781.1"
                     /db_xref="GeneID:66985617"
                     /translation="MGKLIRLELFNFKSYKGHHVLLFGDAYFTSIIGPNGSGKSNSMD
                     AISFVLGIKSSHLRSTNLRDLVYRGRVLRTAKLDAEGNAIEQPTNGEDKAEDGVDRIE
                     SQDPNASQDPNGTQDPRTAWVMAVYEDDAGEEQQWRRSITSHGVSEYRINNQVVTAQQ
                     YNEALEAENILIKARNFLVFQGDVEAIAAQSPRDLTRLIEQISGSLEYKAEYEKLKVE
                     AEEAAEQQTVQLHRRRGINSEIKQYQEQKREADSYARKAEERDQAIITHILWKLFHFQ
                     RLIDDSSEEIQKYQDELKEYRRGVEKYEKNVEDAKKDHAKVGRDVAKAEKNITNKEKQ
                     IEEANTSLVPVDEKVDITVKKVERFASRIAEIGKEREAQLANTRQLEKDLKVVEKAQA
                     QWGAEWQRSMSKQGIQLSDADQQEYNKLKEELNKRSSAEQLNLDNLRRQRKTEAEAVN
                     SLKSKFEGTEWQLQSLRSDKQSLEERQESITEVITTASKDIERKKKELNTLTSERLRV
                     SQMRTELEEKLQVVLKKLLEADDGRKQSEKEIRTRELISTLKRIFPGVKGRVSDLCRP
                     KQKKYNEAVSTVLGRHFDAIIVDNEKTAKECIQHLRDQRAGQATFIPLETIQVKAFNS
                     NLKGVHRGMRPAIETVDYEDSVARAITYACGNAVVCDDLATAKYLCYERNLDAKTVTL
                     DGTVIHKGGLMTGGRGPQQSSKRWEDSEVENLHKLKDKLMADLSSLPKGHRRGTEEET
                     LQGELVGLEQRLAYARDELKALEKNLKSKHSELDFVKRQLEDLRPKYAERKETLDELD
                     QSITETQESVSGVEDDIYRKFCKRLGYDNIREYEAQQGSLQEEASQKKLEFTTQKSRI
                     ENQLSFEKQRLQATVDRISSLQTQHQRDEGLIEELKAEQQNIRNQLDEFEAELEILRE
                     RLGEQKEAYGQSAENLNQQRRELQKRSKNVEGSLKNISGLEAEVQRNSSSRYALLRRC
                     KLEDIDIPLTESSNSLDHLPIDELVQTADPDAMDVDEDANGSGQAMVQDYGVEVDFDS
                     LGDSLKEESDEKLEEELLEKVRSLNSELDKMAPNTRALERLESVENKLRGTEKDFEES
                     RKHARKAKDDFEEVMRKRSDLFNKAFTHISEQIGPIYRELTRSSNYPLGGQAYLDIED
                     SDEPYLDGIKYHAMPPLKRFRDMEHLSGGEKTMAALALLFAIHSYQPSPFFVLDEVDA
                     ALDNTNVARIANYIHDHAAPGMQFIVISLKTGLFQNSETLVGIYRDQAENSSKSLTLD
                     LRKYQ"
     gene            complement(<307813..>308691)
                     /locus_tag="ACHE_70103A"
                     /db_xref="GeneID:66985618"
     mRNA            complement(<307813..>308691)
                     /locus_tag="ACHE_70103A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282399.1"
                     /db_xref="GeneID:66985618"
     CDS             complement(307813..308691)
                     /locus_tag="ACHE_70103A"
                     /note="COG:S;
                     EggNog:ENOG410PU6K;
                     TransMembrane:2 (i97-114o134-152i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139782.1"
                     /db_xref="GeneID:66985618"
                     /translation="MFPRCFAFQRLSQQYPRFSRLPRVQDTASPPTWRYFSSSIPRAK
                     TAVKPQPQPRKVANSEETLKFAGRRPEGFGKLERKVAREGNVILFNAPSHRSYIFGAY
                     SLAAFCFAYSVYNSNMIFRDPIAIGIPIWQQTLFGGVCIAMSVMGTVFLTKTGRLIKS
                     VNAVSANGQTHIRFTVRSMMPFKKAYEFDALPRQIAFSRRLVVTPGSVNRTQQPEAPR
                     NTKPSEIEILKAPAKKISVMIWTIFANVRKLFTQEGVILLEVEGQKGVFRMDSAGFVS
                     EDFLMIGNPLDIKRRP"
     gene            <309207..>310164
                     /gene="PDX1"
                     /locus_tag="ACHE_70104S"
                     /db_xref="GeneID:66985619"
     mRNA            join(<309207..309291,309377..>310164)
                     /gene="PDX1"
                     /locus_tag="ACHE_70104S"
                     /product="pyridoxine biosynthesis protein"
                     /transcript_id="XM_043282400.1"
                     /db_xref="GeneID:66985619"
     CDS             join(309207..309291,309377..310164)
                     /gene="PDX1"
                     /locus_tag="ACHE_70104S"
                     /note="COG:C;
                     EggNog:ENOG410PKBH;
                     InterPro:IPR036625,IPR004167;
                     PFAM:PF02817;
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="pyridoxine biosynthesis protein"
                     /protein_id="XP_043139783.1"
                     /db_xref="GeneID:66985619"
                     /translation="MASNFPARQIPAMFARRQQPTRVHSAARRFASTTVQTQNPAYPL
                     YPSVTQLLHEKGIPDSEISKIPASGPKGRLLKGDVLAYLGSIPADYPSTQAARIDKLA
                     HLDLSNIKIAAPPAPKPEPVPEKMEAPAPPPTTSVALSISLSAVLSVQRKIKESLGIT
                     VPLSEFLARATDLANEELPRSAAQKPSADELFDEILGGEPVTTSRGDYIPELNEVDAP
                     VARAQPVQEDLIDFLAGKVSKKSSSSRVVSPVEEPAANVFSLTVPVSEEKRAKAFLDR
                     VETLLTVEPGRLVI"
     gene            complement(<310987..>312974)
                     /gene="CDH1"
                     /locus_tag="ACHE_70105A"
                     /db_xref="GeneID:66985620"
     mRNA            complement(join(<310987..311751,311809..312383,
                     312442..312569,312664..>312974))
                     /gene="CDH1"
                     /locus_tag="ACHE_70105A"
                     /product="substrate-specific activator of APC-dependent
                     proteolysis"
                     /transcript_id="XM_043282401.1"
                     /db_xref="GeneID:66985620"
     CDS             complement(join(310987..311751,311809..312383,
                     312442..312569,312664..312974))
                     /gene="CDH1"
                     /locus_tag="ACHE_70105A"
                     /note="COG:D;
                     EggNog:ENOG410QD8S;
                     InterPro:IPR036322,IPR015943,IPR019775,IPR001680,
                     IPR033010,IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0010997 - anaphase-promoting complex
                     binding [Evidence IEA];
                     go_function: GO:0097027 - ubiquitin-protein transferase
                     activator activity [Evidence IEA];
                     go_process: GO:1904668 - positive regulation of ubiquitin
                     protein ligase activity [Evidence IEA]"
                     /codon_start=1
                     /product="substrate-specific activator of APC-dependent
                     proteolysis"
                     /protein_id="XP_043139784.1"
                     /db_xref="GeneID:66985620"
                     /translation="MGGNKKDSETVAARSNGKSTRTGTNALNIASPPGSRTPPSMPSK
                     KMLFFPETMSGRKKSQTGQDLIDPDALAKALRDYEDAGNRRERTPGTSPSRKRQRVYG
                     DRFIPNRDGQDFQATYSLLHEDGCPSTPSKTKKRTPHSELHFQKTEEANRMYSRVLRS
                     ELFGNTVPQPDLDSLAADPLSGTNDKTRSHTPPSHVVSNLPPASITPSTPHKNLFTYA
                     SPRVGSNQQTPSKTPRSHHAPNLNVRSELYSLSPIRYDSQRILETPRKQPRYVNKVPY
                     KVLDAPDLQDDFYLNLVDWGSSNVLGVGLGNSVYMWNSHSGQVTKLCELKDDTVTSVN
                     WIQRGTHLSIGTGKGLVQIWDAEHCRRLRTMIGHTNRVGALAWNDHILTSGSRDKIIF
                     HRDVRSPDQHIRRLAGHKQEVCGLKWNTEDGQLASGGNDNKLMVWDKLNETPLYRFSD
                     HVAAVKAISWSPHQHHLLASGGGTADRTIKFWNTSTGSMIKEVDTGSQVCNLSWSKNS
                     DEIISTHGYSQNQIVIWKYPRMEQVVSLTGHTFRVLYLAMSPDGQTVVTGAGDETLRF
                     WKIFNKRPGREHGREGSKLAEMGTIR"
     gene            complement(<318840..>320794)
                     /locus_tag="ACHE_70106A"
                     /db_xref="GeneID:66985621"
     mRNA            complement(join(<318840..318908,318965..319124,
                     319187..319290,319344..319626,319697..320125,
                     320196..>320794))
                     /locus_tag="ACHE_70106A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282402.1"
                     /db_xref="GeneID:66985621"
     CDS             complement(join(318840..318908,318965..319124,
                     319187..319290,319344..319626,319697..320125,
                     320196..320794))
                     /locus_tag="ACHE_70106A"
                     /note="COG:I;
                     EggNog:ENOG410Q1Y8;
                     InterPro:IPR000873,IPR020845,IPR042099,IPR025110;
                     PFAM:PF00501,PF13193;
                     TransMembrane:1 (i81-103o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139785.1"
                     /db_xref="GeneID:66985621"
                     /translation="MADIITGPTIPIPETDYLSYVFNGPYDEKKAWPSTEPILVSTEE
                     SDPSYTINDIKDFVKRLGCGLHHIGARRKRVMLYGEANIHFFLALLGVMAAGSACAVI
                     PPSSVHHIAFYLRQMEAEFILCGPNDIPRARDAAHQVGIPPEHIFVVDRSASDIGSTN
                     EQKVRHWSWLLNIPGGSEYVWPRLGEESKEAEAILLCTSGTTGNPKLAVRTHHNLIAN
                     VESLLYNRSRHLKDSKDIFCAFKFYGAGFITHAMLLPLKARSRTIFMPKFDLHIWLRA
                     VLQFRPTLLMIPKHVLNELMMYKDEDKPDLSSVKFVVTGAATISSTLRKAWAEKYGHP
                     LFSVLGMTELGFVTGEEFDVPLTSDTVGKLLPNVQAKIVDSNGQSLKPGQQGELWYLY
                     PGIMKCYCNEPEKTALTVTEDGWLKSGDICSVDKEGYLYVVGRYKDMFKLNGSDISGA
                     QIEGGLILHPDVKEASVVPVTLPGEEEPAPYGFIVKKPGSNLTVDEFVQWMAQELTAN
                     MKLYGGVSFINALPLSTSGNSKTDQQALKQMAQEAVDSR"
     gene            336007..336079
                     /locus_tag="ACHE_t70002S"
                     /db_xref="GeneID:66987446"
     tRNA            336007..336079
                     /locus_tag="ACHE_t70002S"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:66987446"
     gene            <338911..>340090
                     /gene="ADH1_2"
                     /locus_tag="ACHE_70107S"
                     /db_xref="GeneID:66985622"
     mRNA            join(<338911..339561,339624..339978,340044..>340090)
                     /gene="ADH1_2"
                     /locus_tag="ACHE_70107S"
                     /product="alcohol dehydrogenase"
                     /transcript_id="XM_043282403.1"
                     /db_xref="GeneID:66985622"
     CDS             join(338911..339561,339624..339978,340044..340090)
                     /gene="ADH1_2"
                     /locus_tag="ACHE_70107S"
                     /note="COG:Q;
                     EggNog:ENOG410PH61;
                     InterPro:IPR013154,IPR013149,IPR002328,IPR036291,
                     IPR011032,IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="alcohol dehydrogenase"
                     /protein_id="XP_043139786.1"
                     /db_xref="GeneID:66985622"
                     /translation="MWIPEMQWAQVAEKAGGPLVYKQIPVPKPGPDEILVKIRYSGVC
                     HTDLHAMKGDWPLPVKMPLVGGHEGAGHVVAKGELVHGFNIGDAAGIKWLNGSCLSCE
                     FCMQTDESQCEQCSLSGYTVDGTFQQYTVGKAAHASKLSPNTPLDAVAPVLCAGITVY
                     KGLKESGVRSGQTVAIVGAGGGLGSLAVQYAKAMGICVVAIDGGDEKRAMCEQLGASA
                     FVDFTKSKDVVADVRDATPGGRGAHAVILLAVSEKPFQQATEYVRSRGSVVAIGLPAG
                     AFLKAPVLSTVIRMISIKGSYVGNRQDGVEAIEFFERGLIKAPFKKASLKDLPHIFEL
                     MEQGKIAGRYVLEIPE"
     gene            <341218..>342885
                     /gene="ALD5_3"
                     /locus_tag="ACHE_70108S"
                     /db_xref="GeneID:66985623"
     mRNA            join(<341218..341276,341337..342538,342592..342661,
                     342735..>342885)
                     /gene="ALD5_3"
                     /locus_tag="ACHE_70108S"
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ald5"
                     /transcript_id="XM_043282404.1"
                     /db_xref="GeneID:66985623"
     CDS             join(341218..341276,341337..342538,342592..342661,
                     342735..342885)
                     /gene="ALD5_3"
                     /locus_tag="ACHE_70108S"
                     /note="COG:C;
                     EggNog:ENOG410PFKN;
                     InterPro:IPR015590,IPR029510,IPR016160,IPR016161,
                     IPR016162,IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ald5"
                     /protein_id="XP_043139787.1"
                     /db_xref="GeneID:66985623"
                     /translation="MALYQTIKTAALTYEQPTGLFINNEFVPGVEGKTFQTINPHDEK
                     PIVAVHEGNERDVDIAVQAARSALDGEWKQITPSKRGQLLTRLSELLERETETLAVIE
                     AIDNGKGVGMARGDVAASAGCIRYYGGWADKIYGQTIDTDSASLTYTRHEPVGVCGQV
                     IPWNFPLLMWAWKIGPAIATGNTVVLKSAEQTPLSALYAAKLVKEAGFPPGVINIISG
                     FGKTAGAAIAAHMDIDKVAFTGSTMVGRQILQTAAKSNLKKVTLELGGKSPNIVFPDA
                     DLEDAITWVNFGIYFNHGQCCCAGSRVLVHESVYDQFLEKFGQRARQNKVGNPMSSET
                     FQGPQVSQLQFDRIMEYIEEGKKAGAKVVAGGGRLGSTGYYIEPTIFSEVNENMSIVK
                     EEIFGPVCTVQKFSTEAEAIQLANDTNYGLAAAVHSKNIDTALRVSNAVKAGTVWVNN
                     YNTLHYQMPFGGFKESGLGRELGSYALDNYTQVKTVRVRVSDS"
     gene            <344085..>344837
                     /locus_tag="ACHE_70109S"
                     /db_xref="GeneID:66985624"
     mRNA            join(<344085..344371,344451..344540,344595..344695,
                     344758..>344837)
                     /locus_tag="ACHE_70109S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282405.1"
                     /db_xref="GeneID:66985624"
     CDS             join(344085..344371,344451..344540,344595..344695,
                     344758..344837)
                     /locus_tag="ACHE_70109S"
                     /note="COG:S;
                     EggNog:ENOG410PNV9;
                     InterPro:IPR000791,IPR030186;
                     TransMembrane:3 (o96-115i122-143o155-181i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139788.1"
                     /db_xref="GeneID:66985624"
                     /translation="MATQSSQSTSIPSPRSAIPTFFHFKPEIEDGKMVGDINYNGEPK
                     AASHNEESPMYGLSTVPTSVALTAEQFERLYLTPMTRRQPPLAKQVGNPTPLALGGFV
                     ITTTPLSCCLMAWRGASGNGIAFTGPIIFLGGLLLLITSVLEFVLGNTFPCVVFGTIG
                     GFWFAFAATMIPAFNSAGLFIPSPF"
     gene            <347235..>347905
                     /locus_tag="ACHE_70110S"
                     /db_xref="GeneID:66985625"
     mRNA            join(<347235..347436,347523..>347905)
                     /locus_tag="ACHE_70110S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282406.1"
                     /db_xref="GeneID:66985625"
     CDS             join(347235..347436,347523..347905)
                     /locus_tag="ACHE_70110S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139789.1"
                     /db_xref="GeneID:66985625"
                     /translation="MVGGNTPLSQPPFLIAVRPEHIAAAETNLIIKPKCGDLSPEDQI
                     IKDSDDGSTVFAMAGKKHGERTGRTDGKKDNLVEFSMSIHYGTFDMIVQNAATETAKY
                     EQDKQATVHVRQVSKESIYIWEMLVGEIKVADIRESTVKNDSLGSAPRQYTWYPKPPK
                     RRILDIKVAEGFNASLVSLCTSVITADVPVANAD"
     gene            <348519..>350241
                     /locus_tag="ACHE_70111S"
                     /db_xref="GeneID:66985626"
     mRNA            join(<348519..349453,349509..>350241)
                     /locus_tag="ACHE_70111S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282407.1"
                     /db_xref="GeneID:66985626"
     CDS             join(348519..349453,349509..350241)
                     /locus_tag="ACHE_70111S"
                     /note="BUSCO:EOG09263JCT;
                     COG:S;
                     EggNog:ENOG410PHFB;
                     InterPro:IPR021261;
                     PFAM:PF10998;
                     TransMembrane:8
                     (i204-221o227-244i251-273o279-298i310-329o361-382i422-
                     445o451-469i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139790.1"
                     /db_xref="GeneID:66985626"
                     /translation="MGMLTFSRFLSRPYPNHRDGPTIFSFQQKLIMEDTGYFQSRQSE
                     PSVAALSPELEATAMDDDPLLDTEDLASVSTRSISPPASPRLSRNASFSNNSSSYQED
                     WETFPPLDKLSIFDLLDTFSLPHRLEKWQQAINAQKERVNKQRERLKSTSMNAKDQVV
                     KEWKRRVPTADEQLDRYRRRMRVGVERLGKQWNAAATVSLREKISFIAGVLNIFISGY
                     LVGAYPEYFYIWFSVQLIYFMPIRYYRYHKKGYHYFLADLCYFVNLMCMLSFWVFPQS
                     KRLFISTFCLVFGNNAVAIAMWRNSLVFHSMDKVVSLFIHIMPPVSLHCLVHLTSAEM
                     LKERFPAIYAIKYSEPGSPEHYSLGDMVIWATVPYLIWQIAYHLLITVRRAEQIAAGR
                     PTSFTWLRKSYANAWIGKLVLSLPESLQSVAFMLIQYSYALVTMLPCPLWFWYRWASA
                     GFLMAVFVWSIHNGATYYLDVFGKRFQKELEELKKDVARWQSSPEALNSPLMTPLVAQ
                     NGNGPATLAQVASDKASIDRIPPLDAVAASTGAQEVNGNDSMVRERK"
     gene            <350791..>352579
                     /gene="MDM28"
                     /locus_tag="ACHE_70112S"
                     /db_xref="GeneID:66985627"
     mRNA            join(<350791..350857,351001..351497,351551..>352579)
                     /gene="MDM28"
                     /locus_tag="ACHE_70112S"
                     /product="LETM1 domain-containing protein mdm28,
                     mitochondrial"
                     /transcript_id="XM_043282410.1"
                     /db_xref="GeneID:66985627"
     CDS             join(350791..350857,351001..351497,351551..352579)
                     /gene="MDM28"
                     /locus_tag="ACHE_70112S"
                     /note="COG:S;
                     EggNog:ENOG410PGFS;
                     InterPro:IPR011685,IPR033122;
                     PFAM:PF07766;
                     TransMembrane:1 (i199-219o);
                     go_function: GO:0043022 - ribosome binding [Evidence IEA]"
                     /codon_start=1
                     /product="LETM1 domain-containing protein mdm28,
                     mitochondrial"
                     /protein_id="XP_043139791.1"
                     /db_xref="GeneID:66985627"
                     /translation="MSVALRSSRLVRSHAVLRPNLASRTRLASGALGAASTANLRFNA
                     RGLPSHVTALALLVPQTRGYATEHSTSNSTSSEPFPPPGFNAGQAKKPIQKEESQTKD
                     VQNADKAPTAPAKSGDTRESEIVKADEDKKVSEKKEKKLTIGQKIKKEVQHYWDGTKL
                     LGTEVRISSRLALKMARGYELTRREHRQLQRTTRDLGRLVPFSMFVIIPFAELLLPIA
                     LKLFPNMLPSTYEGPKVRETKALSLSSTRKEVSSFLKNTLKETGLPVTATTLRNEEFA
                     DFFRKIRSTGESPSTQDVIKVCKIFKDDLTLDNLSRPQLVGICKYMNLNSFGTDAMLR
                     YNIRHRMRQIKRDDRAIFYEGVESLSVPELQMASASRGIRTHGVSPARLREDMSMWLD
                     LRLKQGVPSTLLVLSNAYVYAQGGKEAEMSSQIEALQSVLSSIPEELYHEIELEVHNA
                     EGAATNKQRLEVIKEQEELIEEENEQNSENEEKGVAAPKDIEDIDDKEDSSTQSAEAT
                     EAAKDGQQAELNSQAQAKEKSS"
     gene            <353046..>354555
                     /locus_tag="ACHE_70113S"
                     /db_xref="GeneID:66985628"
     mRNA            join(<353046..353207,353369..353525,353596..353622,
                     353687..354070,354206..>354555)
                     /locus_tag="ACHE_70113S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282411.1"
                     /db_xref="GeneID:66985628"
     CDS             join(353046..353207,353369..353525,353596..353622,
                     353687..354070,354206..354555)
                     /locus_tag="ACHE_70113S"
                     /note="COG:L;
                     EggNog:ENOG410PKDX;
                     InterPro:IPR015797,IPR000086;
                     PFAM:PF00293;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139792.1"
                     /db_xref="GeneID:66985628"
                     /translation="MKSRSLLQFTATINRSFISHSAPSRSPFRAPSSPTTAIRKTQYS
                     TMPRLNPKSQAAIDRLRSYKPPPTNYDLLPLTRRAAVLLLLYADSKGDLRIVLTIRAK
                     TLSSYAGHAALPGGRADSLSETPLQTSRREAREEIGLPETNASLPSPFNVEHLCELPA
                     NLAWTELAVRPCVALLHSYDEKTGVNEDPEVSLIPRLDAREVAAVFTAPFHNFLKQED
                     EANVEAGPGEWYSGAWTEWHQSNWRMHQFFVPVRDKSVTKPKPRNQTPSQKHAVDKLS
                     QDEYEREKAGQSTTRFRVHGMTARMLVDAARVAYAEEPEFEHNSDFGDEEMITRLMRM
                     GRLSAVRKPGDKLTREDMQRAAKLS"
     gene            <355504..>357141
                     /locus_tag="ACHE_70114S"
                     /db_xref="GeneID:66985629"
     mRNA            <355504..>357141
                     /locus_tag="ACHE_70114S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282412.1"
                     /db_xref="GeneID:66985629"
     CDS             355504..357141
                     /locus_tag="ACHE_70114S"
                     /note="COG:S;
                     EggNog:ENOG410Q1TI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139793.1"
                     /db_xref="GeneID:66985629"
                     /translation="MLSVPYPYTHGHAYRPAPPVKPSQSLEGLEQVIPPTSPLALSSP
                     LSLVGRPYYLRLDKPLPEKPLPDTPSSMGYSDSIAWSNSNETSTLDSGSRYSGRESSR
                     YSSDSYPIFVRTGSEYGVERPYSDASSGIGIGVGDVGKGGLLSPTVPAPLATRHSPSP
                     LHAFLASDNEENDMVGNLEDLEEWNDNDHHLDARWSQTRHTATDFTQGRNNNSHYFRE
                     KKWDFFPELAPVAATSKRPCRQASAAQAKKWNTSRFDFRRTRANTFTAAPTALASNVR
                     DSIRFVVQKTMKSSLEKEKENQRRQPRPSTAKRAAASVSDFSDSTTSSSGKGTKSKNK
                     GKQQPERSDYLYAIPKPSCEGKVSITNRLRSLSMSTGSSGAMGSPRSTPPHHGPAYPK
                     QLAVPLSPYQKYGAAVFDKPSTPSTPASTQSHSRFYQSQNRTRRWSLSNATSSYTYAS
                     SYVTNNSSTPNLNLTATQSYPELPTSPLLRSQLQRGTKALHDGTSYMRDALDGAKRRV
                     FDARMDRRRAQLKARIRLIGPVNPYTTYGRVDPWDCI"
     gene            <357687..>361121
                     /gene="AMS1"
                     /locus_tag="ACHE_70115S"
                     /db_xref="GeneID:66985630"
     mRNA            join(<357687..357832,357882..358390,358468..360454,
                     360503..>361121)
                     /gene="AMS1"
                     /locus_tag="ACHE_70115S"
                     /product="glycoside hydrolase, 38 vacuolar alpha
                     mannosidase"
                     /transcript_id="XM_043282413.1"
                     /db_xref="GeneID:66985630"
     CDS             join(357687..357832,357882..358390,358468..360454,
                     360503..361121)
                     /gene="AMS1"
                     /locus_tag="ACHE_70115S"
                     /note="BUSCO:EOG092607QZ;
                     COG:G;
                     EggNog:ENOG410PH3N;
                     InterPro:IPR015341,IPR037094,IPR011330,IPR000602,
                     IPR027291,IPR028995,IPR011013,IPR041147,IPR011682;
                     PFAM:PF17677,PF01074,PF07748,PF09261;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004559 - alpha-mannosidase activity
                     [Evidence IEA];
                     go_function: GO:0030246 - carbohydrate binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0006013 - mannose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycoside hydrolase, 38 vacuolar alpha
                     mannosidase"
                     /protein_id="XP_043139794.1"
                     /db_xref="GeneID:66985630"
                     /translation="MGGGAPLGAPSLFPRTPSHPVGQRIKSIYTDRLRQFTAPGQYEG
                     QNLVSKFFETITTDENHIKLSVYSVPNLARPSFAEATSHDFTPTHTGASFGPSWSTHW
                     FRIRLTIPQDMRDKEHLEFHWDANNEGLVWSEDGRPLQGLTGGGERIEWVIPDAWRDG
                     EEHVFYIEMACNGMFGNAPGGDSIQPPREDRYYRLETARIVAVNLEARGLNYDFWIIG
                     DAAREFPSDSWESHEANMVANAIMDAFIAGNGSQESIKEGRRIAKKYLGDKLDSSEVY
                     DTNAQPIVYAIGHCHIDTCWLWPWAETKRKVARSWSNQCDLMDRYPEHRFTCSQAQQF
                     KWLKQYYPSVFERVRGWVKKGHFQPVGGSWVEHDTNMPSGESLVRQFLYGQRFFQSNF
                     GERCTTFWLPDTFGYSTQIPQICRLAGMSRFFTQKLSWNNINNFPHTTFQWVALDGSQ
                     VMCHMTPAETYTASAHFGDVKRSVTQHKSLDQDNTSLLVFGKGDGGGGPTFEHLEKLR
                     RCRGLSDKVGLLPRVKMGNSVDDFFAQLEKKAAEGTKFVTWHGELYFELHRGTYTTQA
                     DNKRNNRKAEFLLRDIELLATVASLRAQYKYPKEEIDDMWEATLLCQFHDCLPGSCIE
                     MCYDDSDKLYAKIFETGQRLKDEALKVLLEGDGHISNGLVAISTMPWSRTEIVRIPAA
                     YATNGYTNYALVEDNTSSATQLKALEREKKPVVIVTEDKPGVFRLENEQLRVIIENGV
                     ITSLFDIKAKREIIAKGSKAGQLVIFDDKPLYWQAWDVEVYHLESRKELSSSQTSIAE
                     ADPYHASVVTQTKISDKSWIKTTISLGASVEDQPSYVEFESEVEWQETMKFLKVEFPV
                     DITNTEASYETQYGIIRRPTHYNTSWDMAKFEVCCHKWADLSEYGYGVSILNDSKYGF
                     ATSGNLMRLSLLRAPKAPDAHADMGRHHIRYAIFPHEGPLDWRTVRAGYNFNNQLIIQ
                     PSSGEEYNVQVAELLGNKSLVLDAVKRGEDDEDVSRGGLPVRPGKSVILRIYESLGGK
                     SRGTIRCHYPVTKAFKCNILEDDEEELVVRKERPAEIKIELRAFEVATYRLQIGSF"
     gene            complement(<361272..>362141)
                     /locus_tag="ACHE_70116A"
                     /db_xref="GeneID:66985631"
     mRNA            complement(join(<361272..361472,361541..361780,
                     361854..>362141))
                     /locus_tag="ACHE_70116A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282414.1"
                     /db_xref="GeneID:66985631"
     CDS             complement(join(361272..361472,361541..361780,
                     361854..362141))
                     /locus_tag="ACHE_70116A"
                     /note="BUSCO:EOG092658WS;
                     COG:K;
                     EggNog:ENOG410PT7H;
                     InterPro:IPR015418;
                     PFAM:PF09340;
                     go_component: GO:0000123 - histone acetyltransferase
                     complex [Evidence IEA];
                     go_process: GO:0016573 - histone acetylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139795.1"
                     /db_xref="GeneID:66985631"
                     /translation="MADTANPPAQTAPPSNANAGATATAPPAQPDSSDKQPQSQPQIQ
                     AQNPGQQPQSQPSQNATTTTTTDQSRGLPYYEKLRRDLRDTLQKKRLMDKSMAQLEDQ
                     IYRFEQSYLEETTAGNIIKGFDNYIKGSSTGSTLTSGIGLSGAGMGAAGGGARRKAQV
                     TETDRVFSRSSASFMRESPTPSSAQTTPAPTPLSNGGDASTNGNSKAGSKNKKKSGNK
                     NVDEDVEDSDKPPVKRLKISYGRD"
     gene            <362414..>363260
                     /locus_tag="ACHE_70117S"
                     /db_xref="GeneID:66985632"
     mRNA            join(<362414..362533,362602..362794,362910..363084,
                     363143..>363260)
                     /locus_tag="ACHE_70117S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282415.1"
                     /db_xref="GeneID:66985632"
     CDS             join(362414..362533,362602..362794,362910..363084,
                     363143..363260)
                     /locus_tag="ACHE_70117S"
                     /note="COG:P;
                     EggNog:ENOG410PPMQ;
                     InterPro:IPR007274;
                     PFAM:PF04145;
                     TransMembrane:3 (o63-82i146-166o172-188i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0005375 - copper ion transmembrane
                     transporter activity [Evidence IEA];
                     go_process: GO:0035434 - copper ion transmembrane
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139796.1"
                     /db_xref="GeneID:66985632"
                     /translation="MDHAMHHEMDMGHGGMDHGGHSGHGGMDHGDMDMGHCNMNMLFT
                     WSTKNLCIVFPQWRVTGPFSLFVSLVVIVLLTAGYEGVRRITRRYEAGHVQRLSSVGV
                     STSTEIADECASTTATAGLDDPDESSPLLVGRDPRRVAERRGKIALAALYAVQVFYSF
                     FIMLLFMTYNGLVMLAVAVGAFVGYLAFGQDSSATKSVACH"
     gene            complement(<363381..>364958)
                     /locus_tag="ACHE_70118A"
                     /db_xref="GeneID:66985633"
     mRNA            complement(join(<363381..364569,364657..>364958))
                     /locus_tag="ACHE_70118A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282416.1"
                     /db_xref="GeneID:66985633"
     CDS             complement(join(363381..364569,364657..364958))
                     /locus_tag="ACHE_70118A"
                     /note="COG:B,T;
                     EggNog:ENOG410PGKP;
                     InterPro:IPR001810,IPR041667,IPR036047,IPR003347;
                     PFAM:PF13621,PF00646,PF02373,PF12937;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139797.1"
                     /db_xref="GeneID:66985633"
                     /translation="MPDITSLDSETVNIDPNLQDQEDTGDTIPGHPLGVKPSGNALLA
                     TENLRDAIGTFSILPDELILILLEFLDGPSLLRIGRTCKAFYAFTQAEELWKGLFSWS
                     PPASFTWRKTWRATYLNLPPSQVPSLDCSHLYSDALHRPFYCAHISLEPFVRNIPARN
                     QIARLPDLTPEEFHKEWTDRPFILTEPVKQWPAYQQWTTDSLLAKYGDTVFRAEAVDW
                     PFKAYVDYMQNNSDERPLYLFDRAFVSKMGLKVGHIDQEPETTYWTPPCFGEDFFSVL
                     ENDRPDRQWLIIGPERSGSSFHKDPNATSAWNAVVRGSKYWIMFPSSSKLPPPPGVYV
                     SEDQSEVTSPLSIAEWLLTFHAEARRTAGCIEGICGEGEILHVPSGWWHLVVNLEPAI
                     AITQNFIPRGHLSAALDFLYNKADQVSGFRKDVTNPYERFVARMQEKYPDLLEQAWEE
                     LKKKNEGKKRKWDEIVHNKTEEEGPEEAEGGGFSFGFGDDSDVEVP"
     gene            <365497..>367078
                     /gene="TIF1"
                     /locus_tag="ACHE_70119S"
                     /db_xref="GeneID:66985634"
     mRNA            join(<365497..365530,365674..365748,365840..365908,
                     365963..366321,366375..367017,367068..>367078)
                     /gene="TIF1"
                     /locus_tag="ACHE_70119S"
                     /product="translation initiation factor eIF4A"
                     /transcript_id="XM_043282417.1"
                     /db_xref="GeneID:66985634"
     CDS             join(365497..365530,365674..365748,365840..365908,
                     365963..366321,366375..367017,367068..367078)
                     /gene="TIF1"
                     /locus_tag="ACHE_70119S"
                     /note="COG:J;
                     EggNog:ENOG410PFHJ;
                     InterPro:IPR027417,IPR001650,IPR014014,IPR014001,
                     IPR011545,IPR000629;
                     PFAM:PF04851,PF00270,PF00271;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="translation initiation factor eIF4A"
                     /protein_id="XP_043139798.1"
                     /db_xref="GeneID:66985634"
                     /translation="MADKGLEDLPEGQIESNYDEITDSFDAMELKPELLRGVYAYGFE
                     RPSAIQQRAIMPIIKGNDVIAQAQSGTGKTATFSISALQKIDPNLKACQALILAPTRE
                     LAQQIQKVVVAIGDFMSIECHACIGGTNVREDMQALRDGPQVVVGTPGRVHDMIQRRV
                     LKTDQMKLFILDEADEMLSRGFTEQIYDVFQLLPQSTQVTLLSATMPQDVLEVTTKFM
                     RDPIRILVKKQELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVD
                     WLTDKLTARDFTVSAMHGDMEQGQRDVIMKEFRSGSSRVLIATDLLARGIDVQQVSLV
                     INYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNV
                     ADLI"
     gene            <367803..>368974
                     /locus_tag="ACHE_70120S"
                     /db_xref="GeneID:66985635"
     mRNA            join(<367803..368358,368421..>368974)
                     /locus_tag="ACHE_70120S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282418.1"
                     /db_xref="GeneID:66985635"
     CDS             join(367803..368358,368421..368974)
                     /locus_tag="ACHE_70120S"
                     /note="COG:S;
                     EggNog:ENOG410Q03F"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139799.1"
                     /db_xref="GeneID:66985635"
                     /translation="MENTPTTATTTATTTTRPWDPTAPSLLWAHELRRENIHLLNQLS
                     TTQSDLSKTTHALSTLQQTVSSLERTVQDLCARSENHAEAKADAEADARVALERRVTE
                     LEGGVNARLDELGVVVEGARWENRRLEGLVDGVKGEWERKLEGAVGMVRGDMRDIVRA
                     EACRVVEEVVGKAMEGLQCGGSCRRGADTNMGDFSNKDMDIVPDSMPRERQVVSSGQD
                     HDTSLQTLSQSTLGSSNFSDAGDQPFHARNYLQKTEPDPDEADYSMIKQDGRSLSEYF
                     SLTEAGRGQLPPRKREGRIVEAFVAGLDDVDVRGCLEKRLDEEGWMWGVVTTVVQGIV
                     KEREASRQTKRSNYKSKKRRCIPIVPVDEEDLLYN"
     gene            complement(<369042..>369872)
                     /locus_tag="ACHE_70121A"
                     /db_xref="GeneID:66985636"
     mRNA            complement(join(<369042..369469,369529..369740,
                     369814..>369872))
                     /locus_tag="ACHE_70121A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282419.1"
                     /db_xref="GeneID:66985636"
     CDS             complement(join(369042..369469,369529..369740,
                     369814..369872))
                     /locus_tag="ACHE_70121A"
                     /note="COG:Q;
                     EggNog:ENOG410PGIV;
                     InterPro:IPR011234,IPR036663;
                     PFAM:PF01557;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139800.1"
                     /db_xref="GeneID:66985636"
                     /translation="MASAIRANCRKVICIGRNYADHITELKNTKPKQPFFFLKPSSSI
                     LCPGEGPVLRPRGTNLHYEVELALVMGKSVRDLDPQDDKGALDAIQSYLLAIDMTARN
                     VQDEAKKKGLPWTIAKGFDTFLPVSQEIAKSRIPDPHNAFLRLSVGSEQRQADSSSLM
                     LYRIPRLMAEISRVMTLEKGDLVLTGTPKGVGEVKSGDVMRASIEVDGKEIEEGKIDV
                     EVKDREGRYEYSET"
     gene            <370326..>370715
                     /locus_tag="ACHE_70122S"
                     /db_xref="GeneID:66985637"
     mRNA            join(<370326..370373,370434..>370715)
                     /locus_tag="ACHE_70122S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282421.1"
                     /db_xref="GeneID:66985637"
     CDS             join(370326..370373,370434..370715)
                     /locus_tag="ACHE_70122S"
                     /note="COG:S;
                     EggNog:ENOG410PZ84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139801.1"
                     /db_xref="GeneID:66985637"
                     /translation="MQVAEILSDLTSLRVCDHTDALTLVTVNERLPARTPSQEAQSQS
                     QNRDSNQDLRRAKELVDLHRELKTRHANGTVDEDLARARENVQKVLKEVSYNGEGIDE
                     RAWDMAF"
     gene            <370986..>372586
                     /locus_tag="ACHE_70123S"
                     /db_xref="GeneID:66985638"
     mRNA            join(<370986..371086,371156..371246,371310..371474,
                     371531..>372586)
                     /locus_tag="ACHE_70123S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282422.1"
                     /db_xref="GeneID:66985638"
     CDS             join(370986..371086,371156..371246,371310..371474,
                     371531..372586)
                     /locus_tag="ACHE_70123S"
                     /note="COG:A;
                     EggNog:ENOG410PNXE;
                     InterPro:IPR002483,IPR036483;
                     PFAM:PF01480;
                     go_process: GO:0006397 - mRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139802.1"
                     /db_xref="GeneID:66985638"
                     /translation="MASVDAKLLRQTKFPPEFSRKVDMTKVNIEVMKKWIAGKISEIL
                     GNEDDVVIELCFNLLEGSRYPDVKSLQIQLTGFLDKDTGKFCKELWSLCLSAQENPQG
                     VPKELLEAKKLELIQEKIEAEKAAEESQRQKEQERIRERELQDLRQRERFDRGRGGRR
                     GGGRGGRDFDRRPFRDNRSPPRRRSRDRFREPPRREFDSYVPSGFRRGRRPSRSVSRS
                     PSRTPSSSRSPPRRRRRSVSSSPSPERGDRRRTRRRSPSRSVSRSDSSRSRSPKRDRR
                     RRSFSRNSSRSRSPPPHRHRRNASYSRSRSRSRSRSRLGSRSLSRESDDRRRKSDART
                     HKRETTADIGKARSRDNRRLSRSRDRDGGRRRRYSTSSSHSRSRGRTRTPSSSPRLSE
                     SRSRSPRRDRDHDRKRRRSLQRYTPAARRRRNSSSVSVPTEKRQRLTDEDEGPAKQPP
                     PANRSSSADKEMKDADEVGE"
     gene            complement(<374089..>377073)
                     /locus_tag="ACHE_70124A"
                     /db_xref="GeneID:66985639"
     mRNA            complement(join(<374089..375297,375496..>377073))
                     /locus_tag="ACHE_70124A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282423.1"
                     /db_xref="GeneID:66985639"
     CDS             complement(join(374089..375297,375496..377073))
                     /locus_tag="ACHE_70124A"
                     /note="COG:S;
                     EggNog:ENOG410Q2KH;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139803.1"
                     /db_xref="GeneID:66985639"
                     /translation="MRSNNLLMLAGLASTALAYPTDMAMDRRTVGLDIDVDISLNLGG
                     LLSGLLGGGHEQSPAKLLDGINANAAAALQAGAMGVKAGSVHAKARKELAAWLRADVG
                     VHLDASLRSPLLKWATGGDGDILDVDVSAGLSVLSPHAADVAAKGGLIVTLDGILGAA
                     DIEAQVVLSASLQDKLAAFLKGSGAAHLGADVKAGLHLAAGGGLVSSMNSDVKSALQA
                     YLNGPKVTLGASIKTALLAWLEGKSADGVVAIGNVPAGGLTTISVGADIGARVGADGL
                     ATDTAKAGLGAFLKADIAADLDADIKAALELLVNGKASSALDTKSRTALVKWLSGSDV
                     SLGVELQAVVLLWLSVGVDVDISVNLGGGLIGNLLTFVLDTVTELLSSILGGVLSILT
                     GGESLLSLSLEARAQLAAVIAGAVDIDITSDIRLTLLGWLTGVDLNGSIVIGTISGSS
                     SSASPSGTPSSGNNGPLSSSAAASPTPSGESPVNGSPSGSASGASSTPCDTLTSESVV
                     PIATNSEGVPSSSSVPVQVPSGPAPRPSSSTPASSPVVPTPSSVAPVSSGAASSTPCD
                     TLTSESVVPVATNSEQAPSSSSVPVQVPSGPAPRPSSSTPASGTVNVIPTPSSVAPVS
                     SSAASSTPCDTITSESVIPIATSSEAPQPSVPAQQPSSPAAQPSSSSTVPVIPVPSSP
                     AAESSSTPSSTPCDTITSETVIPVATNSEEQTTVVQATGTGSTVDVVVPTTTPAVRPS
                     SPAPQPSAGPSTVPVIPVPASPSSSPASSTPCDTITSETVIPIATSSEAQPVPVQTPS
                     SVPAQQPSASPSTVPVIPVPASPSSSPASSTPCDTITSETVIPIATSSETPDVEATQA
                     PSPSTTSVEVPQTPAAASSTPCDTITSESVVPIATSSETPAPLSTPASCASCAPRVVT
                     VTTTVSVPVCTPTA"
     gene            <382772..>385291
                     /gene="MPS1"
                     /locus_tag="ACHE_70125S"
                     /db_xref="GeneID:66985640"
     mRNA            <382772..>385291
                     /gene="MPS1"
                     /locus_tag="ACHE_70125S"
                     /product="dual-specificity kinase, spindle pole body (SPB)
                     duplication and spindle checkpoint function"
                     /transcript_id="XM_043282424.1"
                     /db_xref="GeneID:66985640"
     CDS             382772..385291
                     /gene="MPS1"
                     /locus_tag="ACHE_70125S"
                     /note="BUSCO:EOG092610LQ;
                     COG:D;
                     EggNog:ENOG410PHX5;
                     InterPro:IPR017441,IPR008271,IPR027084,IPR000719,
                     IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0004712 - protein
                     serine/threonine/tyrosine kinase activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA];
                     go_process: GO:0007093 - mitotic cell cycle checkpoint
                     [Evidence IEA];
                     go_process: GO:0051304 - chromosome separation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="dual-specificity kinase, spindle pole body (SPB)
                     duplication and spindle checkpoint function"
                     /protein_id="XP_043139804.1"
                     /db_xref="GeneID:66985640"
                     /translation="MASPNSLSTAYNSGLHRQPSSRQLSRATVSRSGSRRTSSAIQSS
                     SSRDHGISVPRQYSAGDSSDDEVPEPKFSASVKALLDEDGLGSSPRQRREQTPEEVRA
                     STAAISSQERQERRRSSRSPRLESPQDRSTGSPAPRVVRIGSAMSSRSRREGSVLSSS
                     EQQDSDAKNDFITPAPRQRSVRIASHTRSPASISPSQRRSAERNFSDGHGSAERLEEE
                     RKMRYDDDYMPRVGTSSVLRSRGGEEPGASSLRVKRVGRLTGAFLNGPARRGVLRRQS
                     EENDEGPSYLSPEDDQRESHESAHDNNAEYRYKDTRSSPRVTWAEPRPSSREDGRHRS
                     IEPANASGDDAPYERMSSPKSYGSHSKSTPGSSSEYSSKSSGAREQPVFKIPPLPSMP
                     AAQDQENEPPPTFRRTRPQASSMLDKPEKMSVAYGEDKKENGETPVSSSQRKILAARS
                     NNTPHRPAPPPPKMSVLDTATGSGGAAAASQSRRKRNQVSINHKAFTRLDCIGRGGSS
                     RVYRVMAENYKIFALKRVNLEDVDPLTLAGYKGEIDLLKKLENLDRVVRLFDWELNSD
                     KHTLSVLMEIGESDLEKILAYRLNADDATLDINFTRYYWKEMLECVRAVHEHNIVHSD
                     LKPANFLLVQGRLKLIDFGIANAIQDNTVNVHREQQVGTPNYMSPEALVDSNASLGLP
                     SSVGKMMKLGKPSDVWSLGCILYKMVYGHPPFAKIAKYYERIMAIPNPRVQIDFPEFG
                     VGGVPVPPGLIRTLKRCLQRDQTLRPTVDELLGQRDPFLYPDAQMDGAVPISQDMLGR
                     ILVNVVNHCRVRGIPKEEELATWPAGFFAKIKSALEEEAGR"
     gene            complement(<385872..>386642)
                     /locus_tag="ACHE_70126A"
                     /db_xref="GeneID:66985641"
     mRNA            complement(<385872..>386642)
                     /locus_tag="ACHE_70126A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282425.1"
                     /db_xref="GeneID:66985641"
     CDS             complement(385872..386642)
                     /locus_tag="ACHE_70126A"
                     /note="COG:J;
                     EggNog:ENOG410PP2I;
                     InterPro:IPR028909,IPR036164;
                     PFAM:PF00829;
                     go_component: GO:0005840 - ribosome [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139805.1"
                     /db_xref="GeneID:66985641"
                     /translation="MFARSVLRKALALPFEQTPSSTTLFRATLSTTTSTSTSTSSKPE
                     SPLSASPRAQSNNPTHQQHQLPVTPSSAASTPASTPYTTPQTSSHIPTQKQPLPPTFE
                     APLKVTSSLLELLPHLTAQRAHYITAHVHAKPYLVTAGDHLRLPFLMANVQPGDVIRL
                     NRASVIGSRDFTLKGKPYIDERMFECRARVVGVDSEPMRYKEKTKRRQRHVRTIKSKE
                     RYTMLRIMDVKVKTKEELVQEGAVVVEGQDQATLEVKS"
     gene            <387086..>388092
                     /gene="NSA2"
                     /locus_tag="ACHE_70127S"
                     /db_xref="GeneID:66985642"
     mRNA            join(<387086..387088,387149..387159,387215..387757,
                     387807..388019,388077..>388092)
                     /gene="NSA2"
                     /locus_tag="ACHE_70127S"
                     /product="ribosome biogenesis protein"
                     /transcript_id="XM_043282426.1"
                     /db_xref="GeneID:66985642"
     CDS             join(387086..387088,387149..387159,387215..387757,
                     387807..388019,388077..388092)
                     /gene="NSA2"
                     /locus_tag="ACHE_70127S"
                     /note="BUSCO:EOG09263ZBF;
                     COG:J;
                     EggNog:ENOG410PJ4S;
                     InterPro:IPR039411,IPR022309;
                     PFAM:PF01201"
                     /codon_start=1
                     /product="ribosome biogenesis protein"
                     /protein_id="XP_043139806.1"
                     /db_xref="GeneID:66985642"
                     /translation="MPQNEYIERWQKQHGKRLDHEERTRKRQAREHHQQSKDAQNLRG
                     LRAKLYQQKRHAEKIQMKKRIKAQEEKNVKSSAPEEPSKTPLPQYLLDRSQATNAKAL
                     SSAIKDKRNEKAAKFAVPLPKVKGISEEEMFKVVNTGKKTAKKSWKRMITKPTFVGGD
                     FTRRPVKYERFIRPMGLRYKKANVTHPEMAVTVQLPILSVKKNPQNPLYTQLGVLTKG
                     TILEVNVSELGMVTTNGKVVWGKWAQVTNNPENDGCVNAVLLV"
     gene            complement(<388372..>390267)
                     /locus_tag="ACHE_70128A"
                     /db_xref="GeneID:66985643"
     mRNA            complement(<388372..>390267)
                     /locus_tag="ACHE_70128A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282427.1"
                     /db_xref="GeneID:66985643"
     CDS             complement(388372..390267)
                     /locus_tag="ACHE_70128A"
                     /note="CAZy:AA3;
                     COG:E;
                     EggNog:ENOG410PH3P;
                     InterPro:IPR012132,IPR036188,IPR000172,IPR007867;
                     PFAM:PF05199,PF00732;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139807.1"
                     /db_xref="GeneID:66985643"
                     /translation="MRLSQFSLLGLLVTASAQEELNLWNYGATGNILGNTFGIPGTNA
                     TFDYIVVGGGNAGSTIASRLAENKSVSVAVVEAGGFYEIDNGNYSVVPGYSSQFTGSK
                     PNAYNPLIDWGFSTESQQALGGRKLHYARGKTLGGCSARNFMLYHRPTVDSMQRWADE
                     VDDQSYAFDNLLPYYKKSCHYTPPNQGLYTNSTNNQTADAFSSSGGPLEVSFSNAVDA
                     FGTWARKAFITAGMGQINGLNSGRLLGSAYATFTINPKNAHRSTSESSFLKQSLNNGS
                     GLVVYKNTLAQKILFDSNKTATGVQIATGGTFGTPPINFSLNARNEVILSAGALQSPQ
                     LLMVSGIGPCDHLSKFGIPCLSNLPGVGQNMLDHPVFGTAHRVNVLTNSASANNKTLA
                     AENANKYLHHATGPLSIFGPGYYGWEKLPDPYRSKLSNASITALANFPPDWPELEYLP
                     VAAFNGDNQVKQPADPLDGHNYATLNIALVAPLSRGTVSLSGPDMTTPPLVDPNWLSH
                     PADMDLAVQSFKRTREIWSILSKMGIADPVEYYPGANVTSDAQIREFVKESMRPVFHA
                     ACTCKMGKKGDGMAVVDSSARVYGVQGVRVVDASSFPLLPPGHPQSTVYALAEKIADA
                     ILGSTLW"
     gene            complement(<391373..>391914)
                     /gene="HHT1_5"
                     /locus_tag="ACHE_70129A"
                     /db_xref="GeneID:66985644"
     mRNA            complement(join(<391373..391485,391544..391732,
                     391788..>391914))
                     /gene="HHT1_5"
                     /locus_tag="ACHE_70129A"
                     /product="histone H3.1"
                     /transcript_id="XM_043282428.1"
                     /db_xref="GeneID:66985644"
     CDS             complement(join(391373..391485,391544..391732,
                     391788..391914))
                     /gene="HHT1_5"
                     /locus_tag="ACHE_70129A"
                     /note="COG:B;
                     EggNog:ENOG410PN02;
                     InterPro:IPR007125,IPR009072,IPR000164;
                     PFAM:PF00125;
                     go_component: GO:0000786 - nucleosome [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="histone H3.1"
                     /protein_id="XP_043139808.1"
                     /db_xref="GeneID:66985644"
                     /translation="MARATATARKSTGGRASRKRLGAKAARKTPAKKKGTRKFKPGTI
                     ALREIRRYQKGHELLLPKTPFRRVVQEITSEMMFEKDYRFQSSALDALQEISEAFLVN
                     EFEMTNLCAIHARRVTIQARDMQLVRRLRKHMGLDPVGTV"
     gene            <392264..>392886
                     /locus_tag="ACHE_70130S"
                     /db_xref="GeneID:66985645"
     mRNA            join(<392264..392550,392601..>392886)
                     /locus_tag="ACHE_70130S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282429.1"
                     /db_xref="GeneID:66985645"
     CDS             join(392264..392550,392601..392886)
                     /locus_tag="ACHE_70130S"
                     /note="COG:S;
                     EggNog:ENOG410PZP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139809.1"
                     /db_xref="GeneID:66985645"
                     /translation="MTRKPGIPGPKPGANPGKKRKQDKDLSKNPHTMRGRELLASKSD
                     SEKAVIRRKNNDRAAFVSARLKLRASTSWQEATMEEQEILENSLKDQVMRERYEKGQS
                     AQFFLDQLEGESIDSSVWETVDFENDTELCYHAQLDDIASHETIPTTETAKEAEAAQS
                     SATGQLIKICIPSLGVTFDSPFYAVWPVLT"
     gene            <394053..>394982
                     /locus_tag="ACHE_70131S"
                     /db_xref="GeneID:66985646"
     mRNA            join(<394053..394069,394135..394603,394665..>394982)
                     /locus_tag="ACHE_70131S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282430.1"
                     /db_xref="GeneID:66985646"
     CDS             join(394053..394069,394135..394603,394665..394982)
                     /locus_tag="ACHE_70131S"
                     /note="COG:S;
                     EggNog:ENOG410QEHG;
                     InterPro:IPR012337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139810.1"
                     /db_xref="GeneID:66985646"
                     /translation="MHCISRDRLFAAVKQLDPDGVYRRANDLQRHRGEYIVPGPNWLW
                     SIDGHCKLNFYGIEIYAAIDAYSRYITWIYIGISGRTAISILVQFLTTLQKEGVHPQR
                     IRSDRGTETPLLAAAQHAFMKRHVADISFRDCYWYGTSTANQRIESWWGQLTGGLLFR
                     WRDYFQRLHSEHLFEPDNLADKIALLAIYIPILRQEVQAFARMWNMHTIRKQPNRPNA
                     VHGKPIMLYFYPQDPCIQNYGLKPDPQLLQELTDQTASYGMMVHKLPYC"
     gene            complement(<395391..>396645)
                     /locus_tag="ACHE_70132A"
                     /db_xref="GeneID:66985647"
     mRNA            complement(join(<395391..395696,395745..396103,
                     396174..>396645))
                     /locus_tag="ACHE_70132A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282432.1"
                     /db_xref="GeneID:66985647"
     CDS             complement(join(395391..395696,395745..396103,
                     396174..396645))
                     /locus_tag="ACHE_70132A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139811.1"
                     /db_xref="GeneID:66985647"
                     /translation="MSEPWTPFCRRKEHFEHAVHCADDISCPYCGMTNPDTSTSQDII
                     FLPQTPTQSSGKRNTPIEISSSPPAHQSTSSTFPQLDRTSEIARQQSIQRTQQSTQIR
                     PHAGSKILSSRPQVTRTQRTHSAQPTLQKFGVTVIIYTGFLYDFDLGFGDRWKCRTSF
                     GAYLTPADTYETEDDLIPILARNYQRWDDLLRKYNPVKIMIAKTFEKGIGQPQIIPTD
                     AIKLPVPHILTECFSANKIFLFLGCEEELSDVEDTQDTSMKIKKEKGQKVKEEKGPKI
                     KKEQSMPQKPRQTYQRKRNHSQVSPQSSQTTPLRYVQPRVALNRNSKKSESPEHVNDS
                     TEAEDQTTLDGVYAEEQELLEIQEPEELHLDAPAGRTRQRLQQN"
     gene            complement(<401208..>402018)
                     /locus_tag="ACHE_70133A"
                     /db_xref="GeneID:66985648"
     mRNA            complement(join(<401208..401552,401620..>402018))
                     /locus_tag="ACHE_70133A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282433.1"
                     /db_xref="GeneID:66985648"
     CDS             complement(join(401208..401552,401620..402018))
                     /locus_tag="ACHE_70133A"
                     /note="COG:S;
                     EggNog:ENOG410PSKI;
                     InterPro:IPR000073,IPR029058;
                     PFAM:PF12697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139812.1"
                     /db_xref="GeneID:66985648"
                     /translation="MSKPTLIFAPGAWYPPTAFDPLIAKLPDYTCHIIAFPAVQQATT
                     VTDLQLDISAVRTLVEQEADAGRDVVIVLHSWAGLPVSSALGGLSKQARTKAGKEGGV
                     VKLVFIAAFVPEVGESLLDAFGGQAEWMIRDIENGTVTASDPFNRFFHDVPDGHEWTK
                     TLRPHAWAAKTSPATGAAYLEIPNSYLLCEDDRAILLAAQEAMVERARSKGAVFETER
                     IKAAHTPWLVPEVMGEVVGYIRRQAGEVL"
     gene            complement(<403200..>404497)
                     /locus_tag="ACHE_70134A"
                     /db_xref="GeneID:66985649"
     mRNA            complement(join(<403200..403683,403734..404110,
                     404162..404269,404321..>404497))
                     /locus_tag="ACHE_70134A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282434.1"
                     /db_xref="GeneID:66985649"
     CDS             complement(join(403200..403683,403734..404110,
                     404162..404269,404321..404497))
                     /locus_tag="ACHE_70134A"
                     /note="COG:E;
                     EggNog:ENOG410PIV7;
                     TransMembrane:6
                     (o20-40i52-71o91-119i131-159o179-198i210-232o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139813.1"
                     /db_xref="GeneID:66985649"
                     /translation="MPPLDRMDEDPGDNIAYRIWIGTIVTVVPATVITALRFIARTVS
                     RVGLWWDDYTIAVALVINWGMAATRWAQVLMYDYGRHTQYVASEKVINFQISFIAVQI
                     TYFCNAVFTKASLLLLYHRIFGVVSGFRWALGISAFLVTAYFIACVIVTIAGCSPVSY
                     YWYRHQEGSCIDEVNFYRWNGIVNMLLDVLVLCLPFPMTWRIKTCLRQKLILTGIFLL
                     GGFVCIVSILRIIAFDFSDANDPMYSTINTATWSSIEQSVGIICACLPTLRPMFRQLY
                     DASHNSTDKGSGSGSRTLSSSLPIRLSQLGSPQAEADGSTVCFARLPTAITATDGSRS
                     RASSTTQTRTGHGVDMYGYAPSIPSVATGGRSRAGSSGLGKEAQQCV"
     gene            <405256..>406801
                     /locus_tag="ACHE_70135S"
                     /db_xref="GeneID:66985650"
     mRNA            join(<405256..405330,405389..405556,405610..405851,
                     405903..405999,406050..406251,406299..406520,
                     406572..>406801)
                     /locus_tag="ACHE_70135S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282435.1"
                     /db_xref="GeneID:66985650"
     CDS             join(405256..405330,405389..405556,405610..405851,
                     405903..405999,406050..406251,406299..406520,
                     406572..406801)
                     /locus_tag="ACHE_70135S"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139814.1"
                     /db_xref="GeneID:66985650"
                     /translation="MDPQPEIFNLEDFTSSSPETDPNVEGIPVQLTNSKSHSLQTSKI
                     EYIDDLPEYPTSHIHGYSYVVASRGRSQNEMEQLVHEIQYSRRQQHGPRRPVKCPFFN
                     CLVKRWTWKCSGIYACEFLNPFLQSYHHTFVDEDCWDVIRNTQRNIQILEANIGKRNA
                     YSYYRSKNEFFNKGYACIDQLPTCKPVFKRHTQMNVHGEFPPYIGCSNGSNEFLTKHH
                     RGSIQGHTSIDLQFLEDLFNHDIMPPTEECGVFESLASRRKYCDRDHLQGPGRLQHTS
                     CGVIFTALVPVDINECPYILFTSHGIHQHPPPPPSKAPERILQGVKRIIQQIQDPSLT
                     TAQFLRSPQLEAFCQQYGASTLAEIHSSFCNKDRIATIIQKQRLLSYPNGQDINGLLF
                     LQNRDSLINVSGSNHPLPH"
     gene            complement(<419358..>420533)
                     /locus_tag="ACHE_70136A"
                     /db_xref="GeneID:66985651"
     mRNA            complement(<419358..>420533)
                     /locus_tag="ACHE_70136A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282436.1"
                     /db_xref="GeneID:66985651"
     CDS             complement(419358..420533)
                     /locus_tag="ACHE_70136A"
                     /note="COG:C;
                     EggNog:ENOG410PNAU;
                     InterPro:IPR036291,IPR020843,IPR011032;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139815.1"
                     /db_xref="GeneID:66985651"
                     /translation="MATHLAAVSPAKGQLFELQTRLTPKPGPDELLIAVKSVALNPAD
                     AYMRDQGLFIPTYPTVIGFDMSGLVLEVGDNVPTSATDNDPAPSFRPGITRVAAYAAS
                     VWKSCDPDYGAFQERCLVPWQHAVSLPYEGMSWNHAASLPVAAEVPLNAWDVMGIPRV
                     GEATASAPASAGSTGTDTNGEKQKNNMEKREALLIWGASSSVGTMGVQTARLLREDPN
                     SSFAAAYATAGSANKSYVGSLGADRVFDYKDSQVVDAIVSAAKEDGLVIRHCFLATGQ
                     LAPCQAVLKTFLGEDSEGKKTKTAKIGSAPVVPPDAKVVNGVETIFVLPSTVEGERLE
                     QFRYWIGTWLRENLAKGTIRPSPEPSVLAEGLGAINAGLDKLLRGVSCTKLIVEVAE"
     gene            <423924..>424115
                     /locus_tag="ACHE_70137S"
                     /db_xref="GeneID:66985652"
     mRNA            <423924..>424115
                     /locus_tag="ACHE_70137S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282437.1"
                     /db_xref="GeneID:66985652"
     CDS             423924..424115
                     /locus_tag="ACHE_70137S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139816.1"
                     /db_xref="GeneID:66985652"
                     /translation="MGVRKRIAPATQAHYRLRATKLRQEKRLEQLNGTEDADMGEAPE
                     VCETATASPREPTNVIGYA"
     gene            complement(<424541..>425252)
                     /locus_tag="ACHE_70138A"
                     /db_xref="GeneID:66985653"
     mRNA            complement(join(<424541..424638,424700..424821,
                     424884..424942,424995..>425252))
                     /locus_tag="ACHE_70138A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282438.1"
                     /db_xref="GeneID:66985653"
     CDS             complement(join(424541..424638,424700..424821,
                     424884..424942,424995..425252))
                     /locus_tag="ACHE_70138A"
                     /note="COG:S;
                     EggNog:ENOG410PTE0;
                     InterPro:IPR014710,IPR011051,IPR013096;
                     PFAM:PF07883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139817.1"
                     /db_xref="GeneID:66985653"
                     /translation="MAHLFPHPRRIVTGHDNYGKAIVLADSVIPCEPTKIKCNFAVLY
                     ETHQFPESNDKWMDPVESRTTDLANQKGVVLRVVDFPPRTKTMFHRTESLDFGILHEG
                     EITCHLDHDERIDMKAGDVCVQRGTIHGWTNYSDKPARVFFILTAAKPVSIGNCILGT
                     EGFDKEDVESGGTVSAKN"
     gene            <429048..>430796
                     /locus_tag="ACHE_70139S"
                     /db_xref="GeneID:66985654"
     mRNA            join(<429048..429247,429296..>430796)
                     /locus_tag="ACHE_70139S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282439.1"
                     /db_xref="GeneID:66985654"
     CDS             join(429048..429247,429296..430796)
                     /locus_tag="ACHE_70139S"
                     /note="COG:S;
                     EggNog:ENOG410PHT6;
                     InterPro:IPR008979,IPR029058,IPR005674,IPR013736,
                     IPR000383;
                     PFAM:PF02129,PF08530;
                     go_function: GO:0008239 - dipeptidyl-peptidase activity
                     [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139818.1"
                     /db_xref="GeneID:66985654"
                     /translation="MPNPVQNAETTDVRSYPYVFRQNVSVPLSNGGRIRCNIYLPKTG
                     AIDGRYPVLITYGPYGKDIPYQHFNAASFAEINPDHKSEHSAWETPFPTYWTAHGYVV
                     VRADELGTGQSPGQLDVFSATTVDSFCELVEWAAIQEWSTGKIGLLGISYYAAIQWQV
                     AARNPNGLAAIVPWEGFADHYRDFSRHGGIFSNSFLRLWYDRQVKSNQYGLSGRASRN
                     WGPDTVDGNLPEEELSANAIDIVDQLQSQHFRDHDRYATVNFNLEDIRVPLLSVANWG
                     GYLLHLRGNVEGYTWASSEFKYLRFITGRHDLPFYYPDEVEIQRSFLNAFMKGDDRIG
                     WSRKGAVPSVDLVLRRGDVGYNDPDAEALYPRRKENEWPIARTVYTPLFLNPDQRLTD
                     SEPSLSTIKKIAYRALGDLSNPQFISFRTQPFQSETEITGHIVAHLNVSMSRDSWSSA
                     PSDIDLFVTLRHLSSSGKEILYTGTVGDPIPVTKGFLRMSLRKVNNEHPHHRPYRPHR
                     DYLSSDVQAVIPNEVYTADVELWPTNVVVQEGECLVFEVSSGDTPGTGIFEHCDQVDR
                     "
     gene            complement(<433265..>433705)
                     /locus_tag="ACHE_70140A"
                     /db_xref="GeneID:66985655"
     mRNA            complement(<433265..>433705)
                     /locus_tag="ACHE_70140A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282440.1"
                     /db_xref="GeneID:66985655"
     CDS             complement(433265..433705)
                     /locus_tag="ACHE_70140A"
                     /note="COG:O;
                     EggNog:ENOG410Q2DE;
                     InterPro:IPR001375,IPR029058;
                     MEROPS:MER0017248;
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139819.1"
                     /db_xref="GeneID:66985655"
                     /translation="MALETISFQTSDSVTLRGWFYRPTNPSRSQAPCLVMAHGFSALK
                     EIDLGTFAEYLVSKLDLACLVYDNRGFGESDTKPGQPRHEIIPSQQTSDYSDAITYAQ
                     SRSDVDASRIGIWGSSYSGGHVLWVGAVDRRVKAVLSQAPCVDG"
     gene            complement(<434653..>435176)
                     /locus_tag="ACHE_70141A"
                     /db_xref="GeneID:66985656"
     mRNA            complement(join(<434653..434703,434754..>435176))
                     /locus_tag="ACHE_70141A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282441.1"
                     /db_xref="GeneID:66985656"
     CDS             complement(join(434653..434703,434754..435176))
                     /locus_tag="ACHE_70141A"
                     /note="InterPro:IPR024311;
                     PFAM:PF13924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139820.1"
                     /db_xref="GeneID:66985656"
                     /translation="MAPNTEEIRKALTGTWKLVSYVSKPSDCSGPNGYPMGKDVQGYI
                     MYTADGFMSAQLMAPGSLKYTNNDVFDVAEKEAADASRHYLAYSGPYEIEILEGKPIL
                     KHHMDVSLVPNWAGTHQLRRCELKGDELVLGPVTPWSLKGALVDQFLTWRKVNSS"
     gene            complement(<436012..>436456)
                     /locus_tag="ACHE_70142A"
                     /db_xref="GeneID:66985657"
     mRNA            complement(join(<436012..436301,436348..>436456))
                     /locus_tag="ACHE_70142A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282443.1"
                     /db_xref="GeneID:66985657"
     CDS             complement(join(436012..436301,436348..436456))
                     /locus_tag="ACHE_70142A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139821.1"
                     /db_xref="GeneID:66985657"
                     /translation="MDRLSKWMTSRRSSHISRCSIDAYRSELVGTEQEYPDPPVATSL
                     GLPEDHAEALGTSRQISARRTPVCSNSYAQISLSPSVGVLDSTLNVGGESRAENIQFE
                     ETAVEGSKGEAAASYGDEDAIGEVNINECT"
     gene            <437153..>437530
                     /locus_tag="ACHE_70143S"
                     /db_xref="GeneID:66985658"
     mRNA            <437153..>437530
                     /locus_tag="ACHE_70143S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282444.1"
                     /db_xref="GeneID:66985658"
     CDS             437153..437530
                     /locus_tag="ACHE_70143S"
                     /note="COG:S;
                     EggNog:ENOG410PNF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139822.1"
                     /db_xref="GeneID:66985658"
                     /translation="MCLTSPLHFTHIHLAESDPSSPDSFAAFVASRCRAYVLSEEPLG
                     VPVEGIRQHGCNCYASGEALNIECIMPRAWKAMLEWLERVHADPDYYETKLVVKEVSI
                     DELDKLKDLEDDDSNEEAGETEG"
     gene            <438338..>439965
                     /locus_tag="ACHE_70144S"
                     /db_xref="GeneID:66985659"
     mRNA            join(<438338..438922,438976..>439965)
                     /locus_tag="ACHE_70144S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282445.1"
                     /db_xref="GeneID:66985659"
     CDS             join(438338..438922,438976..439965)
                     /locus_tag="ACHE_70144S"
                     /note="COG:F;
                     EggNog:ENOG410PI1G;
                     InterPro:IPR018228,IPR011059,IPR017593,IPR006680,
                     IPR032466;
                     MEROPS:MER0005767;
                     PFAM:PF01979;
                     go_function: GO:0004038 - allantoinase activity [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016810 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds [Evidence IEA];
                     go_function: GO:0016888 - endodeoxyribonuclease activity,
                     producing 5'-phosphomonoesters [Evidence IEA];
                     go_function: GO:0050897 - cobalt ion binding [Evidence
                     IEA];
                     go_process: GO:0000256 - allantoin catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139823.1"
                     /db_xref="GeneID:66985659"
                     /translation="MVLFSGRLFIYILTFFCWISIISDQLLTTATNSSSSSITVLASS
                     RAVISGQLTPATIVISRATGKITAVYDSVLSATDFPEGTPYTDHSPYVLLPGLIDTHV
                     HLNEPGRTEWEGFYTGTQAAAFGGVTTVVDMPLNAIPPTTTVANLKEKVAAAQGKRWV
                     DVGFFGGVIPGNSHELKALVHEGVRGFKGFLIDSGIDEFPAVNTEDIKKAMAELADEP
                     TTLMFHAEKEPHEQPLPPTGPVDDYLTYLESRPSTYETNAIAEVLSLAHLAPQLALHI
                     VHLSAMEAIPILREARAQGVPITAETCFHYLSLAAEQIRNGDTRYKCSPPIRSQANQD
                     ALWAELARYPDDGVIQTVVSDHSPCTPNLKLLPPHIPPTTDAPSHNGSFLTAWGGVSS
                     VGMGLPILWTEFSRRNNLTFAPEGENTNRALQDIVRLCCMNTAAQVGLEKQKGDLAVG
                     MDADICIFDDTAEWVVDPSTMLFRNKISPYQGQKLRGVVRETWLRGERIFTRAAGFSD
                     DRPSGKLLLEKRAKRT"
     gene            complement(<441042..>441603)
                     /locus_tag="ACHE_70145A"
                     /db_xref="GeneID:66985660"
     mRNA            complement(join(<441042..441135,441199..441276,
                     441329..>441603))
                     /locus_tag="ACHE_70145A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282446.1"
                     /db_xref="GeneID:66985660"
     CDS             complement(join(441042..441135,441199..441276,
                     441329..441603))
                     /locus_tag="ACHE_70145A"
                     /note="InterPro:IPR011009;
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139824.1"
                     /db_xref="GeneID:66985660"
                     /translation="MRALQARPDTRGQTSREIKALKDLTEAKCFCTPKFRAWKHENQD
                     RNDWVPGGFLDYIVMEKLEGRTLSPELIDSLSNEQQQRLRTAFKRSYIECLNHNFVNL
                     DQGARNLIWNEEKGICYIIDWETWCRATSSYDWNDDEYCSWDLELS"
     gene            complement(<449156..>449986)
                     /locus_tag="ACHE_70146A"
                     /db_xref="GeneID:66985661"
     mRNA            complement(<449156..>449986)
                     /locus_tag="ACHE_70146A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282447.1"
                     /db_xref="GeneID:66985661"
     CDS             complement(449156..449986)
                     /locus_tag="ACHE_70146A"
                     /note="COG:S;
                     EggNog:ENOG410PYB6;
                     InterPro:IPR002110,IPR020683,IPR036770;
                     PFAM:PF13637,PF12796;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139825.1"
                     /db_xref="GeneID:66985661"
                     /translation="MSPPTEGRVQAKLDADITNSNLQSIKDFYKSADPKSQSSLLADI
                     AARAAAKAQVDILDWVFSEGFQAPPDSLNDEFYHQACLAQSLAVWETLVKNGFNLNGH
                     HSEFFGDALSLEAYCGNVGIIRFLLENGQDPNDAWGGYDDLEPGVAALVGDKPSLEIL
                     HLMLHHGWNQKRSATHIAAAELGNMEALKLLVEHGADLEEASGWWPNCGIIEADKWGT
                     ALYRAAYKGQREPVTYLLDKGANIWFKDDKRRSILWAAKQGGNEEVIELLKSAGLKEE
                     "
     gene            complement(<451680..>453981)
                     /locus_tag="ACHE_70147A"
                     /db_xref="GeneID:66985662"
     mRNA            complement(join(<451680..452787,452856..452912,
                     452980..453135,453209..453415,453467..>453981))
                     /locus_tag="ACHE_70147A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282448.1"
                     /db_xref="GeneID:66985662"
     CDS             complement(join(451680..452787,452856..452912,
                     452980..453135,453209..453415,453467..453981))
                     /locus_tag="ACHE_70147A"
                     /note="COG:E;
                     EggNog:ENOG410PKWM;
                     InterPro:IPR002937,IPR036188;
                     PFAM:PF01593,PF13450;
                     TransMembrane:1 (o83-106i);
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139826.1"
                     /db_xref="GeneID:66985662"
                     /translation="MDETLNLNINEWKDIRNQWALKHAEESVKNDWNYLVGKGPSISP
                     LPSLPSPGIPFLSGDHRLPDPADKLPGDRAKPPEPENDVVLNIGVIGAGAAGLFTGLL
                     LDFLNKKYQEKFKTHKVQFKYDILEASERVGGRLFTYNFDDSQIKKDGSVNRNYYDVG
                     AMRFPDNPVMERLFRLFNYLEMRKANDTPNSKLGDLLPYYIKGDKEPWHFNGTTKWGD
                     YASISAQGLDPWKLNEDGKIPEDILKKSPGDVFNGIIKTFREKLMQDKATSDKSSEGW
                     KYLMKYDDYSARSYLALAHHPALNYETIQWMEAFNGGTEWYDQALSEAVLESLDFDWQ
                     PGTDWRCILGGSGVLAAKMVQKLKNPSSVQTSTAVTQIKNKGEKQVEIAYAQDNNSGG
                     QSHTYNAVFSSLPLGCLQRIDTSEAKLNYGIRQAMRALSYGPSGKVGIKFKNPWWLYK
                     LNDANLKHAGLGHSDLSIRTCVYPSYNLQTPKEEEAVLLCSYTWQQDALRLSSLVSKS
                     KDLKNKWREETELKNVLIHDLARLHADGKPGRTVDELEDLIRDSYLEHFAFDWYQNPH
                     SVGAFAFFGPQQFRCSWPKIIQPSGDLAIIGEAASPHHAWVVGALESAVHQVYSWLNQ
                     HKGKIHGFSYLAELLEENPPTDDPNPFQGLPPYMRTETCKWQSVLAKAYREMPDYM"
     gene            <455896..>456230
                     /locus_tag="ACHE_70148S"
                     /db_xref="GeneID:66985663"
     mRNA            join(<455896..455910,455967..456030,456088..>456230)
                     /locus_tag="ACHE_70148S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282449.1"
                     /db_xref="GeneID:66985663"
     CDS             join(455896..455910,455967..456030,456088..456230)
                     /locus_tag="ACHE_70148S"
                     /note="InterPro:IPR037060;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0004096 - catalase activity [Evidence
                     IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139827.1"
                     /db_xref="GeneID:66985663"
                     /translation="MPGPLYRNTGKIPEAPKFHNHYTLSNGCPVEDSQVSESFSKQDG
                     KNRYASQLIQDINTIDTIPHITRVQIPER"
     gene            <457688..>457846
                     /locus_tag="ACHE_70149S"
                     /db_xref="GeneID:66985664"
     mRNA            <457688..>457846
                     /locus_tag="ACHE_70149S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282450.1"
                     /db_xref="GeneID:66985664"
     CDS             457688..457846
                     /locus_tag="ACHE_70149S"
                     /note="antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139828.1"
                     /db_xref="GeneID:66985664"
                     /translation="MEEEIAKLESKGIFELIRISDISKDKRIFPGKWVYDSKIMSPQM
                     TDLIKPDE"
     gene            complement(<459097..>460455)
                     /locus_tag="ACHE_70150A"
                     /db_xref="GeneID:66985665"
     mRNA            complement(<459097..>460455)
                     /locus_tag="ACHE_70150A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282451.1"
                     /db_xref="GeneID:66985665"
     CDS             complement(459097..460455)
                     /locus_tag="ACHE_70150A"
                     /note="COG:S;
                     EggNog:ENOG410PS0X;
                     InterPro:IPR023213;
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139829.1"
                     /db_xref="GeneID:66985665"
                     /translation="MPWSEKSPGHYTRPIGENESMIKTIGERGLPLNREHWSLSFSAQ
                     FKSRSKKDVDIFVKLHKAWKVLRFNNPSLASTAADGLLHYTVPDTQSLDKWTQDTFFV
                     IDEDHITPEELIASFKPGPYVTLHYLPRHSQIIIHASHWRTDGIGAIQVLDAFFEAAA
                     SNQDPQTLPWGLEVTRLVPSVEEALNIPTTPSPEIKAEAEKCIATIALTRGAIGVDYL
                     GDSTTLPAGTRSARLRLSESTTEAIKEACKARNISIIAAVHAAIAAVNYAAAPEECKK
                     KPYTSTIRTTLRSYLPEPYNTPAYACGLYTSGLMFQVPASQSWLDNAEQYHHQYECVL
                     SSEFIQARREYASQMLQILSMPLPVPLPTPSEVDISSIGDAELLMNRTYGTEDDGIDV
                     LGISLGVETLTRQMYTFVWIFRGQLEFNLVYNEAYHDAASAGRLLVLLEDILETELKN
                     AN"
     gene            <460899..>468886
                     /locus_tag="ACHE_70151S"
                     /db_xref="GeneID:66985666"
     mRNA            join(<460899..461495,461543..>468886)
                     /locus_tag="ACHE_70151S"
                     /product="type I iterative PKS"
                     /transcript_id="XM_043282452.1"
                     /db_xref="GeneID:66985666"
     CDS             join(460899..461495,461543..468886)
                     /locus_tag="ACHE_70151S"
                     /note="COG:I;
                     EggNog:ENOG410Q2NG;
                     InterPro:IPR016036,IPR032088,IPR016035,IPR016039,
                     IPR042104,IPR014030,IPR014031,IPR001227,IPR041068,
                     IPR006162,IPR014043,IPR020806,IPR020807,IPR020841,
                     IPR009081,IPR029063,IPR036736,IPR036291,IPR013217,
                     IPR013120;
                     PFAM:PF14765,PF00109,PF07993,PF00550,PF16073,
                     PF13489,PF13649,PF02801,PF00698,PF01370,PF08242,PF08241,
                     PF18558;
                     SMCOG1022:Beta-ketoacyl synthase;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0016740 - transferase activity [Evidence
                     IEA];
                     go_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA];
                     go_function: GO:0031177 - phosphopantetheine binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="type I iterative PKS"
                     /protein_id="XP_043139830.1"
                     /db_xref="GeneID:66985666"
                     /translation="MTQSTNTVLLFGPQALSFEQESFHQIRSTLLSTSQYNWILGVVA
                     ELPNLFSRAKEKLPKVKSTSGAKLLDDLNDWLRSGVINESSFQLPNILLSPLIIIVHL
                     IEYSQYQQLSSGSENGHKETIGFCTGFLSALAVSSSDSQVKFKQYGSVAIRLAMLIGA
                     VVDAEDAVGEHGENKSLATAWNSPELKGELTRVLDSIPEAYISVSYDENRATVTTSTS
                     TIATLQQQLRAANIIATQIDLRGRFHSTAYEKELDALIEFTDSETSLQFPPASSLVLS
                     TWANGGEIIKDDKPHHAALRSILLDHSQWFQTFSAVQSSKLSSSTDTVVSFGPERCIP
                     PSILRRIPAEVIHFAERNPTTRQSDNDIAVVGIACNVAGASDLEEFWNLLCEGKSQHQ
                     PVPAERFGFETIFRDVDTKRTWYGNFIKDHDVFDHKFFKKSPREISSTDPQQRLMLQI
                     AYQAVQQSGYFRTPNPNNKVGCYVGVCAADYENNVACHAPNAFSATGNLKSFIAGKIS
                     HYFGWTGPGLTIDTACSSSAVAVHQACRAILAGDCVSALAGGTNVMTHPIWFQNLAAA
                     SFLSPTGQCKPFDAKADGYCRGEGVAAVFLKKMSAAIADGDMILGTISGTAVYQNQNC
                     TPIFVPNAPSLSDLFRDVTQQSGLTPSQITVVEAHGTGTPVGDPAEYDSIRQVLGGPV
                     RSKPLHLGSVKGLIGHTECTSGVISLIKVLLMIQEGYIPPQASYSSLNPGIKATPSDQ
                     MQISTTLQPWEDSFKAALINNYGASGSNASMVVTQAPSRITIETLSSRKDSVRLPIWI
                     AALDDRSLRAYSARLRQFLSVNTISPKRRSVTNLAFNLSHQSNRALDKALIFSCQSVE
                     EIEQKLRAFEAGDTSVASIPRPAQRPVILCFGGQVSTFVGLDKQVYESVTILRKYLDE
                     VDQVCRSIQVESLYPGIFRRTPFEDPVQLQTKLFALQYASARSWIDCGVHPVAVVGHS
                     FGELTALCVSGVLTLEDAVKMIADRARIIRESWGADKGSMMAVEAEQSVVERLLAESH
                     KACPEERAATIACFNGPRSFTLAGSAKAIDAVQETIRSSFSSMKNKRLNVTNAFHSTL
                     VEPLMNELEHSAKGLTFYEPKIHLAMARENQRAETKLTAKYVADHMRDPVYFNHAVQH
                     LNEQYPSALWLEAGSNSTITTMAGRALGIPATAHFQAVNLTSENGSLQSLTDITVSLW
                     KAGLPVTFWTHHASQSSEYAPVILPPYQFDKVKHWLDLKKPPKAVQEQPAAQPQIQDE
                     LPKSLLTFFGYQDGSKQRSAKWRINTMIPKYGEMVSGHKIAQTAPICPATLEVDIAVE
                     ALRGLRPDFSAAHFQPRIQNVDNQAPLCVDHSRSVWLEADAQDKDCNAWTWKIVSTDS
                     GKNATTIHVTGQIAFNSMEDPQVQSEFGRYERLVGHQRCSRLLNSSDADDIIQGRNIY
                     KTFAEIVDYGQMYRGLQKLVGKDYESAGRVVKKPSGETWLDTHLSDCFCQVGGIWVNC
                     MTDREPQTMYIANGFEQWIRSPKLDSDRPRPEIWDVFAYHHRSSDKAIITDIFIFDAA
                     TGVLTEVILGINYAQVPKLSMSRLLARLSPDISAPAASAPAPAPAKIDAPAISAPVQA
                     NPAKAPKPKKEKKTAAKPNIAGKVKAVLADLAGLEIADIKDDAELADLGIDSLMGMEL
                     SKEIETSFQCTIPVDDLAHVTDFPGLLKCLWSIVGGADESENEEDEKESSGVDELLDT
                     PGVSTPATSVASVPEVDIIAYLAEFLGLGEGDIAPGTLLRDLGIDSLLSTELRSDLEG
                     KFEIHLPHDEPIEELSIEQLDAAINGHPGSASPVEAEKPVAPTAPVNMTVPSNSGGNG
                     LNLPVQTVLEAFGETKQLTDKFIEDYRCADYMDTVNPKQTQLCVALTVEAFEQMGCPL
                     KTATPGQRLDRIQYLPQHQRLADYLYEMLEKEARLIDIDGDRITRTAITIPTKSSEAI
                     LQDLRQQYPDHDFANRLTYFTGTRLKDVLTGNMNGIKLIFGSEEGRELVSGLYGDSLL
                     NKLSYKQMEDFFSRLSSKLPPNHGPLKILEMGAGTGGTTKWVVPLLANLNVPVEYTFT
                     DLSPSFVAMARKKFKAYPFMTFRAHDIEKPPADDLVGTQHIVLASNAVHATHSLIDST
                     KNIRRFLRPDGFLMMLEMTQTVYWIDMIFGLLEGWWLFDDGRRHAISHESRWERDLHS
                     VGFGHVDWTDGHRPEVKLQKIFIALASGPRYDALPIVPRPENKSFPTDNSARAVAVDE
                     YVRKHTSGFAILESHQSAITEISGHFILLTGATGSLGSHLAMHLASLPTVEKVVCLNR
                     RSVGAEAKQRQLDAFKSRGIPIQQNALSKLQVIEVDTAKPLLGLPREEYDHLTRSATH
                     ILHNAWPMSGKRPLKGFELQFQVMRNLINLAAEASSHRPAKVTFQLISSIATVGHYPL
                     QTGQVLVPEERMAIDSVLPNGYGDAKYVCERMLDETLHKRSDRFRPMAVRLGQIAGSS
                     ISGYWNHMEHLSFLIKSSQTLQALPDFDGDLCWTPVDQVAGTLSDLLLGESTPYPIYH
                     IDNPVRQPWKEMIPILADALDIPRKNIIPFSEWVRRVRQFPGHVEWDNPAAKLIEFLD
                     DNFLRMSCGGLLLDTVKSIEHSETLAAVGPVDEDTARKYIRYWKEIGFLN"
     gene            complement(<469069..>470880)
                     /locus_tag="ACHE_70152A"
                     /db_xref="GeneID:66985667"
     mRNA            complement(join(<469069..469269,469320..469811,
                     469859..470363,470410..470611,470661..>470880))
                     /locus_tag="ACHE_70152A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282454.1"
                     /db_xref="GeneID:66985667"
     CDS             complement(join(469069..469269,469320..469811,
                     469859..470363,470410..470611,470661..470880))
                     /locus_tag="ACHE_70152A"
                     /note="COG:S;
                     EggNog:ENOG410PJX8;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139831.1"
                     /db_xref="GeneID:66985667"
                     /translation="MISDSSVDKDTPRPSRQRPGSACDECRRRKLRCDRGQPKCEVCA
                     LSGVVCNFNSSRPPRGPKRGQIRAMQSRIATLERHILEQQSGLLLPADELPVTQLSNE
                     DKDPQIPGNPEPQYRDREGEWGTPDWAGGCIPDLIRAELDQLYFDRVHVSIPILHQRR
                     YFCMVKQATRPEGFSCLQYAMWTLAASLSAQFHQLQWLLYKYTVEKLEAIERDSGGHD
                     CASIQQAQAWILLAVYECIQMNHQRGWISAGRSFRLVQFLRLYEIDSPESLGSSADWI
                     EMEEKRRTFWMAYCLDRFTSFQNGFPLTLNEQVISTRVPAPELDFQSGQPVSMGFLSQ
                     VMASTDQPSLSSFAECIIMATICGRCLCHRQQSSVERIYGDMSLEFWDRHLWLDTILQ
                     QRIQVLSLQYPSTSEHVDSLILFTNLMLQAIVLYLYKIVVSVPWDTDESEALILEYKN
                     RSSAAAQGIITFTKPLRQLTYFKICPFTAIPLFLCAEYFLTNREGDVALDSDFQDILD
                     VLRDLKNVNNLAQMYLALFDLDCVPPTPSSS"
     gene            <472309..>473115
                     /locus_tag="ACHE_70153S"
                     /db_xref="GeneID:66985668"
     mRNA            <472309..>473115
                     /locus_tag="ACHE_70153S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282455.1"
                     /db_xref="GeneID:66985668"
     CDS             472309..473115
                     /locus_tag="ACHE_70153S"
                     /note="COG:S;
                     EggNog:ENOG410PN81;
                     InterPro:IPR005645,IPR029058;
                     PFAM:PF03959;
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139832.1"
                     /db_xref="GeneID:66985668"
                     /translation="MVGRTNTEDVTNLHLPRILCLHGGGTNARIFRAQCRVLEAQLRT
                     NFRLCYAEAPFPSNAGPDVLSVYKDWGPFKRWLRWLPGHPEIDAQTAIEEIERSLYAA
                     MDEDDLKGATGEWVGLLGFSQGAKMCASLLFRQQMQMATVTRNDSPWPQWRFAVLLAG
                     RAPLVSLDPMLMGTGLHLADPSQIGTYMPISFYTGPENTLKLPTIHVHGLQDPGLQLH
                     RQLLDICCDPESTRLIEWDGNHRVPIKTKDVTAVVQAIVDLGIETGCFDV"
     gene            complement(<473207..>474210)
                     /locus_tag="ACHE_70154A"
                     /db_xref="GeneID:66985669"
     mRNA            complement(join(<473207..473379,473425..474120,
                     474168..>474210))
                     /locus_tag="ACHE_70154A"
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /transcript_id="XM_043282456.1"
                     /db_xref="GeneID:66985669"
     CDS             complement(join(473207..473379,473425..474120,
                     474168..474210))
                     /locus_tag="ACHE_70154A"
                     /note="COG:Q;
                     EggNog:ENOG410PJ4Q;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     SMCOG1001:short-chain dehydrogenase/reductase SDR;
                     antiSMASH:Cluster_7.2;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /protein_id="XP_043139833.1"
                     /db_xref="GeneID:66985669"
                     /translation="MPPPRGTPNILEGPGDYDVTSIVHNDTYPAIYPTKTNFSGKSVF
                     ASGASKGLGRAMILSFAKAGASFIAAGARSDMSQLAKDVEAAALSANRPTPTFLPVKM
                     DVTDRKSVEDAAAEVEKAFGKLDIVINNAGILGKFGLITDSNPDEWWQVLDVNIRGPY
                     LVSRSFLPLLLKGEDKYLINVASVAAHLLNPTLSAYQVSKMGLVKLTQLINAEYSGQG
                     VISFAVHPGNSPTDIMGGPEGLTDHEKTIFVETPEISADTLVFLTSQKRTWLGGRYIN
                     CTWDMPELMAKEEEIVKEDKLKVKFLF"
     gene            <474600..>475984
                     /locus_tag="ACHE_70155S"
                     /db_xref="GeneID:66985670"
     mRNA            join(<474600..475119,475170..>475984)
                     /locus_tag="ACHE_70155S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282457.1"
                     /db_xref="GeneID:66985670"
     CDS             join(474600..475119,475170..475984)
                     /locus_tag="ACHE_70155S"
                     /note="COG:I;
                     EggNog:ENOG410PJJ4;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     SMCOG1087:hypothetical protein;
                     TransMembrane:1 (o12-29i);
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139834.1"
                     /db_xref="GeneID:66985670"
                     /translation="MPGVITDQSFDIAIVGGGIIGLVVAMGLMKRNINVKIYEQSRSF
                     REIGAGVAFTANAIRCMGMLNPDIVTALRKVTTANGDPKNPNDYLQYVDGYSHDPNDP
                     DNMEEEVLFKLYAGYKGFEGCHRAHLLDELVKFIPEGTVEFRKRLDTYVDRGEDQKLL
                     LKFCDGTTVEFDAVIGCDGIKSRVREILLGEGNPASYPHYSHKVAFRALIPMDKAEAA
                     LGSYKARNQHMHMGPGAHVLHFAVASQTLMNFVAFAPDPNEWLSDKIMTAPATKEEVV
                     KIFSDWGPTVRAIVNLLPEEFDKWAIFDTYDYPAPTYTKGRVCLAGDAAHASSPHHGA
                     GAGIGVEDALAMAQVLEMAAETLQSTDMSKAQVLRSAFETYDAVRRERSQWLVHSSRN
                     ICDVYEWNNPKTGSNPEKCLEEIKWRSHKIWYFNIEGMLLETRKEFDSRIAA"
     gene            complement(<476910..>478160)
                     /locus_tag="ACHE_70156A"
                     /db_xref="GeneID:66985671"
     mRNA            complement(join(<476910..477112,477171..477739,
                     477791..477873,477922..477980,478031..>478160))
                     /locus_tag="ACHE_70156A"
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /transcript_id="XM_043282458.1"
                     /db_xref="GeneID:66985671"
     CDS             complement(join(476910..477112,477171..477739,
                     477791..477873,477922..477980,478031..478160))
                     /locus_tag="ACHE_70156A"
                     /note="COG:Q;
                     EggNog:ENOG410PWDH;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     SMCOG1028:crotonyl-CoA reductase / alcohol dehydrogenase;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative secondary metabolism biosynthetic
                     enzyme"
                     /protein_id="XP_043139835.1"
                     /db_xref="GeneID:66985671"
                     /translation="MSVSNSGVWLLESGGQFVVKEAPFSKPGDDEVLIQNKAVAINPM
                     DWKIQAFGPHLPFPAHYPFIIGSDVAGEVYEVGKDVTAFKKGDRVIGLANWFLTNDVK
                     DSAFQHYSICKASVVAALPDNISFEAGSVLPLGLSTAAMGVYPAGRLELPLPDATRPS
                     TIDKVVLIWGGSSSTGSAAIQLAVASGATVIATASEKNYDFVRSLGAAAVFDYRKDTI
                     TEDLVQAIKDTPGDFVGALDAIAEEKTWRACADVVKGLGGGRVVSNLPVGFTNVPEGV
                     EVVGVYDTAHLSNNKEIVEAVWGKFVPVALKNGSLKPVPEPLVIGKGLEKIPEGIALC
                     QQGISAGKVVVDL"
     gene            <478592..>480346
                     /gene="MFS2"
                     /locus_tag="ACHE_70157S"
                     /db_xref="GeneID:66985672"
     mRNA            join(<478592..478970,479033..479382,479435..>480346)
                     /gene="MFS2"
                     /locus_tag="ACHE_70157S"
                     /product="MFS siderochrome iron transporter 1"
                     /transcript_id="XM_043282459.1"
                     /db_xref="GeneID:66985672"
     CDS             join(478592..478970,479033..479382,479435..480346)
                     /gene="MFS2"
                     /locus_tag="ACHE_70157S"
                     /note="COG:G;
                     EggNog:ENOG410PFTW;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     SMCOG1106:major facilitator transporter;
                     TransMembrane:12
                     (i63-83o103-121i133-152o158-181i193-214o220-242i299-
                     323o335-356i377-398o404-425i437-460o472-492i);
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="MFS siderochrome iron transporter 1"
                     /protein_id="XP_043139836.1"
                     /db_xref="GeneID:66985672"
                     /translation="MDQKDPEAGHPRRLSWFRIVFDQAVLTSEIIDHPYPGSGTPDDP
                     YLVGWLENDPRDPMQFPAWIKWSLTQVLAFSILAVSFVSSAYSGGISEVMKSLGGSQE
                     ANVLGVSIFVLGFASGPFLWGPLSELYGRQYLFFITYMVHTAFNAGGAGAKNLQTLLV
                     LRFFSGVFGASPLTNAGGAIADMFAASERGLAMTLFALAPFLGPVIGPVVGGFVGETV
                     GWRWLMGVMTIFTGIVWIIGALILPETYAPVLLRRRARKLSEISGKVYISRSDVGQGK
                     AKPSVLFRNALARPWALLFLEPIVLLLSIYMAIVFGTLYLLFAAFPVVFQHGRGWSPG
                     IGGLAFLGVAVGMMGAIAYALWDNKRYIRAGQRDPSGFAPPEARLPVCMIGGIAIPVG
                     LFWFAWTNSPSIHWMVSIAAGVPFGFGIVLIFLGITNYLVDAYTIFAASVLAAGAILR
                     ALFAFAFPLFTTYMYRNLGIHWASSVPAFLSILCLPFPFLLYKYGPAIRRRCKYAAEA
                     DLVLRKIRGLAPAQQSAPTGVTNPLASSEPSSAGENAG"
     gene            complement(<480541..>481914)
                     /locus_tag="ACHE_70158A"
                     /db_xref="GeneID:66985673"
     mRNA            complement(<480541..>481914)
                     /locus_tag="ACHE_70158A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282460.1"
                     /db_xref="GeneID:66985673"
     CDS             complement(480541..481914)
                     /locus_tag="ACHE_70158A"
                     /note="COG:S;
                     EggNog:ENOG410PRSK;
                     InterPro:IPR023213;
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139837.1"
                     /db_xref="GeneID:66985673"
                     /translation="MLGWTETSPGVFKKDFDGAEKIYRKILQSFAHYGKEHWCLHCIC
                     SLRFDPSVHSPESTAGELRNAWKLVRFEFPGLSIIPDDLTKVYTIPTAAAVEQWADET
                     FFVETEKQPDQVLSTIQLPRELPSLYYFPSSSEILFVSSHWRIDAIGTCMLLDRFFTI
                     FVEQPGKTKYEIQWEKEIDNMSPSMEDAAGSATVYTPEIEDLAQKAIAKHQEALKTAG
                     LPYHGDKTTIPGDSSRQAFAFTKESTRNLVSACRAKGITVTAAIHSALAETIFLLGPS
                     EHQDLDHTAVMSVNIRKYLPSPYNSPSHACQTYVTGITPRARRHSSFLDRAAALKEEY
                     KSWYSDLYLHSLRLIYKYHGDALFAPPKPDAAPPSGVFMSSLGVIEPYLRGDYGSLQV
                     EEFRFGVSMITRQMIVYAWTFHNQLVLSVNYNEAYYNKDLVQDVLEKTRSCLETELGV
                     KCETVCI"
     gene            complement(<482337..>483686)
                     /locus_tag="ACHE_70159A"
                     /db_xref="GeneID:66985674"
     mRNA            complement(<482337..>483686)
                     /locus_tag="ACHE_70159A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282461.1"
                     /db_xref="GeneID:66985674"
     CDS             complement(482337..483686)
                     /locus_tag="ACHE_70159A"
                     /note="COG:O;
                     EggNog:ENOG410PI0U;
                     InterPro:IPR036188;
                     PFAM:PF01593,PF13450;
                     SECRETED:SignalP(1-16);
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139838.1"
                     /db_xref="GeneID:66985674"
                     /translation="MKSLAAFSSLATLTLAASQFDTSSYNPSDIITRDVAVIGGGSSG
                     TFGAFKLKDRGKSVVVIESQGQLGGHIETYTDPATGATLDYGVHEFWNISLVTDFFAR
                     FNVPIEDFVFPSEPAIYADFKTGQVLSNFTVGSNFTAYIEQLDRYPDLAYGWDLTYPV
                     ADDLLLPFGDFITKYGLEAEAYNMFTLLPGVGNILEQSTVNIFKGITKILFDSEAGSS
                     IAVTNTNNQLLYEKAQAALGTDALLNSTVINAQRPTDNSNCTLVVMTPTGNKLIVAKH
                     ILVTIPLLLDNMQSFGLDSDESSLFQQFNYTAWYPGLIRNTGLSFSNRYLNVGANTLY
                     NIPELPGIYTLIPTKEDGVFLYWYGAQNALTESEVKDSITSSIKALGGVAPEFMVFGN
                     HTPYELVVPVDAIKNGFYKDLNALQGYRNTWYTGGLFVGASGPLWNFTNTLVGQMTA"
     gene            <484118..>485488
                     /locus_tag="ACHE_70160S"
                     /db_xref="GeneID:66985675"
     mRNA            <484118..>485488
                     /locus_tag="ACHE_70160S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282462.1"
                     /db_xref="GeneID:66985675"
     CDS             484118..485488
                     /locus_tag="ACHE_70160S"
                     /note="COG:S;
                     EggNog:ENOG410PNTZ;
                     InterPro:IPR023213,IPR003480;
                     PFAM:PF02458;
                     antiSMASH:Cluster_7.2;
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139839.1"
                     /db_xref="GeneID:66985675"
                     /translation="MCDFSRYQDVIGQLPLLKSYSHLCLSFPIEDSSPRDEIANKLQA
                     AALKLTTAIPLLAGKVINQGRGPGNSGHFKAVPCSLWTSPNTIVRFKDCSDVCPSHDE
                     LVKAKGPVTMLGGDILCPRKAFPASYEETDSDPAPVVAIQANFIKGGLLLDCAAQHNM
                     IDMSGIEQVLRLLATLMRGEEIPPLAIEQGNRDRRNMIPLLKSTEPLRDHSHLRRAKP
                     GEKQTALVEPDSPYRWCNFRFSSASQARLKALASKPSEHNSAVSFISTNDALSAFCWQ
                     RIITARQHRRRSPTTISKFCRAVDCRRALGVPKEYMGHMVQIATSYLTFQELETLPLA
                     AVASVLRESVNDVNNEYTVRSWTTLIANEPDKSTIVFGGKFNPDTDVGSSSWAHVNLC
                     REEFGTLGKPSLIRRPNFIPLRSDVYFLPHTEAGDIDALVCVNELDFEALTVDGEWNT
                     YTEYIG"
     gene            <486023..>486697
                     /locus_tag="ACHE_70161S"
                     /db_xref="GeneID:66985676"
     mRNA            <486023..>486697
                     /locus_tag="ACHE_70161S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282463.1"
                     /db_xref="GeneID:66985676"
     CDS             486023..486697
                     /locus_tag="ACHE_70161S"
                     /note="COG:S;
                     EggNog:ENOG410Q29X;
                     antiSMASH:Cluster_7.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139840.1"
                     /db_xref="GeneID:66985676"
                     /translation="MPRPRNTVASTRANRNETNNDDTNRNEANTNTERENRQNPILID
                     GDENEEQRMMTLEEFLQYASEEPEWLYEKLQATHQRYDDSLDDHKVRLAEEELRGQTK
                     DGEIALLRRETEEMKGQLQDIKKQLTDVTAERDAFGSQIARLVMDSASGRRASPMPIN
                     SKSTKIPDPPMLTDGKEPRFEDWLLLMSQKLTANADHFDTSQLRIAYVASRCDGKARK
                     HITPRM"
     gene            complement(<493847..>494476)
                     /locus_tag="ACHE_70162A"
                     /db_xref="GeneID:66985677"
     mRNA            complement(<493847..>494476)
                     /locus_tag="ACHE_70162A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282465.1"
                     /db_xref="GeneID:66985677"
     CDS             complement(493847..494476)
                     /locus_tag="ACHE_70162A"
                     /note="COG:S;
                     EggNog:ENOG410PVMS;
                     InterPro:IPR003806;
                     PFAM:PF02655;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139841.1"
                     /db_xref="GeneID:66985677"
                     /translation="MFDAVRRYRERGGTEVELSEFIHSRRPHYGVNFFVSGYDTPQPC
                     FLGATEQVVTKNGVWVGVIIDYRVQEDLERRLQQTIAAVARTLRKSSYMGWVGIDLIF
                     DLNDQPLVVDLNARIAAGIGVVLFSRHFLSMGFPFAQMETVSFCGPASVPYDAMSAEI
                     ESGQVIVTLSAEVTETESVASVVFGGRTREDLHTVGDWIRDVLPACFKT"
     gene            <497115..>498078
                     /locus_tag="ACHE_70163S"
                     /db_xref="GeneID:66985678"
     mRNA            join(<497115..497321,497374..>498078)
                     /locus_tag="ACHE_70163S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282466.1"
                     /db_xref="GeneID:66985678"
     CDS             join(497115..497321,497374..498078)
                     /locus_tag="ACHE_70163S"
                     /note="COG:Q;
                     EggNog:ENOG410PP6F;
                     InterPro:IPR026992,IPR027443,IPR005123;
                     PFAM:PF03171,PF14226;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139842.1"
                     /db_xref="GeneID:66985678"
                     /translation="MDLHGTHTGNNILKNADRLFAIEQELFDLSLEEKQRYDFSKEGS
                     YFGYKAQGASVVDKKGNLDRNEFYNVSKDDIVGVSTPLPAPDVIHRERATLKSFIENA
                     HSIVGIVLRILNQHPQLPSSTLTNLHRLRGVSGDQVRFIKAPPQPKDDKQTALGEHTD
                     FGSVTILFNRVGGLQVLPPGQGAEWCYVRPLPGHAIINLGDAMVKFTNGLLRSNIHRV
                     VSPPGAQTNSTRYSLVYFARPEDEVKLKRLDGSTCIPPLPEGVVEEDINSKDWIKRRA
                     LGNRVALHKEIDFDKFMGTEQQSRRLA"
     gene            complement(<501151..>503316)
                     /locus_tag="ACHE_70164A"
                     /db_xref="GeneID:66985679"
     mRNA            complement(join(<501151..501670,501728..>503316))
                     /locus_tag="ACHE_70164A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282467.1"
                     /db_xref="GeneID:66985679"
     CDS             complement(join(501151..501670,501728..503316))
                     /locus_tag="ACHE_70164A"
                     /note="COG:S;
                     EggNog:ENOG410PWUX;
                     TransMembrane:4 (i12-33o63-85i125-144o558-583i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139843.1"
                     /db_xref="GeneID:66985679"
                     /translation="MAWFPFNLRSSAPILMVSSFLAALAFSIGHHAFYQRLNDKSVLN
                     SSPFSLTKSYHVSDQQVNVSVGTFFAFLVKALLGVAVSTVFDQFAWKSIKDHTSRIGS
                     IDDLFSVLKNGFMILNFPLWRHYPVSMLLACIAWLLPVASIITPATLNVHMASFANST
                     STKVPRVDFANINFSNLKLINGSGTDALHYSDSTPEVQQIVYSTAMQKTVLPITPPFS
                     NSSWVLDFSGPALGCEHADDKLRRDVMENVRSTIINATFVDVNKTLLASSFGYLSWMP
                     EGYGYGSLPFIQSYVDEGLYNELPGTVYNMFPGKYDSQIMGPLQLYMVTLPHMLAQGD
                     LSNADLNRTTEDATFLTCTLYNASYTANFTYFNGQQNIQLRKVERLNKVDYLSDMYTY
                     SGSGDLAGIHNRTAMETFSYQSIMAQFGSLLTGNINKETYHVKDTTRLGGNGRTIHST
                     NSSSIRIDRTSVMTTGLSNTNEFSTLRMAIYEDNHGDSLSNFWREQSTIQPNNTSIPL
                     SDALEQLFQNITLSMMSSSVFQPNYSMSDIPDVNVTMITYRNIYAYSQSILWTAYGTA
                     LAVSFLSVILGVIIFFVNHGSYSSKFSTVMRTTRTADISTGLNAEDAKGIDPTPGHIN
                     NANIYFNDGPNQKLGRSVTNVEPNAEKEVPETVERTRTAEVSEPTEAVLDGGLSPVSD
                     QESRPPSWFVEMQRDHGADH"
     gene            complement(<516309..>516692)
                     /locus_tag="ACHE_70165A"
                     /db_xref="GeneID:66985680"
     mRNA            complement(<516309..>516692)
                     /locus_tag="ACHE_70165A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282468.1"
                     /db_xref="GeneID:66985680"
     CDS             complement(516309..516692)
                     /locus_tag="ACHE_70165A"
                     /note="COG:S;
                     EggNog:ENOG410Q0U3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139844.1"
                     /db_xref="GeneID:66985680"
                     /translation="MGGAKKKGVVGAASPWPDHSYNHKDHDQCAHAAAILTETAELKQ
                     IADRTQGLPPRDLFIRFMSSVEDLAAKVRDRQSNNGSEDHNGQKEALQQIQNMLNKQT
                     EEIKTLQHSTQAPKVIHSPPSYTPS"
     gene            <519925..>521417
                     /locus_tag="ACHE_70166S"
                     /db_xref="GeneID:66985681"
     mRNA            join(<519925..520289,520374..521079,521160..>521417)
                     /locus_tag="ACHE_70166S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282469.1"
                     /db_xref="GeneID:66985681"
     CDS             join(519925..520289,520374..521079,521160..521417)
                     /locus_tag="ACHE_70166S"
                     /note="COG:E;
                     EggNog:ENOG410PKZ3;
                     InterPro:IPR001692,IPR012131,IPR022695,IPR016161;
                     PFAM:PF00815;
                     go_function: GO:0004399 - histidinol dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0000105 - histidine biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139845.1"
                     /db_xref="GeneID:66985681"
                     /translation="MGRQYLKARAVLSEKGATPSVDVPGIVREVIETIRKDGDKAVTK
                     YSEKFDKWSPQSFKLSQSDIDAAIANCSKQTLDDIKEVQQNVRLFAEAQKASLKDFEV
                     EIKPGVHLGQKNVPIDNVGAYIPGGRYPLLASAHMTILTAKVAGVKHVIGCTPPVNGQ
                     IPNSTVAAMHLAGVDEIFLLGGVQAVAAMAVGTESIQKVDFIAGPGNAFVAEGKRQLF
                     GEIGIDLFAGPTEILVLADETADPFTIATDLVSQAEHGPDTPAVLITTSPDVGWKAIE
                     AVNQLLGFSDLSTAGVAKTSWEAFGEVIVVDSMDDLWQLANHYASEHVQVFTRNPRDA
                     LVRMTNYGTLFLGERTCVSYGDKVIGTNHVLPTRSTARYTGGLWVGKYLKTCTYQEVT
                     SEKASGDLGRLCGRAARAENFEAHARSGDLRAAQYTSDNFEWIQKTKARM"
     gene            complement(<522201..>522825)
                     /locus_tag="ACHE_70167A"
                     /db_xref="GeneID:66985682"
     mRNA            complement(join(<522201..522432,522488..>522825))
                     /locus_tag="ACHE_70167A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282470.1"
                     /db_xref="GeneID:66985682"
     CDS             complement(join(522201..522432,522488..522825))
                     /locus_tag="ACHE_70167A"
                     /note="COG:S;
                     EggNog:ENOG410PVUW;
                     InterPro:IPR014710,IPR011051,IPR025979;
                     PFAM:PF12973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139846.1"
                     /db_xref="GeneID:66985682"
                     /translation="MSPLNHNDLPTRPAPAKSGAILDNKESKLTQLEKSELALADKYS
                     SPDVYISGEADTCWHPWTANLELKPLRFETRTGTFVVVLRSLEDTWLGKHRHRGTVTA
                     VTLNGEWNYKEYDWIAKPGDYVVENPGTIHTLHMNKGAEVLFTVSGSLEFFHDDDSLK
                     NTMDVFSYAHMYYEHCKAQGLKPNDGLWY"
     gene            <524210..>525708
                     /locus_tag="ACHE_70168S"
                     /db_xref="GeneID:66985683"
     mRNA            join(<524210..524913,524974..525188,525256..525353,
                     525413..525509,525569..>525708)
                     /locus_tag="ACHE_70168S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282471.1"
                     /db_xref="GeneID:66985683"
     CDS             join(524210..524913,524974..525188,525256..525353,
                     525413..525509,525569..525708)
                     /locus_tag="ACHE_70168S"
                     /note="COG:S;
                     EggNog:ENOG410PHYQ;
                     InterPro:IPR021858;
                     PFAM:PF11951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139847.1"
                     /db_xref="GeneID:66985683"
                     /translation="MRCQSAGQNSGSGADAVSPSLSPLSPGFSEWPPALPSQSLQLLG
                     MSPKPLTSEDARFLRLFSAEVGQWMDLSDLSQTFSRKICRLAMHDPLLKAAIIACAAK
                     QQYLTGRLFDGMLIARKNYNTAISLLIDRLQESEQPFAGFGFAATVICSCYEMLDATG
                     RDWQKHLDGVFSFSQVRSVNGSSGGIEQAGFWSIARQEVVCSIINKSRLRLDPDLWAV
                     DLVRIGQEGCEDLMNNQILTILAKVANAIAHWEADKPRKLRAVDEWKSLWDLLNHWER
                     SVTAKGFMDPVLYKEDGQLFTTIWFTRGVCASSWQMFHLTRILLLSIDPSQTLDCVAA
                     FRNIEGKLQYHARQICGIAQSKPEGSCRVNSVQPLHYAGCCFSNTDERNAVALLLESI
                     EEDLGWAAKYRANDLYRQWGWRRDF"
     gene            <526790..>529149
                     /locus_tag="ACHE_70169S"
                     /db_xref="GeneID:66985684"
     mRNA            join(<526790..526889,526943..527549,527607..>529149)
                     /locus_tag="ACHE_70169S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282472.1"
                     /db_xref="GeneID:66985684"
     CDS             join(526790..526889,526943..527549,527607..529149)
                     /locus_tag="ACHE_70169S"
                     /note="CAZy:GH36;
                     COG:G;
                     EggNog:ENOG410PIUQ;
                     InterPro:IPR000111,IPR002252,IPR031705,IPR031704,
                     IPR017853,IPR013780,IPR013785,IPR038417;
                     PFAM:PF02065,PF16874,PF16875;
                     SECRETED:SignalP(1-27);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_function: GO:0004557 - alpha-galactosidase activity
                     [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA];
                     go_process: GO:0016052 - carbohydrate catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139848.1"
                     /db_xref="GeneID:66985684"
                     /translation="MRWFSHREAVAAASVLSLATQSQVAVAESANGNAVVANGTSFAL
                     NGDNVSYIFHIDPVTGDLISDHFGGSVTGAIPAAAEPIVNGWVGRPGRIRREFPDQGR
                     GDFRIPAVRIRQSAGYTISDLQYQSHTIVQGKPGLPGLPATFGSEEDVTTLVVHLHDN
                     YSSVGADLSYSIFPKYDAIVRSVNITNHGEENITIEALSSLSVDLPYEELEMIYLRGD
                     WAREAHRERRKVEYGLQGFGSSTGFSSHLHNPFLSLVHPSTTESQGEAWGFSLIYTGS
                     FSVDVEKGSQGFTRALLGLNPSQLSWTLRPGETLTSPECVSVYSATGIGGMSRSLHRL
                     YRKHLIKSKFATSDRPALLNSWEGLGASINASNVYKLAEESAALGIKLFAMDDGWFGN
                     EYPRNDDTAGLGDWQVNRAKFPDGLGPLVNNVTALKAANTSTPLRFGIWVEPEMVNPN
                     STLYHKHPDWALHAGDYPRTLHRNQLVLNVALPEVQEFIIDSMTRLLKSADISYVKWD
                     HNRGMHEAPSPSTDHAYMLGLYHVFETLTSRFPDVLWEGCASGGGRFDPGVLQYFPQI
                     WTSDDTDGAERVAIQMGTSLAYPPSAMGAHISAVPNQQSLRSVPVSFRGHVAMMGGSF
                     GLELNPDELHEDEKTVLPGLIQLAEKVNPIVLEGDMWRLALPEESNWPAVLFISGDGT
                     RAVLFAFQMRANIDNSSPWVRLEGLDAKAEYRVDGGSVYTGQTLMNMGLQFVFEGDYE
                     SRVVMLERV"
     gene            <532903..>533724
                     /gene="ASPERGILLOPEPSIN2"
                     /locus_tag="ACHE_70170S"
                     /db_xref="GeneID:66985685"
     mRNA            <532903..>533724
                     /gene="ASPERGILLOPEPSIN2"
                     /locus_tag="ACHE_70170S"
                     /product="aspergillopepsin-2"
                     /transcript_id="XM_043282473.1"
                     /db_xref="GeneID:66985685"
     CDS             532903..533724
                     /gene="ASPERGILLOPEPSIN2"
                     /locus_tag="ACHE_70170S"
                     /note="COG:S;
                     EggNog:ENOG410PNBI;
                     InterPro:IPR038656,IPR000250,IPR013320;
                     MEROPS:MER0001321;
                     PFAM:PF01828;
                     SECRETED:SignalP(1-18);
                     go_function: GO:0004190 - aspartic-type endopeptidase
                     activity [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="aspergillopepsin-2"
                     /protein_id="XP_043139849.1"
                     /db_xref="GeneID:66985685"
                     /translation="MKFSSILTGSLLASAALAAPLTEKRQARHEARRANKQRHSNPPL
                     IPGTSKEVLKVTNTTQAQYSSNWAGAVLIGSGYTTVTGEFTVPSVSAPSSGAGGFGLG
                     EESCASAWVGIDGDTCETAILQTGVDFCYQGGQASYSAWYEWYPDYAYDFSGITISEG
                     DSIRVTVEASTESTGTATVENLTNGQSVTHRFTGGTQGDLCETNAEWIVEDFESGGSL
                     VSFADFGTVTFTNAEATSNGRTVGPSGATIMDIRQNGQVLTEASVSSDSVTVSYV"
     gene            complement(<536343..>537536)
                     /locus_tag="ACHE_70171A"
                     /db_xref="GeneID:66985686"
     mRNA            complement(<536343..>537536)
                     /locus_tag="ACHE_70171A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282474.1"
                     /db_xref="GeneID:66985686"
     CDS             complement(536343..537536)
                     /locus_tag="ACHE_70171A"
                     /note="COG:Z;
                     EggNog:ENOG410PGZB;
                     InterPro:IPR007122,IPR007123,IPR029006;
                     PFAM:PF00626;
                     go_function: GO:0051015 - actin filament binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139850.1"
                     /db_xref="GeneID:66985686"
                     /translation="MAPHEGLVHPKEYDIKNSNVELIGTDIDHRVKYNSAASEPAWNN
                     GKIGQEPGLFIWRIENFQVVPWPKERLGEFYEGDSYIVLHSYKVGDADKLGHDIFFWL
                     GNKTTQDEAGTAAYKTVELDEFLHGAATQHREVQRHPSEEFVSLFRRISIKSGGVASG
                     FRHVEEEEPKEVLTLLRIFKHPGAGRIDSIIVHEVEPTWQSLDDGDVFVLDKGDKIWV
                     WQGKSCSPMEKAKAAQVVNDLILAKHVDVEVLSQLEPRSKIIVDLLGGKEVNQLSFQA
                     PRPVSFPKKTGDDNIDARPRKLFRFSDSSGALSFDLVKDGGRIRQSDFDGNDVFLYDS
                     GNRLWVWQGLGASAREKALWIKVAQAYLRQLQESQESSEAYLTPIAKVVQGHESPAFA
                     KALEV"
     gene            <538300..>539650
                     /locus_tag="ACHE_70172S"
                     /db_xref="GeneID:66985687"
     mRNA            join(<538300..538328,538376..538396,538444..538522,
                     538570..538843,538911..539097,539161..>539650)
                     /locus_tag="ACHE_70172S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282476.1"
                     /db_xref="GeneID:66985687"
     CDS             join(538300..538328,538376..538396,538444..538522,
                     538570..538843,538911..539097,539161..539650)
                     /locus_tag="ACHE_70172S"
                     /note="COG:S;
                     EggNog:ENOG410PWDQ;
                     TransMembrane:2 (i197-219o336-356i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139851.1"
                     /db_xref="GeneID:66985687"
                     /translation="MRKEGKRTWWCIYSHEVEMCCSSGRLDSMKDLDYYQVPLPTLKT
                     TPGHEQDPDTEDNDVAMIPVMVALAQIMTKASHHLYHSNKRSMHERSRIAMDLDRRLL
                     AWKEGLPAFLNVDKASLNDPEWAFKQKLVLRLRFYNTRILIHRPFLVASTSTSTSTST
                     SEQISYLNHIHLCLAAAQSSIQMQYESFLHRIYIRTWWYNTTYALYSSMILLYLILAG
                     VPDIPEEELLKDVEKSLDIFESMRNVVVARRCAEMIREVMDVTRECLRRRPADHAQVL
                     RPQSQQQQQMQMQPTSPSLILGTGTGTGPTVMANESSALHQNYSNATTLNNYNFDSHP
                     QAFITGLNPIATAVLTAIPLYIKQL"
     gene            complement(<539689..>540696)
                     /locus_tag="ACHE_70173A"
                     /db_xref="GeneID:66985688"
     mRNA            complement(join(<539689..540161,540210..540541,
                     540662..>540696))
                     /locus_tag="ACHE_70173A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282477.1"
                     /db_xref="GeneID:66985688"
     CDS             complement(join(539689..540161,540210..540541,
                     540662..540696))
                     /locus_tag="ACHE_70173A"
                     /note="COG:S;
                     EggNog:ENOG410PWDQ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139852.1"
                     /db_xref="GeneID:66985688"
                     /translation="MEWITAGRILSWTEFYGNSSNLAFLGNLYARARKHRAPHVSGDG
                     YFYGDFQSTAGPSQAYAEDRNKDSTKATDRTQLSIVNLLYNPSYPSNSSSQSPWESEK
                     DKDKTVQTDNPETPSNNIILGSGIAPVNQLANESQLEIEKTFISSYFSNKHYIHPMLC
                     KSSFLRRCEREAFNLSRRKSFACGSSNFAGLYFAVVALGAINASPDETSLLDHYCTYS
                     PDPRRPGTGSVGGYSALDFANFYFGAAKRALGDVSESCSLESAQALMLLVCLRLWWFV
                     GLC"
     gene            complement(<543600..>545787)
                     /gene="DAL81"
                     /locus_tag="ACHE_70174A"
                     /db_xref="GeneID:66985689"
     mRNA            complement(join(<543600..545274,545345..>545787))
                     /gene="DAL81"
                     /locus_tag="ACHE_70174A"
                     /product="fungal specific transcription factor"
                     /transcript_id="XM_043282478.1"
                     /db_xref="GeneID:66985689"
     CDS             complement(join(543600..545274,545345..545787))
                     /gene="DAL81"
                     /locus_tag="ACHE_70174A"
                     /note="COG:K;
                     EggNog:ENOG410PGMJ;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF04082;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="fungal specific transcription factor"
                     /protein_id="XP_043139853.1"
                     /db_xref="GeneID:66985689"
                     /translation="MAAVITLQSSSAAGPAVPSFQQQQQQQPQSQPHSPDSQPSHRRR
                     LSRAQQQQDGPPSTPLSPVSSSTLTASAARAPGRDGPSCDACLRRKSRCAMNEMVNKC
                     YSCDFHRQECTFNLSSGAARPNTAEPLSKKRKLEDSVPEDAESVKRSSTVAATKQGQG
                     HYLVPGFFDQSIQYIGLTTEFEPALLDHVPLDQNNEGIVSNFRLRKLGDDTYIRVRNT
                     MPDSVSVDAIESLVAPYGATLIEKFFEYVHPTFPILMEDTFRQTYRTRKNLSPLLLAA
                     VYVLTLKFVDMPASQSVRRPDVARLESTALKLLTESLPRATVATIQAGLLLMEKSTVA
                     TRALNAQLVTAGFELGLHQDCTHWRMDTWEKGLRKRLAWALYMQDKWSSLVHGRPSHI
                     FAWNWTVKDLVEQDFVDAFHADSNQDDTSVGHGPLYFCHMVALTTILSDILDRFYTLQ
                     AIEDFKASGGNRTRMILERAKPAQIRLKEWFARLPPQLKMDTSGDLFDTITEENARNG
                     ALHLSYFATEITLHRCIIRSLSPETADAYLSHICRSAAKTRLISAMDFVNRLRPAHLR
                     SFWPSASRHNFTLIGSFGILLRVTAPTKEESEFYRLRLCEYRWTLSVSRKNAEFLDFS
                     LDSLDNATNLDRHVPDKPAIDELMHSAVKPTITSRPVPVIALDDPDPMLEAGGTSSVI
                     SGLASPATSVSDESLRDTPIPPL"
     gene            complement(<547798..>548372)
                     /gene="RPB4"
                     /locus_tag="ACHE_70175A"
                     /db_xref="GeneID:66985690"
     mRNA            complement(join(<547798..547925,547998..548125,
                     548182..>548372))
                     /gene="RPB4"
                     /locus_tag="ACHE_70175A"
                     /product="RNA polymerase B"
                     /transcript_id="XM_043282479.1"
                     /db_xref="GeneID:66985690"
     CDS             complement(join(547798..547925,547998..548125,
                     548182..548372))
                     /gene="RPB4"
                     /locus_tag="ACHE_70175A"
                     /note="BUSCO:EOG09264ZI5;
                     COG:K;
                     EggNog:ENOG410PP7T;
                     InterPro:IPR006590,IPR010997,IPR038324,IPR005574;
                     PFAM:PF03874;
                     go_component: GO:0030880 - RNA polymerase complex
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_process: GO:0006352 - DNA-templated transcription,
                     initiation [Evidence IEA];
                     go_process: GO:0044237 - cellular metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="RNA polymerase B"
                     /protein_id="XP_043139854.1"
                     /db_xref="GeneID:66985690"
                     /translation="MSVQLPPATHRKRALPQGELEAASTLKLGADQNTHTLSLSEARL
                     VINKVLENKRRGGKKYEEPENLTKTMDYLEVFARFKDEENIKAVERLLNSHTELEMFE
                     RSQLGSLCCDNAEEAKSLIPSLQNKISDGDLQELLDELTKLRNFTE"
     gene            548716..548820
                     /locus_tag="ACHE_t70003S"
                     /db_xref="GeneID:66987447"
     tRNA            548716..548820
                     /locus_tag="ACHE_t70003S"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:66987447"
     gene            complement(<549488..>551062)
                     /gene="TRM5"
                     /locus_tag="ACHE_70176A"
                     /db_xref="GeneID:66985691"
     mRNA            complement(join(<549488..550398,550469..550546,
                     550597..550698,550762..>551062))
                     /gene="TRM5"
                     /locus_tag="ACHE_70176A"
                     /product="tRNA(m(1)G37)methyltransferase"
                     /transcript_id="XM_043282480.1"
                     /db_xref="GeneID:66985691"
     CDS             complement(join(549488..550398,550469..550546,
                     550597..550698,550762..551062))
                     /gene="TRM5"
                     /locus_tag="ACHE_70176A"
                     /note="BUSCO:EOG09262I0R;
                     COG:A;
                     EggNog:ENOG410PI9Q;
                     InterPro:IPR030382,IPR025792,IPR029063;
                     PFAM:PF02475;
                     go_function: GO:0009019 - tRNA
                     (guanine-N1-)-methyltransferase activity [Evidence IEA];
                     go_process: GO:0030488 - tRNA methylation [Evidence IEA]"
                     /codon_start=1
                     /product="tRNA(m(1)G37)methyltransferase"
                     /protein_id="XP_043139855.1"
                     /db_xref="GeneID:66985691"
                     /translation="MAPKTSTDESNPPPPSNDLPEMFRPPINRAMRVLDRSFFQKKIP
                     LSAAAIYKASDISNVRKELLKSRDMLALPRLNSIREVKDEGEVRRGILLREDVRHDDA
                     ATWSPKINELVEKGTVGLRPFDLELDYDYWNYSDIIASILPEDLLDEIPQGFTQVGHV
                     LHLNLREQYLPYKHLIAEILKDKNSTIRTVINKIEDVGSHSEFRTFPFEFLAGDNDTN
                     VTVHEQDCKFCFDYARVYYNSRLETEHRRLVNKFHPGEMVCDVMAGVGPFAVPAGKKK
                     IFVWANDLNPHGTEAMQEAVKTNHVDQFVLPFNKDGRLFIPWSAKELLQSDPLTVSLK
                     PKRPRKPEETPRHPEEYTRPSIFNHYVMNLPATAIDFLDAFAGVYAGHESLFTAQQPL
                     PMIHVYCFSGHSENERDDHVDICQRISEKLGYTITPEYPELEIHNVRLVSPKKQMFCA
                     SFRLPAEVAFRTV"
     gene            complement(551341..551445)
                     /locus_tag="ACHE_t70004A"
                     /db_xref="GeneID:66987448"
     tRNA            complement(551341..551445)
                     /locus_tag="ACHE_t70004A"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:66987448"
     gene            complement(<551724..>553340)
                     /locus_tag="ACHE_70177A"
                     /db_xref="GeneID:66985692"
     mRNA            complement(<551724..>553340)
                     /locus_tag="ACHE_70177A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282481.1"
                     /db_xref="GeneID:66985692"
     CDS             complement(551724..553340)
                     /locus_tag="ACHE_70177A"
                     /note="COG:Q;
                     EggNog:ENOG410PWMI;
                     InterPro:IPR020946,IPR036188;
                     PFAM:PF07992,PF13738,PF13450;
                     go_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139856.1"
                     /db_xref="GeneID:66985692"
                     /translation="MAFKPAQHIDILIVGAGFGGIGQAYALRNLGLCIKVIDSLPDVG
                     GTWLTNIYPGALSDTESFVYRFSWDAEDLQTYPWNRRYLRQPEILAYLRHFVERHDLR
                     KYMQFNTELQSAKWMEETGVWEVRVNTGEIYWSRYFIPAMGVLSKPNFPDIPGIESFK
                     GRITHTSHWPADLDVTNKRVGVLGCGASGVQVITNIAPHVSSLTAFIRRPQYTLPSND
                     RPISPAYRIWVNKHYDQIWAQLKTSFAGFGYVESNRPYFSVDPHRREQLLEDLWNNGN
                     GLRFMVEHFCDITTNADANDAICDFIRRKIYQIVNDPEKARKLIPNERFARRPISNDG
                     YYETFNRENVSIVDLKETPIEEITTDGIRTADGICHTLDVIILATGFDAVEGNLIRAD
                     IVGRDGIALKDAWAKGPKSYLGSFAAGLPNMFMVNGPKGAFGNVIPAIEASVEFITNA
                     IQRAECARTEHGSRGIVEATLEAEGEWGERCEQASKGSLFSEVKGSWLSGGNVPGKPV
                     GVRTYLGGLGNYRAMGNSATKDAWKGFELF"
     gene            <554036..>556072
                     /locus_tag="ACHE_70178S"
                     /db_xref="GeneID:66985693"
     mRNA            join(<554036..554278,554339..>556072)
                     /locus_tag="ACHE_70178S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282482.1"
                     /db_xref="GeneID:66985693"
     CDS             join(554036..554278,554339..556072)
                     /locus_tag="ACHE_70178S"
                     /note="COG:K;
                     EggNog:ENOG410PHTN;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139857.1"
                     /db_xref="GeneID:66985693"
                     /translation="MARLRQLEDTVEYLRHPVTSGANGENCAREEAGSEKCPYSYTDP
                     KTVLRGHDGKEEFGRLVVEDGCCRYVSNRLWASLSDQIAGLYDLLEQPSPCVDDDSDV
                     AHPSNKSHDAFIFGYNSVAQSLVNYHPNAVQLSVLLNAYKQNVAPLLRILHPQTIQKV
                     IYRSHRVQDEISECLLFALCFSAAVSMSSEECELLLLEKKEVVVDHFRFATEQACPRA
                     RIMSSKSLTLLQAIVLYLASLRSVGETEFAWTMTSTAVRLAFGLGLHRDGSNFGLEPF
                     EAEMRRRLWWYICILDVQTAEDLGTDPMLHDIFFDTKLPLNINDEDIYEGMKNLLQER
                     VGCTDMTYFLLQCEVALATRRLTYNPPGNICPGLKSIEERQYLVQDLEKRLDERYVRH
                     CDPTIPLQLACSKIVRIAVAKLWLVIYQPLNKQESITSLPPDTQSMLLSNAVEVIELS
                     HRLQTNDTMARWKWEFQTCVPWYAVAYLLAQLCNSPNSPPLEQSWCRVSDIFNQWKRK
                     AVEENKPLWQPLPRLMAQATASREKQRNEERQTHVNLSHTGFQSQVSETTTPEIIEDS
                     LAPVDYSAIEQILEHTGPALHTFPDFSEIDGLNVPHIGDLDIASSGSGIFSYSIPSTI
                     TFLDQNSRGSIDTSPFSSQDHPVREIDQPYYWKP"
     gene            <558071..>559770
                     /locus_tag="ACHE_70179S"
                     /db_xref="GeneID:66985694"
     mRNA            join(<558071..558191,558241..558750,558810..559002,
                     559059..559208,559257..>559770)
                     /locus_tag="ACHE_70179S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282483.1"
                     /db_xref="GeneID:66985694"
     CDS             join(558071..558191,558241..558750,558810..559002,
                     559059..559208,559257..559770)
                     /locus_tag="ACHE_70179S"
                     /note="COG:S;
                     EggNog:ENOG410PIGJ;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:1 (i157-174o);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139858.1"
                     /db_xref="GeneID:66985694"
                     /translation="MASGSRGHNASELGEIDVSESSIDGMGAMKFTDEEDCGFFGPSS
                     NIAFMRYISRAIAKASPHRDPTLNPSTPQRECGRKVSVAKSRPPSRGPELGAENLIPS
                     PAVNIYALPSEERTWSLIQQYFYKTGQLLPFIHERSFCETYFQMKRERFSKVRRTWLG
                     LLNIVLAIAASLSTNGDMPAEKRIQESDVYYQRANGLCDRDSRRNASLEMVQYLLILG
                     QYLQGTQKSVQAWTAHGLAISAAYQLGLHSPDANRGFPPLECEVRKRTWFGCVLLDRT
                     LSMTFGRPCAIPESYVKLDMPSQDLQMLSLTAETETHPTLDGSFFTAAIKLYVILYSV
                     LELCYGANLGFEVSTNSIDAMSGILEGQRRLDEWRLQLLPSLGLKVWDIPTSREDVEK
                     MDAGSVIRHRFNVVLSVRYNNLRILLHRRCLESLLDSFQTQDNTMVTSETRLLQHMGL
                     GSVVSCVESAVSIISTVYNMSSGSGWRREFLGAWNYSLYYSRSSV"
     gene            <560482..>562249
                     /locus_tag="ACHE_70180S"
                     /db_xref="GeneID:66985695"
     mRNA            join(<560482..560540,560763..560874,560940..561641,
                     561692..>562249)
                     /locus_tag="ACHE_70180S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282484.1"
                     /db_xref="GeneID:66985695"
     CDS             join(560482..560540,560763..560874,560940..561641,
                     561692..562249)
                     /locus_tag="ACHE_70180S"
                     /note="COG:C;
                     EggNog:ENOG410PKPS;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494,PF00070;
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139859.1"
                     /db_xref="GeneID:66985695"
                     /translation="MAPNSPTVRRPDFLHLIEQHVHVGIVGAGIGGLAAAIAFRRAGV
                     DVTVLEAAEELLEIGAGIQMTPNVSVLLQRWGVADVIGDNLVQIEELNMRRKDGTIVG
                     HTDIPVVERALGRPWWLVHRAHLHDGLAVVAKRLEAVIHINSRVVSLEYQAGGEVTVK
                     TQKGDTYQFDLCVGADGVNSIVRRTLFPEVRPDAKTTNCAYRAVIPYERIRQDAIAKE
                     IIQKQTMEVWMGHNAYIITYPISGGEVFNLVLSHHRPEKVYATQPDVAIEELRNEYKS
                     FDPRIKRIVDMIPETSRWPLLVTGPLKSWSSPQKNIVLMGDAAHSMVNHMAQGAATSM
                     EDGAFLAKCVGAVALGNLSLREAINIYEVERMPKAFLKQQVSFLNGAIWHLPDGPKQQ
                     ARDAAMAPELEGKYQVRSSNLYGDPQTVLDVYGYDAEIHAEEALVQFANGGSVVYPGT
                     GIVPGLEDKYMGWFMKLPANQPHPRL"
     gene            <562509..>563371
                     /locus_tag="ACHE_70181S"
                     /db_xref="GeneID:66985696"
     mRNA            join(<562509..562740,562798..562961,563015..>563371)
                     /locus_tag="ACHE_70181S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282485.1"
                     /db_xref="GeneID:66985696"
     CDS             join(562509..562740,562798..562961,563015..563371)
                     /locus_tag="ACHE_70181S"
                     /note="COG:I;
                     EggNog:ENOG410Q2R4;
                     InterPro:IPR033118,IPR007905;
                     PFAM:PF05241;
                     TransMembrane:5 (o35-57i69-91o122-147i154-174o186-209i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0047750 - cholestenol delta-isomerase
                     activity [Evidence IEA];
                     go_process: GO:0016125 - sterol metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139860.1"
                     /db_xref="GeneID:66985696"
                     /translation="MAATVQLSNESIAVPHPYYPQTIHLPHYVRNETSVFSLIAQFGF
                     LWTAVIGLAFVFIRRIRPTASRSDQVAFTWMCLTGFIHLFFEAYFVVNHETLASSQGL
                     FGQLWKEYSLSDSRYLTSDAFVVCMEAITAFAWGFLAFYIAYCIAVEHPARYALQLII
                     SVGQVYGDILYYATSLLDVSYCRPEGYYFWFYYFFFNFIWMVVGCCEYCPSLRLTSKS
                     ILTGLDYIKQSVVEISRAFGRLAEGDALRKAK"
     gene            <567207..>567674
                     /locus_tag="ACHE_70182S"
                     /db_xref="GeneID:66985697"
     mRNA            <567207..>567674
                     /locus_tag="ACHE_70182S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282487.1"
                     /db_xref="GeneID:66985697"
     CDS             567207..567674
                     /locus_tag="ACHE_70182S"
                     /note="COG:S;
                     EggNog:ENOG410Q11R;
                     InterPro:IPR021842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139861.1"
                     /db_xref="GeneID:66985697"
                     /translation="MIRVICGLDPDVELMRAVTRQSRWRDTRRPRYLTKQQRDQIEDH
                     PDLERARRNLHSARAHYEESQQPSLLNRIRQRQKELKNTRQRLLRALRHQNRENFDEE
                     QAFLDIEAQLSNTAVKDESKDGESSLQDDMHPLQLLLLQRLLSYPTSNSIEDE"
     gene            complement(<568165..>570010)
                     /locus_tag="ACHE_70183A"
                     /db_xref="GeneID:66985698"
     mRNA            complement(join(<568165..568377,568433..568539,
                     568588..568833,568888..569023,569080..569237,
                     569290..569404,569454..569651,569702..>570010))
                     /locus_tag="ACHE_70183A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282488.1"
                     /db_xref="GeneID:66985698"
     CDS             complement(join(568165..568377,568433..568539,
                     568588..568833,568888..569023,569080..569237,
                     569290..569404,569454..569651,569702..570010))
                     /locus_tag="ACHE_70183A"
                     /note="COG:S;
                     EggNog:ENOG410PW1F;
                     InterPro:IPR010856,IPR027443;
                     PFAM:PF07350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139862.1"
                     /db_xref="GeneID:66985698"
                     /translation="MNRLVSPNCLKCPTFHAGRCSGTAKRLLATEASPLTRKDKQEGD
                     ISSVFSTFSGRKSAPLPDRFRELKRNLTTGFEEEIQKSWDDLVETLKVRTEEVASKRE
                     SIIPQLKFSDIQSGNVSPASVEAIRRTGVAVIRGVVPAGVAEGLLSDVRQYFDAHPFK
                     GFPSDAEKKVIYESYWSPSQVKARSHPNMLATQSWMNQLYSADPDQKIDLSVPLSYCD
                     RVQIRPPGDKHFGLPPHVDGGGVERWEDRSYNHVYRKIFQGKWHEYDPWDLTGRLDAN
                     MNMYEGPGGCSVFRTFQSWLGLSRHGPQQGTLVVHPILQPTTAYWMLRPFFKPTRKGS
                     LDGWKFSLDDEEGDVYLHGANPGTAQEHTPDRHPHLMLSETMIPYPTVEPGDTVFWSA
                     DTIHGTESDNTGDNDACVFYIPSVPLTPNNAQYVAQQRDAFLKGVPPPDFPGGLGESQ
                     FSDRAQVGDIQSEAGRMAMGLSPMKVNGKNEKLAHEVNKILGY"
     gene            <572855..>574360
                     /locus_tag="ACHE_70184S"
                     /db_xref="GeneID:66985699"
     mRNA            join(<572855..573614,573675..574178,574239..>574360)
                     /locus_tag="ACHE_70184S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282489.1"
                     /db_xref="GeneID:66985699"
     CDS             join(572855..573614,573675..574178,574239..574360)
                     /locus_tag="ACHE_70184S"
                     /note="COG:S;
                     EggNog:ENOG410Q2V9;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139863.1"
                     /db_xref="GeneID:66985699"
                     /translation="MALESTENVLPPVSVQEVLVDIYFSRINTLLPLVDEEAFRAQFS
                     MEILPPQLIQAICLVATKESGENLGALRLGEGTDLLGIENFKNTLYNLLVQCISRKES
                     RRTVTQIQVHALLSLHTSGPDSTEDASLHLMQAIHHAQTLGLHLINKTNEHQDKAHIL
                     LFWSLWSLDRWNAAINGRPVLIGNSDMQPNMNEAFQCGRAPFRIWLRLAETLDQVIGF
                     YRPTSKLSLFHESTFTGFEQIVEEAQGYLIPKSTLISLELLYHGISILSCGGQKGVTI
                     SNSMKIRESFATTQIVSIIHSNHAKTLLALPMIPYSISLSLCWSYNKLRKSKLLTTRH
                     MARSALETCCRVLSEQKMLWWFAGVISRLGQRALDELGQDPSAAASSEIQEEHFDLRY
                     GQQITSTGYEQTFCQPELPDAFRPGEGNRGLTLQESVENNMGHSSVGSIGDFHRMLLD
                     LNMPLMSGDLF"
     gene            complement(<574936..>576276)
                     /locus_tag="ACHE_70185A"
                     /db_xref="GeneID:66985700"
     mRNA            complement(<574936..>576276)
                     /locus_tag="ACHE_70185A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282490.1"
                     /db_xref="GeneID:66985700"
     CDS             complement(574936..576276)
                     /locus_tag="ACHE_70185A"
                     /note="COG:S;
                     EggNog:ENOG410PRPY;
                     InterPro:IPR029063,IPR041698,IPR013216;
                     PFAM:PF13649,PF13489,PF08241,PF13847;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139864.1"
                     /db_xref="GeneID:66985700"
                     /translation="MATNAETLFDYLGKRYEDAYADSPNLVAFLESAIKELPAQSRVL
                     DVGCGTGKPAADMLASAGHQVQGIDVSQEMVRIASSQVSGKFQKADMRTFTPDAPLDA
                     VFVIFSLYQLTPGETYSMCYRLSEWLKPGGIVVVGTTLSSSVPPGQGVRDRTWNCVRQ
                     LGKPWMDNHTNETFFSEHGWQRLLRRAGFDVESEAHYEFMPKDSSHKAPETHHLLLAR
                     KVESEPLFGPYGVPFDNHNTLPTASRYKFTDRLVSEDLEKQFQSWGEGDQKILSLGCI
                     TADEKPGVQYSDGPIDRLPFPSGMFHVVLASWKLDYADDISKALQELIRVTKRKAGSK
                     IVIIQGAPDNEVLQFLKSDFGDPPHQGLQLRSAWDRLAEHGFSDLSLQRIHAHYEFPE
                     EDRSERCKAATEFLAGNPYCQVDKEDLVDRLQLHFQGDENKIDYGMVMLVASAV"
     gene            <577082..>579455
                     /locus_tag="ACHE_70186S"
                     /db_xref="GeneID:66985701"
     mRNA            join(<577082..577404,577458..578793,578844..>579455)
                     /locus_tag="ACHE_70186S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282491.1"
                     /db_xref="GeneID:66985701"
     CDS             join(577082..577404,577458..578793,578844..579455)
                     /locus_tag="ACHE_70186S"
                     /note="COG:S;
                     EggNog:ENOG410Q2HC;
                     InterPro:IPR040241;
                     SECRETED:SignalP(1-16);
                     TransMembrane:9
                     (n3-11c16/17o168-186i219-237o293-315i358-377o383-405i426-
                     444o450-469i481-504o510-533i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139865.1"
                     /db_xref="GeneID:66985701"
                     /translation="MRLLSLVLLALHGVQAAFIRRLECDLADIPSSPIDPVFQPLSLS
                     GGLDESNVLFLKLSGDYPGPDGCELLNGAIAKVLVDVKVLGRTVGYQIESNGSCPTVS
                     PIGHLRSDPRTYTNYESFYSLDGAYQLHTLATTIRLQLNNGSDAACVAAHITPDIGPL
                     ASNLLKSLPLAIMLISGIIAAGIRIYRNRGSSIFRYEIANSANDPAECFFPGMGSCLQ
                     YIQFVFMTGCLTLSYPGFFKPIVSQLAWSSLYYANGPITHEFTYPGIGDGIYTMNGTY
                     GLELMAQTLGATTVGDLWINSTINLAVMLVGIVAVVQYATLVKWMRNIIPFWKTPGGL
                     DLRAEFLTRIQHTGWSVLRTMLQYYLLPIVTFSLYQPLMATFFPVYRTFLAVMLVALL
                     AVTLGLVVRYLGIQNRQEIFFADSILSKQTTRSWLLDALHGIPLIQGVAIGGLQVSGV
                     GQIIVLAACEIFLIIVLALHYQRHTSLWKPVAFPAVRLTTILISCAFLPAAGLSEGTK
                     GYLGYSILFLHAAALLFGFLATAVVDLARLVLGTADPAGRPDSTPVFGLDQLSRRSKR
                     RTTFGELPALSPDGISQSNHGICLKMLTNGLDQPTTTYIPHSSFRASSLEGSAATANT
                     ESHYFYRPPRHNQTSSSPIDYGSRATMQSIPSSPSSPTPSSEIVQESHSPSMDLADME
                     MEIDKPSDVDYSIREADQYYRHAAARTIVMGSPNPGQDSPSRPTGSGASLSLWMQRKG
                     KKEKRFEVVRSRPSSE"
     gene            complement(<580545..>581043)
                     /locus_tag="ACHE_70187A"
                     /db_xref="GeneID:66985702"
     mRNA            complement(join(<580545..580811,580867..>581043))
                     /locus_tag="ACHE_70187A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282492.1"
                     /db_xref="GeneID:66985702"
     CDS             complement(join(580545..580811,580867..581043))
                     /locus_tag="ACHE_70187A"
                     /note="COG:S;
                     EggNog:ENOG410Q2H6;
                     TransMembrane:3 (i16-37o49-73i80-100o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139866.1"
                     /db_xref="GeneID:66985702"
                     /translation="MKASRPISHDRHPAILILRVATIFASIVCVVAFAWMFRAHDEVY
                     TDSVGSFLTLFPLIFTAYALFWSLLILLIRIFSSAIIHPAIYITFDLIAFGTVLGWCI
                     TKLEFVASYGSRYSCNHGPPGSCDTVARALKGVEYFGCVVGILDS"
     gene            complement(<581476..>582707)
                     /locus_tag="ACHE_70188A"
                     /db_xref="GeneID:66985703"
     mRNA            complement(join(<581476..582449,582518..>582707))
                     /locus_tag="ACHE_70188A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282493.1"
                     /db_xref="GeneID:66985703"
     CDS             complement(join(581476..582449,582518..582707))
                     /locus_tag="ACHE_70188A"
                     /note="COG:S;
                     EggNog:ENOG410PS0G;
                     InterPro:IPR010666;
                     PFAM:PF06839;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139867.1"
                     /db_xref="GeneID:66985703"
                     /translation="MLSPRKEPPHNASRNRAAASPRTSTAIPLNGLFINGTWCCNCPN
                     RPPAIKLQTKNNGVNHGRWFWTCQQPQQNANQRCNFFLWANDAEVREKIVVLSNSKSE
                     TETSTTEAGMNGPTTPSKRSRMSFGDKGDNGNGLLTPQTERKIRDFFTPVSGTRSARM
                     TMIGEDDTELFNNDDDDIGTGKGMSFMDRLKQVQSGNAGEESPRKALRTATTTSPGRR
                     KISDIVDNERLQTQQGLFGTPSQPQISPAQAQSFSPTQPLTQRSPSFSWTPNRAPPSS
                     AEICTTPTPTKYKNVLTSSPSSSQTAQQRSDLANQAIFLLESQYVIIPHSTQEDLVEL
                     LNKFDLRMKGISRGRDISREVLKKKEEEIMRLNERLKNLERQREMDGAALGGC"
     gene            complement(<585283..>588329)
                     /locus_tag="ACHE_70189A"
                     /db_xref="GeneID:66985704"
     mRNA            complement(join(<585283..585513,585601..586741,
                     586788..587542,587603..588141,588200..>588329))
                     /locus_tag="ACHE_70189A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282494.1"
                     /db_xref="GeneID:66985704"
     CDS             complement(join(585283..585513,585601..586741,
                     586788..587542,587603..588141,588200..588329))
                     /locus_tag="ACHE_70189A"
                     /note="BUSCO:EOG09260DUR;
                     COG:U;
                     EggNog:ENOG410Q8MH;
                     InterPro:IPR024554,IPR024555,IPR001683,IPR036871;
                     PFAM:PF12825,PF12828,PF00787;
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139868.1"
                     /db_xref="GeneID:66985704"
                     /translation="MQNEKRQSVPQRKPVGGHPQVPAPPSQTTPPPPGQILTGRQEHY
                     LKRELIAHQVRTEIAELNSPTALHRFGAPFKSEYGEVAPIDSELPILRYIFVHHVRNF
                     PFLDQAREQEFWQDKLQIFLESFANKHVSSSEDRLEETKRRKLARKCEKLVELMMVSG
                     IPTASGYEERIQFSEMEVVDRGANENGILANVPEGHAIHGWDVNVAAVRVRSVRRTVR
                     HHQHAEFIIRVHREGQSDLFVGRRYGDFSKLYKQLQTEFPGKPLPTLPRKNKSSSTTS
                     WWGSSTQDDDVSSISSFSMQEVGITQEENRSSRTLAPGNHHSHHRSLSRSSGRSGRSS
                     LGRSKSPRPSSDESRETVLYREEQRVSLRAFLRTLLQHKRLSESKAMQEFLTGEPISL
                     TEDDLVDIQRRKEVDSVRIEEQKRFYEIARQRAAELDVYMENFRRDIVESNGLTKLFA
                     EIREKQTVADLSPQYQKFAEWLRIEIAATLYHLFLAEDNSPELFAQFKRIHSLVPYTI
                     MKNVIRVANPAAVMSGVLDIFLAQPFGSRSLLQRIFSMTLNDGIKSFQKSIDALAAKV
                     EDPILCQKLKAFTDADEDAKNEIRSEATAEDVDLIVAILRSELLTPELTPEQFERVFN
                     GYVAWNYAVENVDQEMREGAHWFANMKQLLKLYTRQRDKAMMLSIVEEPVTLQLFRDL
                     FTIFYEPLVRVYKSANVYSSITDFAHFADDAIAVIEKCQSQDASADPNQTVQAFIDLC
                     ERHQDNFYKFIHEVHLHDNGLFGSLMSWIEGILEFLRHGPNGGKLDMNALIQGAVDVG
                     QVDKNKALGEINSLIQWHEDRKRWHLNKTRQKMAAEGTGAEGFPSGSFKTSDFGLDEA
                     DLEDLAISDAGSDDEDPEEADEREDLDPIAAERRRRVKKQDQLRRTAGEPVKPEVREV
                     VKLKESFGVMLRLVLAE"
     gene            complement(<589163..>591729)
                     /gene="ACE1"
                     /locus_tag="ACHE_70190A"
                     /db_xref="GeneID:66985705"
     mRNA            complement(join(<589163..590252,590301..590773,
                     590853..591136,591186..>591729))
                     /gene="ACE1"
                     /locus_tag="ACHE_70190A"
                     /product="copper-binding transcription factor"
                     /transcript_id="XM_043282495.1"
                     /db_xref="GeneID:66985705"
     CDS             complement(join(589163..590252,590301..590773,
                     590853..591136,591186..591729))
                     /gene="ACE1"
                     /locus_tag="ACHE_70190A"
                     /note="COG:K;
                     EggNog:ENOG410PIHM;
                     InterPro:IPR013087"
                     /codon_start=1
                     /product="copper-binding transcription factor"
                     /protein_id="XP_043139869.1"
                     /db_xref="GeneID:66985705"
                     /translation="MASQAEPSRVHPRRRQMTTAPPSLASSSRIVPDGSSRPNLSLRK
                     GETFHSPTTPPSGDRDPVVAFRTLPTRSPTCPKSLEAIVAGEERMSDILNRIDLNSTD
                     SSNAMAQPQDDMPVPRSFLQRQTQSNALVRKADKHPMMHAPQCFSPPDSPAKAHHDHA
                     SDSGLGSSISSSEGMMSEKGKVAAGQLSVQGFESSALTTQSAITSSISALQSNVSGKH
                     SLSPLARKQIEALVMIPILREESLKPFHPLVRSIPQLVDNKEISCLRDIEKTLLWLAP
                     QRATSGASYLRFCDFTIQCLHTSLYHINELDQRLPSDRPYTNGYFLDLVEQVRRHAAM
                     INESRNKNRAAAKSRLALEGGMAKTGRPAELVAYKDGQAISMKTGETYNGSVLKRNLS
                     VSSADEGAVRSMARRKKNAPPMDINQKCANCEKVFKRPCDLTKHEKTHTRPWKCSDKT
                     CKYFEIGWPTEKERDRHINDKHSKSPCVYRCLFKPCPYQSKRESNCKQHMEKTHGWAY
                     VRSKHNGKGLPKTTLATPQSSSMATPASASATLSTPATGSIQSPYEPATGPAYSNPQF
                     SFANPPAQTGAGDFQLFPEASPYQGSSSSASAYTGGASDFDSFPTSTTGLDAFQSQLE
                     NADPNGLIPPDMTNMPLDVAIPDFTGAAMGFGGSPMTSTDSSSLDLEWSNLGAQNFNN
                     EFAATNMQMMTPQQVGGNAMQSYSEDPCMADPLAYTQFSQQFDEGFADLCDQNYQTSK
                     FENDFPLFQNPTYPSEPMNNALAGMGDPNAMFPAQQQEQTGYYHQAWPAEVEINIY"
     gene            <593925..>594290
                     /locus_tag="ACHE_70191S"
                     /db_xref="GeneID:66985706"
     mRNA            <593925..>594290
                     /locus_tag="ACHE_70191S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282496.1"
                     /db_xref="GeneID:66985706"
     CDS             593925..594290
                     /locus_tag="ACHE_70191S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139870.1"
                     /db_xref="GeneID:66985706"
                     /translation="MRDIAAPILNTTTTFDRTMSMEPNFLPLSLLTFLTSRLKIPIQW
                     FSHRNHNSADNTFPSQHNSPAQTSTQKNDYVGPDTLVTIVSHTQQEHISIANDHTWLG
                     DSDAPGTLCATCQDVRLTA"
     gene            <607382..>607751
                     /locus_tag="ACHE_70192S"
                     /db_xref="GeneID:66985707"
     mRNA            join(<607382..607476,607541..>607751)
                     /locus_tag="ACHE_70192S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282498.1"
                     /db_xref="GeneID:66985707"
     CDS             join(607382..607476,607541..607751)
                     /locus_tag="ACHE_70192S"
                     /note="COG:S;
                     EggNog:ENOG410PR0V;
                     InterPro:IPR011051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139871.1"
                     /db_xref="GeneID:66985707"
                     /translation="MAETYPIGTRGECERLVRQWGFQQVFTWSDGSNAYYSPHRHGDV
                     TTHLVRHGTFTVNYPEDNTNGEVKKETFGPGARIDVPAGKLHEVWIGPEGCEYVIGE"
     gene            complement(<607955..>609832)
                     /locus_tag="ACHE_70193A"
                     /db_xref="GeneID:66985708"
     mRNA            complement(join(<607955..608063,608121..608239,
                     608292..609132,609195..609523,609575..>609832))
                     /locus_tag="ACHE_70193A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282499.1"
                     /db_xref="GeneID:66985708"
     CDS             complement(join(607955..608063,608121..608239,
                     608292..609132,609195..609523,609575..609832))
                     /locus_tag="ACHE_70193A"
                     /note="COG:G;
                     EggNog:ENOG410Q18W;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:9
                     (i87-104o158-176i188-208o220-241i253-272o369-388i395-
                     413o425-446i492-512o);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139872.1"
                     /db_xref="GeneID:66985708"
                     /translation="MAIEDTKSPTTGQESYDSKSPHDATVVASLTSLSDEERLGKAPD
                     DCAFDTTENPEIYRPISTYEGIHRWDPYFQWEEDEEKKLIRKIDIRVCTFACVTFFAL
                     QLDRGNIVQAMSDNMLDDLGMNTNDYNTGQTIFYLVFLFAELPSQLLSKKLGPDRWIP
                     IQMVMWSFIAAFQAFLKNRTGFFICRALLGLIEGGFIPDTILFLSFWYKSRELPIRLS
                     YFWVSYQGTSIIGAFLAFGFLHVRQSDGTGGWRYLFAFEGLITGIIGIIAMFWMPAGP
                     TQTKGGFRGKDGWFNEREEKIMVNRVLRDDPSKGSMHNRQALTPKMLWRALSDYDLWP
                     IYLLGLVWGIPNTPATNYITLQLKSLGFGTFESNLLTIPAYVIFIVNLLFWTWVSERF
                     NQRMLLGVVCEVWCLALLIALEVLPADASAWGRWVDLVLLIGAPYVHAIIVAITSRNA
                     GSVRTRTVATAMYNMTVQASSIISNNIYRDEDKPLYRTGNKVLIALAAFSAFLFVFTK
                     YYYVWRNKSNETKWNAMSSEERKAYLLANPDAGNKRLDFRFSH"
     gene            <611266..>612744
                     /locus_tag="ACHE_70194S"
                     /db_xref="GeneID:66985709"
     mRNA            join(<611266..611582,611634..611839,611896..612387,
                     612442..612575,612631..>612744)
                     /locus_tag="ACHE_70194S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282500.1"
                     /db_xref="GeneID:66985709"
     CDS             join(611266..611582,611634..611839,611896..612387,
                     612442..612575,612631..612744)
                     /locus_tag="ACHE_70194S"
                     /note="COG:I;
                     EggNog:ENOG410PHDX;
                     InterPro:IPR042098,IPR003819;
                     PFAM:PF02668;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139873.1"
                     /db_xref="GeneID:66985709"
                     /translation="MRNGGGSGLSGSTISGLMFPTTSSRLKNQIQLVPKGHFKMAPAP
                     VESLPVRTTPIAQLKHDAGTNKENIIGYKSAYVHENEIKGTGKQPPASFPNYLPVWDN
                     ETERYAPLEPFEHYDHGKDADPSFRDLFPEGKAQLDEITPEIGSEVHGVQLSQLTKEA
                     KDQLALFVAQRKIVAFRDQDFAHLPINEALDFGGYFGRHHIHQTSGAPKGYPEIHLVF
                     RGADDRNRSQFLETRTNTVTWHSDVTFEKQPPGTTFLYILDGPTSGGDTLFANMALAY
                     RRLSPEFQKRLHGLRAVHSGIEQVNASLSKGGIARRDPITSEHPIVRTHPVTGEKALY
                     VNPQFTRYIVGFKKEESDFLLKFLYDHIALSQDLQCRVRWRPGTVVVWDNRVTAHSAL
                     FDWEDGQRRHIARITPQAEAPYETPFEQ"
     gene            complement(<613594..>615445)
                     /locus_tag="ACHE_70195A"
                     /db_xref="GeneID:66985710"
     mRNA            complement(join(<613594..613905,613975..614235,
                     614684..>615445))
                     /locus_tag="ACHE_70195A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282501.1"
                     /db_xref="GeneID:66985710"
     CDS             complement(join(613594..613905,613975..614235,
                     614684..615445))
                     /locus_tag="ACHE_70195A"
                     /note="COG:S;
                     EggNog:ENOG410PQ4F;
                     InterPro:IPR019193;
                     PFAM:PF09814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139874.1"
                     /db_xref="GeneID:66985710"
                     /translation="MASRNPETKPTLTLHAEFLPNIRQTTLYITLPMNLEPIISLSES
                     RRAVTVSLPEPYDDVSETIKLPARVNEAARRVLEGRQHTGTGNGTRQKGESGSISGPG
                     SGNWDERELSFRMQIDPGDTSGGLLRPDDEVTSEKYVPWMAGDMGSYTQLGCRGCGKV
                     VLDCAPAPTPGDTGSKWVWKDLPSGNWAEMMDFWHCHKPDTHDHDHGDHTVSIEERNS
                     QVKGYGAANQVVASSGTGLVDVATFLVAEGDCRGLQIQNENSKKRNITCTQCNALIAL
                     EDPIANGWRLLKAALSAYTPSTTEEKGTWHTHPTETVVAAQLLELVERESARRFVVHY
                     SGKHGLLLWVFNPDLRYSTTSTSHSTTTTTAHRGMKILFQETSTVEDLLSPGNGKPSS
                     LSLEELMLPSDIYKSVYQTLVERNAMLPVSARGFREWRVGILERFERSLNTE"
     gene            <616235..>620674
                     /gene="PEX6"
                     /locus_tag="ACHE_70196S"
                     /db_xref="GeneID:66985711"
     mRNA            join(<616235..616436,616494..620229,620308..>620674)
                     /gene="PEX6"
                     /locus_tag="ACHE_70196S"
                     /product="peroxisomal assembly protein"
                     /transcript_id="XM_043282502.1"
                     /db_xref="GeneID:66985711"
     CDS             join(616235..616436,616494..620229,620308..620674)
                     /gene="PEX6"
                     /locus_tag="ACHE_70196S"
                     /note="BUSCO:EOG09260VTN;
                     COG:O;
                     EggNog:ENOG410PFF8;
                     InterPro:IPR027417,IPR003593,IPR003960,IPR003959;
                     PFAM:PF00004;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA]"
                     /codon_start=1
                     /product="peroxisomal assembly protein"
                     /protein_id="XP_043139875.1"
                     /db_xref="GeneID:66985711"
                     /translation="MDFEHYGGQSADQPKRQRRRRPNAARRLLRNKAPISARLTLDPQ
                     LRGNVGIVSDDLVNDLFQYREVKDGEVLYVAVSPYTPSYNSVEELAWTILPVRVHPRE
                     SSYTAPISHSTVVFPDSAESLQPFLQAQSRLDPTRHSVQTQRVIEIRVLDVVPLQLDT
                     VYVTVERNLVRNHDDVQNKFGGGFSPSIHGPNGLWAKAAKGSEAKRYSKKAAAEAEER
                     LTAAVREALGAQKVVHTGAVLPLPLPPHPITYAPPPPVHISFCEPVSQGVLVPETKIV
                     LIQARAHGTRSQKSLSSTSSLKQVTEDEADDTSNEQFYSAAEEKGNESGTEMESTSPP
                     DDSETEGSVGTASDTSDDSLEDMISLSAPQLPQPPSGIASSMTGATPRAGSRRGDGVQ
                     TPGSVASNFTSTTMRPGGRSGSGGKVFKAEGLLRSIPLELLHPRPRDDDDVDAFVFVD
                     ISALAKIGCFSGDWVRIEASEEPQANIFASIKLGSFNEQEEDSGDWRAVRIYGLPGLP
                     SAKPRYSINQSERRGSFSQRLPVRLTPSVYVPPLLLNNLDNPKHLRISRMNFASANGP
                     SKPGLLHQVKSSSIRTPPLAKEVTLLKVSTPLSMDRVLQPALFAGLKQYFESARRLLK
                     SGDLVGISVDEGLGKTVFGGAAATDGAAQDDDLTTRLGQVSGANNPGSRKVGVAWFRV
                     GHVTASSSEDDEPTEDQWGGVAVIDTASTRMVQAGSDVSRVPGTMNNGWEYWLGAKGI
                     PKAIGESLTPHGLLTESPQLFTPPLQQRIRDLMSAATSSRAIKLGMKPVVILLRSQQR
                     HIGKATVAKRACSDIGLHTFPIDAYDILTEGGANGGDVKTEAYLKARAERAFNCGPSC
                     TALLIQHIEVLTADRIVTAMSEIVADARVVIATTTDVEQIPEGIRSMFTHEFEMTAPE
                     EKEREGILQNAVADRSIKLSPDADLATVALKTAALVAGDLVDVVERACAARAARLEKL
                     AETASTSSSETKINIRDVVIAGGDAARGVTKADFETAVEAARKNFADSIGAPKIPNVS
                     WDDVGGLATVKDALVETIQLPLERPELFAKGMKKRSGILFYGPPGTGKTLLAKAIATE
                     FSLNFFSVKGPELLNMYIGESEANVRRVFQRARDARPCVVFFDELDSVAPKRGNQGDS
                     GGVMDRIVSQLLAELDGMNGGEENSGGVFVVGATNRPDLLDTALLRPGRFDKMLYLGI
                     SDTHEKQAKILEALTRKFTLDPELSLQRVADRLPLTYTGADLYALCSDSMLKAVTRKA
                     LAVDEKIRLLPDGPVSTAYFFDHLATPDDVSVMVTEEDFTDAQSELVPSVSAKELEHF
                     ERIRQSFESVDKKKQNQQEQHQPQQSRPAQTIGEALEALRLSGEQPILDGTDGPVVNG
                     DSHLPLNMGKGKARHGKGKGKARSKAGSEVDGEVSDEESIGEKEDEDYVVRTDHLQ"
     gene            <621887..>624072
                     /locus_tag="ACHE_70197S"
                     /db_xref="GeneID:66985712"
     mRNA            join(<621887..621966,622021..622054,622104..622173,
                     622234..622306,622357..622385,622494..622558,
                     622613..622684,622733..622847,622901..623014,
                     623060..623088,623134..623166,623213..623237,
                     623293..623494,623543..623620,623676..>624072)
                     /locus_tag="ACHE_70197S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282503.1"
                     /db_xref="GeneID:66985712"
     CDS             join(621887..621966,622021..622054,622104..622173,
                     622234..622306,622357..622385,622494..622558,
                     622613..622684,622733..622847,622901..623014,
                     623060..623088,623134..623166,623213..623237,
                     623293..623494,623543..623620,623676..624072)
                     /locus_tag="ACHE_70197S"
                     /note="COG:E;
                     EggNog:ENOG410PIX6;
                     InterPro:IPR002293;
                     PFAM:PF00324,PF13520;
                     TransMembrane:11
                     (i24-47o59-81i93-111o117-139i151-168o180-197i258-282o302-
                     324i363-381o387-409i421-447o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139876.1"
                     /db_xref="GeneID:66985712"
                     /translation="MDKVHGDDAQLAAMGHRAELKRNFSMLSMLGLAFAILNSWTALS
                     TSLSLSLPSGGCVSVVWGLITAGLCNLCIATSLAEFLSAYPTAGGQYHWVAVAWERWM
                     PILSWITGWANVSGWVALTATGGLLGSELVIGVISLMHPTYESERWHQFLIYIAYNVI
                     AFIINALMNSALPLFTKSAFIWSLTGFTVICITVLACSSPDFNSGKFVFGQFINQTGW
                     PDGIAWLLGLLQGGLGVTGYDGVAHMIEEIPNPSVVGPRIMIGCVVIGIVTGSIFLIV
                     LLFVAGDIDTIINSSAGPLLAIFKHATSNNAGAICLLIFPLVCMLFTTTSIMTTSSRM
                     VYAFARDGGLPASPFFSSVHSKLKVPLNALYFTVVLVIIFGCIFLGSSSAFNAIVSAS
                     VVMLDIAYGIPIAVNCLRGRNMLPERQFVLPNVVGWILNIVCFLFLFLSFFFMYYGKV
                     ANYSGLSCLYFSDYRALPVPA"
     gene            complement(<624437..>624937)
                     /locus_tag="ACHE_70198A"
                     /db_xref="GeneID:66985713"
     mRNA            complement(join(<624437..624788,624852..>624937))
                     /locus_tag="ACHE_70198A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282504.1"
                     /db_xref="GeneID:66985713"
     CDS             complement(join(624437..624788,624852..624937))
                     /locus_tag="ACHE_70198A"
                     /note="COG:S;
                     EggNog:ENOG410Q2ZQ;
                     InterPro:IPR009413;
                     PFAM:PF06355;
                     go_process: GO:0019836 - hemolysis by symbiont of host
                     erythrocytes [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139877.1"
                     /db_xref="GeneID:66985713"
                     /translation="MDSSQWVSIHIRDRLEKGEISIKDSFLYEGSFHSPTDKSLPLTE
                     DDIDNLTIPSYGIGEVCARGRRGSEGWMDLFHGDGKICELYWDNRDKKPVNKFEVSGV
                     DSAKYKIECSGWSPQAGPMGHVFIDIEAAKAKAAEAAAKEKAV"
     gene            <625699..>627096
                     /locus_tag="ACHE_70199S"
                     /db_xref="GeneID:66985714"
     mRNA            join(<625699..625899,625969..626114,626167..626294,
                     626345..>627096)
                     /locus_tag="ACHE_70199S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282505.1"
                     /db_xref="GeneID:66985714"
     CDS             join(625699..625899,625969..626114,626167..626294,
                     626345..627096)
                     /locus_tag="ACHE_70199S"
                     /note="COG:S;
                     EggNog:ENOG410PHW6;
                     InterPro:IPR025337;
                     PFAM:PF14027;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139878.1"
                     /db_xref="GeneID:66985714"
                     /translation="MLQFSFSLPRIFPLWEKSQFKIPPPKIHDIENAPEKPTRALKYL
                     IKLNHANHAILFHERKSHNHIPHLLSSAWIQGADADELHRLYETECLVMEPWVDSPGE
                     VSLDDWRDFLGRREYQRAFVNYFEDELVRHGYDWKEVVNEYLFSGEQPLFNSLITDLG
                     HPLIHLSYAFEFSSRELAMEALGLAATTYSPIHKYLSDPVYTQTESSYHTSSLFDILS
                     RVRTDIRFRGLFGTPGNENIEKIFATREDALIDHWNAWKFEGDAVTRFRETQEVATAL
                     LLGTHADGSEEYDFFFLHVLSTSHAVRILLPLIPAKFQLALVRQWWLLTLSVYIAQLR
                     PEIHVDRIRDVELKDRDWKWVARMALKGEKKDAHYVKALRMLREAAGTWKDEEGYYLR
                     AAVRFAEEFIGWGGFV"
     gene            <628007..>628801
                     /locus_tag="ACHE_70200S"
                     /db_xref="GeneID:66985715"
     mRNA            join(<628007..628037,628104..>628801)
                     /locus_tag="ACHE_70200S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282506.1"
                     /db_xref="GeneID:66985715"
     CDS             join(628007..628037,628104..628801)
                     /locus_tag="ACHE_70200S"
                     /note="COG:S;
                     EggNog:ENOG410PN20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139879.1"
                     /db_xref="GeneID:66985715"
                     /translation="MPSAVVTGATVLSCTICSKIPHMKESFSLSRSNPGYESPKIKHA
                     TLDLQASADEMAKELADVSAEHVFFCAYLARGDPGEAARVNSAMLGNFIRALEVSGAV
                     KKLKRFILTCGFKQYGVHLGHPKQPLLESDPPLENGFGGIAWQTNFYYDQQRILAEAA
                     ARGNWEWVATYPEDVLGYAKGNFMNEASALGLSTKRSQALNFLFLAAARITLPSIAGL
                     RPICTPSSAFGPRAAHAQGTTRST"
     gene            <628945..>629319
                     /locus_tag="ACHE_70201S"
                     /db_xref="GeneID:66985716"
     mRNA            <628945..>629319
                     /locus_tag="ACHE_70201S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282507.1"
                     /db_xref="GeneID:66985716"
     CDS             628945..629319
                     /locus_tag="ACHE_70201S"
                     /note="COG:S;
                     EggNog:ENOG410PN20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139880.1"
                     /db_xref="GeneID:66985716"
                     /translation="MRSKHPLAAHATHLGLFSDPLLQQSPTLHLQVVPEKWAKREDVN
                     EAWAKLREKYSLDQKAWDKATWDFLTFVLGRDWSCVGSMSKARELGWTGYADTWTELV
                     DTFETLEKEGVLPPVEQLKQDF"
     gene            complement(<630579..>632030)
                     /locus_tag="ACHE_70202A"
                     /db_xref="GeneID:66985717"
     mRNA            complement(join(<630579..630892,630960..631411,
                     631460..631583,631650..631776,631836..>632030))
                     /locus_tag="ACHE_70202A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282509.1"
                     /db_xref="GeneID:66985717"
     CDS             complement(join(630579..630892,630960..631411,
                     631460..631583,631650..631776,631836..632030))
                     /locus_tag="ACHE_70202A"
                     /note="COG:S;
                     EggNog:ENOG410PPYX;
                     InterPro:IPR001077,IPR036388,IPR016461,IPR029063,
                     IPR036390;
                     PFAM:PF00891;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0008171 - O-methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139881.1"
                     /db_xref="GeneID:66985717"
                     /translation="MGSIGPVTDSIQQELEQLIVASRRYQEQPPGLENYEARGDLLVK
                     ATRLVHTIRGPADMLFGQFENMTNIGAIRTLLEAGVFHAIPTGGKSASAVEIAAKTGV
                     DKNIIVRLMRAVTPLGPFREVAEEEYAHTPFSEIYLVPQMAAVYNLMMDEYCPAMLRN
                     HEFLQQHSWQNNYGVRHNPYSLVHDCEGKTIFEHVSESPKRLTRFNDAMRAADSALVT
                     VGLYPFAEELGDLASDDGVTVVDVGGGRGHILRQIMQTARELKGRFILQDQAGVIEDN
                     GKEIEKDGIEAMAHDFFKPQPVKGALVYYIRRCLHDWPDEPESREILQNLAASMDREK
                     SRVLITEYIVPEVGSTMSIAWMDHTMMTFGGVERTEKDWARLLDISGLRLVKVWRAKG
                     VPVGVVEARLK"
     gene            <633126..>634568
                     /locus_tag="ACHE_70203S"
                     /db_xref="GeneID:66985718"
     mRNA            join(<633126..633312,633366..633422,633475..633542,
                     633599..633978,634051..634146,634211..>634568)
                     /locus_tag="ACHE_70203S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282510.1"
                     /db_xref="GeneID:66985718"
     CDS             join(633126..633312,633366..633422,633475..633542,
                     633599..633978,634051..634146,634211..634568)
                     /locus_tag="ACHE_70203S"
                     /note="COG:S;
                     EggNog:ENOG410PQ8Y;
                     TransMembrane:7
                     (o30-50i71-92o112-131i143-167o187-208i220-247o259-279i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139882.1"
                     /db_xref="GeneID:66985718"
                     /translation="MDPSKTPAAPPPPGVTPNFTNPSGSEYDTYSISIALCATASIAL
                     LARLYTRTFVLRVFGLDDVCCIFGQSCAWIFAALSIANIKNGYGVHIWDLHLDKLTPF
                     KKYDIAEEDVYALGVWFVKTSILLFYLRLSPDKRFRQMTYAIMIFVAVYSLLSILLFT
                     LGCKPVAATWDVSLMSKAKCIDQMAFVYANAAFNIFSDVITLILPIKLCWTLQTSLKQ
                     KFLLLVVLTMGSFACIVAIIRIVTMMPFIHSNDFTWFKVTIAKWCMVEINVGIICACL
                     PVLRPIIVQTFPRLFSSYHQSGDNYTPASDGSYGLDSSSKKKRVVSWNHLTTIGNTQL
                     TTTNRGGDFDSESVQAIVMHNKTEHESGQQGITKSTEMDITYRDDRF"
     gene            complement(<635061..>635640)
                     /locus_tag="ACHE_70204A"
                     /db_xref="GeneID:66985719"
     mRNA            complement(join(<635061..635275,635334..>635640))
                     /locus_tag="ACHE_70204A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282511.1"
                     /db_xref="GeneID:66985719"
     CDS             complement(join(635061..635275,635334..635640))
                     /locus_tag="ACHE_70204A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139883.1"
                     /db_xref="GeneID:66985719"
                     /translation="MPTGIGRVLLSSGYTMWNNRVADWAFVQMFDNVTPQPFTFPKIP
                     SSQNPSKFKLGLNYNEGAPLAGFGDLKANEWYCKVGKPTGLIGGICKGVQVPCCWNAV
                     EEYAIVDQVGDYTQTDLCKPGDSDSVLLDRRGRIRDLLYRFTYTYAGIDLNVYAGLAI
                     TMSDGKETIKIES"
     gene            <636086..>636480
                     /locus_tag="ACHE_70205S"
                     /db_xref="GeneID:66985720"
     mRNA            join(<636086..636093,636147..>636480)
                     /locus_tag="ACHE_70205S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282512.1"
                     /db_xref="GeneID:66985720"
     CDS             join(636086..636093,636147..636480)
                     /locus_tag="ACHE_70205S"
                     /note="COG:S;
                     EggNog:ENOG410PY9H;
                     InterPro:IPR025951;
                     PFAM:PF14231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139884.1"
                     /db_xref="GeneID:66985720"
                     /translation="MTSAQEQYTQLIQTPGRVDPSTLSAIFDQLDPIKPEQLLGDWNG
                     GFFDTGHPVANTLKEINWVGKSFTSIDHVDPVVVEENGCRVSWGKWGFASVSLPEQSV
                     HHTMPRQAIKS"
     gene            <638319..>639642
                     /locus_tag="ACHE_70206S"
                     /db_xref="GeneID:66985721"
     mRNA            join(<638319..638492,638554..>639642)
                     /locus_tag="ACHE_70206S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282513.1"
                     /db_xref="GeneID:66985721"
     CDS             join(638319..638492,638554..639642)
                     /locus_tag="ACHE_70206S"
                     /note="COG:C;
                     EggNog:ENOG410Q2DB;
                     InterPro:IPR044152,IPR001155,IPR013785;
                     PFAM:PF00724;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0003959 - NADPH dehydrogenase activity
                     [Evidence IEA];
                     go_function: GO:0010181 - FMN binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139885.1"
                     /db_xref="GeneID:66985721"
                     /translation="MTNWPDIPTTPAEGISFFTPAKSPTAGTARNPQSSGKPIPKLFQ
                     PLTIRGQTFHNRLGLAPMCQYSADDGHMTPWHSAHYGGIAQRGPGMMIIEATGVVPEG
                     RITPGCVGLWKDTQIAPIRSVIEFAHSQGQKIGIQLAHAGRKASTLPPWLGGGTATNA
                     VGGWVDNVKAPSAIPFASGDIIPKAMTEADITEVKEAWIASTKRALAAGADFIEIHNA
                     HGYLLSSFLSPLSNQRTDKYGGSFENRIRLSLEIAQLTRDTVGPNMPVFLRVSATDWL
                     ETNEQGWKNEDTVKFAEALAVQGAVDLIDISSGGVHSAQKVKSGPAFQVPFAAAVKKA
                     VGDRMLVAAVGMINNGNLAEEILNENELDVILVGRAFQRDTGLAWHFAKDLDVEIAMA
                     AQIRWGFTSSRNASEYIQPNSMKASIFD"
     gene            <640973..>641758
                     /locus_tag="ACHE_70207S"
                     /db_xref="GeneID:66985722"
     mRNA            <640973..>641758
                     /locus_tag="ACHE_70207S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282514.1"
                     /db_xref="GeneID:66985722"
     CDS             640973..641758
                     /locus_tag="ACHE_70207S"
                     /note="COG:S;
                     EggNog:ENOG410PT6R;
                     InterPro:IPR012506;
                     PFAM:PF07947;
                     TransMembrane:8
                     (o6-29i41-58o64-83i104-125o131-155i176-193o205-227i239-
                     259o);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139886.1"
                     /db_xref="GeneID:66985722"
                     /translation="MPSTKMSAYLSISPPACYLLLGSLPLLVLSEYKSRSYYGTALFK
                     MLSSAAFLSGPLLTSMDWTPYRRLITIGLLFSMLGDFFLIPSRGEFFDSGSKSQERQV
                     PISFHLGVVAFAAAHIAYIIAFLRDARENSWGVFITVFIATLLLAKWLGVIYPPSHSS
                     TGVNVLDLAIAKDMKPLVFIYAVIISLMFAAASSTTPLTISSSWVYQRVLGAGMFVVS
                     DIFVAVTAFRRYTAPVQRGWVQIAVGYGLYFWGQMIIAGMVEA"
     gene            <643938..>645554
                     /locus_tag="ACHE_70208S"
                     /db_xref="GeneID:66985723"
     mRNA            <643938..>645554
                     /locus_tag="ACHE_70208S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282515.1"
                     /db_xref="GeneID:66985723"
     CDS             643938..645554
                     /locus_tag="ACHE_70208S"
                     /note="COG:F;
                     EggNog:ENOG410Q2NC;
                     InterPro:IPR035994;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139887.1"
                     /db_xref="GeneID:66985723"
                     /translation="MAYNATSPPALRVPPPHTEFMVGWICVLKEEYRAAVSILDEKYD
                     TAGLVRGQGDKNHYVLGRVGTHNVMINLPPAEMYGQLHATRIALDMRSTFPRMRFVLL
                     VGIAGAAPSQKHDIRLGDVVLGTKVVPYATGKETDHGFERTGLVRTPARELLETITFL
                     EERFWSGHVSLSDSIERIRTRTTRGRTAFLRPAQDRLYKEGFLHQESVCDCLRPESQQ
                     QVNLCSRQDREGDLVRLFQGGIGSDNHVIKNAHNRDDIAKKEKILCYEMEAAGVMDIT
                     PCLPIRGISDYADGHKNDDWHLYAALAAAVCARELLLSVPPQIVAQFPLTLAGNLVDR
                     YITGAVSTPNAFSGNEIEKLRQMRDSLMERHDFLEELMVPELRKMKDKSRDDIENVRD
                     GVQKLKDLQSTLKIHLQDLDRFLKRHDDLLLSEDPVVREAYKKLKTQVYRDGEAMEKL
                     SELAQDSLQATGKMLRGLGQDLKNRDLSIAGTVLGASGEFLGHVMSIWKSSRMSPTAM
                     WRWLHRKLRMIRNPPNSNHTIEMESLLVEA"
     gene            complement(<645810..>646638)
                     /locus_tag="ACHE_70209A"
                     /db_xref="GeneID:66985724"
     mRNA            complement(join(<645810..646228,646335..>646638))
                     /locus_tag="ACHE_70209A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282516.1"
                     /db_xref="GeneID:66985724"
     CDS             complement(join(645810..646228,646335..646638))
                     /locus_tag="ACHE_70209A"
                     /note="COG:S;
                     EggNog:ENOG410PSWB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139888.1"
                     /db_xref="GeneID:66985724"
                     /translation="MSTTWMLPRGLFFRYLRQSHYTNPVSSEFLASSSFMFVNPRHHA
                     VVTDKVAQKFPAAAIAGLSDEKALALFTCGFFSGFIFGFKRWILRIGGYNLLPARYTG
                     FQPDPQAVTIWNRSKVPSTHLLPVGSCLFGSFRMLDKHIAEPSDHSSSYVDYGFGSDE
                     FIFAGCHRFQITRLPPSSNMDSESEPSIKGKQSMPQVQIQLQHFRCNPQKNVPSVAEY
                     IERFHYVYAKALFANGVQSLLG"
     gene            complement(<647812..>649362)
                     /locus_tag="ACHE_70210A"
                     /db_xref="GeneID:66985725"
     mRNA            complement(join(<647812..648036,648087..648159,
                     648217..648610,648663..648758,648814..649017,
                     649069..649112,649173..649198,649252..>649362))
                     /locus_tag="ACHE_70210A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282517.1"
                     /db_xref="GeneID:66985725"
     CDS             complement(join(647812..648036,648087..648159,
                     648217..648610,648663..648758,648814..649017,
                     649069..649112,649173..649198,649252..649362))
                     /locus_tag="ACHE_70210A"
                     /note="COG:Q;
                     EggNog:ENOG410PMA8;
                     InterPro:IPR027399,IPR013154,IPR002328,IPR036291,
                     IPR011032;
                     PFAM:PF13823,PF08240;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139889.1"
                     /db_xref="GeneID:66985725"
                     /translation="MATMKAVNYIGPHKVQVQEVEKPKLEHPDDIIVKVTTAAICGSD
                     LHMYEGRTAAEPGITFGHENMGIVEELGQGVTILKKGDRVVMPFNVADGRCRNCDEGK
                     TAFCTGVNPGFAGGAYGYVAMGPYRGGQAQYIRVPYADFNALLLPPGTEHEADFVLLA
                     DIFPTGWHGVEISGFKSGESIAVFGAGPVGLMAAYSAQLRGASRIFVVDRVPERLAVA
                     KKIGCIPIDFTLGDAVDQIIRLNDGMVDRSVDAVGYQAVNATGSAEKPNIVLENMIRV
                     TRACGGMGIPGLYVPSDPGASDDTAAKGLVSLSFGKLFEKGLSLATGQCNVKAYNRYL
                     RDMIVAGKAKPSFVVSHEVSIDDAEIAYHKFDKREDGYTKVLLHPNGSIDQISAKI"
     gene            <649983..>651168
                     /locus_tag="ACHE_70211S"
                     /db_xref="GeneID:66985726"
     mRNA            join(<649983..650085,650147..650234,650301..650438,
                     650491..650649,650699..650968,651048..>651168)
                     /locus_tag="ACHE_70211S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282518.1"
                     /db_xref="GeneID:66985726"
     CDS             join(649983..650085,650147..650234,650301..650438,
                     650491..650649,650699..650968,651048..651168)
                     /locus_tag="ACHE_70211S"
                     /note="COG:G;
                     EggNog:ENOG410Q2RK;
                     InterPro:IPR013022,IPR036237;
                     PFAM:PF01261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139890.1"
                     /db_xref="GeneID:66985726"
                     /translation="MASVLRFRSVWGVDPGNNYENWDKWFPTLKAQGYSGVEIDFAGL
                     RDLSTVRQIAEKHGLEISVLVHTQWPRYEGPKPVGLTPQDHLQGYKEQLEIAKALKPY
                     KVNAHSGDDGWTIEQSVEFFSGTFAIDAELGYAGKVCHETHRNRAFFSPYATSEVLKR
                     VPNLRVTADFSHFVVVCERVLDVGEEDKEMLRTIIPRVGHIHARMGTTQSSQCPAPTD
                     DAFKEERRFFETAWKQIIDATATTAEPITWVPEYGPFPYHPFGSPQSFSDLADSEGTR
                     LHPLFERYAQAAVARS"
     gene            <653023..>653544
                     /locus_tag="ACHE_70212S"
                     /db_xref="GeneID:66985727"
     mRNA            <653023..>653544
                     /locus_tag="ACHE_70212S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282521.1"
                     /db_xref="GeneID:66985727"
     CDS             653023..653544
                     /locus_tag="ACHE_70212S"
                     /note="COG:S;
                     EggNog:ENOG410PWIN;
                     InterPro:IPR013341,IPR034593,IPR029017;
                     PFAM:PF02746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139891.1"
                     /db_xref="GeneID:66985727"
                     /translation="MSDLKIRQIDVFQVDLPYSGGVYYLSGGRAITRFDATFVRVITD
                     HRIEGWGESTPFDNYIASHAGGIRAAIAEIAPKLIGLDPRRVDRVNDAMDAALLGSES
                     AKSAIDIACWDIFGKSVGLPVCELLGGRTSKKLPVLESIPVSQMQMVLASLLPSPEQL
                     DTLDSRLKLEGTR"
     gene            <653645..>654136
                     /locus_tag="ACHE_70213S"
                     /db_xref="GeneID:66985728"
     mRNA            <653645..>654136
                     /locus_tag="ACHE_70213S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282522.1"
                     /db_xref="GeneID:66985728"
     CDS             653645..654136
                     /locus_tag="ACHE_70213S"
                     /note="COG:S;
                     EggNog:ENOG410PWIN;
                     InterPro:IPR036849,IPR029065;
                     PFAM:PF13378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139892.1"
                     /db_xref="GeneID:66985728"
                     /translation="MLKLLPNELDFVLEAPCATYRGSLSLRRRTNVPIIFDELASNES
                     TIAQFIADDGIEGIGLKISKTGGLTRGRRVRDICLAAGYIMSVQDTSGSDIAFAAIVH
                     LGQTVPARNLRCVFECRAMCEGKTADGAFDVHDGLLTAPTTPGLGVTPRLDVLGKPVA
                     TYN"
     gene            <654871..>655530
                     /locus_tag="ACHE_70214S"
                     /db_xref="GeneID:66985729"
     mRNA            <654871..>655530
                     /locus_tag="ACHE_70214S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282523.1"
                     /db_xref="GeneID:66985729"
     CDS             654871..655530
                     /locus_tag="ACHE_70214S"
                     /note="COG:S;
                     EggNog:ENOG410PYGT;
                     InterPro:IPR007497;
                     PFAM:PF04402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139893.1"
                     /db_xref="GeneID:66985729"
                     /translation="MTPITINVTGSSTIHQPPERAVLFFHVQSEGSSSDTVSKEVTAT
                     SNQLQQIFKGLKSNSLVPTPVAAFSTSSLRRWSERPRDRDGNPGERVHYAQLRFEATF
                     REFKKLSEVAGRLSAYPNVAISNIDWRLTDETKQELGSKTRKLAMKDAIQKAFDYAEV
                     IGREVNPVEITDMESPGLHSPRYMAAMAACPMEDEREELDLTPQDVELTSSIQVNFRG
                     E"
     gene            complement(<658234..>660042)
                     /locus_tag="ACHE_70215A"
                     /db_xref="GeneID:66985730"
     mRNA            complement(<658234..>660042)
                     /locus_tag="ACHE_70215A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282524.1"
                     /db_xref="GeneID:66985730"
     CDS             complement(658234..660042)
                     /locus_tag="ACHE_70215A"
                     /note="COG:S;
                     EggNog:ENOG410PH6K;
                     InterPro:IPR004303,IPR013530,IPR036556;
                     PFAM:PF03068;
                     SECRETED:SignalP(1-19);
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0004668 - protein-arginine deiminase
                     activity [Evidence IEA];
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_process: GO:0018101 - protein citrullination [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139894.1"
                     /db_xref="GeneID:66985730"
                     /translation="MGSRVYITSLLLSSSLVYAFSPAIRADTNRDGVVDLDGNTDAVD
                     KDLWSEDHGAIFLPNIGDAKGRCHFRDRRDQDLSDIELASCNDASGDTLITPEYLAPL
                     RTVPIHDIGSNATAHVAADPSPYVRIFWKHGSEWIYIDPEFIFNATAIRTGLELGIDS
                     RALVTDSDVWNGTARVSFTVTESNTTKTDHVALKLAPVLLHHHLQPAQRLISVLGNDS
                     TKAQHRFIRELDAAKQKAGLNTPLTLLGSSDDWWAQDIMEPAFASMPGPNGPISIRVI
                     LRTAQESRPAGRQVFTQLRGKGIGGFLPVGSGVLGRREINSGGNIETIPPYTSKKTGK
                     HYPLGRILTGQHFEEKHSEAMMKFFRAQRLQDPLVIEAGWLAVGHVDEFISFLPADNE
                     LGFTMAVSDPVAGFNVLLKANESGYGTVDAYSANLQDRTPPQGAEPRLNWTIGQVVSD
                     EVVLHATVRAQRNIDSAVHVLLEETGLTKEDLIYIPHLFTDGEFSGPGHTKSRDGLPP
                     HMSPPKEGEFNVASFFPASINGVVLGNHFICARAFGPVIDGKDIFQDAVEKAFRKSNM
                     TVHFIDDFWSHHINGGDVHCGSNTLRDTAVSWWSQQ"
     gene            complement(<662917..>663466)
                     /locus_tag="ACHE_70216A"
                     /db_xref="GeneID:66985731"
     mRNA            complement(join(<662917..662991,663043..663132,
                     663192..663254,663305..>663466))
                     /locus_tag="ACHE_70216A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282525.1"
                     /db_xref="GeneID:66985731"
     CDS             complement(join(662917..662991,663043..663132,
                     663192..663254,663305..663466))
                     /locus_tag="ACHE_70216A"
                     /note="COG:J;
                     EggNog:ENOG410PQ35;
                     InterPro:IPR006175,IPR006056,IPR035959;
                     PFAM:PF01042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139895.1"
                     /db_xref="GeneID:66985731"
                     /translation="MSSLIKKEVRSEKAPQNQLFSQALVVGDMVYVSGNTGVDPATGN
                     FVEGTVVSRATQILKNISNILEATGSHIDKTVKVNIFLTSMSDYGLMNEAYAKFFNKQ
                     PKPIRTCVAVKELPRGTDVEMEVTALL"
     gene            complement(<665486..>666211)
                     /locus_tag="ACHE_70217A"
                     /db_xref="GeneID:66985732"
     mRNA            complement(<665486..>666211)
                     /locus_tag="ACHE_70217A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282526.1"
                     /db_xref="GeneID:66985732"
     CDS             complement(665486..666211)
                     /locus_tag="ACHE_70217A"
                     /note="COG:I;
                     EggNog:ENOG410Q1Y6;
                     InterPro:IPR006694;
                     PFAM:PF04116;
                     TransMembrane:1 (o63-84i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0008610 - lipid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139896.1"
                     /db_xref="GeneID:66985732"
                     /translation="MHIMRLLGQVYGFLDGDKHPRDGIPDVGVGKVIRELISTSTLRM
                     TMAIFVTYRQNETPASLRWGWLALEIGLYSITVDFWFYWYHRLMHSTGSLWKMHRRHH
                     LTKHPNPMLAAYADHEQEFMDIIGIPLLAYFTLKLLGLPMGFYEWWICYQYVAFSEFI
                     GHSGLRIHGGAPSTLNWLLELFDAELVIEDHDLHHRYGWRKSHNYGKQTRLWDRVFGT
                     CHDRIESIKENVDYSNRVTMPLL"
     gene            <675138..>675413
                     /locus_tag="ACHE_70218S"
                     /db_xref="GeneID:66985733"
     mRNA            <675138..>675413
                     /locus_tag="ACHE_70218S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282527.1"
                     /db_xref="GeneID:66985733"
     CDS             675138..675413
                     /locus_tag="ACHE_70218S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139897.1"
                     /db_xref="GeneID:66985733"
                     /translation="MAKISRALQGRENSDPSTNQKLRKKTTSQKAVLIDIAAIGTVSF
                     QRHLKKDIEVFITSLSEIDRITEEKRVEEHQEEDRQEQELVEQLLPE"
     gene            <677260..>679480
                     /locus_tag="ACHE_70219S"
                     /db_xref="GeneID:66985734"
     mRNA            join(<677260..677309,677647..678237,678330..678646,
                     678696..678856,678908..679210,679265..>679480)
                     /locus_tag="ACHE_70219S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282528.1"
                     /db_xref="GeneID:66985734"
     CDS             join(677260..677309,677647..678237,678330..678646,
                     678696..678856,678908..679210,679265..679480)
                     /locus_tag="ACHE_70219S"
                     /note="COG:E;
                     EggNog:ENOG410PJTQ;
                     InterPro:IPR037217,IPR000898;
                     PFAM:PF01231;
                     TransMembrane:1 (o18-41i);
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     go_process: GO:0019441 - tryptophan catabolic process to
                     kynurenine [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139898.1"
                     /db_xref="GeneID:66985734"
                     /translation="MKNDVENLLLTFLYPENFLYLCNTSSFFYLIFYYLIAPYICNSS
                     SAIIMTRTQVPYPSPATLTKFPHIHDVPSEVSHALDPFTITTSTGFMPYQTAPTELPE
                     AFKALQSLVERMPVLRLDGKPGLLATYEFGPAVERELSVDLTDEIEKLVLPDGSYDKF
                     TMAAVFRDYTFVASSYLLEPCWENWRKNPDGGYGLGRQVLPKAIARPMYRAAQILDVP
                     PFMSYAASYALFNYTLADHSKGLGEYSNLRLVRGFERGLDPKSSEAGFILTHVDMVKE
                     TGALVAGVLKVIDTIEQHGDRDEINDGFRDILRTMEKIEASMEDMWGNSKPEEYLSFR
                     VFIFGITNQSMFPNGVIYDGVEDNQPLSFRGESGANDSIIPLLDHLCQIPMPETPLTK
                     ILHEFRAYRPRPHREFLTYIREKAEEIGVQKYAVEDSETAVLFLKTLNHVRSFRWRHW
                     LFAREYIIRRTPHPTATGGSPIVTWLPNQLSAVMDLMVTIYDTYLAPKDGVTIVNGKE
                     DLIASHRKQVEPMMELVRDQRVKLAKEVARWCQERGV"
     gene            complement(<684598..>685383)
                     /locus_tag="ACHE_70220A"
                     /db_xref="GeneID:66985735"
     mRNA            complement(join(<684598..685279,685349..>685383))
                     /locus_tag="ACHE_70220A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282529.1"
                     /db_xref="GeneID:66985735"
     CDS             complement(join(684598..685279,685349..685383))
                     /locus_tag="ACHE_70220A"
                     /note="COG:S;
                     EggNog:ENOG410PHUH;
                     InterPro:IPR031100,IPR005269;
                     PFAM:PF03641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139899.1"
                     /db_xref="GeneID:66985735"
                     /translation="MTQDKPAVICVFCGSTAGKNPVHLEAARALAYEFHKNNVQLVYG
                     GGTTGLMGEIAKTLVSLSGPKAVHGVIPRALVKVAARNSAGEDETASDTTGGKAAERV
                     VSELLDGNEIPESKFGLTTIVPDMHTRKRLMATKVLEGGPGSGFVSLAGGYGTIEEVM
                     EMTTWNQLGIHRVGVVLLNINGYWDGVLAWVRTAVQEGFISGENGSILTEAHDVKDVW
                     PKLVEYQCSPDRYQLNWGQE"
     gene            <687582..>688520
                     /locus_tag="ACHE_70221S"
                     /db_xref="GeneID:66985736"
     mRNA            join(<687582..687623,687684..>688520)
                     /locus_tag="ACHE_70221S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282530.1"
                     /db_xref="GeneID:66985736"
     CDS             join(687582..687623,687684..688520)
                     /locus_tag="ACHE_70221S"
                     /note="COG:S;
                     EggNog:ENOG410PPYH;
                     InterPro:IPR021858;
                     PFAM:PF11951;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139900.1"
                     /db_xref="GeneID:66985736"
                     /translation="MRILLALIMLSFFESLTGNTQGAMFSHLRASRQLILQLANSPLQ
                     SSTNDNSRLLSFVLEIYRYLVFINNITPFGAIESRTLPHDTFLDDIVGTMTQFDTCGA
                     IFGGSHGLFEILPSVAVLAARRLTEKDPSRASSRMYQALHVRITEWKSPDPVVPDQKW
                     QSQREVALELCREAVLLYLETAMFPRALSDTVTRTRILDHVDIIMLYAEQASGSPYET
                     ILLCPLMIAGSCMMRTDQRQRLQAGLRSTRFHMNHCVQAASLLELVWNDPSERVFGPY
                     GLGVVMRRSGINLGVA"
     gene            <691072..>691776
                     /locus_tag="ACHE_70222S"
                     /db_xref="GeneID:66985737"
     mRNA            join(<691072..691432,691525..>691776)
                     /locus_tag="ACHE_70222S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282532.1"
                     /db_xref="GeneID:66985737"
     CDS             join(691072..691432,691525..>691776)
                     /locus_tag="ACHE_70222S"
                     /note="COG:Q;
                     EggNog:ENOG410PNCV;
                     InterPro:IPR036188;
                     PFAM:PF13450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139901.1"
                     /db_xref="GeneID:66985737"
                     /translation="MAAAPATHKKHDVLIVGAGLSGLQAALSVRAAGFSVCGVEAINR
                     VGGKTLTAKSCEKGFNDMGAAWINDTSQSEMFKLYQRYGIRTEIKRDCGHTLIQSTDG
                     FVVKVPYWQLPACPMFPFYMGNPTNSAGARKIDQLTFREFCVQKVQSNSAISIAGVLS
                     VSLLWVESDEVSALYMFLYFKSGAGIDNIISDQKDGGQYLRNRQ"
     gene            <696341..>698187
                     /locus_tag="ACHE_70223S"
                     /db_xref="GeneID:66985738"
     mRNA            join(<696341..696446,696500..696625,696686..696766,
                     696818..>698187)
                     /locus_tag="ACHE_70223S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282533.1"
                     /db_xref="GeneID:66985738"
     CDS             join(696341..696446,696500..696625,696686..696766,
                     696818..698187)
                     /locus_tag="ACHE_70223S"
                     /note="COG:S;
                     EggNog:ENOG410PUHV;
                     InterPro:IPR027443,IPR013785,IPR005123;
                     PFAM:PF03171;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139902.1"
                     /db_xref="GeneID:66985738"
                     /translation="MSLFSPANVGPFKLKHRVVVDPILMGWGEAQLSTYFDELDPEGG
                     LILAPNALLEATELTQKRTVDRLHSLDSVVFAQLCDGSHNIASLSENAIKTGYDGVEI
                     SAGVGSTLHRAFHQANDLPTATLAVTEAIESVVAVVPAEQVGIRFTPFAIVEGNRFPM
                     PDTLYCAMIESIRSKFPNLGFVHIVAHTLFDDFEYTSNKSLDVFRAALGPEDARQTAF
                     ISADAYDPQTASKIASNTPDLVAINLPADMNPKLVSSLRRGNKSYSLGRSTADRLQAI
                     RTAFDEGKEYIVEWSDEQKSRTEQAMVDLDKHLSNFDPSLSYEGTDKKVAWRKSCWFA
                     CEGIARPFLDTEEAIARFDGDLKDGITGIQGLQNRQVRRSAEYLKSVLDSALVTTSKA
                     VGIGQDMIQRCTVRYRAIKYTPHAGAPGGIGLHPDGNLLSALITNGDGLRVYDFDGTV
                     RFPSDVNGTIMMGGSTLYRWSQGKYPPTFHDVDIGNGQDKFSIVAFFNFPDMVSIPHS
                     LISGDVKEGASFFHDIKSIKEDDKSPQGQLSPLWDIIIDRHQLVLPPAVAAN"
     gene            complement(<699350..>705605)
                     /locus_tag="ACHE_70224A"
                     /db_xref="GeneID:66985739"
     mRNA            complement(join(<699350..700102,700171..700253,
                     700315..701498,701560..701679,701737..701909,
                     701968..702113,702166..703311,703364..703490,
                     703547..704029,704097..704836,704891..>705605))
                     /locus_tag="ACHE_70224A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282534.1"
                     /db_xref="GeneID:66985739"
     CDS             complement(join(699350..700102,700171..700253,
                     700315..701498,701560..701679,701737..701909,
                     701968..702113,702166..703311,703364..703490,
                     703547..704029,704097..704836,704891..705605))
                     /locus_tag="ACHE_70224A"
                     /note="COG:S;
                     EggNog:ENOG410Q93Z"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139903.1"
                     /db_xref="GeneID:66985739"
                     /translation="MSNMQTLKALTADQIEKGINNSPLSTRSLESIDLIVDKSKLDYL
                     PITLADVPADEPFLTTPDDSGDSESDDNQPLTPTEAPSHPADFKTTDLDQTVIGGAVV
                     DSVSLVVPDEHAASFAGLPVIPITGSAGVQAQMLAAVPQDKAQGRSNQLPVLLLPDEK
                     PTTTTVAAAAAAAEKQLMANTDALAEMIKSTPKIDQDAGSASGDKEIVKTELGGYVLA
                     GDIKNFFGIKGLKAKLYKFKGPGKKIDKEDSNKKVDGSGTEDQDGDGDNNANANADSE
                     DDSEPAREKAILNPESYALKGKPLGTLFPFIDDIDLQKMPITNLAFTYCEEKQSAFFP
                     PGLRFEADVQLKDSLQWASDALKSMFGGQKTPESIHLSAHLADERDWTKRPRVEKFVL
                     QGYFDNMGLKTWDLLQFKTMGVEITGTKAARSKKDNKEEGKDDDKDKKDEEGKEEGKD
                     DQSTEDPPKDTTEATPENLESGVGGKPESATKDTEAKPKGDTEDAAKPEEGDDKKEDD
                     EKRKPKEKKSWNFGFGFFGTLMFTKVPHANAPVELNYRIGRDFEVDDSADGTDGEKGE
                     SDDKKDDKTDAEKNAEDDKDMTQSPTADVVKVDAEPPAGKPSKKLQKPQKQWSDGKHK
                     RVWNMVIWCDKWDDIYGIKNVSLTKAELKSSFEHGEFKETLRLDLLADLKLGGGTFKV
                     TGLISKNENSLDAEVGDLKLSEIKKIHAQVAGYEVPKDDTITDTKVKEEEETDAKNEA
                     KGNEITFKELHLNLSSKKRKEEKTTERSLQLDGHVTFNEHASSSALIKINQDGLTING
                     DIKDFNIPETSVKIQKAGLNIYVAFRHDKKKIKGQTDEKTTKSITDKPVSTEQDSKAE
                     AADEQESITDGEKAVTKPGVAGEKKDDDKPTKPKRESQFSILGIVQIEEFVVTVGLHI
                     EQKKNKQTREWLAVGSVKSLKLSELWPTLKGGFLDLELDNLALIGSSEEREVKEDSED
                     GSSGENSKEEGEGTDEEKSKEKSEEKSEEKSEEKSEEKSEEKSEEKSEEKSEEKSEEK
                     SEEKSEEKSEEKSVEKSEDKKPASWDVLAEVDSYKYPIAKGVQLCATIRKFDALEKLN
                     NNQKLNGLVLIVGFSFEGKLLIRINMPRSMEIPLRDYAKLGEFGAAIAVDNEGPYLQL
                     DATLKLLFEDQAPIRVRGHIKGGIERAEGKLHMDKKDIWINPFNFNKNLVISKLGVGA
                     GFRYATVVVHGPDRLEAAGNIKVGKEFEADMALSLGIGKDQVISFSMSEANIMKLVKF
                     AAEMADIKAMENIEGADDILVFRDLKFSLSTGAKVFDVYYEPSILMKGSVEFLKKKGD
                     FEGRLKDDGFMIKAGLDNFNIGGLEIRSAKDDRKRATMDITMTKETQKILIDGMIRFH
                     DLHLKMYIDADVQERRLDADVSIQFLEELSFQMKAKARIPETKTLDGLLVRFEAELRP
                     DLFGAIFDGINNGIDAIGKLATETIDNAINDLQGQIDKHESELAIMKKDLDRMKLKSD
                     AEVLERQEAINKENGELTMLANELEKYDQAVKDAKAKKDQNSDEIKAKESKRDDAQRQ
                     LDTKVREMRNEYERKVEEQRQKQAEWELEKKRLEDEKEASWGDALRKGEEVERSWRWW
                     QDQVNQAYAWKEQAWRIHCDAGFFDKFSTWLKFQEANVGLEQIKARRDAQNEILKLAR
                     EIVSSPAFRQIEYGINDAVREINKFGRALDSLTRNGVYGYIQEMSRDERAELDRQIRQ
                     LNELREKSKELEANLRMAIDALEKNKGRITNQEREVQTRILTLEKEIELKPFEDAYRN
                     KKNDHDRVAAQVQVIQKTLKDIRNGVNAETKAAKQVVEALKKATPRITLIVVKASTEV
                     FAKNEPLVFSVDVAWAGETKRYEVTWTPGSNPADLYKNVADKVIGFR"
     gene            complement(<707578..>707808)
                     /locus_tag="ACHE_70225A"
                     /db_xref="GeneID:66985740"
     mRNA            complement(<707578..>707808)
                     /locus_tag="ACHE_70225A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282535.1"
                     /db_xref="GeneID:66985740"
     CDS             complement(707578..707808)
                     /locus_tag="ACHE_70225A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139904.1"
                     /db_xref="GeneID:66985740"
                     /translation="MADAEQDLHGKNQEPGKTRGFPLGKGHDVFDAEHLGAVRALQLA
                     EKVGDQNQSLSCWTPKRPLQGCDTPSQGQVKH"
     gene            complement(<709333..>712727)
                     /locus_tag="ACHE_70226A"
                     /db_xref="GeneID:66985741"
     mRNA            complement(join(<709333..709521,709583..709885,
                     710012..710897,710948..711550,711601..711933,
                     711985..>712727))
                     /locus_tag="ACHE_70226A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282536.1"
                     /db_xref="GeneID:66985741"
     CDS             complement(join(709333..709521,709583..709885,
                     710012..710897,710948..711550,711601..711933,
                     711985..712727))
                     /locus_tag="ACHE_70226A"
                     /note="COG:S;
                     EggNog:ENOG410PKJ9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139905.1"
                     /db_xref="GeneID:66985741"
                     /translation="MDQHERPVYRARVPYGVDIIVDDLYLPTPGRCGTKELSRKLESD
                     GWPTDMLFINQAYLDAISAEAKSNGLSWEEWLERRASVRCIPRLKDRHTDKLSNLFQN
                     LAINHPLTLLDILKTYWHDYQGQITPQIIETVRNIEVPCQNTDTWYPLKETYFPSTEL
                     NNICSRASITDSFNLFIEPLPEWATETIDGWEFLAEFEVGLSPDIIFMEQVLHSLKEK
                     APLDTARDGFFAMYRELSIRFFDEDPSEVRNLFCNSEAVYIPATQTRPARITSYRQCV
                     WRGNHCLRNKYPLAMHQEYSDNPNVVHLFKNMLCVADASITTYLEELQYRKKFPDVLL
                     EDLYSIYGELSEELLEGGALTTYACDMFHKEKLIYIPTQRSWVSPDQCIWAAASKIGG
                     QFGISTMYSRFEGLLRGVLNIQIPTITTYINQLRILVSDQPNDITAIKASIHSMGQLR
                     PSAEDLHGVRELRFLPIERADGSKMLAKLTDAFFIADRIEYQAAFHGKVSMLNFSLEE
                     VFRLRRLFEALSLGNHYMSVAVQERTIVRFPAPEPSSSLTHTFRKKARHLYRCAVHYD
                     AGRLQSDGASIRRRLQHIIIHESHGFMKTVILSHNGLRINAETDKGLVHIDHSNNKLR
                     IYVPRDPQQRQRCYSTQLPEALVSFLEIEDRTATEVFRLLCLLHEDVIENVLDDNGIS
                     RISYADTDDPDTDFPTEATQESSFGDTFDVYGTSSDDESRSSETEFTQGSMASPDTAT
                     RNASSTVQRPEYEPEYSLSTHQQASSFPRPVPTNFVEPSSDTTSVPTSYSPQYVRLLD
                     HVIMLARQAAFPRNSDSTSTTACASGNSIQGLASRSSIPSESQLAHDIKIGAAGELYA
                     FELLSQQSLPGFTRQNWQSNVRKMVNVHPEYLDLEPWSGLETADLVYNDIDSVLTKIL
                     INAGYLSQIDWEGATPTYFIEVKTTAGTCGTPFYMNRSQYVRMQSMKIGNHEPANAKI
                     YLIFRVYSLGSDGTAMEIYLDPETLREVGMLRFTPASYSVSPRVDY"
     gene            complement(<713984..>714641)
                     /locus_tag="ACHE_70227A"
                     /db_xref="GeneID:66985742"
     mRNA            complement(join(<713984..714070,714108..>714641))
                     /locus_tag="ACHE_70227A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282537.1"
                     /db_xref="GeneID:66985742"
     CDS             complement(join(713984..714070,714108..714641))
                     /locus_tag="ACHE_70227A"
                     /note="COG:S;
                     EggNog:ENOG410PKJ9;
                     InterPro:IPR036890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139906.1"
                     /db_xref="GeneID:66985742"
                     /translation="MEQAREIVNNIRRRNGGITEEQRAELGTDLTEVYQNLQSLAGRS
                     IRHVAEDLYDSDTRFIFELIQNAEDNRYESALSRNESPYIHFTLHDDRLVIDSNEDGF
                     NEEDVRAICSIHNSSKPLTGGYIGHKGIGFKSVFKVAQRVQIQSGPFCFSFQHCRNES
                     GLGMITPSNQEHEALPDEKISTHEPQSSLKYQTHSSYFFRNSKRLQ"
     gene            complement(<715387..>716320)
                     /locus_tag="ACHE_70228A"
                     /db_xref="GeneID:66985743"
     mRNA            complement(join(<715387..715880,715936..>716320))
                     /locus_tag="ACHE_70228A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282538.1"
                     /db_xref="GeneID:66985743"
     CDS             complement(join(715387..715880,715936..716320))
                     /locus_tag="ACHE_70228A"
                     /note="COG:S;
                     EggNog:ENOG410PX2B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139907.1"
                     /db_xref="GeneID:66985743"
                     /translation="MEQGGWAAKEDRVVRDELAKLQDGLRSWARKYSRAAVSSDLESV
                     SALEKDKVVEELKGYCVQTNWCSLLERMPISSNKVFPLLVQALLAKDIFQTIFADPFF
                     AFPETIDDPELPNRAEMRLLHQTMTQLNKEEAEIWRSHMIRVLSGHRSGGKGSSMPDR
                     IQKMASFHGEALINGRAHILLREPESQAEVIRRSDDLYRLYHQAGGLALSLWAQRTVI
                     ASHGLQRLHKFRASSSLMTAHRLHHLDEDDKRLDGRKILLCIQPAVLAFGNENGENYD
                     KSKVWAKAIVLVEDNA"
     gene            <717722..>719241
                     /locus_tag="ACHE_70229S"
                     /db_xref="GeneID:66985744"
     mRNA            join(<717722..717815,717870..718459,718514..718558,
                     718619..718688,718751..719006,719060..719165,
                     719230..>719241)
                     /locus_tag="ACHE_70229S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282539.1"
                     /db_xref="GeneID:66985744"
     CDS             join(717722..717815,717870..718459,718514..718558,
                     718619..718688,718751..719006,719060..719165,
                     719230..719241)
                     /locus_tag="ACHE_70229S"
                     /note="COG:S;
                     EggNog:ENOG410PJ95;
                     InterPro:IPR013126,IPR043129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139908.1"
                     /db_xref="GeneID:66985744"
                     /translation="MSSELINRLGSLVLAPTHKIIVGVDYGTTYTGASYVSTKGKADL
                     DNIILINSWPGPTRDAETVLKTPSRIAYQEDNPRVSKQRWGYQVEPGMIAYSWSKLLL
                     DENTPLTKYDDAALDGSSGAGILKLPKGKNAVDVVSNYLSEVYQYILKTIAKQITEEA
                     LSVTPLEFWFTVPAIWSDQAQSATRTAARRAGFGSRVGDYIFMISEPEAAAIAALKKY
                     TTNSMGGSVEPGDGVLVCDCGGGTVDITTYLVEATHPELMFEELCTGIGGKCGSTAVD
                     RNLYQLMSDRFGDAFDSLPMKRKGPGSEFMKNFEVIKRDFGNSDEERIFELPINMAVE
                     DPNPEHFDDEERMVIIHSDDLRSIFDPVVDQILSLVRQQIKDATAEVGRGVINRVI"
     gene            <719572..>720087
                     /locus_tag="ACHE_70230S"
                     /db_xref="GeneID:66985745"
     mRNA            join(<719572..719607,719680..719815,719870..>720087)
                     /locus_tag="ACHE_70230S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282540.1"
                     /db_xref="GeneID:66985745"
     CDS             join(719572..719607,719680..719815,719870..720087)
                     /locus_tag="ACHE_70230S"
                     /note="COG:S;
                     EggNog:ENOG410PJ95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139909.1"
                     /db_xref="GeneID:66985745"
                     /translation="MASGYMEWIIAKGEKYSENHSCTVSFYRSHQDSHGLKFYAELYS
                     CDSNHAPERVDDPGVRCVGSICTDLTGVDLGLFDCKYSTTGRVYRVEFDLKVVFGARE
                     GLLKFETICQGKVIGRTTIDFSTTKFY"
     gene            complement(<720500..>722738)
                     /locus_tag="ACHE_70231A"
                     /db_xref="GeneID:66985746"
     mRNA            complement(join(<720500..720665,720718..721318,
                     721371..722142,722289..>722738))
                     /locus_tag="ACHE_70231A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282541.1"
                     /db_xref="GeneID:66985746"
     CDS             complement(join(720500..720665,720718..721318,
                     721371..722142,722289..722738))
                     /locus_tag="ACHE_70231A"
                     /note="COG:T;
                     EggNog:ENOG410PKMA;
                     InterPro:IPR017946,IPR035892,IPR000909,IPR001192,
                     IPR001711;
                     PFAM:PF00388,PF00387;
                     go_function: GO:0004435 - phosphatidylinositol
                     phospholipase C activity [Evidence IEA];
                     go_function: GO:0008081 - phosphoric diester hydrolase
                     activity [Evidence IEA];
                     go_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0035556 - intracellular signal transduction
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139910.1"
                     /db_xref="GeneID:66985746"
                     /translation="MVETAAMKEKVHQLVEKTSHLALGSPPAPGAEPSIPHAAEVRES
                     VAAFSPTMASYLQEIYKSLLTSESCKSDFLHKAQSESSDGKEHADPLASLADFQAYMA
                     SPASAALRPPHEQDTSAPITDYFISSSHNTYLTGNQLYSDAAASAYTNVLLGGCRCVE
                     IDVWDGQADSADEDTSSSSSSSDDEKPHKKEQKERQKHKKLEKEKKATNRRSRINDAV
                     SSKLGSIMGRKSIPQDASTVGDGNFQDRPAHLPIRPEPRVLHGHTLTKGTTFRDVCNA
                     IRDSAFVVSDLPVIVSLEVHACLEQQEIMVEIMQEAWKGFLIEVTPELLNSPMPKLED
                     LKRKILIKVKWLPESVTGEAGEAAEDLEEIEVVQSQKSQESTAPPPKPSKILNALSRL
                     AVYTKGFSFKHLDQPEAKIPGHVFSLSESAAKETSQNYRDALFEHNRSNFMRVYPYGL
                     RVNSSNLDPAFHWRRGAQIVALNWQNLDKGTMLNHGMFRGEPGWVQKPQGYRSSEEPS
                     TPIIRRTLDLSIEFFAAQDLSLPPGDTKEKSFHPYVTTCLHVEQPGEETGATADDDST
                     DTEKNSYKRTIKSSVGVTPDFGPQTIQFPQVTGIVEELSFVRFKIKDDELGRDSMAAW
                     NCIRLDRLQSGYRLLHFHDCTGWRSGGVVLVKITKNIS"
     gene            <724089..>724945
                     /locus_tag="ACHE_70232S"
                     /db_xref="GeneID:66985747"
     mRNA            join(<724089..724137,724197..>724945)
                     /locus_tag="ACHE_70232S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282543.1"
                     /db_xref="GeneID:66985747"
     CDS             join(724089..724137,724197..724945)
                     /locus_tag="ACHE_70232S"
                     /note="COG:O;
                     EggNog:ENOG410Q1WH;
                     InterPro:IPR036249,IPR004045,IPR036282;
                     PFAM:PF13417;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006749 - glutathione metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139911.1"
                     /db_xref="GeneID:66985747"
                     /translation="MADTPVHFFDVESKLPDNTKAWSFNTNKTRLVLNYKNIPYTQSF
                     ISYPEITPLLRSLQVTSYPEGPFAYTLPAIYHPPSIRVASGAMMDSLPIALHLDRLYP
                     ERPLWPNGDASYALSLAVGKLVSNAALKSLVLVIPHVPKILDKKGREYFIKTRSAMFG
                     KPLSELRPSDPDSLRVTTESIKREVETLAQMLRGRYGKSGPFFEGENASYADFILMAY
                     LAWTEKLDNQLWRELMGIGRGEIKALWDACLPWLYGQGQTTKWKISK"
     gene            complement(<725237..>726274)
                     /locus_tag="ACHE_70233A"
                     /db_xref="GeneID:66985748"
     mRNA            complement(join(<725237..725484,725554..>726274))
                     /locus_tag="ACHE_70233A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282544.1"
                     /db_xref="GeneID:66985748"
     CDS             complement(join(725237..725484,725554..726274))
                     /locus_tag="ACHE_70233A"
                     /note="BUSCO:EOG09265KQ4;
                     COG:S;
                     EggNog:ENOG410PR5G;
                     InterPro:IPR013870;
                     PFAM:PF08561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139912.1"
                     /db_xref="GeneID:66985748"
                     /translation="MSTTPWVPTNCRRTTHVTSPPAWHQIHPGVFSENYLRAGPQHPS
                     VRTELTELSRSPRSQELRLISTSPFNCPTTTLHPATMICQRCRTGILSRLQPQQTLTR
                     TASRQNLLQRPQFQQTSPYSDGKPSVSATPPPPKPRQPIADDISIPSAVSSASPGVSQ
                     PLSTPESGVHADVHPEQPVKRAPKVVSSCPAGTKLNGLNYFKNKPDVFAREDEEYPEW
                     LWGLLEQFESKKKAQDGGVDPSTLNKKGRKKLEKKLAAQAAAMPPKIPVHHQATDITP
                     ASYSRPETGDIFTEATASLEKRTEITKSAREARRKAIRESNFLRGL"
     gene            complement(<739515..>741103)
                     /locus_tag="ACHE_70234A"
                     /db_xref="GeneID:66985749"
     mRNA            complement(join(<739515..739726,739784..740005,
                     740060..740258,740317..740413,740472..740713,
                     740773..740952,741008..>741103))
                     /locus_tag="ACHE_70234A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282545.1"
                     /db_xref="GeneID:66985749"
     CDS             complement(join(739515..739726,739784..740005,
                     740060..740258,740317..740413,740472..740713,
                     740773..740952,741008..741103))
                     /locus_tag="ACHE_70234A"
                     /note="COG:S;
                     EggNog:ENOG410PV13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139913.1"
                     /db_xref="GeneID:66985749"
                     /translation="MENTFISEDPGFILQDDLFRSIETDLSQPQQEKEENILIQLSDA
                     STKPLKVLKLEYTSDLPEYPSTDPNGYGYVINVPPNQQRETVEDMVNSIQYCVRQNYR
                     NRPSSHSSFLGTSYTSSSYRCSGIKICEYAGIQLKNMHHTHVTDDLWTILQDIRQRIH
                     EMERDTTKDAAYRFYRSAKNLFKNQLSCYHFQNSCQPKLTQSSIPNPLGGFDFYVRCI
                     NAPSDPAGHYTYRVPKNGSVHLQFLEGLLNNEIIMDMEECGAVESIKSKSLYCAYDHP
                     QGPGKLVHAKCNVTFHWLIPTDLSQNPYFVFMSHGVHTHVPPPPRKAPAKIMNGILQL
                     INQARSPSLTLGTFLKSPALQSFCAEHNCHTIQQIHESFSNMDPIQAVIRKQRLLHYP
                     AGQNVNGVMFELGKNKDLQVSTS"
     gene            complement(<741733..>743028)
                     /locus_tag="ACHE_70235A"
                     /db_xref="GeneID:66985750"
     mRNA            complement(<741733..>743028)
                     /locus_tag="ACHE_70235A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282546.1"
                     /db_xref="GeneID:66985750"
     CDS             complement(741733..743028)
                     /locus_tag="ACHE_70235A"
                     /note="COG:M;
                     EggNog:ENOG410PM6B;
                     InterPro:IPR036291,IPR016040,IPR005886;
                     PFAM:PF16363,PF01370;
                     go_function: GO:0003978 - UDP-glucose 4-epimerase activity
                     [Evidence IEA];
                     go_process: GO:0006012 - galactose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139914.1"
                     /db_xref="GeneID:66985750"
                     /translation="MMETPDRYDSNSPFEPCSPLSLDSPATDGFDLFDNDGYFEELQS
                     DSLVGRYILVTGGLGFIGSHTTLELLKANYNVLIIDNLSNSFLSVLERINFLASKYHE
                     QRGTKMPSLRLHSHNFRDQLALRQFLKEYRVPSETGRPMSRIAGVIHFAAYKAIEESI
                     REPLKYYANNVSGLIDFAATLGEFGIKTFIFSSSATVYGTLATSGLPLREELCVHREQ
                     IVRDDDGVEKIVQPGCTGITNPYGRTKWMCETILADLAASDPEWTIVNLRYFNPIGCD
                     SSGLLGEDPKQVPTNLLPVVIKVITGQYQELQIFGTDWETEDGTAVRDFIHVTDLARG
                     HIAALNAANDGKLRDNFRAFNLGAGRGHSVMEVVNAMEEVSSKHIPVRTTGRRPGDIG
                     SCVAVATRSHEELHWRTEKTLKDACLDICHFLDVSGLSS"
     gene            <747785..>748829
                     /locus_tag="ACHE_70236S"
                     /db_xref="GeneID:66985751"
     mRNA            join(<747785..747996,748059..748416,748509..>748829)
                     /locus_tag="ACHE_70236S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282547.1"
                     /db_xref="GeneID:66985751"
     CDS             join(747785..747996,748059..748416,748509..748829)
                     /locus_tag="ACHE_70236S"
                     /note="CAZy:GH135;
                     COG:S;
                     EggNog:ENOG410PRJ3;
                     InterPro:IPR021986;
                     PFAM:PF12138;
                     TransMembrane:1 (o18-41i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139915.1"
                     /db_xref="GeneID:66985751"
                     /translation="MNSQILANRFLQSKRSRLLVAFIVLVLILAIVIPPAVVIPLRDK
                     SMGPKSKVFVPLYVYPAPGAWTPLENVVATHPSINFTVVINPGNGPGPNALPDANYTR
                     EIPRIASYDNVRLLGYVPITYTNRDIALVRRDVETYAGWPVNGSNPDLTVQGIFFDET
                     PQEYDDRALGYLQELTDLVKRSSGLGPDKYVFHNPGVVPDYRYISTADSTVVFEATYD
                     TFQERRKAKVFKTLSDDNRGQLCAVIHSVPDSVQGSKLRSLVKKARKVAEEVYITHLR
                     VDYYAGFGHSWGDFVDLMAA"
     gene            complement(<750497..>751408)
                     /locus_tag="ACHE_70237A"
                     /db_xref="GeneID:66985752"
     mRNA            complement(<750497..>751408)
                     /locus_tag="ACHE_70237A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282548.1"
                     /db_xref="GeneID:66985752"
     CDS             complement(750497..751408)
                     /locus_tag="ACHE_70237A"
                     /note="CAZy:GH114;
                     COG:S;
                     EggNog:ENOG410PJDR;
                     InterPro:IPR017853,IPR004352,IPR013785;
                     PFAM:PF03537;
                     TransMembrane:1 (o20-42i);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139916.1"
                     /db_xref="GeneID:66985752"
                     /translation="MTPMGQSTGGWKTWSTKKKLIVLVSAVLVLILVLGLALALGLKH
                     DKEREPRETPPTPAKWQPAAGSTFQIVLLYQLDDTSTNTDIYDIDLFYNTKETISQLH
                     REGRKVLCYFSAGSYEDWRDDRAQFHKSDLGSNLAGWPGERWLDINSENVRRIMLSRL
                     DTARDKGCDGVDPDNVDGYDNHNGLGLTRADAADYVNWLANETHARDMSMGLKNAGDI
                     IPYVIRNMQWSVNEQCGEYKECETYSSFIEAGKPVFHIEYPKGNEVNDSLAVTNAQKQ
                     SVCGSDGAMGFSTVMKNMNLDDWIQTC"
     gene            complement(<751971..>754101)
                     /locus_tag="ACHE_70238A"
                     /db_xref="GeneID:66985753"
     mRNA            complement(join(<751971..752237,752296..>754101))
                     /locus_tag="ACHE_70238A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282549.1"
                     /db_xref="GeneID:66985753"
     CDS             complement(join(751971..752237,752296..754101))
                     /locus_tag="ACHE_70238A"
                     /note="COG:S;
                     EggNog:ENOG410PKR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139917.1"
                     /db_xref="GeneID:66985753"
                     /translation="MSLIPSSFFSSMSPAAPPVDSKPVSSNILVIAKDNATASDATSG
                     LNAYGVPFTALLVPQNGVQLPALNSSEGGNFGGIFITSEVSYDYGQERGFQSALTPDQ
                     WNQLYAYQIEYGVRMVHQDVYPGDRFGTTPAGEGCCANDVEQLVSISDTSEFPTAGLK
                     IGEGVTTKGLYHYPATIVNTTNTKEIAQFAENGVITTKTTAAVINNFGGRQQMAFFIS
                     SNTTWSQTSTYLQHAWINWITRGTHAGQRRVIFNTQIDDMFLESDIYNSPGTVYRITP
                     ADMNGIVEWLPSIRAKMNPGSDYFMEIGHNGNGNIEASSTTEEGESICNGGGIEYESP
                     PDTEMEFKKPQGTGTDLWPVRTTAYTWSSACTNRDELLLWWTNEANRDQFAHVSHTFT
                     HLEQNNATYSDASKEIFYNQAWLKQVGISSAKKYTSQGIIPPAITGLHNGDALKAWWD
                     NGVRNCVGDNTRSVLVNQENSMWPYFTTVEHDGFAGMQVNPRWATRIYYNCNSPKCTV
                     DEWIETSHGTGNYGNGGFNDLLTAEKSDTMVRLLSLSHSPYMFHQANLHNANVEPITI
                     NGNTGNYSIFQAWVETQVQEFTRLVNWPMVSTTHQEMSDAYLSRYTRDQCKYNMSYLT
                     SNREITGVTVSAENANCAAPIPVTFSVPPTDTQGFKTEQIGSDPLTVWVKLSGSPVTF
                     TLSKPIPF"
     gene            <756987..>764159
                     /locus_tag="ACHE_70239S"
                     /db_xref="GeneID:66985754"
     mRNA            <756987..>764159
                     /locus_tag="ACHE_70239S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282550.1"
                     /db_xref="GeneID:66985754"
     CDS             756987..764159
                     /locus_tag="ACHE_70239S"
                     /note="COG:M;
                     EggNog:ENOG410PKT7;
                     PFAM:PF00534,PF13692;
                     TransMembrane:13
                     (i485-505o525-549i561-583o595-616i628-645o651-672i815-
                     836o848-866i908-929o935-952i964-981o993-1011i1329-1347o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139918.1"
                     /db_xref="GeneID:66985754"
                     /translation="MATHTHWRLNSDVKRDLVDIPAWDTLRAYFPSLDAVLKSVGSQV
                     EAMDDQSITVRDPSNWSMVMSSHDSPLSVSFTEQSYDSCGCVPLGIDVAPAVSAEILQ
                     SQLHLKSLGLLDLVSSSKVQGVGMLFRQFCDHWAVNSGLMKSIQELSELAVDGSLRIN
                     LGMDSGFRKDTYSRFWAVYQIDSTGIEIFISKDAPDFEGTVLHTFLSAKGYSRQICFE
                     AETALGNWLDNLVGNTGLPRRIVQDIDALSPEERLLLLQHLTVTYSTDRISEAVCSYT
                     RRQLVDAPSFAQLKELNAIGFLDGSISPEILVRTRVNWYKEQHCQYPSTSTCLALFNE
                     VDVTFARILAERREQDLAHITSSLCDMIKEHHIDAYVDITALSLFCAARKCAFDEIYT
                     EVTDRNPLFGIQNDQAAAFAEAFALGSRCKAYFDITPSAFGKLLSDRFRCQYSKRELP
                     DWVNGAPQVATAYAGAQTDVDHVDWVRPMSPYQRFTFLSAFAVPALIDILLLTIIGRG
                     LYLSTFMTYDQQQSATLAVMISLLLSGAIGAWIACGGPYYLVSMAFAAANMFILTRLI
                     AGVSFTIATGLIAFIAISAGRGAAAGIIFYLYLVALTTYFSVFASLASFSYPKSSFLS
                     GRKIIFYCVPILFISPIVTTFTGHDVAIYLTVLYAFLGCLLLGLRTVASKWVTWYQRI
                     RRTDDTEIRKWYISTYKNNDEKSLDNLSDPAVLKLAREKLLEDVFAERKRRSSSEAKT
                     SGLVFELARDWESTNFLLDWYCRYADVPRPVPFSSSWNIQTNVALDTLRSSQKGLRLH
                     NAFIHWRQSGKEIGCGVLYFVIALLDKWVELLTGGHLVGLSASLRNTSRMAIGFGLAY
                     YLVGAVLIDIKAQDLEDLLAKQTPLEVRTAQDARISQKRYIRFKRAVYWRTLFKFLMW
                     HTWSLAISTALVWTFQDSLEATIMFLMYVLAYTGLLWYQYTKIFSGPHALKPLLVGVI
                     VGLPIGIALKQCLPSFQYPQVTGLAAATWTVALLSLFTAKLGMPRKIDSLEKPGVTFH
                     AYTTPWDDPEWSQEELHALWQKSLQISPYSRLKLAPKAHPGFEVKDIMTSRIEKPKIE
                     EAFPNADELVRVAIDGWEEGMISIELVPSGSLGPGIRALSCHTANQLELVISVGRALK
                     KHVDVHANCQIIAETLLHAVSEAFMGMSHEHAVLTGSLVTDGMTETTRQQLHEESNTA
                     TIMRWARKELLRQLCLGLDCDTQWEQLPKQIRIMLLDRCLGRPGRLSIDQADWLQETL
                     CVSDAKTLDVHVARCNLGVATVARILSYPHHGTGGTLIREPELAAYIPRPPLTCARIA
                     RLLKTPFSFFYHALGSLSKFVVVALVADAEFQRELDHVMKHHTAIYRVPAKLILNLIW
                     CYSKIVQDTFMVFFLFHGRDNVKRLWDETKGLTIGIKKTSASVQGLDGTFTAFWHAGE
                     DERFKVYYYAGEHKTEPDDSTLLRYVCTYSSDLLLHIRQELSYGQLVNEYHYDYYTPT
                     RTSRLKKNFTARIPLSRRCVQGEHASQRVQYNRNGLISSGSYMRNGSLVRFQYRYRKN
                     PHFGDELLRAEYSFPHSNCSISWCAPPLRRSEKVDRWIPHAKVTRATIVQGSDVYESR
                     WLYDHKFNPAIFTTLNGENVKTPAFIEYDHLGILTKPTHTSFVRDNPLLYCDSLTTNI
                     VQRFLGLTTRRFPVSTSRARSLMWKAWKDHVDFDGVTVRWMDDRLLRRDRTLAPYWRR
                     RDHGELASAETYLKQHADTIMASADLNDNVSSWTSLAVKISDLFNFGPGGDAVINTRT
                     KDFGSDTENTLHVMAADTGTWPNEGGGVSACRRDMVNHLRTVKWHMICESANDFGIPK
                     HQTEHNIQSLKIIPLWGLDFLTPTHGLLRNKLDSEVDDVTSANELDIKQNFVPILATL
                     VKSSRTINLTRADIRQSTRALVNLNTYFQGSRHWTQVWNSDIVKKSWNELWLSQTMPN
                     TVPSSSWFQTELPTLASLDVALGLWYRYLFIFSIPVPEKVPDVFQASHHSVSASYGVI
                     CKMKRSCTLQIWDHAISWREVNISLSSALSKLPPFVRNALLGLMRITSVLTLHHADII
                     TPCTDFFNPDWEVEIGTAQGTIQHRNIFRRKVDPVINGIINMQKFAPVKEIKAQHPTV
                     TMLSHVWYAKDIKTALLAADIIINHWHFTDYNLDIYGAIDRSPMYTTECQEIIASKGL
                     RGKVTLRGTADPLDVLERTWLFLNSSLSEGLPLALGEAALTGAPVVCTDVGASLRVLS
                     DPDDSSRYSAVVAPNDALALARAQISMLAMLGEWSQYADDPDDTSAPVLTSSPSREDV
                     EAITRRMYEKTPQRRKLGMMTRAIVQKSFSGERCLREHEQMLWIGKAMKVMRSRGESE
                     VSGEWDSGGVGESFGPFSPMSSGNIR"
     gene            complement(<764502..>767364)
                     /locus_tag="ACHE_70240A"
                     /db_xref="GeneID:66985755"
     mRNA            complement(join(<764502..764620,764688..764957,
                     765012..>767364))
                     /locus_tag="ACHE_70240A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282551.1"
                     /db_xref="GeneID:66985755"
     CDS             complement(join(764502..764620,764688..764957,
                     765012..767364))
                     /locus_tag="ACHE_70240A"
                     /note="COG:O;
                     EggNog:ENOG410PGX8;
                     InterPro:IPR001375,IPR038554,IPR029058,IPR002469;
                     MEROPS:MER0000405;
                     PFAM:PF00930,PF00326;
                     TransMembrane:1 (i88-109o);
                     go_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA];
                     go_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139919.1"
                     /db_xref="GeneID:66985755"
                     /translation="MGKPSAEGDHSFLSSSHRRSTSITSDTSDSDLSIDTPTSHKIHP
                     TPQDPTPMIEGEPYRDLEDGESQADDPFLGTRKKSTSSSRTRRVVWILGLLCVGGWVL
                     AFVLFMVQRGPNYQAAMEALETPDSKSATGFTDSGKPITLDQVLGGQWLGRSHGISWI
                     AGANGEDGLLLEQGESDGKGGYLRVEDIENRKGDVESKASKVLMEKGYVVVDGSVVVP
                     YRTWPSADLNKVLLLSNFEKNWRHSYTGKYWILDVESQTAQPLDPGNPESRVQLAIWS
                     PTSDAVVFVRDNNMYMRKLSSETVISITKDGGKDLFYGVPDWVYEEEVFSGNSVTWWS
                     NDGKFVAYLRTDESKVPEYPVQYFLSRPSGKKPLPGLERYPDVSDIKYPKAGAPNPVV
                     DLQFYDVEKDETFSVEIPEDFPGDDRIIMEVLWASGGNVLIRTTNRESDILKVFLINT
                     ETRTGKLVRLDNVAELDGGWVEPSQSTRFIPADPNNGRPTDGYIETVVHEGYDHLAYF
                     APLDNSEPLMLTSGEWEVVDAPSAVDLKKGLVYFVAAKEAPTQRHVYSVKLDGTDLQP
                     ITDISRPGYFDISFSDGTGYALVSYKGPSVPWQAIMNTKGEKATYQETIEENKELARL
                     VQQYALPTEVYSNVTIDGFTLQTVERRPPHFNPAKQYPILFHLYGGPGSQTVDRKFNV
                     DFQSYVASNLGYIVVTVDGRGTGFIGRKARCIVRGNLGYYEAHDQIETAKIWAAKPYV
                     DASRLAIWGWSYGGFMTLKTIEQDAGQTFQYGMAVAPVTDWRFYDSIYTERYMHTPDH
                     NPNGYDNSSINDMSALQENVRFTVMHGVSDDNVHLQNTLVLLDKLDVAGVENYDVHFF
                     PDSDHSIYFHNAHKMVYDRLSNWLVNAFNGEWHTVAHPVPEESIWERAKRSVSVFAY"
     gene            complement(<767965..>769912)
                     /gene="CCT4"
                     /locus_tag="ACHE_70241A"
                     /db_xref="GeneID:66985756"
     mRNA            complement(join(<767965..768819,768876..769448,
                     769505..769534,769593..769622,769680..769702,
                     769755..769806,769865..>769912))
                     /gene="CCT4"
                     /locus_tag="ACHE_70241A"
                     /product="T-complex protein 1 subunit delta"
                     /transcript_id="XM_043282552.1"
                     /db_xref="GeneID:66985756"
     CDS             complement(join(767965..768819,768876..769448,
                     769505..769534,769593..769622,769680..769702,
                     769755..769806,769865..769912))
                     /gene="CCT4"
                     /locus_tag="ACHE_70241A"
                     /note="BUSCO:EOG09261XNJ;
                     COG:O;
                     EggNog:ENOG410PFPI;
                     InterPro:IPR002423,IPR027410,IPR027413,IPR017998,
                     IPR002194,IPR012717,IPR027409;
                     PFAM:PF00118;
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0051082 - unfolded protein binding
                     [Evidence IEA];
                     go_process: GO:0006457 - protein folding [Evidence IEA]"
                     /codon_start=1
                     /product="T-complex protein 1 subunit delta"
                     /protein_id="XP_043139920.1"
                     /db_xref="GeneID:66985756"
                     /translation="MSTAVSQGPPGNNSFKDKEKPMAVRTSNILAARAVSDAIRTSLG
                     PRGMDKMIQTPKGNTIITNDGNTMLKDMSVMHPAARMLVDLSAAQDVEAGDGTTSVVV
                     IAGSLLAAAERLLSKGIHPTVISESFQRAAAAAVEILHNMSQPINLVDRSTLLQAAST
                     SLSSKIVSQHSGLLGPMAVDSVLKVVDPKTADNVDLRNIRIVKKVGGTIEDSEMVDGL
                     VLNQPVIKSSGGPTRIEKARIGLIQFQLSPPKPDMENQIVVNDYRQMDKILKEERQYL
                     LNMVKKIQKTKCNVLLIQKSILRDAVNDLSLHFLSRLKICAIKDIERDEVEFLCKSLG
                     CKPIANIDSFTEDKLGTADLVEEVQASGARYCKITGIKAPANPVNQTVSIVARGANNL
                     ILDEAERSLHDALCVIRCLVKKRALIAGGGAPEIEVAHALAMRSRELTGTESICFKAF
                     ADAMEVIPTTLAENAGLNSIRVVTDLRHRHAQGQHNAGVSIRSGGVKDDITEENILQP
                     LLVSTSAIELAAETVKMIMRIDDIALSR"
     gene            <770294..>771781
                     /gene="RPT1"
                     /locus_tag="ACHE_70242S"
                     /db_xref="GeneID:66985757"
     mRNA            join(<770294..770388,770456..770570,770625..770854,
                     770902..>771781)
                     /gene="RPT1"
                     /locus_tag="ACHE_70242S"
                     /product="26S proteasome regulatory subunit 7"
                     /transcript_id="XM_043282554.1"
                     /db_xref="GeneID:66985757"
     CDS             join(770294..770388,770456..770570,770625..770854,
                     770902..771781)
                     /gene="RPT1"
                     /locus_tag="ACHE_70242S"
                     /note="COG:O;
                     EggNog:ENOG410PG2P;
                     InterPro:IPR003959,IPR003960,IPR027417,IPR003593,
                     IPR035245,IPR005937;
                     PFAM:PF00004;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_function: GO:0016887 - ATPase activity [Evidence IEA];
                     go_function: GO:0036402 - proteasome-activating ATPase
                     activity [Evidence IEA];
                     go_process: GO:0030163 - protein catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit 7"
                     /protein_id="XP_043139921.1"
                     /db_xref="GeneID:66985757"
                     /translation="MPSATGESWEKYKKNFADEEEPEKKITPLTDDDIQVLKTYGAAP
                     YATALKRLEKQINEKQASVNEKIGIKESDTGLAPPHLWDVAADRQRMAEEQPLQVSRC
                     TKIIQDEKDSDKSKYVINVKQIAKFVVNLGERVSPTDIEEGMRVGVDRNKYQIMLPLP
                     PKIDPSVTMMTVEEKPDVTYGDVGGSKDQIEKLREVVEMPLLSPERFVNLGIDPPKGA
                     LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
                     IIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDARGNIKVMFATNRPSTLD
                     PALMRPGRIDRKIEFSLPDVEGRANILRIHAKSMSVERDIRWELISRLCPNSTGAELR
                     SVATEAGMFAIRARRKVATEKDFLAAVDKVIKGNLKFNSTATYMQYN"
     gene            <772285..>774549
                     /gene="SDH1"
                     /locus_tag="ACHE_70243S"
                     /db_xref="GeneID:66985758"
     mRNA            join(<772285..772326,772399..772450,772515..772588,
                     772652..772815,772885..774273,774330..>774549)
                     /gene="SDH1"
                     /locus_tag="ACHE_70243S"
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /transcript_id="XM_043282555.1"
                     /db_xref="GeneID:66985758"
     CDS             join(772285..772326,772399..772450,772515..772588,
                     772652..772815,772885..774273,774330..774549)
                     /gene="SDH1"
                     /locus_tag="ACHE_70243S"
                     /note="COG:C;
                     EggNog:ENOG410PFY0;
                     InterPro:IPR036188,IPR037099,IPR003953,IPR003952,
                     IPR027477,IPR014006,IPR011281,IPR015939;
                     PFAM:PF02910,PF00890;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA];
                     go_process: GO:0022900 - electron transport chain
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /protein_id="XP_043139922.1"
                     /db_xref="GeneID:66985758"
                     /translation="MSSLGLRSLAPASKFSRAINQRRLFSSSRPAARIFANNPLRAKE
                     ANGYISDKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQ
                     GGINAALGNMHQDDWRWHMYDTVKGSDWLGDQDAIHYMTKEAPASVRELESYGCPFSR
                     TEDGRIYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLAHNTNYFIEYF
                     ALDLLMEDGECRGIIAYNQEDGTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMA
                     MVARAGLPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKD
                     LASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPAELLHERLPGISETASIFAGVD
                     VTKQPIPVLPTVHYNMGGIPTKYTGEVLTVDESGKDKVVPGLYACGEAACVSVHGANR
                     LGANSLLDLIVFGRAVSHRVRDISSPGQPHKELSSDAGAQSIQDLDFVRNADGPQTTF
                     DIRNAMQKSMQSDVSVFRTQESLDEGVEKVTKVDSQFDQVGTKDRSMIWNSDLVETLE
                     LRNLLTCASQTAVAAANRKESRGAHAREDYPERDDENWMKHTLTWQKTPHGKVELGYR
                     AVEADTLDSAECKPVPPFKRTY"
     gene            <775530..>776882
                     /locus_tag="ACHE_70244S"
                     /db_xref="GeneID:66985759"
     mRNA            join(<775530..776046,776119..>776882)
                     /locus_tag="ACHE_70244S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282556.1"
                     /db_xref="GeneID:66985759"
     CDS             join(775530..776046,776119..776882)
                     /locus_tag="ACHE_70244S"
                     /note="COG:S;
                     EggNog:ENOG410PTYI;
                     TransMembrane:1 (o113-135i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139923.1"
                     /db_xref="GeneID:66985759"
                     /translation="MNTGMATTTTTDTENAAGTRTTQPQAGTVWSIPGGISGPLPSPA
                     LLGTPSRPHVTTTTGNSSTSTSAHSTISITSFSSSTTSTLSSSEQTESTSSSPDSNLN
                     TSNSSSGSNKALIGGVGGILALVIILAVIFVLFCRRKKKKRRFTLLAWHGPQHGHDRE
                     NGAVIAAAGVGSAGPASSSPAQPTPISITLPTTTTTSTSSPTFNANTPNSATRLLRTP
                     TLPSPAPSFTFSSSEQRHRHPLSPIPSIPSNSSLHSTLSSKHDMALGIEPDLGIHPAL
                     RGTNRETQTERTIETGTATKPETTPELGDTGFYRQRAELATYSQSELINIPPERRHPH
                     FTASSPSPTSLPNSNSNSPPQTTRTSRSRTKIITPDGVLLSANFERLPGCEDYATSFA
                     QHFDGLGIQLVEEEILPAYACDAIEGEGVRADGG"
     gene            complement(<777119..>778598)
                     /gene="ARG4"
                     /locus_tag="ACHE_70245A"
                     /db_xref="GeneID:66985760"
     mRNA            complement(join(<777119..778458,778547..>778598))
                     /gene="ARG4"
                     /locus_tag="ACHE_70245A"
                     /product="argininosuccinate lyase"
                     /transcript_id="XM_043282557.1"
                     /db_xref="GeneID:66985760"
     CDS             complement(join(777119..778458,778547..778598))
                     /gene="ARG4"
                     /locus_tag="ACHE_70245A"
                     /note="BUSCO:EOG092621S9;
                     COG:E;
                     EggNog:ENOG410PHD8;
                     InterPro:IPR022761,IPR000362,IPR024083,IPR020557,
                     IPR008948,IPR029419,IPR009049;
                     PFAM:PF14698,PF00206;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004056 - argininosuccinate lyase activity
                     [Evidence IEA];
                     go_process: GO:0042450 - arginine biosynthetic process via
                     ornithine [Evidence IEA]"
                     /codon_start=1
                     /product="argininosuccinate lyase"
                     /protein_id="XP_043139924.1"
                     /db_xref="GeneID:66985760"
                     /translation="MSAPKVAENMLWGGRFTQGLDPLMVQYNESLPYDRIFWKQDIAG
                     SIAFARANTKTGILSAHEFAEIERGFKQIAEEWSTNTFIVKENDEDIHTANERRLSEI
                     IGKEIGGKLHTGRSRNEQVATDMRLWLRDELRKVEGWLCDLIKVSTARAEAEIEYIMP
                     GYTHLQKAQPVRWSHWLLSHATAFASELQRLREVIRRVNKCPLGTGALAGNPFHIDRE
                     GMAKELGFEGLLYNSMNAVADRDFAMETMQWGSSFMLKISRWAEDLIIYSSLEFGFVR
                     LSDAYSTGSSLMPQKKNADSLELLRGKAGRAFGQMAGLMVTIKGLPTTYNKDLQESVE
                     PLLDHIKTLGDSIQIATGVLSTLTTIPEKMTAALAPEMLATEIADYLVRKGVPFREGH
                     HISGRVVALGEKHGVSMDMLSLEQLKTVDARFDDDVQACLDYERAVELKDAVGGTSKR
                     AVLEQTSVLKELL"
     gene            complement(<780579..>782744)
                     /locus_tag="ACHE_70246A"
                     /db_xref="GeneID:66985761"
     mRNA            complement(join(<780579..782373,782429..782535,
                     782592..>782744))
                     /locus_tag="ACHE_70246A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282558.1"
                     /db_xref="GeneID:66985761"
     CDS             complement(join(780579..782373,782429..782535,
                     782592..782744))
                     /locus_tag="ACHE_70246A"
                     /note="COG:S;
                     EggNog:ENOG410PICM;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139925.1"
                     /db_xref="GeneID:66985761"
                     /translation="MNKRKRSPEETPAGPKTHNSNTSPVAAGELNESLPSISRKITAC
                     AACRKQKIRCDMPDGVPPCTRCRRRELSCVLNKSLQSLVEEAKNTDLLHVDVREIHLT
                     LGAVCEHLGLDRPKPLHSSHNHNSNDVSAPDGDVSGSQAPPSTIDNNDQDQTLPGCEV
                     SPPGTPSAVQAPIDTYLDIAKLGSNSHSRSPGSGSAETPSNQLSRPRRHASPDLVSKR
                     IISMADAETLIDRYFTRVDSYLYGIGSRLHNLQRLRTGHPVLFAAICTVSALHDPGDQ
                     SLYESCNREFRRLVSQSLFEKHDLEYIRALCISSFWLADASRILLSDAIRRSADVHLH
                     RSFGRLWSCAGDARSNPAVAEMRDRVRLWYLLFICDQHLSILHNRDPLLRSDTEIAIS
                     WEAYLRRSDVTDSDVRIVSQVALLLIMSQVRDVLGCDSDTETRIPQTLANQIVHYSRQ
                     LDKWFKRFSSMFKPDPFLGDFPRRGLQLHYQFGKLYLGHQVFKGLRGEAIPGPFMAAA
                     SMAHDAAISIFEMILNEETLQANLVGIPHYFHIMLAFAGHFLLEVTKGYAGQLGIVPD
                     DNFMLIRKVLTLFRETRCVTMHPICRMTPGLERKLGDCAASLVSSSTQVSPVAVSGMT
                     KGIAENVTEGFVWPGDGFFGTVAGTETETGTETGTADEMFLPEWDFGEFSFPGMLSNI
                     MP"
     gene            complement(<783191..>784812)
                     /locus_tag="ACHE_70247A"
                     /db_xref="GeneID:66985762"
     mRNA            complement(join(<783191..783396,783449..783889,
                     783938..784413,784467..784539,784590..784603,
                     784667..>784812))
                     /locus_tag="ACHE_70247A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282559.1"
                     /db_xref="GeneID:66985762"
     CDS             complement(join(783191..783396,783449..783889,
                     783938..784413,784467..784539,784590..784603,
                     784667..784812))
                     /locus_tag="ACHE_70247A"
                     /note="COG:E;
                     EggNog:ENOG410PHHD;
                     InterPro:IPR013057;
                     PFAM:PF01490;
                     TransMembrane:11
                     (i52-71o77-97i128-148o154-175i182-206o226-247i259-280o300-
                     319i340-361o373-394i406-429o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139926.1"
                     /db_xref="GeneID:66985762"
                     /translation="MAQDIKVENGPEPQYYDQEDVKSSPPSAQMDPFGAEDSADVKYK
                     TLTWWQTGIIMIAETVSLGVLSLPAAVASIGMAPAVVLIVGLGFISTYSGYLIGQFRQ
                     KYPFIHSMADAGEILMGQVGRNVLELGQLLFFLFATGSHLLTFTVMMNTLTEHGTCSI
                     VFGVVGLILSFLLSLPRTMKNVSWLAMASFISIFVAVMVTMIGVGVERPGKGIYSVTQ
                     KTDFVSGFTAVTNIVFAYCGHPGYFGFIAEMKNPEDFPKSLCLQQGFEILLYTISAAV
                     IYRYAGDGVASPALGSTGPILRKVAYGLAIPTIVIAGVVLGHVAIKTIYVRIFRGTNV
                     MHQRSFLGTGAWIGLTLAFWTISWVIAEAIPVFSDLLSLISALFVSWFSYGLPGVFWL
                     YMYWGDYFSSPKKILLCLTNVGLVAIGTTICACGLWVSGLAIHEDSKGANGSFSCANN
                     A"
     gene            complement(<785346..>786557)
                     /locus_tag="ACHE_70248A"
                     /db_xref="GeneID:66985763"
     mRNA            complement(join(<785346..785365,785870..786164,
                     786519..>786557))
                     /locus_tag="ACHE_70248A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282560.1"
                     /db_xref="GeneID:66985763"
     CDS             complement(join(785346..785365,785870..786164,
                     786519..786557))
                     /locus_tag="ACHE_70248A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139927.1"
                     /db_xref="GeneID:66985763"
                     /translation="MSMTWRETYGGDARKKQRKLRVFWTRERLATWLQANYEDRHQGA
                     EKLQNLLSLDRSTHILYGTGWFGLEPLNAAPDGAWMNVQSDGYGRESGMLLLSLPLLR
                     SSLRSSTLESERLTV"
     gene            complement(<791797..>792655)
                     /locus_tag="ACHE_70249A"
                     /db_xref="GeneID:66985764"
     mRNA            complement(join(<791797..791879,791938..792163,
                     792218..>792655))
                     /locus_tag="ACHE_70249A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282561.1"
                     /db_xref="GeneID:66985764"
     CDS             complement(join(791797..791879,791938..792163,
                     792218..792655))
                     /locus_tag="ACHE_70249A"
                     /note="COG:S;
                     EggNog:ENOG410Q1WM;
                     TransMembrane:1 (o41-62i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139928.1"
                     /db_xref="GeneID:66985764"
                     /translation="MPNQIPVVSVMGPNHDQSEHTRARKRNENRSLAPNANACRFSIY
                     DTLFFIFFYFLSFNFFLVRPTHYHRQWWPLHRMAMLQQSTTDINPRLVHKALSKSEHS
                     QVLNIRKDLSGLKISLYKPHSLPSHITHSLHTSTMSYKTNYEPYNSMDFDMERERSSE
                     EVLYPLIDLYPHVVALQLQADGQYFNRSDSDSGYHSVNYWTDSSPTRSTFEEESRMSR
                     KSNESTKDRFVSKIRKILCQNDLRRRTNSN"
     gene            <794632..>795436
                     /locus_tag="ACHE_70250S"
                     /db_xref="GeneID:66985765"
     mRNA            join(<794632..794731,794796..>795436)
                     /locus_tag="ACHE_70250S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282562.1"
                     /db_xref="GeneID:66985765"
     CDS             join(794632..794731,794796..795436)
                     /locus_tag="ACHE_70250S"
                     /note="COG:S;
                     EggNog:ENOG410Q1PA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139929.1"
                     /db_xref="GeneID:66985765"
                     /translation="MALNAQDSGEPFLQSSPCLGSPLGHFAQTPTPMKAEQTSGRPEH
                     IPNGSSTEFPYGLMSPMQEQPVRMEEAPAAEPARVDPTEWYPHYLVCLRYFLDHAQHT
                     LPVQSMTSFINIRLPCQRPSAPVFQFTQTEGSPASAATVSLTPYIRRLIVTGNDTPAV
                     LHAFFGNDWEAGIETIWKQERMNYLFTAKSSGWASTKEAYDILPDEQTPTLRPLRNST
                     EEELRLADARWSDWLAMEDWMVGPRSPW"
     gene            complement(<798145..>798885)
                     /locus_tag="ACHE_70251A"
                     /db_xref="GeneID:66985766"
     mRNA            complement(<798145..>798885)
                     /locus_tag="ACHE_70251A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282563.1"
                     /db_xref="GeneID:66985766"
     CDS             complement(798145..798885)
                     /locus_tag="ACHE_70251A"
                     /note="COG:S;
                     EggNog:ENOG410PM77;
                     InterPro:IPR029062,IPR002818;
                     MEROPS:MER0002601;
                     PFAM:PF01965,PF17124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139930.1"
                     /db_xref="GeneID:66985766"
                     /translation="MPKKILIILSDAKSFPLKTPTGTTPQQTGFFLMELAKPLSKLLE
                     SSHEITFSSPKGLTPEPDPNSESLLAFAGNFYERTRENELIQRMRRENGFNSPRPFGS
                     ISDAELETFDGVFIPGGHAPLTDLGGDKELGRVLWHFHERGKPTAVICHGPYAFLSTR
                     EIGDRGFAYKGYRITCWSDAEEKVMETVMGGEIPKVESALREAGADMVEGLSTKVGGI
                     TVDREVVSGANPTAAGALGEKFLEMLGS"
     gene            <799922..>800152
                     /locus_tag="ACHE_70252S"
                     /db_xref="GeneID:66985767"
     mRNA            <799922..>800152
                     /locus_tag="ACHE_70252S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282565.1"
                     /db_xref="GeneID:66985767"
     CDS             799922..800152
                     /locus_tag="ACHE_70252S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139931.1"
                     /db_xref="GeneID:66985767"
                     /translation="MADAEQDLHGKNQEPGKTRGFPLGKGHDVFDAEHLGAVRALQLA
                     EKVGDQNQSLSCWTPKRPLQGCDTPSQGQVKH"
     gene            complement(<803018..>804458)
                     /locus_tag="ACHE_70253A"
                     /db_xref="GeneID:66985768"
     mRNA            complement(join(<803018..803358,803413..803480,
                     803539..803921,803981..804051,804099..804135,
                     804184..804368,804428..>804458))
                     /locus_tag="ACHE_70253A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282566.1"
                     /db_xref="GeneID:66985768"
     CDS             complement(join(803018..803358,803413..803480,
                     803539..803921,803981..804051,804099..804135,
                     804184..804368,804428..804458))
                     /locus_tag="ACHE_70253A"
                     /note="COG:S;
                     EggNog:ENOG410PVD5;
                     TransMembrane:7
                     (o36-55i67-90o110-133i140-161o188-213i225-247o267-288i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139932.1"
                     /db_xref="GeneID:66985768"
                     /translation="MANCSMKEALTAKYIVSRQCDLPIPRRYPEADPGTIIPFVIATI
                     LFAIRMTAKFLRLGGGWGPDDYTIITAYVLAIIAFALNISMVHYGFGMNIWDIPPQDN
                     ITIAYKYFFAFVLVYKALISLAKISVCLFLLRIFQSPVFRYTTYTMIAINTAVAITWI
                     LTDSFHCIPVHLAWTGWAMEEQGTCINFIASTFANGFVNIVVDTVMVIMPVYEVSRLN
                     LSVQKKIGVAVMLGMGLVLTTIGIVRVVIFSRNTSNTNPTFEMEPLNHWSVIECQIAI
                     ICACLPTSRALFVRVLPGANTTHDSSTARPYPTATGASSRTAAVSAFAGSGEREKGRI
                     AKTVSYSVDIGSKTKRLTRESDGFIQLKDIEAGGERG"
     gene            <807941..>808264
                     /locus_tag="ACHE_70254S"
                     /db_xref="GeneID:66985769"
     mRNA            <807941..>808264
                     /locus_tag="ACHE_70254S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282567.1"
                     /db_xref="GeneID:66985769"
     CDS             807941..808264
                     /locus_tag="ACHE_70254S"
                     /note="COG:S;
                     EggNog:ENOG410PYKN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139933.1"
                     /db_xref="GeneID:66985769"
                     /translation="MPHSVHSASSLEDGSGDPLQGSLTGLSLTDTRETETVASDPVQS
                     IEDLTRDVIPQHLARLQQSRRFTLDETDALYVQGRHFQGKWRVSEEGSSIGRHYCPVG
                     SISQL"
     gene            complement(<808768..>809163)
                     /locus_tag="ACHE_70255A"
                     /db_xref="GeneID:66985770"
     mRNA            complement(<808768..>809163)
                     /locus_tag="ACHE_70255A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282568.1"
                     /db_xref="GeneID:66985770"
     CDS             complement(808768..>809163)
                     /locus_tag="ACHE_70255A"
                     /note="InterPro:IPR036770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139934.1"
                     /db_xref="GeneID:66985770"
                     /translation="ACQGGGTYDSPPSNKTLPLIHYLLDNGADPQKGSWRDCGALCTA
                     LEFSRPLEILDKMIDKGATVDDFVFSEAVRSRRIDAVELFFEKATLHCSTKKMLHEAR
                     KTKDREIKSLVKAGVAKRTDQPKWWQIWK"
     gene            <810065..>810874
                     /locus_tag="ACHE_70256S"
                     /db_xref="GeneID:66985771"
     mRNA            <810065..>810874
                     /locus_tag="ACHE_70256S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282569.1"
                     /db_xref="GeneID:66985771"
     CDS             810065..810874
                     /locus_tag="ACHE_70256S"
                     /note="SECRETED:SignalP(1-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139935.1"
                     /db_xref="GeneID:66985771"
                     /translation="MNHSVSTLISLFFILGAHVAPALAMGGCLSAPRDPNDVPPVPQP
                     WTQCKNRPKKWACESKKIDFPTVECLKKDMETCGNVGTGPTIFYSFGAETIEVRKPVR
                     DTKNPKGVMWNDALDASYTEMLAKRKNTFKLDRPERQKVYNARYAEALASLSKGEVFF
                     GVLHYNGKYGGHGAYQNVRTGESPEDNTWIQYEFPTLQHKSRATKVTTFAISDGSYHV
                     DWERGVKGDLKPYHDASKLAVPVVKRSDESNTCALDNNPKDYEKDEEECEE"
     gene            <813004..>814131
                     /locus_tag="ACHE_70257S"
                     /db_xref="GeneID:66985772"
     mRNA            <813004..>814131
                     /locus_tag="ACHE_70257S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282570.1"
                     /db_xref="GeneID:66985772"
     CDS             813004..814131
                     /locus_tag="ACHE_70257S"
                     /note="COG:S;
                     EggNog:ENOG410PYZX"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139936.1"
                     /db_xref="GeneID:66985772"
                     /translation="MPPVTRHSARGHASGGPRHGDSPREQGLAALVKARKHRKREKPD
                     NQMEGDTGEPNASPPPPTPLFMDHEMATQTPPAMLEPQSPNKQLEFELRKNASIALQA
                     RAKKEEEEDEEILEFLNILDKKLSSMKQKNLPRASSFGKALQTFAHNYFTQPGANANN
                     QGHTANPAPASPPKTYANAIPTPKPNNTTGKKLVVSAPKPARPLHLFLRLPTDHPARH
                     ASPHAALQKLRSSLDPAVTDAIKEIQHVPTGLAIGPKDAQSAEILLDNKDDIQQVIQG
                     SNAELEQRWAIFVIPGAIKQYIGYDTSIVTVTEQAAKEEFKLQTGITPLKLHWSKRSQ
                     EHLSIQTMQQQWSWQCQRLPPPRFHLGSISSARTSALDARS"
     gene            complement(<825679..>826137)
                     /gene="TOK1"
                     /locus_tag="ACHE_70258A"
                     /db_xref="GeneID:66985773"
     mRNA            complement(join(<825679..826062,826129..>826137))
                     /gene="TOK1"
                     /locus_tag="ACHE_70258A"
                     /product="potassium channel"
                     /transcript_id="XM_043282571.1"
                     /db_xref="GeneID:66985773"
     CDS             complement(join(825679..826062,826129..826137))
                     /gene="TOK1"
                     /locus_tag="ACHE_70258A"
                     /note="COG:P;
                     EggNog:ENOG410PHEQ;
                     InterPro:IPR013099;
                     PFAM:PF07885;
                     TransMembrane:2 (i27-50o70-88i)"
                     /codon_start=1
                     /product="potassium channel"
                     /protein_id="XP_043139937.1"
                     /db_xref="GeneID:66985773"
                     /translation="MAILVGITSAMHMYAAPTFPNQIYTQAYWFAVIAAVLYFALAGI
                     LMINLLGYLLGHYPQTFVLTDSQRTLILQTTMLGIWLAAGAAIFQKLISLTFADALYF
                     SNVKILTLGFGDITAVDPVARGLSSRTL"
     gene            complement(<828391..>829884)
                     /gene="FET4"
                     /locus_tag="ACHE_70259A"
                     /db_xref="GeneID:66985774"
     mRNA            complement(<828391..>829884)
                     /gene="FET4"
                     /locus_tag="ACHE_70259A"
                     /product="low-affinity Fe(2+) transport protein"
                     /transcript_id="XM_043282572.1"
                     /db_xref="GeneID:66985774"
     CDS             complement(828391..829884)
                     /gene="FET4"
                     /locus_tag="ACHE_70259A"
                     /note="COG:P;
                     EggNog:ENOG410PHER;
                     InterPro:IPR007251;
                     PFAM:PF04120;
                     TransMembrane:7
                     (o66-85i189-209o221-241i294-318o330-349i404-428o434-455i);
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="low-affinity Fe(2+) transport protein"
                     /protein_id="XP_043139938.1"
                     /db_xref="GeneID:66985774"
                     /translation="MNRLMSILSKPGAGAQIQGVAPTQWTRREDVQADMPNFTGYAPK
                     SKARLLDRWLDTVVRVSGSEPVFFLILASLLVWALLGIKYAGTDSWQVLISDVQAIIS
                     YVFDSFLVRQQLNAYGEEMAVVAELQSRILSHSRMLAKLHQETDKEDEEKRSRVMDLA
                     NQYRNAIDSNAELPLETWLGRSITWLSHVFGHLGTVSLYWVGVFAWIGTGHLYKYSNL
                     WQLYMNSASSALMVFIFAFLANICERHAAHTRRCLNAIFKIDSTLEFHLRLLTGDTLD
                     NDVVIIPAPGVSKIQRTIFYYADLVGTLVGTAILLAVIIFWVAIGPLLHFDSNWWLII
                     GTYAGLIGMNDGFVLRNMQACRRSYVDSEFTKIDSQDAKLFEMVALPIPVKESTRKES
                     LTRRASDLMNRFCAHELTVVAGFLTILGLIAGASAMKWTMTGQLLCNVPPSLIELFFM
                     LILITGHNSADDQRRIDLQNIYKRRLELLAFVNGLKAFQVELNVVKG"
     gene            complement(<831627..>832673)
                     /gene="AIM6_3"
                     /locus_tag="ACHE_70260A"
                     /db_xref="GeneID:66985775"
     mRNA            complement(join(<831627..832314,832498..>832673))
                     /gene="AIM6_3"
                     /locus_tag="ACHE_70260A"
                     /product="altered inheritance of mitochondria protein 6"
                     /transcript_id="XM_043282573.1"
                     /db_xref="GeneID:66985775"
     CDS             complement(join(831627..832314,832498..832673))
                     /gene="AIM6_3"
                     /locus_tag="ACHE_70260A"
                     /note="COG:S;
                     EggNog:ENOG410PITV"
                     /codon_start=1
                     /product="altered inheritance of mitochondria protein 6"
                     /protein_id="XP_043139939.1"
                     /db_xref="GeneID:66985775"
                     /translation="MISLGEESDAPSADKNYNFPLQVIHEESSVGDFSDSGLPSSSLN
                     ACGVSKGMDFPRQVWGLLNLVPPVWDGMIYLISNDPNANLGPAAFSHWNENGFDPVRC
                     HSSSDYWRRAPLHCAIDAGCLSIKADIWPSNEDVLVGHTPYSLHQDASLHSLYLTPLF
                     ELLQKRNKRPSRPVPPQGNNSSLAGAFAKEPSQTLVLLLNFKANGDKLWPLVVDQLGP
                     LRKAGYLTNFNGTGINERPVTIIAMGNVPFHAIIANQTYRDIFYKRSATGKAASKAAA
                     VRGRAFCSSSP"
     gene            <834032..>834948
                     /locus_tag="ACHE_70261S"
                     /db_xref="GeneID:66985776"
     mRNA            join(<834032..834563,834620..>834948)
                     /locus_tag="ACHE_70261S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282574.1"
                     /db_xref="GeneID:66985776"
     CDS             join(834032..834563,834620..834948)
                     /locus_tag="ACHE_70261S"
                     /note="COG:S;
                     EggNog:ENOG410PQKI;
                     TransMembrane:7
                     (o20-43i73-94o106-128i140-159o171-196i208-232o244-265i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139940.1"
                     /db_xref="GeneID:66985776"
                     /translation="MARVDNDTALRNMPLEPISSLAPFSALIMSIVLIILFLIRYYIL
                     EDLLIPRIYGRIYTELSELNKRGFINHHIAGTTKIVILIIAAYPFISAISGKATLKSP
                     YTRGSIFTVGDILLVAAQMLIAMYAFELIYRIKLSPIAVLHHIGTILIGQAAIAISLR
                     LVREPDADIEFILCTVWGAFDIISEFFPHVAIILYRVFPNRHVFLKRVFLLSCITTAT
                     GTTCETIVTMYLFGSLWSRWQIAFKVVTPILHVAFSAAQIHGSIVLWKMYRKQCQYVK
                     GSVPVEGADA"
     gene            complement(<835977..>837557)
                     /locus_tag="ACHE_70262A"
                     /db_xref="GeneID:66985777"
     mRNA            complement(<835977..>837557)
                     /locus_tag="ACHE_70262A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282576.1"
                     /db_xref="GeneID:66985777"
     CDS             complement(835977..837557)
                     /locus_tag="ACHE_70262A"
                     /note="SECRETED:SignalP(1-24)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139941.1"
                     /db_xref="GeneID:66985777"
                     /translation="MYVNTSKLATVALATILSANSVLSAPIAGRSSNLLTRDPRGSHG
                     STSHKVSDVTGAISDGTGAIADAMTLQEYLNQKRSPRGHHSGSGSSTGERVSTWTGAL
                     GDITGMGADAATIAEAANNQKRSPRGHHHSSSSSSTGEQVSTWTGALGDITGMGADAA
                     TIAEAANNQKRSPKGHGSSHGGSSSSDKALNGLDAAGNLVGIGADAATIAEAANNQKR
                     SPKGHGSSHGGSSSSDKALNGLDAAGNIVGIGADAATIAEAANNQKRSPKGHGSSHGG
                     SSSSSSDKALNGLDAAGNVVGIGADATTIAEAANNQKRSPKGHGSSHGGSSSSDKALN
                     GLDAAGNFVGIGADAATIAEAANQKRAPKGHSGSSSSGKALDGLDATSNIVGIGADLT
                     TIADAANQKRAPKGHGRPSSSSSSSDKALNGLDAATIADAANQKRSPKGHGSSSSHGG
                     SSSSDKALNGLDAAGNLVGIGADAATIAEAANNQKRAPKGHSGSSSSDKALNGLDATS
                     NIVGIGADFTTIADAASQ"
     gene            <842046..>842610
                     /locus_tag="ACHE_70263S"
                     /db_xref="GeneID:66985778"
     mRNA            join(<842046..842226,842283..842378,842429..>842610)
                     /locus_tag="ACHE_70263S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282577.1"
                     /db_xref="GeneID:66985778"
     CDS             join(842046..842226,842283..842378,842429..842610)
                     /locus_tag="ACHE_70263S"
                     /note="COG:S;
                     EggNog:ENOG410PZP2;
                     InterPro:IPR038213,IPR009311;
                     PFAM:PF06140;
                     TransMembrane:3 (o62-83i90-114o126-148i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139942.1"
                     /db_xref="GeneID:66985778"
                     /translation="MPPSNLLIASLNFTRAETVGAGIRQFIADRSLVIYGVENLTQTW
                     LWDEWWTNLSQWLSRPDVIAAIMAWWITFTIVMTIIMCLGFGPGGVIAGSLAAAFQSL
                     MYGGFTPAGGIFATLTSMAMLGTFMFPAFLLASVLATGVTVLVWGLGVGK"
     gene            complement(<844780..>845389)
                     /locus_tag="ACHE_70264A"
                     /db_xref="GeneID:66985779"
     mRNA            complement(join(<844780..845006,845062..>845389))
                     /locus_tag="ACHE_70264A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282578.1"
                     /db_xref="GeneID:66985779"
     CDS             complement(join(844780..845006,845062..845389))
                     /locus_tag="ACHE_70264A"
                     /note="COG:S;
                     EggNog:ENOG410PYHI;
                     InterPro:IPR016191;
                     SECRETED:SignalP(1-19);
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0004540 - ribonuclease activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139943.1"
                     /db_xref="GeneID:66985779"
                     /translation="MSFNFKSVFLLALAANAYALPISTAGDTALETRSLEARTQYKDV
                     DCNGKVFKADILRSSISKAREVQGLKDQKKPGYSYPKPYGNDDGNMFPGASGLYEYPL
                     NSPVYSGKGIPGSYRVIMTSNYGYKGALLHKGGNTFQKCINVEDKKKQEEEDARKKKE
                     ESDKQSKEAKEANERKKHGKGGKQ"
     gene            <846034..>846909
                     /locus_tag="ACHE_70265S"
                     /db_xref="GeneID:66985780"
     mRNA            join(<846034..846430,846485..>846909)
                     /locus_tag="ACHE_70265S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282579.1"
                     /db_xref="GeneID:66985780"
     CDS             join(846034..846430,846485..846909)
                     /locus_tag="ACHE_70265S"
                     /note="COG:S;
                     EggNog:ENOG410PS59;
                     InterPro:IPR022085;
                     PFAM:PF12311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139944.1"
                     /db_xref="GeneID:66985780"
                     /translation="MVDEYDEYAEYDPDLILTPEFQLLQNLVKDPNASPEEAVQQVVE
                     LTKAEALSGKWPKNTIGGDFAWNISHLALDIATNTKPENQLNLLNFMRKLQTVAVMDP
                     RTGEQLIYDHEKLWTDLPCVGYYSSDLQDFWHYTQHTPEEIEKWENRSTFFARATATS
                     KPFVDESHSFDPLDFSLLAYFELNGAFESEDVYETAVRTVCIWYIHAAEKLWYNCRME
                     RDHTNENTADRKFDMNKWEFWKQELIAASGVYKEGGTRMLIKEAMECINCVDSSN"
     gene            complement(<850095..>850460)
                     /locus_tag="ACHE_70266A"
                     /db_xref="GeneID:66985781"
     mRNA            complement(<850095..>850460)
                     /locus_tag="ACHE_70266A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282580.1"
                     /db_xref="GeneID:66985781"
     CDS             complement(850095..850460)
                     /locus_tag="ACHE_70266A"
                     /note="COG:S;
                     EggNog:ENOG410QE5M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139945.1"
                     /db_xref="GeneID:66985781"
                     /translation="MIHLEDSPLSETVHHERLRALIAGQLDDMQLVCQDHKVLINANY
                     LVALFQSALRHLADEICEPFHYVKATRAYNAVPSSLAAHLAHYEEIGMQSGFCHEDLA
                     PSIASALVMDHYIPVMLSG"
     gene            <852431..>852702
                     /locus_tag="ACHE_70267S"
                     /db_xref="GeneID:66985782"
     mRNA            join(<852431..852445,852493..>852702)
                     /locus_tag="ACHE_70267S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282581.1"
                     /db_xref="GeneID:66985782"
     CDS             join(852431..852445,852493..852702)
                     /locus_tag="ACHE_70267S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139946.1"
                     /db_xref="GeneID:66985782"
                     /translation="MATFQIPPPRNDDYQAISRLMKTTSEQENRSRQYQGLLESRIRE
                     EQATNRQISDRCTWLESIIRKTNEYCTEIS"
     gene            <853815..>855699
                     /locus_tag="ACHE_70268S"
                     /db_xref="GeneID:66985783"
     mRNA            join(<853815..854832,854894..>855699)
                     /locus_tag="ACHE_70268S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282582.1"
                     /db_xref="GeneID:66985783"
     CDS             join(853815..854832,854894..855699)
                     /locus_tag="ACHE_70268S"
                     /note="COG:Z;
                     EggNog:ENOG410QEG6;
                     InterPro:IPR000845,IPR035994,IPR027417,IPR003593,
                     IPR002182;
                     PFAM:PF05729,PF00931,PF01048;
                     SECRETED:SignalP(1-23);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0043531 - ADP binding [Evidence IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139947.1"
                     /db_xref="GeneID:66985783"
                     /translation="MRPKSRNDFAIAIICALPLEADAIEALFDETYDRLGKHYGKQPG
                     DANVYINGRIGKHHAVLCYLPGMGKESAASVASSLQVSYTGIQLALVVGICGGAPPPP
                     KYDEIFLGDIIISDTVMEYDFGRQYPGGFQRKTGVKDTLGRPDREIRTLLKSLQAYNS
                     HIEFQDQVLQYLHTLQQAGTRWQHPDVDDVLFKASYLHKHHGETSSVKCCCSESNVLD
                     SICHDALETNCKDLGCDNDQVIRRREPIKAANISVHIGTVGSADKVMKSGQDRDAISR
                     KEEVIGFEMEGAGVWDNAPCVVIKGVCDYADSHKSKAWQAYAAATGASAAKAFLEYWR
                     PVNHEDVSKNRHLMIPFGRNPRFVGRQDEIHKLEDLISMPDGPKKLAITGLGGVGKTQ
                     VALELAYRMRDREPECSIFWIPCTRYEAVEQACMAIAQVIGIQDVKPAEMKEHIKAYF
                     SQMDGKWLLIFDNADDLDMWVKDSSTGSALRDFLPYNSQGHTIFTTRNRKLAVKLASS
                     DVIHVRELDEKTGMEFLEKSLIQESLLNNHHAMITLLEQLTFLPLAVTQAAAYMNENG
                     IGVSDYLLLLQEQETDVVELLSEDFGDDGRYKDTQNVTAHI"
     gene            <856472..>857467
                     /locus_tag="ACHE_70269S"
                     /db_xref="GeneID:66985784"
     mRNA            <856472..>857467
                     /locus_tag="ACHE_70269S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282583.1"
                     /db_xref="GeneID:66985784"
     CDS             856472..857467
                     /locus_tag="ACHE_70269S"
                     /note="COG:Z;
                     EggNog:ENOG410PX7V;
                     InterPro:IPR011990,IPR019734,IPR013026,IPR002151;
                     PFAM:PF13374,PF13432,PF13176,PF13181,PF13424, PF07721;
                     go_component: GO:0005871 - kinesin complex [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139948.1"
                     /db_xref="GeneID:66985784"
                     /translation="MQNLASTYRNQGRWKEAEELFVQVMETQKQVLWPEHPSTLTSMH
                     NLASIYWDQGRWKEAEELFVQVVEIKKQVPGPEHPDTLASMHNLASTYQDQGRWKEAE
                     ELKVQVMETWKQVLGPEHPSTLASMHNLASTYQDQGRWKEAVELIVQVMETRKQMLGP
                     EHPSTLASMHNLASTYRYQGQWKEAEELFVQVIETEKQVPGPEHPDTLTSMANLALTY
                     CNQGRWKEAEELEVQVMRIYEQVLGPEHPSTLASMHNLASTYQSQGRWKEAEELEVQL
                     METWKQVLGPEHPFTLASMHNLASTYRDQGRWKEAEELFMQVIETEKQVLGPEHP"
     gene            <858587..>858976
                     /locus_tag="ACHE_70270S"
                     /db_xref="GeneID:66985785"
     mRNA            <858587..>858976
                     /locus_tag="ACHE_70270S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282584.1"
                     /db_xref="GeneID:66985785"
     CDS             858587..858976
                     /locus_tag="ACHE_70270S"
                     /note="COG:S;
                     EggNog:ENOG410Q2QC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139949.1"
                     /db_xref="GeneID:66985785"
                     /translation="MQSPLFLRRSFEPILKEISPTDHEILRCGGTPSSLERLPSRLQQ
                     SKRAFPDLRQQLEELAYEASYLRAELQWQKESKQALLHFWEEVFGVFHLLEDALVQVT
                     MRLRDSEQRYISLWRRSSGGGENGGMI"
     gene            complement(<861006..>861848)
                     /locus_tag="ACHE_70271A"
                     /db_xref="GeneID:66985786"
     mRNA            complement(<861006..>861848)
                     /locus_tag="ACHE_70271A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282585.1"
                     /db_xref="GeneID:66985786"
     CDS             complement(861006..861848)
                     /locus_tag="ACHE_70271A"
                     /note="COG:L;
                     EggNog:ENOG410PGPZ;
                     InterPro:IPR012337,IPR001584,IPR036397,IPR041588,
                     IPR043128;
                     PFAM:PF00665,PF17921;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139950.1"
                     /db_xref="GeneID:66985786"
                     /translation="MTTKKLTARQARWAEFLSRFYFLIRYRPGRENTLADALSRPVTD
                     IQKKDEYRHQILLKPETVEAPIQVNDLEPALQVVDQILKANRNSATAEGYHKKAQEGK
                     DDWTLQDGLLLKGNRLFVPDDDPELRTRLLDEVHAQVSTAHPGRTKTQQLIRAQYYWP
                     TWRQDAERYVRNCSKCQRAENPRDHVPGLLQPLPIAERPWQHISMDFRSFPVDKNGYD
                     AALVIVDRFSKRPISIPCKKTATSEDVARMFIKHVYRHRGPPSTIVSDRGPQFVSAFW
                     DELC"
     gene            complement(<864011..>865312)
                     /locus_tag="ACHE_70272A"
                     /db_xref="GeneID:66985787"
     mRNA            complement(<864011..>865312)
                     /locus_tag="ACHE_70272A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282587.1"
                     /db_xref="GeneID:66985787"
     CDS             complement(864011..865312)
                     /locus_tag="ACHE_70272A"
                     /note="COG:S;
                     EggNog:ENOG410Q29X;
                     InterPro:IPR032567,IPR001878,IPR036875;
                     PFAM:PF00098;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139951.1"
                     /db_xref="GeneID:66985787"
                     /translation="MPRPRNTVASTRANRNETNNDDTNRNEANTNTERENRQNPILID
                     GDENEEQRMMTLEEFLQYASEEPEWLYEKLQATHQRYDDSLDDHKVRLAEEELRGQTK
                     DGEIALLRRETEEMKGQLQDIKKQLTDVTAERDAFGSQIARLVMDSASGRRASPMPIN
                     SKSTKIPDPPMLTDGKEPRFEDWLLLMSQKLTANADHFDTSQLRIAYVASRCDGKARK
                     HITPRMRDDAINPYTDSKDMLNHLKTIYDDPNRVTTAKHQFRQLYMKNSDKFHDFFSE
                     FLYLAAEAGVAEDDWKDELYTKLTTKLQELCISSSIGDGTFQEFSSAVSQTASRLEVI
                     NHQAQKNRTFTPNKDMSKGTSRTGTTFKKEPTPSQSTNSTTPRMGNAERDQLMKEGRC
                     FHCQEHGHLARDCSTKTPTPELKELEQKAPENEQNDDAGKV"
     gene            complement(<866453..>867416)
                     /locus_tag="ACHE_70273A"
                     /db_xref="GeneID:66985788"
     mRNA            complement(join(<866453..866577,866631..866812,
                     866871..866986,867051..867271,867341..>867416))
                     /locus_tag="ACHE_70273A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282588.1"
                     /db_xref="GeneID:66985788"
     CDS             complement(join(866453..866577,866631..866812,
                     866871..866986,867051..867271,867341..867416))
                     /locus_tag="ACHE_70273A"
                     /note="COG:S;
                     EggNog:ENOG410PPEN;
                     InterPro:IPR029062;
                     MEROPS:MER0031431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139952.1"
                     /db_xref="GeneID:66985788"
                     /translation="MAPSQKALIAITSAHAPLYPDGKETGLFITEALHPFEVFRKAGF
                     EVDLVSETGSYQPDWLSQQKDWLSDQDRAVHEDHNSEFRSKLDKLLKPNDVNPANYGL
                     FFASAGHASLIDYPSAKGLQAIAARIYTIGGIVSAVCHGGAIFPGVIDPSTGKSVIAD
                     RKVTGFTTRGEEEEGVLDTIKSWNRPTIEASAADSGATYVSPAGPWDAFTITDGRIVT
                     GANPASAHVTAEAAVKAFNNL"
     gene            complement(<868693..>869659)
                     /locus_tag="ACHE_70274A"
                     /db_xref="GeneID:66985789"
     mRNA            complement(join(<868693..869115,869173..869264,
                     869318..869584,869647..>869659))
                     /locus_tag="ACHE_70274A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282589.1"
                     /db_xref="GeneID:66985789"
     CDS             complement(join(868693..869115,869173..869264,
                     869318..869584,869647..869659))
                     /locus_tag="ACHE_70274A"
                     /note="COG:Q;
                     EggNog:ENOG410PFM9;
                     InterPro:IPR013154,IPR013149,IPR036291,IPR011032,
                     IPR020843;
                     PFAM:PF00107,PF08240;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139953.1"
                     /db_xref="GeneID:66985789"
                     /translation="MNAVVVQGGKGPADSMSIQQIPKPVPCTGQALVKIKAFGLNRMD
                     LLQREGLYPLPPQAPETLGVEFSGTIEALGPDTKCDFQIGDPTFGLAYGGAYAEYIAV
                     STDMLIHKPAALSWEEAAGVPETWITASQALLLIGNFVPGQSVLWHAGASSVSISGIQ
                     LAKAKGAKAIYATVGSQEKVDFLVKELGVTAAFIYKTQDWASELKQATNGEGANIIVD
                     FVGASHFQGNLNAAAYDGRVVLLALMGGAKLPDNVDISALLSKGSA"
     gene            <870428..>871091
                     /locus_tag="ACHE_70275S"
                     /db_xref="GeneID:66985790"
     mRNA            join(<870428..870496,870549..>871091)
                     /locus_tag="ACHE_70275S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282590.1"
                     /db_xref="GeneID:66985790"
     CDS             join(870428..870496,870549..871091)
                     /locus_tag="ACHE_70275S"
                     /note="COG:S;
                     EggNog:ENOG410PU9D;
                     InterPro:IPR007219;
                     PFAM:PF04082;
                     TransMembrane:1 (o52-69i);
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139954.1"
                     /db_xref="GeneID:66985790"
                     /translation="MPPNDVLDQLITQFFDCVDWFMMVFHEGEFRRQYRNLIASVDVS
                     ASDGNNNFLWLLLLVLGLGAHYSSFTGSLGERQQNLQDLSKRLLAEIEYKFLPIIGSP
                     NVEAVQICVLMGSFHLFNGRPTVGLGVLGSGIKIAQVIGLHRESMWQGVSDVARETRR
                     RSWWALEVADKCVVSTHPASLLADQLIDYFPDTQPLPLGGRAL"
     gene            complement(<874696..>876795)
                     /locus_tag="ACHE_70276A"
                     /db_xref="GeneID:66985791"
     mRNA            complement(join(<874696..874808,874893..875329,
                     875383..875696,875748..876448,876507..>876795))
                     /locus_tag="ACHE_70276A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282591.1"
                     /db_xref="GeneID:66985791"
     CDS             complement(join(874696..874808,874893..875329,
                     875383..875696,875748..876448,876507..876795))
                     /locus_tag="ACHE_70276A"
                     /note="COG:S;
                     EggNog:ENOG410PPVP;
                     InterPro:IPR027417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139955.1"
                     /db_xref="GeneID:66985791"
                     /translation="MSFLYYAFRKLLNAGAPDDIPPQPAYIMTGRCKGESMVDGQTVP
                     CFCPKGQYQVVDRHPNLSELRCICGHYFSKHDSSPESTTSAPSALAPTLPRHARSAPR
                     KRLPETFTERNLTVTALWDLIKRRQVVHIRGTPATGKSTLAHLLARHVSILEPELEVY
                     HLCWPESFDYLLKSTPYSYLLNDLAHRSQDCDDWMDIEGLLIIDEAQASYRYSSLWND
                     LIKFLEPGFGLRVALFSSYGSASALVQEASTLTPLKLNSNQRVSLKRFVEHPDLCLLL
                     SHDEFHDLVYRRCLSYGDSQPFRPSAELIEHLFGMTQGHAAASACVLEILSESKELRS
                     FRKRALPIPLVDALKFIQTDKFLKAALNSAKFARGLVSEEVLHKMPDLVKFLQTAVSQ
                     NFVSGDPAPGTPLELCYRNGWLQAELSRDDSTVYVFASPLHRRCTEFLLPQPSEPFPR
                     SLYPTLKVFSFSVLRMFSAVALNIEAPLSDSAVSRPLEAGYQDEYYRASFELLGNLYL
                     KSEWAGTQQTGWVDFVIPSEKWIVDCIRDGDKLEEHIERFQMTGKYRHRISNQEVQEF
                     ILLDFRRSIPRKQRGIDWLFHVVFADDFSSYTVYDSDCKVVLGESQVALLR"
     gene            <878786..>881545
                     /locus_tag="ACHE_70277S"
                     /db_xref="GeneID:66985792"
     mRNA            join(<878786..878870,878926..878957,879023..879490,
                     879559..879577,879628..879822,879873..880174,
                     880235..880441,880504..881006,881086..881389,
                     881456..>881545)
                     /locus_tag="ACHE_70277S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282592.1"
                     /db_xref="GeneID:66985792"
     CDS             join(878786..878870,878926..878957,879023..879490,
                     879559..879577,879628..879822,879873..880174,
                     880235..880441,880504..881006,881086..881389,
                     881456..881545)
                     /locus_tag="ACHE_70277S"
                     /note="COG:S;
                     EggNog:ENOG410PXCT;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (o603-622i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139956.1"
                     /db_xref="GeneID:66985792"
                     /translation="MDGSPEAESGPDRRQALACSYCRIEKIKCSRTNPCENCMDRGEE
                     CTYPLVKRRVGSKRDKPRKALEERLARMEFLLQLSNSENAATSSANREQRPEFSTSAQ
                     SAEMQNPESQSPFSSAMLNDSGEIMDGISTAEVDPLKDHPSFHSQMTQETSHTLPPLP
                     APTLTRPQHLTHHTLPEGVQDSSPHVECADLLGTEVGWEYHGPTSFLSICSIPGIAWV
                     SESSGEPGFFETAKTLVLNIDSRLKMRRNLRRETIAEPDEDTAWKWCKAYFEHSFDAS
                     LGLVSQQHFETRLRHHFAQRDVTDDDPAWYALRNTVYASGYRLSSSNMPYSNMFGEIH
                     GQAWRYFEKAFSVHTELLYCDTGLTAVQALTSMSFFAEGLGSPSLGYMLSSCAMRLAQ
                     AKGLHRQPAQSWNLPQAEQQHRIRLFWTLYILEKHISYRSGRPSIIDDDDISCSLPST
                     QLADNTTYTDSFIYIVQHARISSRIAKQLASGKSFRQTHAKILEVIQELNTELQEWRD
                     SLPSFLQPDAPTTRHEKRPRNINMYHVMYLRYAYYGSVMAIHCILTHPWNSSLFGSGQ
                     TAALHSHISISSHVVVNAARSIILDTNAIHVDASTPIWLAFYFPLVSAINIFIYTLKY
                     PALPTASSDLALLDIATGHFSRLELVSPDIALPFVREIARLARATVECVNKVATSPSS
                     LLRPDLQAFPVTPPFLQNSEDNTSLKEDMLELYSDNWSTMFPCLNDEFPRNY"
     gene            complement(<883103..>884190)
                     /locus_tag="ACHE_70278A"
                     /db_xref="GeneID:66985793"
     mRNA            complement(join(<883103..883525,883592..883921,
                     883987..>884190))
                     /locus_tag="ACHE_70278A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282593.1"
                     /db_xref="GeneID:66985793"
     CDS             complement(join(883103..883525,883592..883921,
                     883987..884190))
                     /locus_tag="ACHE_70278A"
                     /note="COG:S;
                     EggNog:ENOG410PND0;
                     InterPro:IPR036291,IPR008030;
                     PFAM:PF13460,PF05368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139957.1"
                     /db_xref="GeneID:66985793"
                     /translation="MSKILTVVGATGAQGGSVVTSALKSGAYKVRGVTRNVESARAKA
                     LAAQGVEMVAADTNDLASLVKAFKGSYAIFVVTDFFASFGTNGVEETVAIESNQGINC
                     AKAASKTPTLEHYIWSTLPDNQKISGGKYSVPHFESKTRVDEYIRQDKALLSKTTFLF
                     ITYYATNILMPMFTPSQFKTTGKHVQLLPVAEDTPITTLGATTINTGIYVLAILQQPQ
                     LTLPARTVLAETETRTAKDIVKLWSEVSGTPAEYASISLDHYDNLWPKWGREVGLMLQ
                     FWDYAREKSWIAEDVVIKKEDLNITGLVGMKEVFAGIDWTTL"
     gene            <891564..>892030
                     /locus_tag="ACHE_70279S"
                     /db_xref="GeneID:66985794"
     mRNA            join(<891564..891847,891907..>892030)
                     /locus_tag="ACHE_70279S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282594.1"
                     /db_xref="GeneID:66985794"
     CDS             join(891564..891847,891907..892030)
                     /locus_tag="ACHE_70279S"
                     /note="COG:Q;
                     EggNog:ENOG410PJMK;
                     InterPro:IPR008972,IPR011707;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139958.1"
                     /db_xref="GeneID:66985794"
                     /translation="MKPALLLSLVGLGAGLAIDLDLGASLSAGQLPQTNRFELNVTWE
                     LWAPDGVERYQTLVNGQFPGPPLIMDEGDNVEVIVNNFMPFNTTIHYHGIEERHGQME
                     YLGSLRGLFLLAEDLCIPSPYSNMEHTGEAFKV"
     gene            <892347..>892631
                     /locus_tag="ACHE_70280S"
                     /db_xref="GeneID:66985795"
     mRNA            join(<892347..892353,892408..>892631)
                     /locus_tag="ACHE_70280S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282595.1"
                     /db_xref="GeneID:66985795"
     CDS             join(892347..892353,892408..892631)
                     /locus_tag="ACHE_70280S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139959.1"
                     /db_xref="GeneID:66985795"
                     /translation="MSYSILINGKGRVNCRDPGYLTDMVPTSLKSVLQGMNYTVKGYF
                     GPGKTLVMVTDWKLKMRSTSKHLCPNNVFAQL"
     gene            <893426..>894271
                     /locus_tag="ACHE_70281S"
                     /db_xref="GeneID:66985796"
     mRNA            join(<893426..893769,893825..893838,893891..893940,
                     894248..>894271)
                     /locus_tag="ACHE_70281S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282596.1"
                     /db_xref="GeneID:66985796"
     CDS             join(893426..893769,893825..893838,893891..893940,
                     894248..894271)
                     /locus_tag="ACHE_70281S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139960.1"
                     /db_xref="GeneID:66985796"
                     /translation="MSLHSNPVTHSISILIESMFLSVSNGSHKLQFNLGKFADFVFQG
                     SGTGSFNWTSVAEAAKAIPESFNLVNPPMRGLFSSNIPNLLLRRLILDISRYFYNTPC
                     FSRPKLVGNSLSCTKSRGLLAPLSSRSASDGRNGIDEQLDF"
     gene            complement(<894505..>895030)
                     /locus_tag="ACHE_70282A"
                     /db_xref="GeneID:66985797"
     mRNA            complement(join(<894505..894933,895019..>895030))
                     /locus_tag="ACHE_70282A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282598.1"
                     /db_xref="GeneID:66985797"
     CDS             complement(join(894505..894933,895019..895030))
                     /locus_tag="ACHE_70282A"
                     /note="COG:S;
                     EggNog:ENOG410PP6I;
                     InterPro:IPR012312;
                     PFAM:PF01814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139961.1"
                     /db_xref="GeneID:66985797"
                     /translation="MDLIHNNFRGIWNELYSTCPKNKRPNGQSIRAFLSLAEFFCHQL
                     TLHHTIEERHFFPELAVRIPEFRKELSLVGQHREIHRGLEELEAYVNMCRTGETELQL
                     THMKTLMDNFGGVLWAHLDDEVKALGAENMRKFWTLHEMACLYH"
     gene            complement(<898067..>898984)
                     /locus_tag="ACHE_70283A"
                     /db_xref="GeneID:66985798"
     mRNA            complement(<898067..>898984)
                     /locus_tag="ACHE_70283A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282599.1"
                     /db_xref="GeneID:66985798"
     CDS             complement(898067..898984)
                     /locus_tag="ACHE_70283A"
                     /note="COG:Q;
                     EggNog:ENOG410Q4IM;
                     InterPro:IPR036291,IPR002347,IPR020904;
                     PFAM:PF08659,PF00106;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139962.1"
                     /db_xref="GeneID:66985798"
                     /translation="MTSTPRPDPSTLRNTVDKKVTIVTGAARGIGFATASLLANHGAR
                     VILTDISDDALKIACSTIGLGSTYKACDVSDWEAQEELFDWTVRNFGSVDIVVCNAAV
                     NPEIALLQTQDADRQREMAGMVEYNYLADERREEAETSAGSTRLKRPSTRAFDININS
                     VVFGLKLAIHHMKRNGGGRVIVVGSAGSYLPVPTQSLYTASKHAVLGLVRSAAMTAEV
                     IQSGISISIVAPWLTLTSMVDGLEATRSSHTLKSSPEDVAWAIAHAASAPAGDVNGKG
                     FWIQGKAISEVEGAYGRLAGELISPLNRF"
     gene            complement(<899222..>900178)
                     /locus_tag="ACHE_70284A"
                     /db_xref="GeneID:66985799"
     mRNA            complement(<899222..>900178)
                     /locus_tag="ACHE_70284A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282600.1"
                     /db_xref="GeneID:66985799"
     CDS             complement(899222..900178)
                     /locus_tag="ACHE_70284A"
                     /note="CAZy:CE10;
                     COG:V;
                     EggNog:ENOG410PN6T;
                     InterPro:IPR029058,IPR013094;
                     MEROPS:MER0034961;
                     PFAM:PF07859;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139963.1"
                     /db_xref="GeneID:66985799"
                     /translation="MPLQYDPEFAELAAPVLQLVSQAERPAIHDIDTRRANLDAFSSQ
                     ATATAQIPNDVEQIVHYARTADNHDVPMLHFRRKNTLPSGPGPAIVHMHGGGFIALSA
                     AIGTPSLSRFVSETGVQILSIDYRLAPENIFPKPLDDCWTALTWIHGHAHELSIDNSR
                     IAVMGESAGGSLAAGLTLLARDRGLSPPLAKQILVYPMLDDRTRTNPFGDLAFWSAED
                     NVTGWTAYLGASAAAKSVSPYAAPARVNSVQGLPPLYLDCGQIDVFALEDVRYVLRFM
                     EANIPAELHVYEGLPHGFEGFAPTSGAVKQAFANRARAIISF"
     gene            complement(<901986..>903608)
                     /locus_tag="ACHE_70285A"
                     /db_xref="GeneID:66985800"
     mRNA            complement(<901986..>903608)
                     /locus_tag="ACHE_70285A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282601.1"
                     /db_xref="GeneID:66985800"
     CDS             complement(901986..903608)
                     /locus_tag="ACHE_70285A"
                     /note="COG:Q;
                     EggNog:ENOG410PWDX;
                     InterPro:IPR036188,IPR023753;
                     PFAM:PF07992,PF13738,PF13450;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139964.1"
                     /db_xref="GeneID:66985800"
                     /translation="MDGKKYLQTDALVIGGGFSGCCALHKLRQQGLTTKLLEAGGDFG
                     GVWYWNRYPGARVDTEMPMYQFNFPEVYKDWNWSERFPAHDELRRYFQHVDRVLDLRR
                     DAIFNTVVSEVTYDEGERMWCVKAEDGMQAACRYLIVATGSSYKAFYPSFPGLEAYNG
                     HLVHSARYPQSLEVTGKKVGIVGNGASGLQIVQELAKQDCEMTVFIRTPGFSIPMRQR
                     KFSPAESESQKGFYDAIFSKCYNSTTGFANNTRNQSGHDATPEEREALFDELWQRGGF
                     NWLISNYSDYLVDERVNSMLYDYWARQVRARMTDPVKMDFVAPLKQEQLIATKRPSLE
                     QDYYEMIDKPNVHLHSLKEAPIVRLDANGIVTRNVAGDDEHHHDLDVIIFATGYDAVT
                     GSQLDLSIQGRDQISLGQKWKDGTLTHLGMMVPGMPNLFLLYGPQAPTSLANGPPFIE
                     MQVDWISKMTSKMKERGVESIEPTQAAAEQWREHVLVASTYTLLPKADSWYMGANIPG
                     KRREPLIYMGGLDRWWQMCMKTLETWEGLKTG"
     gene            <904033..>905085
                     /locus_tag="ACHE_70286S"
                     /db_xref="GeneID:66985801"
     mRNA            join(<904033..904493,904567..904679,904729..904751,
                     904800..904852,904896..>905085)
                     /locus_tag="ACHE_70286S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282602.1"
                     /db_xref="GeneID:66985801"
     CDS             join(904033..904493,904567..904679,904729..904751,
                     904800..904852,904896..905085)
                     /locus_tag="ACHE_70286S"
                     /note="COG:Q;
                     EggNog:ENOG410PNXK;
                     InterPro:IPR036291,IPR002347;
                     PFAM:PF08659,PF00106,PF13561;
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139965.1"
                     /db_xref="GeneID:66985801"
                     /translation="MASKLEGTALITGAGSGIPSSFQSFKIKGITNPGIGRGTANTLI
                     QNGINNLSLLDINISALESARNDLLSQHSTANILIQQTDVASETSIATAVKKTVEMYG
                     RIDVAINSAGISGNPCPTHEMSLSEWQRVIDVNQTGVWICQRELIRQMLGQENLGPRR
                     GRGVIVNLSSMFGVHAPRGEFGISPYTASKHAVIAITKLDAKTYAPHGIRINAICPGY
                     VDTPIIADAIRLGALQAEFDRTPMRRPSSVEEVADSISFLASPMSSYMCGAALVMDGG
                     YTI"
     gene            complement(<905130..>906572)
                     /locus_tag="ACHE_70287A"
                     /db_xref="GeneID:66985802"
     mRNA            complement(<905130..>906572)
                     /locus_tag="ACHE_70287A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282603.1"
                     /db_xref="GeneID:66985802"
     CDS             complement(905130..906572)
                     /locus_tag="ACHE_70287A"
                     /note="COG:S;
                     EggNog:ENOG410PNWF;
                     InterPro:IPR021858;
                     PFAM:PF11951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139966.1"
                     /db_xref="GeneID:66985802"
                     /translation="MLESIFEGLDQWSLSSGGWGGEERRGPFSVFGVGLQRPGESSQG
                     TGSETGIGGDGMQVDGLKTGEEDVIANEISQPSVATTQSPAVSTTTTTPYLLYRDESP
                     SDTGYTIEQPITSTALPETELIHHWVIFLSQNMLLIDTPDNPCRTVFMPLALQGLDTS
                     SPAHLAVFHAICAASAFSLSYLRNDARYHSSAVRHDQHALRLLRRHLLHGGRLDEPTL
                     AAALTCITGEAMSGRKGRWRAHVVGVLGLLEREISRSWIRSSTATPLIQSCLSLSTLC
                     RLRVPRELVALFRGVDPQERDCYLERAHGVTRNLVEFLADVNDIKEVRSRVSPAELDQ
                     LELRLYLNFPRVSADTHKSEVVQHALNSFYYATVIYFRRTLKGACVADVRDLVEKAVQ
                     DLEAVEAQGSACGSAYNWASFVVAAECDQPDLQARMLNCFDRKRRHGIKNIDRLREFV
                     RIVWERRVSTGVDIHWQDLADEFEFDIMFV"
     gene            complement(<907366..>908814)
                     /locus_tag="ACHE_70288A"
                     /db_xref="GeneID:66985803"
     mRNA            complement(join(<907366..908169,908230..908577,
                     908635..>908814))
                     /locus_tag="ACHE_70288A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282604.1"
                     /db_xref="GeneID:66985803"
     CDS             complement(join(907366..908169,908230..908577,
                     908635..908814))
                     /locus_tag="ACHE_70288A"
                     /note="COG:K;
                     EggNog:ENOG410PUCF;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139967.1"
                     /db_xref="GeneID:66985803"
                     /translation="MPMSSEDSPSERMLTNVRCLQTMFQISMPQQKQSSPVYHARRSH
                     KKSRKGCLTCKERRVKCDEQKPYCQQCQRRSISCRFLSKTSPSREICVDKKPGSSDMN
                     ITLFPPPSESVTKRIEETLILDPKWNHFVLRNQDYARSISTVAFQHFINCSTETVAHP
                     AIRDVMKTDMIRVSFSNSHLMYTVLGVGMMHLNRMSPLKERTFAESLFWQHAIQKYQE
                     ALFMPVRKDSVDGLLSTCMLMGSMTVCPERFVPTDSWVLTKRPKDLNWLCLQSGLRLI
                     LSLTAPYLPGSIWAAAFNEVSKEECQLHDQRTQQGRVGLDPDLADVCEIDNSTTERNS
                     LYYAPLRTLTTLMGLEKNSRNSALCASFMGRLECSFLTLLKARDPPALIILAHWMGLM
                     CLLSQWQPWVEGRIRAECVAICMFLEQSADSRMRRLLRFPAGSCGYGLDKI"
     gene            <909166..>909885
                     /locus_tag="ACHE_70289S"
                     /db_xref="GeneID:66985804"
     mRNA            <909166..>909885
                     /locus_tag="ACHE_70289S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282605.1"
                     /db_xref="GeneID:66985804"
     CDS             909166..909885
                     /locus_tag="ACHE_70289S"
                     /note="COG:S;
                     EggNog:ENOG410PSWN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139968.1"
                     /db_xref="GeneID:66985804"
                     /translation="MSTGTCYTMEPPTEVAAAATAHTENQPAYSADNEHEDLSQNRSR
                     SYHIYHNHWHRDYNITTPTGQQLYYVDSSSFTVNKPDLTVHMGIDNKAPVIATCKFMH
                     FSRDFCVGLGDPQSPNQVDWEDVICQGFRRNNYRWQMNLPSGRHTFVWKRTHSVGVED
                     VPLSSISYRNFKLVDESTGQVLAVFTNDYLSTKKAGDFQVYADYGRGFNLISLITVLA
                     LYEKGSRRHRRIAAAGGGAGG"
     gene            <912934..>914099
                     /locus_tag="ACHE_70290S"
                     /db_xref="GeneID:66985805"
     mRNA            join(<912934..913270,913321..914027,914088..>914099)
                     /locus_tag="ACHE_70290S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282606.1"
                     /db_xref="GeneID:66985805"
     CDS             join(912934..913270,913321..914027,914088..914099)
                     /locus_tag="ACHE_70290S"
                     /note="COG:S;
                     EggNog:ENOG410PYN0"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139969.1"
                     /db_xref="GeneID:66985805"
                     /translation="MKHQAALNTSIPNFEINRVTNIVQALLKKQVFQSDTKAKMEFPD
                     IFTPSPANNVKSNVFEADADHSAAHILEEITLAHAKDSERTQVPPGSLSVQLQAHDEA
                     QVQAEGDSDSSPGSALEPRLPMPSLYPSYFPYSAQHSLLSSIQQVLEECCFDFTKKWL
                     PSEVENHEWDCAAAMELTEWTKFLAKWSPQLPHESLQLRGSQLDTLLSKICQIRHTAV
                     HRQPITATSVSLLVLAAKRLAEALQDPLRTSQLEDLHFDIQNKIQAMELNKNALEADH
                     AHELRAVQLQRDELDQKEEQLRAKIINHDKENKTLTGLLVKESIRRIFNDRESALDYD
                     SAWFEAEYEGANRNTFN"
     gene            complement(<916560..>916811)
                     /locus_tag="ACHE_70291A"
                     /db_xref="GeneID:66985806"
     mRNA            complement(<916560..>916811)
                     /locus_tag="ACHE_70291A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282607.1"
                     /db_xref="GeneID:66985806"
     CDS             complement(916560..916811)
                     /locus_tag="ACHE_70291A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139970.1"
                     /db_xref="GeneID:66985806"
                     /translation="MYEEAGDDETLNSKEHFERALVRAEGWVAMTPDDHPACNRRIET
                     FNPMPARRNNADHQSPRSPLTFDPIPTTEREPSRSELLE"
     gene            complement(<918554..>919285)
                     /locus_tag="ACHE_70292A"
                     /db_xref="GeneID:66985807"
     mRNA            complement(<918554..>919285)
                     /locus_tag="ACHE_70292A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282609.1"
                     /db_xref="GeneID:66985807"
     CDS             complement(918554..919285)
                     /locus_tag="ACHE_70292A"
                     /note="COG:F;
                     EggNog:ENOG410PMHQ;
                     InterPro:IPR035994;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139971.1"
                     /db_xref="GeneID:66985807"
                     /translation="MVFTGDIGLSAGALLTGTQKLAAMLVEGNLDLDFIVRQTFNKSP
                     KITTEYQRPHERPDRLYKSEYNHDDSCDCQLDCAQNLSRLVNRPERNDYCVEVHCGNI
                     GSADIVVKDALSRDNYAREFRLLCFEMESAGLMSKLPCLPIREICDYSDSHKNKHWQG
                     YAAATAAVYAKSLLKVIPPENVLQTRITMDKTELERHIRSIIRDVQRVATSRSVDEDS
                     QIRFKQFRTIQPITVAETGISKPGT"
     gene            complement(<919325..>919660)
                     /locus_tag="ACHE_70293A"
                     /db_xref="GeneID:66985808"
     mRNA            complement(<919325..>919660)
                     /locus_tag="ACHE_70293A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282610.1"
                     /db_xref="GeneID:66985808"
     CDS             complement(919325..919660)
                     /locus_tag="ACHE_70293A"
                     /note="COG:M;
                     EggNog:ENOG410Q18J;
                     InterPro:IPR035994;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139972.1"
                     /db_xref="GeneID:66985808"
                     /translation="MLPSHGNFAVGWIAAIHKEYVAARQVLDEVYEDLEFPRPAEDLN
                     SYTLGRMERHYVVIACLPSGSYGAQAAAEAVERMKSSFPMIRFVLMVGVAGGAPTQAD
                     VRLGDVVGT"
     gene            <922542..>925501
                     /locus_tag="ACHE_70294S"
                     /db_xref="GeneID:66985809"
     mRNA            join(<922542..923292,923450..924287,924343..>925501)
                     /locus_tag="ACHE_70294S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282611.1"
                     /db_xref="GeneID:66985809"
     CDS             join(922542..923292,923450..924287,924343..925501)
                     /locus_tag="ACHE_70294S"
                     /note="COG:M;
                     EggNog:ENOG410Q18J;
                     InterPro:IPR035994,IPR002110,IPR027417,IPR036770,
                     IPR020683;
                     PFAM:PF13857,PF12796,PF00023,PF13606,PF13637;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139973.1"
                     /db_xref="GeneID:66985809"
                     /translation="MVGIGGGVPKSVRLGDVVVSTPTDEFGGVVQWDFGKVQQESTFK
                     RTGALNRPPTELLSALTKIEKEHTMKGSKIPQYLKDLETNWPRLAPKYTRSKSLKDVL
                     FKADCKHIENTKESQEKYDNEEEDEEDEEEKEANYCIHCDQTKIVRRKPRDMRVHYGL
                     IASGNLVVKDAPFRDEINKTLGGKVLCFEMEAAGLMNDFPCLVIRGICDYADAHKNKN
                     WQEHAAAVAAAFAKELLLLVPAQEVEQMPTIKQLENQLEGVSNAINEIRSHQRDYQRD
                     QKSQAIIDWLTPMNYAAQQNDFIAQRQEGTGEWVLESSEFQLWLKQTNQTLFCPGMPG
                     AGKTIITSIVVNHLHDKFRNEPSIGIAYLYCTFQQQQEQRPVDLLTNLLKQLIMGQPT
                     IPNAVKDLYDRHKPKQTCPSLSEIRNTLHQVAAFYSRTFIVIDALDECRATHDGRDMF
                     MQEIFNFQADIKANLFATSRFIQEIEAKFQKVIRLEIRADDTDVQRYLHAKLQNCPSL
                     ISQNDSLQEQIKNKIAKAVDGMFLLARLYVDSLACQTTTKKVKRALQELETTVEEKND
                     DKRSKALDDAYEKAMQRIQGQIQQHEELAKQVLSWISCAKRRLTSAELQHAIGVEENT
                     SEFDSDNIVDVGLMVSVCAGLVIVDKESDIIRLVHYTTQEYFERTWECWFPNAHIDMT
                     KACITYLSFEVFKAGYCPTEDALRERLQLHVLYDYASQNWGHHAGKSPIQGEKLMLDL
                     LEDTAKVFACSQAMLSQIFFVTETKMTGLHLAAYFGLWKPASILLGKNHDIESEDKYG
                     RTPLSLATRNGHEAVVKLLLEKNANVESKNEDGRTPLIIAIRNGHEAVVKLLLEKNAN
                     VESKDKYGWNPLIIAAEYGHEAVMKLLLEKNTSTESKNEYCNTLVLQSVGNRDSTDQM
                     F"
     gene            complement(<931021..>933291)
                     /locus_tag="ACHE_70295A"
                     /db_xref="GeneID:66985810"
     mRNA            complement(<931021..>933291)
                     /locus_tag="ACHE_70295A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282612.1"
                     /db_xref="GeneID:66985810"
     CDS             complement(931021..933291)
                     /locus_tag="ACHE_70295A"
                     /note="COG:S;
                     EggNog:ENOG410Q27Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139974.1"
                     /db_xref="GeneID:66985810"
                     /translation="MPPKRASRTPQPAPQRVYDLRKTHIPRISPPPEEGYQGRKNTNG
                     VYVPRAAATKAAAMRRRAAAARAARANEEADASPGPPQTRLRTPNRRSTTPQARRSAT
                     PGKRVQFALQNAQPKPSSAAKSNASPQKEALHRRAASTSTEPETTEADEASEASYDEE
                     EVYEEGVNEDHDENGPEDEESGQMDDEGSADEDDNLPSIDDRDVDTEEEASARALYDA
                     KEKYRELIGRRVLDEARRRYPEGVQRQPREVETSDLEAALEDAMRAADYPVGIILNIR
                     VNKKPYVKKSLPDSQRRSFNMENVEKAFLSAIAPTVGEEEYQIMARRVTVKHSSGRGG
                     TTHHDFDDFDTANGSHILSIIDKHHSRHRTGMIEAHFDINVQCDAILPTPKRSRQPEP
                     PSSDIPSSPPSFPPKKRQNRSSRLQEQHSTRLDTIRVAGNFQRQLMDRWRCHDPNCTN
                     KDNYCFSDPTERTKHFNITAVQHEAWANAISNGEATIQNPPVKMLRYWEEHQGALNRQ
                     SRQPARQTFIQQTKSSLERLAEMQQQMHERMLEARMYDQMDALEEKQERREERNERRR
                     MEQERREHELAHARLMYMPPHYAAMPYSHGQSPRPMMPISGQYPAAQYPRAPITPQAA
                     SRAPQKRRSSPIDETTDEYELLESFFYWKNVNTPNPRQKEKWNQVKEIVFQNDWTIQD
                     LKDMEDDASPMYQRAIKAGISDGFTRLIQRELQAFKRDVRRQKEAHEEELQAIATLGQ
                     LGHQTDIEGSEFMRYT"
     gene            <935726..>938144
                     /locus_tag="ACHE_70296S"
                     /db_xref="GeneID:66985811"
     mRNA            join(<935726..935860,935925..936200,936256..936403,
                     936459..936546,936594..936729,936783..>938144)
                     /locus_tag="ACHE_70296S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282613.1"
                     /db_xref="GeneID:66985811"
     CDS             join(935726..935860,935925..936200,936256..936403,
                     936459..936546,936594..936729,936783..938144)
                     /locus_tag="ACHE_70296S"
                     /note="COG:U;
                     EggNog:ENOG410PITD;
                     InterPro:IPR022812,IPR027417,IPR001401,IPR000375,
                     IPR030381,IPR020850;
                     PFAM:PF00350,PF01031;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139975.1"
                     /db_xref="GeneID:66985811"
                     /translation="MHDVTKPSLDLSGANELDNDDRVRVLAIIDQLRELGINEDISLP
                     QLVVVGDQSSGKSSLLEGLTGLSFPVASELCTRFATQIVLRRAPASEAAVSVSIIPGP
                     AANADEATKKKLLEFERTMEAKDFGAAQFSAILDEAAECMGLPSTQTAGFVELDKRFS
                     DDILKIELSDPEHSHLSVVDVPGLFHNPTKFQTIEDRNVIRGLIQRYIIDKRTIIMAV
                     MDARNNLANQEVFHMARAADPDGLRTVGIITKCDALQAGDEHGVLEIFRNEMVRLSHG
                     WFAVRNRSTKEIKEGVTMAQRHINEKQFFNTAPWANLRKDRVGIGPLKSFLGQVLFDH
                     IRNEFPGLVNEVRNLTNETKKDLESLGPSRQTSADQRRYLIRSAVDYQRDVSNILSGI
                     YSPRIESGSPRKLRTRLRFLMDEFSSRMAKEGHRWAFKLVDGRTDPEYAKDANKADEE
                     SYKEVDLQSHGNSDNANDIEEWIRSSYNESRGVELPGTVNPHLLENLFREQCASWGDI
                     AIDYLSKIVNAVSAYDGSALKDFVTDSSVRQKLQTRLKAKRQTAEEDMFAELRNILAD
                     ELSGTLQTANPSYSDMLSTIRNERVQARVASMGIKDADSNNFDQFMTNEHWYNEQQAV
                     NDIHDILVAYYKVARQRFVDNVIIQAGERYVVGETGPLKIFSPEYISGFSNEELSDIA
                     GENYSTSVARSEITSRGERLQRALEIARRAGI"
     gene            <938408..>939598
                     /locus_tag="ACHE_70297S"
                     /db_xref="GeneID:66985812"
     mRNA            join(<938408..938632,938689..938836,938886..939251,
                     939306..>939598)
                     /locus_tag="ACHE_70297S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282614.1"
                     /db_xref="GeneID:66985812"
     CDS             join(938408..938632,938689..938836,938886..939251,
                     939306..939598)
                     /locus_tag="ACHE_70297S"
                     /note="COG:S;
                     EggNog:ENOG410PPDZ;
                     InterPro:IPR041712,IPR036866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139976.1"
                     /db_xref="GeneID:66985812"
                     /translation="MSDDLVEADSLEALVIIDNDLDPLSTIAPDTVQVSGHLGHLATN
                     SPHHIKDRGDACKELRMEDICCSAHGLSILVTATKGDVKHSILFDAGPEEDAWERNVK
                     RLRPDLSSVGVVQLSHWHRDHSGGLLRAIRMINDAKQHKNISNKLVLDLHPDRPDYRG
                     LAIGHKIISLQADPTFEEIESAGAVIHKNDETHTVLDNFFLISGEIPRRTTYEHGLKH
                     AMRFDREENDWFSDEAIADERFLMCNLKDKGIVVFTGCSHAGVVNTTKHAVDLLNGAV
                     PLHAVIGGFHLATSEQEQMESTVKDLKRLDPAVLLPGHCSGWRAKFAIEKQIPGTLVP
                     CSVGIKITF"
     gene            <940648..>941574
                     /gene="DST1"
                     /locus_tag="ACHE_70298S"
                     /db_xref="GeneID:66985813"
     mRNA            <940648..>941574
                     /gene="DST1"
                     /locus_tag="ACHE_70298S"
                     /product="RNA polymerase II elongation factor"
                     /transcript_id="XM_043282615.1"
                     /db_xref="GeneID:66985813"
     CDS             940648..941574
                     /gene="DST1"
                     /locus_tag="ACHE_70298S"
                     /note="BUSCO:EOG092645TJ;
                     COG:K;
                     EggNog:ENOG410PFX1;
                     InterPro:IPR035100,IPR003617,IPR036575,IPR017923,
                     IPR035441,IPR003618,IPR001222,IPR006289;
                     PFAM:PF01096,PF08711,PF07500;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="RNA polymerase II elongation factor"
                     /protein_id="XP_043139977.1"
                     /db_xref="GeneID:66985813"
                     /translation="MDAKEIELKTKALAKAATQNDSASTITSILKELQQGVKATEDLL
                     RSTRVGIVVNKFKQHKAPDVARLASEIVSKWRTEVNKQKAAGSPAKERSSSSPRPGAA
                     AAAAGSNGSASPASATPTDKASKLSVPPDKRTWKADGVDVNQTSNRIRDSCIGLMYDG
                     LCLNSTEPPRLVLQKASAVEASAYNSLGPETKEQYRTKIRSLYQNLKNKSNPTLRIRV
                     LNGDVTPDQFVTMSHEELRSAEQREKDARIQKENMDKAMVAQAERSISTSLQCGKCGQ
                     RKVTYTEAQTRSADEPMTLFCTCMNCGKSWKQ"
     gene            <941892..>942503
                     /locus_tag="ACHE_70299S"
                     /db_xref="GeneID:66985814"
     mRNA            <941892..>942503
                     /locus_tag="ACHE_70299S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282616.1"
                     /db_xref="GeneID:66985814"
     CDS             941892..942503
                     /locus_tag="ACHE_70299S"
                     /note="COG:S;
                     EggNog:ENOG410PQW1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139978.1"
                     /db_xref="GeneID:66985814"
                     /translation="MKYTRANLLTPARNFCAALSSSSPIPTLLTHFTHDPYPQAHEHG
                     LPHLAPFLGRTFTGSDGVARYFEVMTSELGFEDMSFEPEAEWLVDTSIMAVVIRGTAK
                     FYAKRTGQKWDEGFVYRLGIAEEVNEEVSGRGELKVQEYEVWADTGAAYLALNGRLGE
                     VLSEEKEGGTGGAGRTRRSQDRKRSGCGEVVGSGMGAYGSCGQ"
     gene            complement(<944390..>947475)
                     /locus_tag="ACHE_70300A"
                     /db_xref="GeneID:66985815"
     mRNA            complement(join(<944390..946744,946801..947024,
                     947079..>947475))
                     /locus_tag="ACHE_70300A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282617.1"
                     /db_xref="GeneID:66985815"
     CDS             complement(join(944390..946744,946801..947024,
                     947079..947475))
                     /locus_tag="ACHE_70300A"
                     /note="COG:P;
                     EggNog:ENOG410PFW2;
                     InterPro:IPR018303,IPR023298,IPR023299,IPR001757,
                     IPR004014,IPR036412,IPR006534,IPR008250;
                     PFAM:PF00122,PF00690,PF00702;
                     TransMembrane:10
                     (i118-141o147-166i336-357o377-404i735-756o762-786i798-
                     816o836-852i864-884o909-933i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0008553 - proton-exporting ATPase
                     activity, phosphorylative mechanism [Evidence IEA];
                     go_process: GO:0120029 - proton export across plasma
                     membrane [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139979.1"
                     /db_xref="GeneID:66985815"
                     /translation="MAERRISYAPDVENGDHSRSAAGDEGNLDEYSALNRYISTARDG
                     RRGSTSSAGNRSQEEKKKPWWKFGGKKDDAGGEGFVIPDEWHDTDMHSGLGASEIEAR
                     RKKAGWNELTTEKTNFFIQFIGYFRGPILYVMELAVLLAAGLRDWIDFGVIIAILLLN
                     AVVGWYQEKQAADVVASLKGDIAMRAWVVRDGQEQEVLARELVPGDIVIIEEGTVIPG
                     DVRLICDYSKPEMYETYKEHLATVNEDTLKEKEDDDEGAMEAQLGVSLVAVDQSAITG
                     ESLAVDKYMTDTCYYTTGCKRGKAYGVVLATARHSFVGKTAALVQGAQDQGHFKAVMD
                     HIGTTLLVLVMFWILAAWIGGFYRHLKIATPEFSDNNLLHYTLILLIIGVPVGLPVVT
                     TTTLAVGAAYLAERKAIVQKLTAIESLAGVDVLCSDKTGTLTANQLSIREPYVNEGVD
                     VNWMMAVAAIASNHNLKNLDPIDKVTIMTLRRYPKAREILSRNWVTEKYTPFDPVSKR
                     ITTICTCDGVRYVCAKGAPKAILNMSECSEEEAALFREKSTEFARRGFRSLGVAVQKE
                     GEPWQLLGMYPMFDPPREDTAHTIAEAQHLGLAVKMLTGDAIAIAKETCKMLALSTKV
                     YDSERLIHGGLAGSAQHDLVEKADGFAEVFPEHKYQVVEMLQQRGHLTAMTGDGVNDA
                     PSLKKADCGIAVEGSTEAAQAAADIVFLAPGLSTIVDAIKLARQIFQRMKAYIQYRIA
                     LCLHLEVYLVTSMIIINETIRADLIVFIALFADLATIAIAYDNAHFEARPVEWQLPKI
                     WLISVILGLLLAIGTWILRATLFLPNGGVIQNFGSPQEILFLEVSLTENWLIFVTRGA
                     KTMPSWQLVGAIFGVDVIATLFCVFGWLSGGPEEAHSSPDSSAVFSKNADVDIVTVVV
                     IWGYSIGVMIIIAVVYYILTEIPALDNLGRKTRSKADTQIENLLAHLHKLAIEHEVDE
                     TGKGRYTLGARADAEADDE"
     gene            <957949..>959204
                     /locus_tag="ACHE_70301S"
                     /db_xref="GeneID:66985816"
     mRNA            join(<957949..958025,958287..958997,959054..>959204)
                     /locus_tag="ACHE_70301S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282618.1"
                     /db_xref="GeneID:66985816"
     CDS             join(957949..958025,958287..958997,959054..959204)
                     /locus_tag="ACHE_70301S"
                     /note="COG:B;
                     EggNog:ENOG410PGXE;
                     InterPro:IPR011990;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139980.1"
                     /db_xref="GeneID:66985816"
                     /translation="MWLELYYQDSQRDVEDIVKKGSVLIVYTRGLNCSPTANETRALS
                     LNRSVAFIKTKQFAAALADSNSAIVATGTTEKALTRKLQELYSLERFQECCEILKGLL
                     KENPSNAAAQDELARATKRLAEQETGSYEFNKFHEAANKLRPPLLDDATYIGPVVVKE
                     AASYGRGLFTTKEVKAEGLLLCEKAFGFVYADPEHRRDVTLVYEMGTNQLWFGANTEL
                     IRVIAQKMYANTSLTSVITDLHADGYRSADVAEMESQWSTPVVDTFQFERIIDANAFG
                     SQNSAAQNHIEETLYKREGIAINQGKSSFHSLASGR"
     gene            <959259..>959894
                     /locus_tag="ACHE_70302S"
                     /db_xref="GeneID:66985817"
     mRNA            join(<959259..959375,959478..>959894)
                     /locus_tag="ACHE_70302S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282620.1"
                     /db_xref="GeneID:66985817"
     CDS             join(959259..959375,959478..959894)
                     /locus_tag="ACHE_70302S"
                     /note="COG:B;
                     EggNog:ENOG410Q1RJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139981.1"
                     /db_xref="GeneID:66985817"
                     /translation="MLILRVTQDMPANTEITLAYKDPIPEFDEERTRFRSWNFFLRHQ
                     RQKREAIAASLEQTYARPPTFVPRVALFDIYLDLAHGYMRKQQPEKAVAAALKTFESL
                     GFVIEGGELPHVPSTQLVVKRWGMFHSRPSAGLCLLVRIVCSSRRFARRRSSMRALRI
                     KRLWGRMRRLRRRRIML"
     gene            complement(<960543..>961763)
                     /locus_tag="ACHE_70303A"
                     /db_xref="GeneID:66985818"
     mRNA            complement(<960543..>961763)
                     /locus_tag="ACHE_70303A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282621.1"
                     /db_xref="GeneID:66985818"
     CDS             complement(960543..961763)
                     /locus_tag="ACHE_70303A"
                     /note="BUSCO:EOG09260KNI;
                     COG:A,T,Y;
                     EggNog:ENOG410PGV5;
                     InterPro:IPR001611,IPR032675;
                     PFAM:PF13516;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139982.1"
                     /db_xref="GeneID:66985818"
                     /translation="MAPPKVFSLEGKGLKLDTAEDMEAHIQPLLEGADFTEVRLGGNT
                     LGVAASERLASALSAQKNLEVAELADIFTSRLLSEIPQALTALLNALLEIETLHTVNL
                     SDNAFGLNTQAPLVDFLSRHVPLRHLILNNNGLGPFAGTYIADALTKLAERKEEVRKE
                     GKEAPLLESIVCGRNRLENGSMEAWARAYEVHAKGMRSVKMTQNGIRQEGISHLLKEG
                     LRHASALEVLDLQDNTFTIMGSTALAGVLGGWSSLRELGVGDCLLSARGGIKVAQALA
                     EGKNEKLQTLRLQYNEINAEGVKQLLHATRTGLQALRRIELNGNVFLEEDENVNDLRE
                     ILEARKDEHGHDDDPEDMWGVDELDELEEEEDESEEDELDEEEEEDEAKQAETEKKSK
                     DVDELAETLGKTGL"
     gene            <962219..>962623
                     /locus_tag="ACHE_70304S"
                     /db_xref="GeneID:66985819"
     mRNA            join(<962219..962243,962339..962409,962483..>962623)
                     /locus_tag="ACHE_70304S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282622.1"
                     /db_xref="GeneID:66985819"
     CDS             join(962219..962243,962339..962409,962483..962623)
                     /locus_tag="ACHE_70304S"
                     /note="COG:O;
                     EggNog:ENOG410PSUK;
                     InterPro:IPR009069,IPR007745;
                     PFAM:PF05051;
                     go_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IEA];
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0016531 - copper chaperone activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139983.1"
                     /db_xref="GeneID:66985819"
                     /translation="MSWLFGSSTGNAAQEPIPAPVQTSQTQTEKPKPCCVCKPEKAAR
                     DDCMLFSKGEDPAQECKSTIDQYKSCMAGFGFKI"
     gene            complement(<962951..>964823)
                     /gene="ALG6"
                     /locus_tag="ACHE_70305A"
                     /db_xref="GeneID:66985820"
     mRNA            complement(join(<962951..964331,964381..964543,
                     964598..>964823))
                     /gene="ALG6"
                     /locus_tag="ACHE_70305A"
                     /product="glucosyltransferase-like protein"
                     /transcript_id="XM_043282623.1"
                     /db_xref="GeneID:66985820"
     CDS             complement(join(962951..964331,964381..964543,
                     964598..964823))
                     /gene="ALG6"
                     /locus_tag="ACHE_70305A"
                     /note="BUSCO:EOG09260NZ8;
                     CAZy:GT57;
                     COG:G;
                     EggNog:ENOG410PGJR;
                     InterPro:IPR039488,IPR004856;
                     TransMembrane:13
                     (o41-65i154-173o185-206i218-244o250-268i275-295o374-
                     395i402-420o426-443i450-467o473-493i513-532o544-565i);
                     go_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA];
                     go_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     go_function: GO:0042281 - dolichyl pyrophosphate
                     Man9GlcNAc2 alpha-1,3-glucosyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0006488 - dolichol-linked oligosaccharide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="glucosyltransferase-like protein"
                     /protein_id="XP_043139984.1"
                     /db_xref="GeneID:66985820"
                     /translation="MSPSYRPRKKRRVPPSSGTNNNLILDVGDGKSLPAFPLVSFLWA
                     ARAGVSTWLILPLILMAVGLFRWAVSLWGYSGFQIPPMHGDFEAQRHWMELTIHLPMS
                     KWYTYDLQYWGLDYPPLTAYHSWLLGKIGSLFDPAWFALDVSRGFEDPRFKVFMRATV
                     VVSEYLVYIPAVINFLRRYTRMQGVPVWSASIALVAVLLQPATILIDHGHFQYNTVML
                     GLAVASLDAILAGRMLWACIFFIGALGFKQMALYYAPVMFAFLLGVCTFPRIRILRLL
                     CIALTTIAAFAVLFAPLIAEASGVEAREYFKDIPQPPLLQALPFEVNKDSVLYAPLFQ
                     LLQIVHRMFPFSRGLFEDKVANAWCAIHTFYKLHRFDASLLQRASLGATLGSILIPCA
                     IIFRHPRASLLLPALASVSWGFFLFSFQVHEKSVLLPLLPMTLLLSGDGGLSKETRAW
                     VGWVNTLGSWTMFPLLQREKLRIPYFMMTFLWTYLLGLPPTSLETYRSRPSSGNSNPS
                     FEPNVLTKILHFCFYLAMVAWHVLEAFVPPPPSKPDLWVVLNVLIGAGGFGIAYLWCM
                     WKLITQCWKIDRKAEEDSQKKKQ"
     gene            <965583..>967245
                     /locus_tag="ACHE_70306S"
                     /db_xref="GeneID:66985821"
     mRNA            join(<965583..966230,966287..966594,966657..>967245)
                     /locus_tag="ACHE_70306S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282624.1"
                     /db_xref="GeneID:66985821"
     CDS             join(965583..966230,966287..966594,966657..967245)
                     /locus_tag="ACHE_70306S"
                     /note="COG:K;
                     EggNog:ENOG410Q5P3;
                     InterPro:IPR000504,IPR035979,IPR012677,IPR034276,
                     IPR034272;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139985.1"
                     /db_xref="GeneID:66985821"
                     /translation="MSKTKAIKAEKPVDKTLSKVKDAGVTKSSQSPKSKSKQIAKDLA
                     SKEKKPKSKKKAPTPSSSESESDSEESDSSSSSSSESEEEKKPAKDVKKGGKAEKKAE
                     SSSESDSDSDSDEEMGDASSDSDSSSESEDEKPAKKEEKKDNKKAETKPAESSSESDS
                     SESDSESDSDSESEEKEAPKKETKESSDSDSDSDSDSDSDSESEDKAPTKAKAEKKES
                     SDDSDDSDDSDDESGSDSSDSDSDEEEKPKDSKKRKADEESAPTQKKSKTEEPAEGAS
                     PNLFVGNLSWNVDEEWLASEFQEFGELAGVRIVTERETGRSRGFGYVEYTNAVDSAKA
                     YAAKKDTELDGRKINLDYATGRPANKDQGNGGERAQARARSFGDQTSPESETLFVGNL
                     PFSANEDSVHELFGPCGNVMGIRLPTDPESGRPKGFGYVQFSSVDEARQAFTDLNGAD
                     LDGRPIRLDYSSPRPNNGGGGARGGRGGGRGGGRGGRGGGRGGFDAGSRNRGGITEFT
                     GKKMTF"
     gene            <968060..>969525
                     /locus_tag="ACHE_70307S"
                     /db_xref="GeneID:66985822"
     mRNA            join(<968060..968198,968339..>969525)
                     /locus_tag="ACHE_70307S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282625.1"
                     /db_xref="GeneID:66985822"
     CDS             join(968060..968198,968339..969525)
                     /locus_tag="ACHE_70307S"
                     /note="COG:S;
                     EggNog:ENOG410PPJP;
                     TransMembrane:1 (o367-391i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139986.1"
                     /db_xref="GeneID:66985822"
                     /translation="MQPNQYDLLGQVRNEPRRMTREDHQPLRENPLQSRSPSGAVPSR
                     TDDSWIEVASQPSSSSLSSANDDIITTGLRVQQQGSNSHRSRSQRHVAVSMQNGYSSR
                     DASSSQDEYEESESESDRVLSSSNEEMNRKPLSLQQNGPSPSTLDAASSDDDDNSTAL
                     GTRISTSRFVPQPNVFSHPPASRNPSWTRAMDTHRPEPSEASNSSRRTAIRMSSQASM
                     RSNRSARQNQQHSPFNMLSPSHQADHDAALRASLSTLLSCAAAARGLPKSEPQQLSTD
                     PRQQPSSFRLVPESAMDSGDEEVPTAAVERNAAGPVPRKHPSSGPSYPSEAIPAPKKR
                     RSSSPRGARNQAAPRKSRRSLLNESLSVNSPTVMTWVVSAGVVVLFSAISFSAGYMLG
                     REVGRMELGPGMAGDGSGTTSATCGQHAVKGGLKRFRWGSSAAGSGILA"
     gene            complement(<970400..>971458)
                     /locus_tag="ACHE_70308A"
                     /db_xref="GeneID:66985823"
     mRNA            complement(<970400..>971458)
                     /locus_tag="ACHE_70308A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282626.1"
                     /db_xref="GeneID:66985823"
     CDS             complement(970400..971458)
                     /locus_tag="ACHE_70308A"
                     /note="COG:I;
                     EggNog:ENOG410Q1BZ;
                     InterPro:IPR006694;
                     PFAM:PF04116;
                     TransMembrane:4 (i62-81o87-106i144-162o174-195i);
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0008610 - lipid biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139987.1"
                     /db_xref="GeneID:66985823"
                     /translation="MAPPVRNPKDSMKSTWRLWDRSQWHAGHWLIEVLNVHHWDLDKE
                     IPVHQKTDKVPYAPEPQFHVWVLFYASIPLVLHQLYINYVGHGPSRLLTFFFYMLSLE
                     FIAVHQTHILRRVGHQIGFFDGDKHPRDGVPDVGVGKTAQTLLSVIVLRPMMLAFLSY
                     SPRDDQGPLLSIPWVWLFFETGVYAVVLDFWYYLFHRSMHESDSLWRFHRTHHLTKHP
                     NPLLTAYADTVQEFFDLVGVPMMTYGTMKVMGFPMGFYEWWICQQYIVFTEILGHSGL
                     RMEATAVNPWTWLLRLCDMDLVIEDHDLHHRKGWKASHNYGKQTRVWDQLFRTWVPRV
                     EGHRDNIDYVNTAKIPLF"
     gene            <975414..>975998
                     /locus_tag="ACHE_70309S"
                     /db_xref="GeneID:66985824"
     mRNA            <975414..>975998
                     /locus_tag="ACHE_70309S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282627.1"
                     /db_xref="GeneID:66985824"
     CDS             975414..975998
                     /locus_tag="ACHE_70309S"
                     /note="COG:O;
                     EggNog:ENOG410Q2F5;
                     SECRETED:SignalP(1-18)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139988.1"
                     /db_xref="GeneID:66985824"
                     /translation="MRFFLILSILFLLPIVSAKFGLSCFKVITALAGRPGDLYDKFQR
                     EICDRGCQPTVPHWDLWTRNNTFVPAVHNALKRLHVPRQEETMIQLGDDVANIIKVRC
                     GPALGGNHICSDPETLAGFGNCFKRNFVRAMIVHLPKLLPMADEAVCREQLVYLKDGH
                     LWETVIPQNMRDYAAACQNLEEKEAEYHFEPYGF"
     gene            <976203..>978195
                     /locus_tag="ACHE_70310S"
                     /db_xref="GeneID:66985825"
     mRNA            join(<976203..976942,976992..>978195)
                     /locus_tag="ACHE_70310S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282628.1"
                     /db_xref="GeneID:66985825"
     CDS             join(976203..976942,976992..978195)
                     /locus_tag="ACHE_70310S"
                     /note="COG:S;
                     EggNog:ENOG410PG2S;
                     InterPro:IPR011009,IPR004147;
                     PFAM:PF03109;
                     TransMembrane:1 (i61-80o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139989.1"
                     /db_xref="GeneID:66985825"
                     /translation="MPLLRPLRPANRYVLPSLRLPRRHFHPHPRQFQRFVPPWPSSLD
                     KPVPTNTTRSRKWLRRLAYLSLATGTVYIIDNQFYASSITRTTRTFALGLLVALDYKI
                     NFRPNPPLASSVTAVHARSAERLSDLLQRNGGLYLKIGQAIAMQSAILPAEFQKMFSR
                     MFDDAPQNEWKDVEAVIKEDFGKSAEEVFGVSFDGEPDKGVFERRARASASVAQVHWA
                     RLADGREVAIKIQKREIARQLEWDLWAFKVVTWVYTRAFDIPFYSLVPYISERLSLET
                     DFDNEASNSERMAQLVASEPRLRGRVYIPKVHRDLSSKRVMTAEWIEGVRLWDKDSIT
                     RPWRGGWREGTPGCQGTPMDPPKDNPANPTSKATDKIKPSRDHWRGQNNDGGLGLSLK
                     QVMTTMVDLFSAQMFLWGWVHCDPHPGNIFIRRTPSGKPELVLIDHGLYIHMDPAFRH
                     QYARFWKALLTFDNATLGDIVKGWGVQNADLFASVTLMSPYRGGNRSTEQHLTGLSKS
                     ELAARHYEMQQSARKAVRQILGDETKWPQQLIFIGRNLRIVQANNQFLGSPVNRVKIT
                     GLWASRALAESPDLPFGEKISNWGRHLVFRVVLIGSDVWFWFAKIRQFLRLGGGMEDD
                     IEAQMQGMAKEMGVELRQNIFEG"
     gene            complement(<978370..>980560)
                     /locus_tag="ACHE_70311A"
                     /db_xref="GeneID:66985826"
     mRNA            complement(join(<978370..979452,979544..>980560))
                     /locus_tag="ACHE_70311A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282629.1"
                     /db_xref="GeneID:66985826"
     CDS             complement(join(978370..979452,979544..980560))
                     /locus_tag="ACHE_70311A"
                     /note="COG:S;
                     EggNog:ENOG410Q19V"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139990.1"
                     /db_xref="GeneID:66985826"
                     /translation="MRATFSRISGRISDISLGRSGDNDKPNRRHTLNLGNFTFSRSRT
                     RAHERQVSAPMPGSKLALTDPVPSIRHTDIDEGSIQRPRSLPPQIIWPSDGSGTLNLS
                     FPDYASQMNTGTGTQYSTSRPPSNFTNTRMPTIRCVDCESQSGSQSQSHGPRTTTPTP
                     SIRALEDPNPDRRETNEYLQSPHEPLKKQSISSIATEPATRPAPASTSASKISQSSEI
                     GQPGFGPQGQHQQQHEVAAPAPAAAAAAPTAVQRNTESTRSSTGTFRFYGQLNQNQNL
                     NQTLNQDRKQDPGAGENDRTETDMADHRNKDKSSMRRMYQRIVQSTSATLTGEKQKKA
                     LRRISDIFQPRRDKLQQAREKEKLPAPSQPHHHNDNDSDSDSDDTNNTSDDNDNDDTD
                     TTKETNTTQLQLQPEIQATTNKTPQDTHPYHPNDYWDRIRQHHQQHQLSPSISHQSLP
                     RHVPNIHIHITRKPSLLSSSSLTEADSRGRLADQYHAQDLRLRSRSPRLAPASNAPSI
                     ASRSSNGGRDEHEHDESQHPHEPANENQDVNGSENDIDPRSTTSPASQRSTFHSINPR
                     TSHMGDQELPWKLRIPGDIDEEHEHEHEHEHTRSQGPAPPTTTALTTVTTTPAPQIAT
                     TPAITPNKDETNDNEAAHQQKAIRTINEGQSPIELPAPGQSGGKDEESSDEEVVMSST
                     AYPGQEWRPAGFSGWEY"
     gene            complement(<980805..>983230)
                     /locus_tag="ACHE_70312A"
                     /db_xref="GeneID:66985827"
     mRNA            complement(join(<980805..983118,983193..>983230))
                     /locus_tag="ACHE_70312A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282632.1"
                     /db_xref="GeneID:66985827"
     CDS             complement(join(980805..983118,983193..983230))
                     /locus_tag="ACHE_70312A"
                     /note="COG:S;
                     EggNog:ENOG410PSXD"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139991.1"
                     /db_xref="GeneID:66985827"
                     /translation="MAPTTYEPEFQKLASPASNSPISGSGTPVSFRANVNRTKTKRWV
                     EAKQVSYDGDDWGDDDEDDYEEEPPPVPPTHVSQRTGNIAGLPRPAFPAMDRSRSMDH
                     VLMVDPDGTSGSRSRSVEGRQFAGQPPDSKPAPFVRPADIYKRLREDRARDGMPVATR
                     SNTAPMESFPTVAAQGQETKEASNVASKKSQNVPIIGLPDVKRLSGLNTDFLSGSGDK
                     NSNTRDAQSGEPQQHQLQHNPSLGFRSAVNQAFDVPETPSSADDSVARSNSASTSAIS
                     PIIPSRGLNDEKTPTIVEEPGEMTPKDTTDRNIVFKPGHRRDLSVPSPGNSPSRKPKI
                     MDNDRIPQSAMAQLSYTTPSESLEDQTLPYLRQPKRTSVQLPATSGKDLPPPLRVSSN
                     QSNVPAASDNPDPPTVIVPSISADNSPQDTESDRLRKEIIRSLSRENTPSDEPELGSR
                     PQTRGGDSLVPSEYEKYWNNEANRSPQEKADPMPDYNSPSTNSPGVALNDTPVGPAPA
                     PWQGESQPKLKKKFSWESSEEEEAEPVADTHDQPMQNPPIPGQLPPEPDSPPMITQEP
                     NRQSMTEKPKLSIIPPSAGDESSIISGRYLPEVVPQPTEPDAAPENEAPQPPVPVPAA
                     PNAMPPVPSTVLGFRDILGIKSSDERVRQFERTRAQFAAIDTGLNHWIQVTIHAHPEH
                     SDIVGQNLKLSAGAQKQLGRKFPKLPSLGKHPHTEDAPAGAGHARRPSAPLGAMMNKQ
                     QVEQRGKDLLHTAGVLGGQAGKAAKGFFNRGRSKFKGNEKVDA"
     gene            <983607..>983771
                     /locus_tag="ACHE_70313S"
                     /db_xref="GeneID:66985828"
     mRNA            <983607..>983771
                     /locus_tag="ACHE_70313S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282633.1"
                     /db_xref="GeneID:66985828"
     CDS             983607..983771
                     /locus_tag="ACHE_70313S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139992.1"
                     /db_xref="GeneID:66985828"
                     /translation="MKHRIRTPELRLRKLWLKTSSVAHESHDWAEEAYESRDNVVSLP
                     PTLFLVNAVD"
     gene            <984040..>985231
                     /gene="SED5"
                     /locus_tag="ACHE_70314S"
                     /db_xref="GeneID:66985829"
     mRNA            join(<984040..984286,984343..984524,984572..985144,
                     985196..>985231)
                     /gene="SED5"
                     /locus_tag="ACHE_70314S"
                     /product="cis-Golgi t-SNARE syntaxin"
                     /transcript_id="XM_043282634.1"
                     /db_xref="GeneID:66985829"
     CDS             join(984040..984286,984343..984524,984572..985144,
                     985196..985231)
                     /gene="SED5"
                     /locus_tag="ACHE_70314S"
                     /note="BUSCO:EOG09263J3H;
                     COG:U;
                     EggNog:ENOG410PGDE;
                     InterPro:IPR021538,IPR000727,IPR010989;
                     PFAM:PF11416,PF05739;
                     TransMembrane:1 (i324-343o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="cis-Golgi t-SNARE syntaxin"
                     /protein_id="XP_043139993.1"
                     /db_xref="GeneID:66985829"
                     /translation="MAGPSIQDRTGEFHAILGQAQKRLASNKVGSQRQALLSDAQRKH
                     ANGFGANNGNRRSEFARRAAEIGRGITGTTAKLQRLAELAKRKTLFDDRPVEISELTY
                     VIKQDLAALNQHIAGLQALTLSQHPKSGRSKTDQEGEHNDNVVVMLQGKLADVGANFK
                     EVLEVRTKNIQASRSRTENFVSSVSSKSQSALDPQRSDSPLYNPSGRRTPTPGFQSNQ
                     SDLLTLEPSNPSPLGRPSMQSDQQLLVMEEAQSSNTYIQARGEAIDAIERTINELGGI
                     FGQLAQMVSEQSEMIQRIDANTEDVVDNVQGAQRELMKYWNSVSSKRWLIAQMFGVLM
                     IFFLLWVLISG"
     gene            complement(<985596..>986860)
                     /locus_tag="ACHE_70315A"
                     /db_xref="GeneID:66985830"
     mRNA            complement(join(<985596..986178,986236..986730,
                     986787..>986860))
                     /locus_tag="ACHE_70315A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282635.1"
                     /db_xref="GeneID:66985830"
     CDS             complement(join(985596..986178,986236..986730,
                     986787..986860))
                     /locus_tag="ACHE_70315A"
                     /note="COG:S;
                     EggNog:ENOG410Q1KQ;
                     InterPro:IPR001810;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139994.1"
                     /db_xref="GeneID:66985830"
                     /translation="MILDRFSTAVQRIRRSSVLRRRSTRKYSTSQKESFWEAVPSNIL
                     IRILAQCELSDIYALNLVCRVLRRRIYQHEPAIAQEYLFRRLHQHYPAFLSPGENLTF
                     IYNLFPPPPPHYPAADGSSEDNLPEYSFCYLTDLTRCWKTCIRLSFYLAESVVQHHLG
                     TDATLRDVSEQEAIYSKAVCQLQDKLLQPIAYLIFFLEFDATTTSSNESQQSILQQPP
                     FTDTQVLISTHHCMTLLCNYLRRLMAPDIQYPSTEPWLRLLLTTSTLERTLNFFAAAA
                     TSTTCEYNEKKEKLNRLSDATWTPRMEFIWQMRSDWEQILSATKESIYDPETKNEAIR
                     VLSTAGVEDVWFEAARRELDRRGLIPHACEEGVPVLHEATTRPRCEFCE"
     gene            <988449..>989384
                     /locus_tag="ACHE_70316S"
                     /db_xref="GeneID:66985831"
     mRNA            <988449..>989384
                     /locus_tag="ACHE_70316S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282636.1"
                     /db_xref="GeneID:66985831"
     CDS             988449..989384
                     /locus_tag="ACHE_70316S"
                     /note="COG:S;
                     EggNog:ENOG410PV62;
                     InterPro:IPR010699;
                     PFAM:PF06912;
                     TransMembrane:6
                     (i78-99o127-148i160-178o190-207i254-271o277-297i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139995.1"
                     /db_xref="GeneID:66985831"
                     /translation="MQGHYSYPGTTPYVHRLAYEDGVRNHTYQPRPEDHPALRTDLDS
                     RTGSLSSQETVTIEPKRGPVARYFLAEINPHRTYLLLIICSYIAGLVDALSYNAWSTF
                     TGMQTGNTVFMALGASNQPSYPDYLWAKALIAFSVYMISNLFFTYVARALNPLRRTTM
                     LLMFGLQTLALLVAALLVELEVVLPRPEEYTAPIQWTQVLAIALLAFSQAGQISASRI
                     LGYNEVPTLSVTTVLADMLADPHLFELHNPKRNRRIAGFIASFVGAMTSGFLSRETEM
                     VACLWLAMALKVVVMLCFFVWRDDRESEKKDLEGQ"
     gene            complement(<992255..>993621)
                     /locus_tag="ACHE_70317A"
                     /db_xref="GeneID:66985832"
     mRNA            complement(join(<992255..992706,992767..992912,
                     992972..993064,993134..>993621))
                     /locus_tag="ACHE_70317A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282637.1"
                     /db_xref="GeneID:66985832"
     CDS             complement(join(992255..992706,992767..992912,
                     992972..993064,993134..993621))
                     /locus_tag="ACHE_70317A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139996.1"
                     /db_xref="GeneID:66985832"
                     /translation="MSVSFGFSVSDCIGMEPNHFTSHFSNHFVNIGGLKFIKEVGEAL
                     GNSCKAKDEYSSFISTIQWAEVMLHQIQELQLENISQELIQKYKAIAVNIQQAVDNFK
                     QGIMKKFDGSLAANPVQFEKKLKTAFSKMEWTSIKSLVEEFKSSLILQFVLQLTLSQH
                     MTMKILDKDRCSQAHNICCQFSYQRNQGALQSDCTSISSRPAIECDSTSHFISTVEEI
                     PKTSDVSEEIMAEENTLCLSNRSDGKNNSTTANFTCTSPCFSHYFGADSSLPVLRHPS
                     TSSADLQVQGDARFTGLPIKSPTDGSIRIYSKPSYPDHGVKPIFVIPGRKDKSLPLKD
                     PCDGSIKSLEMTAKSTKHSTYNKPYRRNSIFASPQGKKTVIRDPSNMAIIDFDSRKLS
                     "
     gene            complement(<995234..>995648)
                     /locus_tag="ACHE_70318A"
                     /db_xref="GeneID:66985833"
     mRNA            complement(join(<995234..995539,995640..>995648))
                     /locus_tag="ACHE_70318A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282638.1"
                     /db_xref="GeneID:66985833"
     CDS             complement(join(995234..995539,995640..995648))
                     /locus_tag="ACHE_70318A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139997.1"
                     /db_xref="GeneID:66985833"
                     /translation="MTPFEETAVEGSKVEAAPNYGDENAIDKVNINESLRYRSLGVEN
                     QSADTSERDERPDDNNGEGAASGFKQTHPNVPSKIPAGHFLSVSSSTGKTWKGKTIPT
                     RL"
     gene            complement(<995992..>996276)
                     /locus_tag="ACHE_70319A"
                     /db_xref="GeneID:66985834"
     mRNA            complement(<995992..>996276)
                     /locus_tag="ACHE_70319A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282639.1"
                     /db_xref="GeneID:66985834"
     CDS             complement(995992..996276)
                     /locus_tag="ACHE_70319A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139998.1"
                     /db_xref="GeneID:66985834"
                     /translation="MYPHDGEHFRPEWYVRNLQAVSRPEGLLQWSTTAVRNEFDIEID
                     KTCPVENSSIVTEKGPETNNTSGHQNEDIKDVFSSQKAPSTVGMLDGNTC"
     gene            <998383..>998853
                     /locus_tag="ACHE_70320S"
                     /db_xref="GeneID:66985835"
     mRNA            <998383..>998853
                     /locus_tag="ACHE_70320S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282640.1"
                     /db_xref="GeneID:66985835"
     CDS             998383..998853
                     /locus_tag="ACHE_70320S"
                     /note="COG:S;
                     EggNog:ENOG410PJS5;
                     InterPro:IPR003480,IPR023213;
                     go_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043139999.1"
                     /db_xref="GeneID:66985835"
                     /translation="MTGSTAKITITATHVVHSQHRITLQDPFVLGPFDQLGHFATPVN
                     AVWIYESSSSVSLIPLERLHKAISRLLDYYPQLTGRLHIDTETDVRSMTRLGSGIHLL
                     EATCDAPLRSFAGRSSSSDRESSVFNFPGIGNGLLAPWDISLEGAQRDPVFTIQ"
     gene            <998887..>999219
                     /locus_tag="ACHE_70321S"
                     /db_xref="GeneID:66985836"
     mRNA            <998887..>999219
                     /locus_tag="ACHE_70321S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282641.1"
                     /db_xref="GeneID:66985836"
     CDS             998887..999219
                     /locus_tag="ACHE_70321S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140000.1"
                     /db_xref="GeneID:66985836"
                     /translation="MRLSHVVSGAGGFLGLYQDLAEIYRAADPANGGRIELTSPPYLP
                     PFMVTEMLHMNADEQRKALSERPAAYSLKDPKAAAETPAKTEAHFQQQSLSQDPLVGR
                     SLRFSLQH"
     gene            <999477..>999869
                     /locus_tag="ACHE_70322S"
                     /db_xref="GeneID:66985837"
     mRNA            <999477..>999869
                     /locus_tag="ACHE_70322S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282643.1"
                     /db_xref="GeneID:66985837"
     CDS             999477..999869
                     /locus_tag="ACHE_70322S"
                     /note="COG:S;
                     EggNog:ENOG410PJS5;
                     InterPro:IPR023213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140001.1"
                     /db_xref="GeneID:66985837"
                     /translation="MELAQVPLWKIADIINGRIRHVSAEETYKLGRWIAAQSKKSHVQ
                     LNFPCTPASFIATGWHRFPLYSGTDLDVAPIFASPVFMESLFDGMIYFVEPKAKDNGI
                     EAVACMRSSTWEFLDKDEGFINTWDRRS"
     gene            <1004882..>1006836
                     /gene="RIM9"
                     /locus_tag="ACHE_70323S"
                     /db_xref="GeneID:66985838"
     mRNA            join(<1004882..1006239,1006293..>1006836)
                     /gene="RIM9"
                     /locus_tag="ACHE_70323S"
                     /product="regulator of ime2"
                     /transcript_id="XM_043282644.1"
                     /db_xref="GeneID:66985838"
     CDS             join(1004882..1006239,1006293..1006836)
                     /gene="RIM9"
                     /locus_tag="ACHE_70323S"
                     /note="COG:U;
                     EggNog:ENOG410PII9;
                     InterPro:IPR009571;
                     PFAM:PF06687;
                     SECRETED:SignalP(1-26);
                     TransMembrane:3 (n9-22c26/27o84-107i119-145o151-173i);
                     go_component: GO:0005886 - plasma membrane [Evidence IEA]"
                     /codon_start=1
                     /product="regulator of ime2"
                     /protein_id="XP_043140002.1"
                     /db_xref="GeneID:66985838"
                     /translation="MLFKPATPLTILLLIAFALLVLSVISTPIVKQIPLASFDNVDYG
                     VFGYCKDGVCTDIHIGYTSSDISNTASNDFNLPSGTRRSLSSILIVHPVAAFLTLICL
                     CLAAAAHFHGPSHSPRYLLALLILLLPTLLVSLLAFLVDILLFVPHLHWGGWIVLVAT
                     VLLVACGVVTCAMRRTLVSRKARKRRIAENAEMSGENYYNRQNAAAAALDTKPEMNGD
                     TKEAYVTGAPTADGPTFATFRTNTRESDDDQTPLNSRTPAPANDYPLPDQPPRGMPYS
                     AARDEVGNPLPPSGPYAAAAGRGRPTDPRMNGGPPPGFGSRGRGGYPPRGAYGRGGYG
                     PPRGRGGPMGPMRGGPAMRGRGGYRGPPPVDYGYEAYGAVPRTHPTPPPAEYRGTSPV
                     YRQPSPGPIGMALSADGGPVGQAIEMTPQPRRSPGPDQVHALSVDGYPEPTSPSSFYS
                     RTPSTYVPPRAGWTQPDNRLGPSPSPVYEHAIPEPLRPAQSPVHAYGPPNGAQHARNN
                     SADYYEDMDPEFAESQPAVSAPPVAALPSALMPGPAGEPKPVEDIPEAPGSPTASEMS
                     HFTSISQRPVNPRWQPPMQPAQQRTNMLLEGNPDFDLSAGRRRGGTGPGGRMPTLSTL
                     REVTRYPVP"
     gene            <1007695..>1009132
                     /locus_tag="ACHE_70324S"
                     /db_xref="GeneID:66985839"
     mRNA            join(<1007695..1008045,1008110..>1009132)
                     /locus_tag="ACHE_70324S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282645.1"
                     /db_xref="GeneID:66985839"
     CDS             join(1007695..1008045,1008110..1009132)
                     /locus_tag="ACHE_70324S"
                     /note="COG:S;
                     EggNog:ENOG410PFAR;
                     InterPro:IPR039254;
                     PFAM:PF13668;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140003.1"
                     /db_xref="GeneID:66985839"
                     /translation="MLQKHHLLPLLGLSHHALALPKPSSASLSSVSLSGPPVVSHPTS
                     LPHTPYSGTPTTTGALSASSVVGSSITPGATGYPSDGKLHDAEPAPYVPAGGVGTSGE
                     EPVYNAKSDFDFESLALATYQEYIELDLFHDGLARFSVEDFKKAGLTAEDRFLIEFMA
                     DQEVGHATMLTNILGPDSAPKQCTYNYPYKTVWEFLDFSQKLTRFGESGVYGFLGHLD
                     SREAATLLTQSITTEARQQMVFRQFEGLFPMPVWFEVGIPQSWAWTLLAPYISSCPEG
                     QTRLAWQNFPALTIDNQPNPSRIDGGKAFHESLEPGMNTLQQVTGPESCLDSDTQGEN
                     CSPAITHNRTNPLSYPGREVYLSWEEPGKPVGPNNSYVTSSQASEPKYVAWATQLNVT
                     YSPLEVLNKTAGKTVQPDLSTYQGDPAINGTMFLAVVDEDVYVTPFNFSSINEHVVAG
                     PALYQAG"
     gene            <1009700..>1010150
                     /locus_tag="ACHE_70325S"
                     /db_xref="GeneID:66985840"
     mRNA            join(<1009700..1010007,1010108..>1010150)
                     /locus_tag="ACHE_70325S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282646.1"
                     /db_xref="GeneID:66985840"
     CDS             join(1009700..1010007,1010108..1010150)
                     /locus_tag="ACHE_70325S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140004.1"
                     /db_xref="GeneID:66985840"
                     /translation="MITRKAHPKSPDEREYALLSDPESDLDSDSDHAVTCAHIEDLDN
                     QYNIQDTSVQGNPTVRLAGEYPRPRTPPKAKTKTTTKAEVEVKERYVRFGIGGAGNMR
                     RVLVRDERLVRVIS"
     gene            <1014495..>1016906
                     /locus_tag="ACHE_70326S"
                     /db_xref="GeneID:66985841"
     mRNA            join(<1014495..1014546,1014604..>1016906)
                     /locus_tag="ACHE_70326S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282647.1"
                     /db_xref="GeneID:66985841"
     CDS             join(1014495..1014546,1014604..1016906)
                     /locus_tag="ACHE_70326S"
                     /note="COG:S;
                     EggNog:ENOG410PIWI;
                     InterPro:IPR021840;
                     PFAM:PF11915;
                     TransMembrane:8
                     (i224-247o267-293i332-359o379-400i512-539o559-582i635-
                     661o673-694i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140005.1"
                     /db_xref="GeneID:66985841"
                     /translation="MDSSAPQPGNVSLRTVSSSRPQYQYFEQRSEAASDDYYSFPSTA
                     SNSASSRDGVMRYATPVSGPTSRASSPGVGVPRMGAIGEHGPLLGEDTPRRVRARTGH
                     DNGGNGSVWMEGDLPHIRYAINHLTREEEDDEEVRDVGGREDHPDGFVWDEERGCFTR
                     LGTLPAPSHQQQQQERETSPARSVQSSTSSMTTIGRKTFVAMDPPENSLLYLPLDYVP
                     IILRPWALALLIICCLLMIVGVSFCNVWSKKHQGLWDYDGQSGSRYFVFQFLPQILAA
                     ILILWIFVVQAAVYRVMPFAIMASERKLERVLQKLPMLPRNFLLPDLSHFLYGEPLVG
                     FSLFTIWLANMFAIPLLSCLFQVKWYSYVDGANGQGRFRWTSVQSIGWTIVSLYGLLT
                     IGLTVLLVRFVRAWSGLIWDPTSIADLIPIIQRSNILQDFDGLETSPDVGKSLEPRTL
                     RLGYWKLSGKKEILFYGIGEEDAPVRTPSLHTDKQAKITDVERQQNNLNMYEPTTRHR
                     WTPWFLRTISIIAWSFLVGGLFIAFVIVSFLHDAIASGFPPRLPTLPSTDGFSASNFV
                     YSFVPALIGMLFFLAYQHVDVYFRAIQPYASLSSSPTGVPAKQSLLLSYPSDLPLLVT
                     IKALLNKHPKLALITFTSTASLAIPILAGGIFTALYYPSSRTIRMTSLMPAFYALLAF
                     CALYTLSLLAIWPHRIRYLPHGIATLGEQVSFLYQSPLLADKGLREVRCRTDLVRMVV
                     SGGEGFEVGETRYGFGVFVGRDGREHLGVERVRRGGREDMVILR"
     gene            complement(<1017111..>1018944)
                     /locus_tag="ACHE_70327A"
                     /db_xref="GeneID:66985842"
     mRNA            complement(join(<1017111..1017917,1017966..1018106,
                     1018153..1018836,1018885..>1018944))
                     /locus_tag="ACHE_70327A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282648.1"
                     /db_xref="GeneID:66985842"
     CDS             complement(join(1017111..1017917,1017966..1018106,
                     1018153..1018836,1018885..1018944))
                     /locus_tag="ACHE_70327A"
                     /note="COG:S;
                     EggNog:ENOG410PM0B;
                     InterPro:IPR036864,IPR021858,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140006.1"
                     /db_xref="GeneID:66985842"
                     /translation="MAYGGKPSTGCQNCRQRRIKCDEARPHCRACVRTGRTCPGYQHP
                     LDVALRGQTAFQRKKKGAPGKQSSASKAVVPATTPSSSDDSISTIVDIPHTPETLVSS
                     VSPVSTSSDSIPHTLEISRLVPPVPPVPTFNVSIPRSIYLPMEDTVIPLFFNSYLYLP
                     KDPQISNGFLDLLPQFYSETQVGSSVHLSLLAVSAFSVAAWTGERNSLQLAEHSFLRA
                     LRKTREVLQTDIDGNLNEILLTVLLLSLYEDFVSKRDRQLPPRDHLRGAIALINSRRP
                     EQLDSPSCRLLADGVEHEVIRTSMGLAHPMVPTPKVWPLTAPIAQTAPEQLQMASSGL
                     VNLRLAWESLASRPPSQITESEILHLMSQAQELDSKLVNWVHTVPPNWLPSPATMIPQ
                     SVRAAGVFNDRCDCYSDLWVAATWNSYRDSRIVVQKIILSCLRMLTDTDTNINASSPS
                     NQATLAVKSTAEATIQSLAMDICACVPFLLGSQMESVQLNPYKVEYPEAEGRPLTQGH
                     QQTAPLLGGWFLITFLGNLCTSGLCLSEEHLGWIRGQMQRILQIYNFGFVPPSQV"
     gene            <1019337..>1020698
                     /locus_tag="ACHE_70328S"
                     /db_xref="GeneID:66985843"
     mRNA            <1019337..>1020698
                     /locus_tag="ACHE_70328S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282649.1"
                     /db_xref="GeneID:66985843"
     CDS             1019337..1020698
                     /locus_tag="ACHE_70328S"
                     /note="COG:S;
                     EggNog:ENOG410PWDK;
                     InterPro:IPR011009,IPR002575;
                     PFAM:PF01636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140007.1"
                     /db_xref="GeneID:66985843"
                     /translation="MDFDHLAEQESQRIFKKWIQHLVKNSSETLVTKLALRHRPGIPV
                     STTRFSHGAFNFCYQVAYEDGSRLLVRFTALGRAVFRHEKVQDEVAVMRYLAENTSIP
                     VPTVLGSGSCAVGPYVVMTLLEGNLLSRYLRDPMKKIETLNLHISECALKKAYRDMAD
                     IVLELSKPEFSFIGALKLDESGDWSVHKRPLTFNMNRIAQFSNIPPSAFAKQRFNNAT
                     DYFEELAKQHLYHLEYQRNDAVINEDDCRKKYIARCLFRKISRKASKEHRHGPFHLFC
                     DDFRPDNILVDQSKLEIIGAFDWEWSYAAPAEFTHAAPWWLLLERPEDWEMNLDHFLE
                     RYMPRLSIFLEALRECESRKIGDGSLTEEQCLSDAMEDSMENGLFWFCLAARHGAMFD
                     EIYWAFLDQRYFGSFTTLEDRMRLLSDEERMNLDDFVQRKLQQSSEGTLESYMSIDDI
                     AQL"
     gene            <1021223..>1021849
                     /locus_tag="ACHE_70329S"
                     /db_xref="GeneID:66985844"
     mRNA            <1021223..>1021849
                     /locus_tag="ACHE_70329S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282650.1"
                     /db_xref="GeneID:66985844"
     CDS             1021223..1021849
                     /locus_tag="ACHE_70329S"
                     /note="COG:S;
                     EggNog:ENOG410PYW1;
                     InterPro:IPR038814;
                     TransMembrane:1 (o56-73i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140008.1"
                     /db_xref="GeneID:66985844"
                     /translation="MLSSLWGSKPSSPSTSTPSSSTETKSETQLSHSANPNEPSTTPP
                     QNQQSTFPQRPLKLLLAGTTFVTLSLYLTRRALRTRHLAAIPPYYTSSTYHHPPVNGA
                     LDAFEAFNLATINVVSFAMVGTGGVMWKLGVNDLEDARRITRRYIKGVGEGPEGIGGA
                     KSGKEEDEEAEKAIEKWVVETLGLKGYEEKKREILEERERARNEKSEK"
     gene            complement(<1022002..>1024613)
                     /locus_tag="ACHE_70330A"
                     /db_xref="GeneID:66985845"
     mRNA            complement(join(<1022002..1023060,1023116..1023465,
                     1023512..1023572,1023620..1023822,1023875..1023950,
                     1024073..1024371,1024484..>1024613))
                     /locus_tag="ACHE_70330A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282651.1"
                     /db_xref="GeneID:66985845"
     CDS             complement(join(1022002..1023060,1023116..1023465,
                     1023512..1023572,1023620..1023822,1023875..1023950,
                     1024073..1024371,1024484..1024613))
                     /locus_tag="ACHE_70330A"
                     /note="COG:S;
                     EggNog:ENOG410PGDM;
                     InterPro:IPR000504,IPR036443,IPR035979,IPR012677,
                     IPR000467,IPR001876;
                     PFAM:PF01585,PF00641,PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140009.1"
                     /db_xref="GeneID:66985845"
                     /translation="MSHTYANDNMYPPGPVQRPFPSRDNRDGRMYDDRSRSRSRSPGE
                     DRQRPAADRQHEYSRDRDSRNRRDRDRDDYRRRPSSRSPPPRGGRSTYRDRDSPRYYS
                     RSRSYSRSRSRSPRRSRGPYYGQESREVMMDGLPVEMAEEDISSELNEFYHVEGLEEV
                     RVIRDRQTKVSRRLGFLRFCDLDHSRAFLEPNFPSIYFNGPNHSGDDRGTRVRIAYSR
                     EREDRARARAEGDWTCRMCAIVNYSTRQKCFRCQAPRPEAGPAGPPGIAAPKVENHGD
                     NDVAPDNQPSQFLIFRGLESSVTEELLAKGVAKLYKPASGGSDNTSKTEKKGAKVAST
                     TGDSNLGAREGSIRRVLLVRDRKTNESWRYGFAEFATVQDAQAAVTRLNSFEKFTISS
                     RPVLVSYIHAGVFVPVMNPTAATERFTFSPLLNPSLKLMYWDEEGYVTELTVSPAEAD
                     HAQGQPKSDATTAQDQAKSSKDPEKSKKRKADANANAGSKKVVASHLQFWSNRHAELH
                     GIKRKNPDEIAPGESGSDGGSPSDVAPPSQSYADLNRNCCYLCMRQFKTPAEVNCHER
                     LSQLHRTNLQNEDLVSKATNKLVKHGIVPPTPEYRDRAKERRKAFGSTKPPTTTTKAR
                     PTARAPPGEKEEEPPAQQPSKGASLLSKMGWSAGSGLGAQGTGMTAPIATEIYAQGVG
                     LGAQGSKIGDAAEEAGRNTRNRYDEFLEKTRQTARERYERLDK"
     gene            <1025376..>1027184
                     /locus_tag="ACHE_70331S"
                     /db_xref="GeneID:66985846"
     mRNA            join(<1025376..1025847,1025899..>1027184)
                     /locus_tag="ACHE_70331S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282652.1"
                     /db_xref="GeneID:66985846"
     CDS             join(1025376..1025847,1025899..1027184)
                     /locus_tag="ACHE_70331S"
                     /note="CAZy:GH13;
                     COG:G;
                     EggNog:ENOG410PGUZ;
                     InterPro:IPR017853,IPR006047,IPR013780;
                     PFAM:PF00128;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140010.1"
                     /db_xref="GeneID:66985846"
                     /translation="MAKSSNQIHRAWWKECSVYQIWPASYKDSNEDGIGDIPGIISKL
                     DYIKNLGVDIVWLCPSYKSPQVDMGYDIADYYNIADEYGTVADVEKLIQECHERGMKL
                     LMDLVVNHTSDQIEWFKKSRSSKDNEYRNWYVWKPPRFDEQGNRHPPNNWMSHFQGSA
                     WQYDELTGEYYLHLYATEQPDLNWEHPPVRDAVHDIMRFWLDKGADGFRMDVINFVSK
                     DQRFPDVPVKDPRTPWQWADRYYANGPRLHEYLQGLGDILKEYDAFSVGEMPFVKDTN
                     EVLKAVRYDRNEINMIFNFEHVDIDHGTYDKFEPGNWKLTDLKEFFERWQTFMYDNGG
                     WNALYWENHDQPRSIDRYTNAKEEHHVISSKMLATVLALHGGTPFVYQGQEIGMRNIP
                     PSWGMEEYKDIDCLNHWNPLVRDRPSDINAQTIARQEYQKKSRDNARTPVQWTSAPNA
                     GFTGPNTKPWMSVNPNYTSINAEAQINDPNSTYSFWGRVLGLRKKYLDIFVYGNYTLV
                     DRDSQEVFAFTRQYENQKAIVVCNWTETAREWSAKANGIEGVEEVILDNWEGVQETAQ
                     RLEGGKWSLRPYEAVVALL"
     gene            <1027333..>1027869
                     /gene="MOCS2"
                     /locus_tag="ACHE_70333S"
                     /db_xref="GeneID:66985848"
     mRNA            <1027333..>1027869
                     /gene="MOCS2"
                     /locus_tag="ACHE_70333S"
                     /product="molybdopterin synthase catalytic subunit"
                     /transcript_id="XM_043282654.1"
                     /db_xref="GeneID:66985848"
     CDS             1027333..1027869
                     /gene="MOCS2"
                     /locus_tag="ACHE_70333S"
                     /note="COG:H;
                     EggNog:ENOG410PMW6;
                     InterPro:IPR036563,IPR003448;
                     PFAM:PF02391;
                     go_process: GO:0006777 - Mo-molybdopterin cofactor
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="molybdopterin synthase catalytic subunit"
                     /protein_id="XP_043140011.1"
                     /db_xref="GeneID:66985848"
                     /translation="MSSEQQQEQQRDLPPHLNPSNYPQARTHPSLNIHLTLTYAPLNP
                     TTHITDISSPSAGANLLFLGTTRDSFDHRPVTTLSYTTYPILAFKTLMQIAENAVAEH
                     GLLGVSIAHRLGEVPVGECSIVVGVSAGHRGAAFRGGEEVLERCKERVEVWKREVFGD
                     GGSEWRANEERDRDGNLK"
     gene            complement(<1027975..>1029015)
                     /gene="SCO1"
                     /locus_tag="ACHE_70332A"
                     /db_xref="GeneID:66985847"
     mRNA            complement(join(<1027975..1028102,1028164..1028488,
                     1028563..>1029015))
                     /gene="SCO1"
                     /locus_tag="ACHE_70332A"
                     /product="Cu-binding protein"
                     /transcript_id="XM_043282655.1"
                     /db_xref="GeneID:66985847"
     CDS             complement(join(1027975..1028102,1028164..1028488,
                     1028563..1029015))
                     /gene="SCO1"
                     /locus_tag="ACHE_70332A"
                     /note="BUSCO:EOG09264ENO;
                     COG:C;
                     EggNog:ENOG410PG4G;
                     InterPro:IPR003782,IPR017276,IPR036249;
                     PFAM:PF02630;
                     TransMembrane:1 (o83-104i);
                     go_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA];
                     go_function: GO:0005507 - copper ion binding [Evidence
                     IEA];
                     go_function: GO:0016531 - copper chaperone activity
                     [Evidence IEA];
                     go_process: GO:0006878 - cellular copper ion homeostasis
                     [Evidence IEA];
                     go_process: GO:0008535 - respiratory chain complex IV
                     assembly [Evidence IEA]"
                     /codon_start=1
                     /product="Cu-binding protein"
                     /protein_id="XP_043140012.1"
                     /db_xref="GeneID:66985847"
                     /translation="MTSSLKHLPRLLPRVTRTATPTIASSSRTVPLSSILHSTPRIPQ
                     VQNKNALNRNTSRTFTSSTLRARAKTMGQLRARNSTGPFSWKAALLFIVTGAGMIVYF
                     QVEKERLARKRVAEMSKGVGRPKVGGPFVLRDLEGREFTAEDLKGKYSFVYFGFTHCP
                     DICPDELDKMAEIIDKVNEATGDPSLFLPVFITCDPVRDTPEVLREYLKEFHPKIVGL
                     TGTYEQVKHVCKMYRVYFSTPRDVKPGEDYLVDHSIYFYLMDPENDFVECIGRQDTPE
                     SASKVILEHINDWKREGRALTGRQQ"
     gene            complement(<1029529..>1031151)
                     /locus_tag="ACHE_70334A"
                     /db_xref="GeneID:66985849"
     mRNA            complement(<1029529..>1031151)
                     /locus_tag="ACHE_70334A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282656.1"
                     /db_xref="GeneID:66985849"
     CDS             complement(1029529..1031151)
                     /locus_tag="ACHE_70334A"
                     /note="COG:S;
                     EggNog:ENOG410PJKH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140013.1"
                     /db_xref="GeneID:66985849"
                     /translation="MSDLVGVAPAATTLGGAGAASHGRVQNGAPRPVPVNTNPPSGVR
                     TPTDIMRQRREREGRRKAEQEARDREQQQQQEPQPQPPVQQQPYAAGVDRMSQRRPTT
                     SAGAGHRRAGSQPGPPPSSAQPIPGQPKPQQPGATKPADASQEPRRVAFPHAFERWET
                     LSSHWEGLTGYWIRKLEQNNEALERDPLSQQMARQVTDLSAAGANLFHAVVELQRLRA
                     SSERKFQRWFFDTRAEQERAKELQAELERQIQTERQARAEAVASYQKAESDKRRVDDL
                     VKEMRRELQISKDEARRAWEELGRREQEERDRTASLRNGEPTLVGGVQVVPMISSRQH
                     PINYSSTEENEDRYARDAAMKMSDAGDAQYYDDQPVSPTGSDPFSETVRKTDPASTIP
                     ASQPQPSYPGHFYRPENATVPGHTRATSDPEYGQSVEGSEPGDDEYTHYQRDSQGRPL
                     VYPGTMSEESDDYDPEDNGPYATEGSYVPSTSASPSVPTTSAPVYNYPPTSGGWGWDS
                     VTPRHRHPTRLSDVMEEDEPRTTPSRASRTSH"
     gene            complement(<1037395..>1038486)
                     /locus_tag="ACHE_70335A"
                     /db_xref="GeneID:66985850"
     mRNA            complement(join(<1037395..1038023,1038135..>1038486))
                     /locus_tag="ACHE_70335A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282657.1"
                     /db_xref="GeneID:66985850"
     CDS             complement(join(1037395..1038023,1038135..1038486))
                     /locus_tag="ACHE_70335A"
                     /note="COG:S;
                     EggNog:ENOG410PV62;
                     InterPro:IPR010699;
                     PFAM:PF06912;
                     TransMembrane:6
                     (i141-162o168-192i204-223o229-246i266-282o288-307i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140014.1"
                     /db_xref="GeneID:66985850"
                     /translation="MFEAPRNLTFVDDSLNKDALNEPSGSRGIYSRSDDVEKQARSPY
                     SNPLAGSTNVSIAETLNEEETPAPSKRSKLGKYFLSDIDRNWTEAILISCGFVSGLVD
                     GLSFTFWSSFSSMQTGNIINLALGVSGNLYHQEKLWVKALIAVGAFLLGTFCFIVGSW
                     MLGPLRRITMISSFALQTILIMVAAILVHTEAIGGTPSGDPMRWLQDVAIALLAFQAA
                     GQILASKFLGFPEIITVALSAVMCDIFLDKKLFHGWRENPKRNRKIGFVLALFLGAMA
                     GGGMARHHGLAAGLWLAMSLKGAITVAWCIWPECPPPTEEGEGKGKEVMK"
     gene            <1042780..>1044597
                     /locus_tag="ACHE_70336S"
                     /db_xref="GeneID:66985851"
     mRNA            <1042780..>1044597
                     /locus_tag="ACHE_70336S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282658.1"
                     /db_xref="GeneID:66985851"
     CDS             1042780..1044597
                     /locus_tag="ACHE_70336S"
                     /note="COG:S;
                     EggNog:ENOG410Q4K6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140015.1"
                     /db_xref="GeneID:66985851"
                     /translation="MAAIQARTLPSDFGALRSDNKSQLTTCTPYSSPVKQRGSSCYLP
                     RRGTQVLEESNTDPFYLEQTLRDSCQPGQRGVHCCETTDHRYFTLSSVDKRKEYHYPN
                     PVRREPAGPRSNFYDNIKGNRNTLSVVELEHRVGLQQIAAQRGLERQHVHCKQGSFSS
                     GTSEPTPDLTPSSSFSSNYSLVRDQHISFEPQRITSESGSHLYLTPCTPPPIRPPPTT
                     ALPSLPSTPKPHQNPTRNSKGTARPANDPTETFTMQNEDPQVRYNRLGKPLPTLPNIA
                     RNGQKTKTTQNDTQRTQIEPSMISPPSLINPVTMEPHATHFDQAFFIPANDCPSPVPS
                     PGRNSTSSRLAREVTNTSPSREKERPWTARSEAYCEQSVWESDSDSESIGPKSLSKKP
                     IDTLRKVRSRVHLRVARSAPRLNGAPSQPPPVPSPPTDGAPLEKFPSMPDHPVQQPPP
                     LPPGSSAMARKPALQTRSSKDIFRPNAQTLRLVAPSTASLVRPDSRKDKEKESLPATP
                     TTATTKTSEHDMDSAAAAAFQAQSRRRQRSRSPTSPATTGFADKEKLRTLCREERTEH
                     TLHSSLALGRRPLYRRFWESLRILSCHGDMSPKPTRKSF"
     gene            complement(<1045676..>1046425)
                     /gene="YAE1"
                     /locus_tag="ACHE_70337A"
                     /db_xref="GeneID:66985852"
     mRNA            complement(<1045676..>1046425)
                     /gene="YAE1"
                     /locus_tag="ACHE_70337A"
                     /product="essential protein Yae1, N terminal"
                     /transcript_id="XM_043282659.1"
                     /db_xref="GeneID:66985852"
     CDS             complement(1045676..1046425)
                     /gene="YAE1"
                     /locus_tag="ACHE_70337A"
                     /note="COG:S;
                     EggNog:ENOG410PR4G;
                     InterPro:IPR038881,IPR019191;
                     PFAM:PF09811"
                     /codon_start=1
                     /product="essential protein Yae1, N terminal"
                     /protein_id="XP_043140016.1"
                     /db_xref="GeneID:66985852"
                     /translation="MTSTHSDTITAQPPPPPPPAADTLDDIFGSSPPPSSSFEHDHVP
                     APEAAVPAAAAEPSDLPSLRRQHVTTGYRDGISLSKGEHVQDGFDAGFPVGAQLGMRA
                     GTVLGILEGVLRGYESKVGGGAVKKLPSTSRGGKSTDRAQGQGQGKESEIEILRREQR
                     EKLSKIYQRALKELEVQAVFNGLENMGEKEQEKPETQLGRKGDGVVSSWEGRVKVAEW
                     EVNMDALEEKEKEKEKKAEATATPDDEGEQS"
     gene            <1047460..>1048233
                     /locus_tag="ACHE_70338S"
                     /db_xref="GeneID:66985853"
     mRNA            <1047460..>1048233
                     /locus_tag="ACHE_70338S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282660.1"
                     /db_xref="GeneID:66985853"
     CDS             1047460..1048233
                     /locus_tag="ACHE_70338S"
                     /note="COG:M;
                     EggNog:ENOG410Q2HB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140017.1"
                     /db_xref="GeneID:66985853"
                     /translation="MASRRFILLSSPFAIGYGVHQGLNILEAKYPALPPDTNTSAALR
                     TPSNPKTQRCAYVDVYSARVPVKALESHPAAEESRNLQEAWARTLFQSRVLRTEARLI
                     GLFTAGRPTPGDTGNTPGGFSQKDERGEQRKLMNGALAVERSPSSGSWLSMSGPSGLL
                     VSWKVPDNAREFFEKISVYGYPWRLMSGGRHEVSVSKPFKEEGRQVVEVRFASAHDYE
                     IVPDEGELEKQKVIPAWVGKLHRGFARLILDSAVRELQD"
     gene            complement(<1051361..>1053157)
                     /locus_tag="ACHE_70339A"
                     /db_xref="GeneID:66985854"
     mRNA            complement(join(<1051361..1051703,1051755..>1053157))
                     /locus_tag="ACHE_70339A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282661.1"
                     /db_xref="GeneID:66985854"
     CDS             complement(join(1051361..1051703,1051755..1053157))
                     /locus_tag="ACHE_70339A"
                     /note="BUSCO:EOG092624UF;
                     COG:P;
                     EggNog:ENOG410PH6F;
                     InterPro:IPR004752,IPR024371,IPR036259;
                     TransMembrane:12
                     (i95-118o124-141i162-182o202-225i237-256o276-299i320-
                     341o361-380i392-416o422-449i461-481o539-558i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0008521 - acetyl-CoA transmembrane
                     transporter activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140018.1"
                     /db_xref="GeneID:66985854"
                     /translation="MKPKGQTLNKRRSKPSLTLATGHENGHANREKMNSNIEMRKRDT
                     PPESSSARANRLMSRESFTLDEEPSMPTTPQTPGLATTSFQNLPHTDKRNFLLLCVLY
                     FLQGIPMGLATGSVPFLLKPHLSYGQIGVFSLASYPYSLKLLWSPIVDAVWSPTFGRR
                     KSWITPVQVIAGLAMIYLGGRIEEMMTAAGANGGAGVWNFTYWWFMLVFFCATQDIAV
                     DGWAITLMSPPNISYASTAQTVGLTAGHFLSYTVFLAFNSADFANRWFRSTPSEGGLL
                     SLGTYLNFWGWTYLIVTLCLAFMKKEDKTRERDSIMHVYRSMWNVLKLKNVQTIILVH
                     LIAKIGFQANDGVTSLKLLDKGFGQDNMALVVLIDFPFEIFLGYYAGKWSTEYTPMRL
                     WCWAFVGRLAAAVLAQVTVTIFPASPEVPFWYLLAVIGEHVVSTFMNTVMFVAVSAFH
                     ARIADPVIGGTYMTLLATVCNLGGTFPRYFILRLVDLFTEATCIPPTTPPAAETLKDA
                     LVTSPFSCALEPEKNRCVNGGGTCHVVHDGYYTTNILCVLVGVVTFVLFIKPAVLKLQ
                     GLPLRAWRVASGNRS"
     gene            <1053757..>1054806
                     /locus_tag="ACHE_70340S"
                     /db_xref="GeneID:66985855"
     mRNA            join(<1053757..1053802,1053854..>1054806)
                     /locus_tag="ACHE_70340S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282662.1"
                     /db_xref="GeneID:66985855"
     CDS             join(1053757..1053802,1053854..1054806)
                     /locus_tag="ACHE_70340S"
                     /note="COG:S;
                     EggNog:ENOG410PNBY;
                     InterPro:IPR018464;
                     PFAM:PF09496;
                     go_component: GO:0000776 - kinetochore [Evidence IEA];
                     go_process: GO:0034508 - centromere complex assembly
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140019.1"
                     /db_xref="GeneID:66985855"
                     /translation="MESDLDADISSIRAEIRALQSRKRFLSSSLLASDALQKHFSDPD
                     TLSSAKSQLQLAEASPLVQSANTHTESNHHRIAFSTTAFPFTDPSPHGSSGGGKDQNK
                     DKEKEKSLLGVRIDICARNGRFAKPYYVLLKRVPGPDGQRRLRVHRHTIPAFISMEKL
                     ERTYLPTPSQTEEQEQREEEEEELKPWKKKKRPNRKPDLHAFVRTLRRELVSWQKRRD
                     AVGLLREKLGVRNQDSDSEQDIFSDVKDGEGWLPINPMGLASLSPTALEARYVRLEWE
                     DGRVGRFKLSNTGMVERAVVIGDQGRDKILEAAMTGGDGRVESVLDRLGQYTTSKP"
     gene            complement(<1055171..>1056852)
                     /locus_tag="ACHE_70341A"
                     /db_xref="GeneID:66985856"
     mRNA            complement(join(<1055171..1055803,1055854..>1056852))
                     /locus_tag="ACHE_70341A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282663.1"
                     /db_xref="GeneID:66985856"
     CDS             complement(join(1055171..1055803,1055854..1056852))
                     /locus_tag="ACHE_70341A"
                     /note="COG:S;
                     EggNog:ENOG410PXPK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140020.1"
                     /db_xref="GeneID:66985856"
                     /translation="MSVYNPVDEDQYRKEVLLHPSEESELSSNQKLLDEAHQLGLKVP
                     ELEVTASLTASIASGLVDLSSSSPVLSSGSSTGRNSVCERPGTAHQQQQGQQQGQQQQ
                     DRPQKQHAHHEIPLDQITSSLSELTVSSRPVKSGSVRSIASLSTRPTSYCSSDGKLAP
                     AGSDGATARASPVAVHNNRHSMISLTPGEKKQKRRESLKSAIDKFPFRRKRTSSAVLL
                     PPEAQITVTKGEQGEEKVYVESKPSEAQSSQPTSAPNNGEDSVMKLEIPVFDHESLQR
                     SLVNAELVKMREAHRLERNRHVTFQAAFMSRLRSRQQASVADRLAENKRTEEEKREKN
                     TANAIKMEERQLAVEMEQQREFDRAKQNARTRIKHMEGYFNNRSPPSSPGSGSEKPAF
                     QRKYTSQQKAQLAQEYHDHETMDQLHESKIKVLRERQERRLQEAIERFENELDAMIDK
                     HAEAFSELQKQHQQEELNVLQGFDARKTKLMHRWNLEEAILRRKLEQQHGQPYGPLPP
                     LTFNDSHYETRDSACCVAGSGDDEQMHQKGDGTMI"
     gene            complement(<1057841..>1058728)
                     /locus_tag="ACHE_70342A"
                     /db_xref="GeneID:66985857"
     mRNA            complement(<1057841..>1058728)
                     /locus_tag="ACHE_70342A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282665.1"
                     /db_xref="GeneID:66985857"
     CDS             complement(1057841..1058728)
                     /locus_tag="ACHE_70342A"
                     /note="CAZy:CE10;
                     COG:V;
                     EggNog:ENOG410PWZP;
                     InterPro:IPR029058,IPR013094;
                     MEROPS:MER0036039;
                     PFAM:PF07859;
                     TransMembrane:1 (o6-22i);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140021.1"
                     /db_xref="GeneID:66985857"
                     /translation="MSWFSYLYYKLVAVLIRALVRFRSRKRTVVPPDEVYRIPSRETG
                     RTIKTHIYRSSSAPKLSPVLINFHGSGFVIPMHGSDGPFCYQVSQETKYTVLDVQYRL
                     APEHPFPAALNDVEDVVNWVLNQPTEFDLSRVDISGFSAGANLALAASSTIYPRETFH
                     SVLAFYPPLDLFTDPAAKVSPDPTGKPIPPAAARMFDKCYIPSGMDARDPRISPYYSE
                     PDRFPDRVLMVTAAGDSLAGEAERLATRIGELPGREVVCQRMQGCNHAWDKSARKGTI
                     QGDATEKAYAMAIAMLSRD"
     gene            <1059892..>1061388
                     /locus_tag="ACHE_70343S"
                     /db_xref="GeneID:66985858"
     mRNA            join(<1059892..1059981,1060035..1060110,1060166..1060175,
                     1060231..1060415,1060471..1060530,1060577..1061227,
                     1061279..>1061388)
                     /locus_tag="ACHE_70343S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282666.1"
                     /db_xref="GeneID:66985858"
     CDS             join(1059892..1059981,1060035..1060110,1060166..1060175,
                     1060231..1060415,1060471..1060530,1060577..1061227,
                     1061279..1061388)
                     /locus_tag="ACHE_70343S"
                     /note="COG:S;
                     EggNog:ENOG410PND5;
                     InterPro:IPR039362,IPR039113,IPR040666;
                     PFAM:PF18388;
                     go_process: GO:0000045 - autophagosome assembly [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140022.1"
                     /db_xref="GeneID:66985858"
                     /translation="MALPAEPGDSKLTVFLRLPFPRGNFVDPPPIEWDATKDQALWDV
                     LSRPSKGDDIDWKTLAHSFGVTLQFLLQQAAWLYDRQLTQVRAQMRKVGTAQSSSPSP
                     MLGSTSGSAALGGQYKGQGSRPPPSRLTTQQKDAQPQRIIPRRTSSNATINQIKQRDQ
                     SRNATPTAEMKDPKPEGSGRRLSANIREQAPPAPTRRSPTLEEEDLSTSSSESESDEE
                     EELDSRRNPRFKRFGKFSMHRPGLRDDEEDDDDDSPAFLPYSRDVEHRPREHSGQDLN
                     ATLRLNTGSPDVYRRRSAEHPQTPRKFMAAESSMSSASSGVPVSHQPGDNSRQASQLA
                     SPRRSKEASDGTPSMGSSFSDLDATDVTQSALEEELLSMQGGMASRMSTISQALRSRY
                     L"
     gene            <1062175..>1063356
                     /locus_tag="ACHE_70344S"
                     /db_xref="GeneID:66985859"
     mRNA            <1062175..>1063356
                     /locus_tag="ACHE_70344S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282667.1"
                     /db_xref="GeneID:66985859"
     CDS             1062175..1063356
                     /locus_tag="ACHE_70344S"
                     /note="BUSCO:EOG09263YFX;
                     COG:H;
                     EggNog:ENOG410PGAA;
                     InterPro:IPR035929,IPR007085;
                     TransMembrane:2 (i158-177o183-200i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140023.1"
                     /db_xref="GeneID:66985859"
                     /translation="MTTPEEAESTYFNNYPPPKALPKHESLARAFINYHAEENRRVVL
                     VTSGGTTVPLENQTVRFIDNFSAGTRGATSAEYFLQEGYAVIFLHRQFSLLPYSRHYS
                     HSTNCFLDFMDEGVPSGDCSNSTSPDHGPIVVRSEYQDQMRDVLRKYRYAKKNNRLLL
                     LPFTTIAEYLFELRSLAKLMHPLGSKALFYLAAAVSDFFIPRDRMAEHKIQSSEVSSA
                     EQRQKSAGNNEQQQEGHSKKLVIDLDPVPKFLHRLVDGWAPEGSMIVSFKLETDPDLL
                     VHKAQTALQRYSHHLVIGNLLSTRKWEVVFVTPDPPYERWIRVPKSRRSKSISGSEAQ
                     VGLAEAKKRNQALSGAKEGQSGSGNEEGAAPGDTEGEGGIEIERLIIPELVKLHSRMV
                     K"
     gene            <1063895..>1065344
                     /locus_tag="ACHE_70345S"
                     /db_xref="GeneID:66985860"
     mRNA            join(<1063895..1064965,1065027..>1065344)
                     /locus_tag="ACHE_70345S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282668.1"
                     /db_xref="GeneID:66985860"
     CDS             join(1063895..1064965,1065027..1065344)
                     /locus_tag="ACHE_70345S"
                     /note="COG:S;
                     EggNog:ENOG410QEGN;
                     InterPro:IPR003378;
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140024.1"
                     /db_xref="GeneID:66985860"
                     /translation="MITPRLYRRRITWVASLVALFLLYHFFSLRSDLDAPAVAARTKT
                     SQNANASPNANANSNTNQKPNANNGEKEQDRPICPPLPGMEDVLVVLKTGVTEALDKV
                     PVHFQTTLRCIPNYVIFSDHDEEIAGVRVHDALRNMPDENLKQSIPDFNIYNRIRAMG
                     RAGLAQEDFSDVANSALGKPDNPGWKLDKWKFLPMAMGTYKHKSDAKWYVFMEADTYF
                     VWGSLLAWLEHFNPEDPLYIGTETQIADVIFAHGGSGFIVSNPAMKRVVDEYSVKSNE
                     IHAYTAGHWAGDCVLGKILLDVGVPLHFSWPMLQNTAVAELDEFSPDFYRRPWCYPAV
                     AFHHLSALDIQSLWEFEQKRYKESRKTLLLHGDVFKERIYPELSSDRSYWDNLSTEEH
                     SVAIDTYEDCQALCATAPQCAQFTFRAGRCYTNKTPKMGHSSADASSGWIMKRVDAML
                     ASAPKCRRPDFG"
     gene            complement(<1065450..>1067345)
                     /locus_tag="ACHE_70346A"
                     /db_xref="GeneID:66985861"
     mRNA            complement(join(<1065450..1065465,1065751..1066069,
                     1066115..1066197,1066246..>1067345))
                     /locus_tag="ACHE_70346A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282669.1"
                     /db_xref="GeneID:66985861"
     CDS             complement(join(1065450..1065465,1065751..1066069,
                     1066115..1066197,1066246..1067345))
                     /locus_tag="ACHE_70346A"
                     /note="CAZy:CE4;
                     COG:H;
                     EggNog:ENOG410PK45;
                     InterPro:IPR002509,IPR011330;
                     PFAM:PF01522;
                     TransMembrane:1 (i50-72o);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016810 - hydrolase activity, acting on
                     carbon-nitrogen (but not peptide) bonds [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140025.1"
                     /db_xref="GeneID:66985861"
                     /translation="MDTAESSEPSRLQRLKQSVDAVLLSLAIKLVRLEQKTPAARRIT
                     RFLDSLALPNMMLVFLLLASLFTIVSAAGGDPVVINSNVTNVDKRAPPQLIASPDATT
                     PSVQYGMNLMEAQLRYRDPFVIDTFEYSDRNDLGFWHGSGENLDVHYGVDTRRGGHYA
                     RLYPKDPDQNFHSQVSAVHCTNFMPFRERYLHVVFSGSNKFSISLNQNNPECRPGRNP
                     YPATWDTVEARRYLSGKNDIYVPMSHFAIDLSKIVSVSFNGFYSGESVTLHRIEIVRV
                     LPTGASVPLKLPNGQMILKCSRPNSFAFGIDDGQPRFAQEVMNILEEEKVLVTFFVVG
                     KGLRDKETNFTQVYREMLRRGHQVALHSNTHQKMEALDDEDIEDEILENIDAFKDHLG
                     IQSRYFRPPYGTIGARTRQILATRLLDPYIVNWSVDVEDWLWADTDTPERQIEAFTRD
                     ITKGGNLAVMHYLSPSTVAYFRQFIHTVKSAGMNIMRIDQCLEDPNAPPLNPNNF"
     gene            complement(<1067884..>1070555)
                     /locus_tag="ACHE_70347A"
                     /db_xref="GeneID:66985862"
     mRNA            complement(join(<1067884..1068236,1068296..1068444,
                     1068496..1068689,1068744..1068895,1068947..1069026,
                     1069092..1069452,1069508..1069643,1069701..1069758,
                     1069823..1070251,1070524..>1070555))
                     /locus_tag="ACHE_70347A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282670.1"
                     /db_xref="GeneID:66985862"
     CDS             complement(join(1067884..1068236,1068296..1068444,
                     1068496..1068689,1068744..1068895,1068947..1069026,
                     1069092..1069452,1069508..1069643,1069701..1069758,
                     1069823..1070251,1070524..1070555))
                     /locus_tag="ACHE_70347A"
                     /note="COG:A;
                     EggNog:ENOG410PFY4;
                     InterPro:IPR027417,IPR001650,IPR014014,IPR014001,
                     IPR011545,IPR000629;
                     PFAM:PF00270,PF00271;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140026.1"
                     /db_xref="GeneID:66985862"
                     /translation="MRSDCSPKLLLSSSNRVSFDPDVSKMDSFDVSDMNNAVQEVETN
                     GQTNGHSKVNAEAASLARSKGWAAPETYDYSKYVAPVGPAAGPDGPAAPAADSEFAGE
                     PPAAEGLPEWAGNAAKYEWRDEYGDVGPEIPELEEMLFRNEFINRTGLKISNLQNIEV
                     VAESRERPNPVRNFDDAGLHPIMRENIRLCRYDVPTPIQAYSIPAVLTGHDLIAIAQT
                     GSGKTAAFLIPVLSQLMGKAKKLAAPRPNLAAGFNPSTDAVRAEPLVLIVAPTRELST
                     QIFDEARRLCYRSMLRPCVAYGGAPVRDQREELQKGCDILIATPGRLLDFMGQPHVLS
                     LSRVKYTIIDEADELLQSDWEDDFNRIMSGGDTNEDADHRYMMFSATFNKACRQLARK
                     FLTEDHVRVRIGRPGSAHINVDQNIIYAEDSLKKKCLYDLLLSMPPSRTLIFVNTKTQ
                     ADFLDDYLFNMGLPSTSIHSDRTQREREDALRAFRTARCPILVATGVSARGLDIKNVM
                     HVINFDLPRAMNGGVTEYVHRIGRTARIGNEGLATSFYNEDKDAELAPDLVKILMESK
                     QRVPDFLEAYKPMEEAVTFNDDTDDEDENGDDNANGGAWGGIQMGDSNEVPSSNWGAA
                     TDSAWGEPPEATGEPNVGGASWD"
     gene            <1072022..>1073545
                     /locus_tag="ACHE_70348S"
                     /db_xref="GeneID:66985863"
     mRNA            join(<1072022..1072291,1072408..1072690,1072749..>1073545)
                     /locus_tag="ACHE_70348S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282671.1"
                     /db_xref="GeneID:66985863"
     CDS             join(1072022..1072291,1072408..1072690,1072749..1073545)
                     /locus_tag="ACHE_70348S"
                     /note="BUSCO:EOG09262IP2;
                     COG:H;
                     EggNog:ENOG410PFR3;
                     InterPro:IPR004567,IPR043129;
                     PFAM:PF03630;
                     go_function: GO:0004594 - pantothenate kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0015937 - coenzyme A biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140027.1"
                     /db_xref="GeneID:66985863"
                     /translation="MSPPDRISTVFDSTPGSKHAYKSSADFRSGRLNAIANPGAVKIN
                     VEGAFIVDEEPRSRSRSPIEAEGVHYESQDIRLPHHTGVVSHVAVDIGGSLAKLVYFT
                     RELDSADNGGRLNFINFETHRIDLCIDFIRQLNEEHEKLNGSSQDELCVVATGGGAYL
                     YYDKLKEALNVNVKREEEMQCLITGLDFFITEIPNEVFTYSDTDPEPMKFAEARPDVY
                     PYLLVNIGSGVSMIKVSGPKEFQRVGGTHLGGGTFWGILSLLTGARTFDDMLAMADSG
                     DNSGVDMLVGDIYGMDYSKIGLKSTAIASTFGKVFRMKNAAERNAEDGEGLSPRDPEH
                     PEDDVKFRPEDMSRSLLYAISNNIGQIAYLQSEKHEVKHIYFGGSFIRGHRQTMNTLS
                     YAIRFWSKGEKQAYFLRHEGYLGAVGAFLRRQPANWGRRNSLDDATAPLTFKEALLS"
     gene            complement(<1074423..>1075834)
                     /locus_tag="ACHE_70349A"
                     /db_xref="GeneID:66985864"
     mRNA            complement(join(<1074423..1074971,1075022..1075345,
                     1075401..1075436,1075492..1075589,1075649..1075660,
                     1075726..>1075834))
                     /locus_tag="ACHE_70349A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282672.1"
                     /db_xref="GeneID:66985864"
     CDS             complement(join(1074423..1074971,1075022..1075345,
                     1075401..1075436,1075492..1075589,1075649..1075660,
                     1075726..1075834))
                     /locus_tag="ACHE_70349A"
                     /note="COG:C;
                     EggNog:ENOG410PG0F;
                     InterPro:IPR036621,IPR017449,IPR023395,IPR004154,
                     IPR018108,IPR016061;
                     PFAM:PF03129,PF00153,PF09180;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0004827 - proline-tRNA ligase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006433 - prolyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140028.1"
                     /db_xref="GeneID:66985864"
                     /translation="MSSEVDVKVPNLPVDWMETAKGLTAGAAGGITQVLIGQPFDIVK
                     VRLQTQTGGTALSAARGIWAREGVLAFYKGTLVPLLGVGACVSIQFGTFQGFRQLIEH
                     YNYRKSGSHGGDLPLGQFYLAGVAAGVTNSVVSGPVEHIRIRLQTQPHGKDRLYTGPW
                     DCVRKVVRMAGVSGLYRGQAVTLLRGISWIRSVWALPLALVRRSKTKPCEPLRQFEGS
                     EYSPGWKFNHWELKGVLVRLEMVPKVLKGGFVSTARRDTGEKGRMPIYNAATEIPVLL
                     ETIQSDMYTSALEGFRNTVKIVKHWALFTPAIDKKHLCLIPFCLQEECEDRIKKLSER
                     AADGQPQEQEDTRAPSMGAKSLCIPFKQPTELKGSSTNHDA"
     gene            complement(<1076632..>1076880)
                     /locus_tag="ACHE_70350A"
                     /db_xref="GeneID:66985865"
     mRNA            complement(<1076632..>1076880)
                     /locus_tag="ACHE_70350A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282673.1"
                     /db_xref="GeneID:66985865"
     CDS             complement(1076632..1076880)
                     /locus_tag="ACHE_70350A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140029.1"
                     /db_xref="GeneID:66985865"
                     /translation="MDDAKVLAAGLAYNAGVAVVAACAHTIRDLAIQITEHLSGSGVM
                     QGSKFGMLQGGVGDGFWVTRKELNDVRRQTCFLQDLLL"
     gene            <1076949..>1077599
                     /gene="PUT2_1"
                     /locus_tag="ACHE_70351S"
                     /db_xref="GeneID:66985866"
     mRNA            <1076949..>1077599
                     /gene="PUT2_1"
                     /locus_tag="ACHE_70351S"
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /transcript_id="XM_043282674.1"
                     /db_xref="GeneID:66985866"
     CDS             1076949..1077599
                     /gene="PUT2_1"
                     /locus_tag="ACHE_70351S"
                     /note="COG:E;
                     EggNog:ENOG410PG3T;
                     InterPro:IPR015590,IPR016161,IPR016162,IPR016163;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="XP_043140030.1"
                     /db_xref="GeneID:66985866"
                     /translation="MLRCLPADVSESVWPEFKDQLAQETGELKMGKPEKFDNFIGPVI
                     HERSWEKLVRVIKDAKKDPSVTLLAGANTSREVGWFVKPTIFQVQDPSHSLMKNEFFG
                     PILSVYVFPDSNYEETLSLVDSSTNFGLTGAVFAKDQSAIEAAEQHLRHSAGNFYINC
                     KSSGALVSHQPFGGSRASGTNDKATSTNLVARFASIRSIKEGFQLADEVMYPSNEV"
     gene            complement(<1079225..>1080454)
                     /locus_tag="ACHE_70352A"
                     /db_xref="GeneID:66985867"
     mRNA            complement(join(<1079225..1079279,1079326..1079372,
                     1079446..1079873,1079927..1080076,1080133..1080197,
                     1080250..1080369,1080423..>1080454))
                     /locus_tag="ACHE_70352A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282676.1"
                     /db_xref="GeneID:66985867"
     CDS             complement(join(1079225..1079279,1079326..1079372,
                     1079446..1079873,1079927..1080076,1080133..1080197,
                     1080250..1080369,1080423..1080454))
                     /locus_tag="ACHE_70352A"
                     /note="COG:S;
                     EggNog:ENOG410PUGV;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o271-290i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140031.1"
                     /db_xref="GeneID:66985867"
                     /translation="MVASNPRSSNACETCRRRKVKCSGEQPCDACVKHGWECAFGRTG
                     RRRYSEAHVQRLLERIQSYEERYGTDCNGCSASPPVAPVDNPHRPPPQPGPVTLGYNA
                     ASDQPQESIPYEDSVTGISPATDLTSGPAFESQVRFLLDLSKPCPSPASVIYSSQRIP
                     CGSRAQWASVRTLLNHTDEPPIPSLEASQQLLDQFLFYLGVSKHFFDSRSFSDSMVLL
                     FQTPESREQQKRTSWFTEYLLVMAMAKLMDVEPSSCQPPGSDLFAEARPISNGAIASM
                     MLIFIKLLANWAGIAPRHRAGM"
     gene            complement(<1080917..>1082116)
                     /locus_tag="ACHE_70353A"
                     /db_xref="GeneID:66985868"
     mRNA            complement(<1080917..>1082116)
                     /locus_tag="ACHE_70353A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282677.1"
                     /db_xref="GeneID:66985868"
     CDS             complement(1080917..1082116)
                     /locus_tag="ACHE_70353A"
                     /note="COG:E;
                     EggNog:ENOG410PHWR;
                     InterPro:IPR002872,IPR015659,IPR029041;
                     PFAM:PF01619;
                     go_function: GO:0004657 - proline dehydrogenase activity
                     [Evidence IEA];
                     go_process: GO:0006562 - proline catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140032.1"
                     /db_xref="GeneID:66985868"
                     /translation="MVVKFVTTRSLGLPRGPKLAIRFLQYRAKSTQAVPSKDHFRRIA
                     PPPPPPHFLLPNKMLLRALLVATVSSHSWLLKPALRVLSLLAHPRVSLLDVNKNPLLR
                     QILKMTFYNHFCAGESGAGVQSTIRKIKDMGFRGGDFDLRERIVIGASASKTKDFPTS
                     QNSHSESAQHPDIAAWRESVLETVALDLMREYNQKGVAVVYNTYQAYLKSTPVNLLSH
                     LELAEKEGFTIGIKLVRGAYIASEPRALINDTKPETDHLYNTMAEGIIRRQYGSFGSG
                     DRPFPSAGLFLATHNKKSVLKADQMSQEQLSLKRPMTKTQYGQLLGMADGFSCRLLQL
                     GQEMSKTPRQTSPEVFKCLSWGTLKDCLSYLLRRAVENRDGVGRTKEEYLLLKQETMR
                     RLKRGFM"
     gene            <1082530..>1083103
                     /locus_tag="ACHE_70354S"
                     /db_xref="GeneID:66985869"
     mRNA            join(<1082530..1082620,1082748..>1083103)
                     /locus_tag="ACHE_70354S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282678.1"
                     /db_xref="GeneID:66985869"
     CDS             join(1082530..1082620,1082748..1083103)
                     /locus_tag="ACHE_70354S"
                     /note="COG:Q;
                     EggNog:ENOG410PK0J;
                     InterPro:IPR006680,IPR032466;
                     MEROPS:MER0005900;
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140033.1"
                     /db_xref="GeneID:66985869"
                     /translation="MTNPWTKPWLPRTPAPGIAFYNANLTDVEAGLIDCHVHLTTTPS
                     SFSLKDLYAINPNTVAHRTAYVAREMLLRGFTTVRDTGGADAALRDAISESLIVGPRL
                     FVAGKALSQTGKHGDFRASDQGDEPMCCGRHSPALARICNGNPEMS"
     gene            complement(<1084151..>1085101)
                     /locus_tag="ACHE_70355A"
                     /db_xref="GeneID:66985870"
     mRNA            complement(<1084151..>1085101)
                     /locus_tag="ACHE_70355A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282679.1"
                     /db_xref="GeneID:66985870"
     CDS             complement(1084151..1085101)
                     /locus_tag="ACHE_70355A"
                     /note="COG:F;
                     EggNog:ENOG410PNJY;
                     InterPro:IPR029062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140034.1"
                     /db_xref="GeneID:66985870"
                     /translation="MVQVHIAVLDTDVPCYRVYAKRGLYSSQFRRLLQGAAKRLNQSS
                     QPLKHGKLDVHVTAFDVIGGSLPSLGCLRADSLSGRDPYIDAQPKPIDAILVTGAAAA
                     SYDDLFWIPPLQSFLQTVYTKFPLVKIFGSCFGHQLIAKALLGSDEQSMGEESSVKVC
                     VQPMQHGHEIGVQPISLNPEFAWKFPPLHRFLPSSPFQIQLIHGDAVVSYLQAATDRR
                     EPDVSLPERWINVGSSELCSIQGLYYPGRVLTLQGHFEFDAFATAELCHQFAHAFKWP
                     LSLLASHLDQIHRSSRPDEEDDDDSRVAAEVVLLFLAGED"
     gene            complement(<1086438..>1087821)
                     /locus_tag="ACHE_70356A"
                     /db_xref="GeneID:66985871"
     mRNA            complement(join(<1086438..1087241,1087300..>1087821))
                     /locus_tag="ACHE_70356A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282680.1"
                     /db_xref="GeneID:66985871"
     CDS             complement(join(1086438..1087241,1087300..1087821))
                     /locus_tag="ACHE_70356A"
                     /note="COG:L;
                     EggNog:ENOG410PY1H;
                     InterPro:IPR012337;
                     TransMembrane:1 (i21-42o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140035.1"
                     /db_xref="GeneID:66985871"
                     /translation="MVKERQQKLLQRLPPGGKLSIALDCWTSPFCQAFMAITGYFIDQ
                     EWNYCEILLGFEPLYGTHTGSNLSSVLFNILQEHNVTDRVLSITTDNASNNNTMMSSI
                     QASVQAQNLNSDTIIIRVPCIAHVIQLSLNQLLGKMKANPVNDTTETEWLDACTHSLH
                     TRYQTKEIADTLNKVRSLAIFINASPQRREAFLDLQTKQPKLVPYQDVRTRWNSTFLM
                     LRRAKQLQPIFDEYCMMHQYLHFKLNKEEWRQIEYLLWVTQPFFQFTTALSKTKDVTV
                     HLIFGIYNKLFDHLEASIQQLQRKKVPWKKTMLDALEAARSKLSDYYGNTDNELHGDI
                     FAISTIMAPSNKLQFFSTKDWEDDTIDYCARYRNSLDNYLERYKKQLSDKHILPMHQP
                     STSPTSELEMLLNSTTPRSQHSQTRKNNDELTQYLERGQCLFYVLDDYD"
     gene            complement(<1090095..>1090463)
                     /locus_tag="ACHE_70357A"
                     /db_xref="GeneID:66985872"
     mRNA            complement(<1090095..>1090463)
                     /locus_tag="ACHE_70357A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282681.1"
                     /db_xref="GeneID:66985872"
     CDS             complement(1090095..1090463)
                     /locus_tag="ACHE_70357A"
                     /note="COG:E;
                     EggNog:ENOG410PMF9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140036.1"
                     /db_xref="GeneID:66985872"
                     /translation="MFAAGAQQAAANTQSLLEMLQHSQVSNLPAYGAKVAAAILGSED
                     FTQVWYTDLITELSGSVYETGTVFSIDPKWHVDSPRGPLTLSLTRTTRCSGDMELSYS
                     TAGDVWLLRTTVGNCGQTSR"
     gene            <1091744..>1093299
                     /locus_tag="ACHE_70358S"
                     /db_xref="GeneID:66985873"
     mRNA            join(<1091744..1092125,1092203..>1093299)
                     /locus_tag="ACHE_70358S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282682.1"
                     /db_xref="GeneID:66985873"
     CDS             join(1091744..1092125,1092203..1093299)
                     /locus_tag="ACHE_70358S"
                     /note="COG:I;
                     EggNog:ENOG410PH39;
                     InterPro:IPR009450;
                     PFAM:PF06432;
                     TransMembrane:8
                     (i153-181o187-205i304-323o335-353i365-383o389-406i413-
                     434o440-467i);
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0017176 - phosphatidylinositol
                     N-acetylglucosaminyltransferase activity [Evidence IEA];
                     go_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140037.1"
                     /db_xref="GeneID:66985873"
                     /translation="MPSLLGSPPIPPSVPDESHPNQVGGSRSHSPGEQRALPDPNRLA
                     PEDAYYAPSLLKARAAAAAKATHDDSLRTLKGNGNSAAVATLRPLSAVPKPDAEKDVR
                     TVRGASRRRRRRKGAWKKLLWVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADS
                     TVIVQHVCSVVIFICCFVGIVQGRVSPVSVVCWGSVGTAVGWILWDAWAKADESASGP
                     ERVVEGDTGSSSSSVVDHPSGTGQKDSQVQGLGLSMGSSLPGPNRYGDSRVSESISPT
                     ANAIHQYPIPPEPSRPLRLSSRNRQRLSTVKSAFLIYFALLGLSPILKSLTKSTASDS
                     IWAMSCWLLIMNIFSFDYGSGEGAGATKFPASLSTNAAVMASTVLASRLPSTTHVFSL
                     MLFSIEVFGLFPIFRRQLRHISWTGHIFLTLTLVIAAGGAVGCTLRGGWAAAVVGSIL
                     GSILTALAMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWD"
     gene            <1094962..>1096381
                     /locus_tag="ACHE_70359S"
                     /db_xref="GeneID:66985874"
     mRNA            join(<1094962..1095038,1095090..1095992,1096063..>1096381)
                     /locus_tag="ACHE_70359S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282683.1"
                     /db_xref="GeneID:66985874"
     CDS             join(1094962..1095038,1095090..1095992,1096063..1096381)
                     /locus_tag="ACHE_70359S"
                     /note="CAZy:GH18;
                     COG:G;
                     EggNog:ENOG410PI4X;
                     InterPro:IPR036861,IPR011583,IPR001223,IPR017853,
                     IPR001002,IPR001579;
                     PFAM:PF00187,PF00704;
                     SECRETED:SignalP(1-17);
                     go_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     go_function: GO:0008061 - chitin binding [Evidence IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140038.1"
                     /db_xref="GeneID:66985874"
                     /translation="MMKHILLGLLAAQTALSTRFVMYIDQYHTKDLPGKNLTEGITHA
                     VMGFAKSDLFTSESSPHYEPFEPVSTMRDRFSPDTKVLFAIGGWGDTEGFAAGAKDDT
                     SRQQYAKNVAAVVEENGFDGVDIDWEYPGGNGENYKDIPNEEKTGEIDAFPKLLEAIK
                     KELPEGKILSIATPGKKGDMIAYTDENGPKIAESVDMVNVMSYDLANRRNNVTKHHSS
                     VEDSRETIKAYKGIGLPAGKLNLGFAYYAKWFMTAKDADCKAHPLGCEMQELETPDGK
                     DTGKSGVLTFEKGTMATPNKDDLKESTDGSCGYGTMTTCPEGQCCSQYGTCGTTDAHC
                     QAGCLSDYGTCKGLSIIDSWRRADKDGQLDEKAGGQYYFDGEEDLFWTWDTPEMIKRK
                     FKDIVDEEKIGGVMAWSLGEDTLDFAHVKAMQEGVKERSA"
     gene            complement(<1097346..>1098884)
                     /locus_tag="ACHE_70360A"
                     /db_xref="GeneID:66985875"
     mRNA            complement(<1097346..>1098884)
                     /locus_tag="ACHE_70360A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282684.1"
                     /db_xref="GeneID:66985875"
     CDS             complement(1097346..1098884)
                     /locus_tag="ACHE_70360A"
                     /note="COG:G;
                     EggNog:ENOG410PKV4;
                     InterPro:IPR005828,IPR003663,IPR036259,IPR020846;
                     PFAM:PF00083,PF07690;
                     TransMembrane:12
                     (i7-25o65-85i94-113o119-140i152-170o182-203i268-291o311-
                     331i338-357o369-394i415-432o438-455i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140039.1"
                     /db_xref="GeneID:66985875"
                     /translation="MLQGRALQIAQVALIVAPAFILFGYNQAGVGPLATLQSWVHTFP
                     EIDATNTEGALKSHNSTSKGAVVASFQIGALIGALSCALLSERIGRRKTIFLGGILYI
                     IGQVLQTAAYGVEQFTVGRVILGIGIGQFSVAVPVWQSECSSAKNRGQHVVTDGIFIC
                     LGYALCNWIDFGLSKASGTIQWRVPLAISFVWVLMIMCSVFFLPESPRWLVRVNRSEE
                     ATASLAQYKGLPEDDETIRLEIVGIETSLEMAQQSISFKEMLANKDGERLLWRFFLCM
                     ALQFFQQMCGGNLISVYASTIFEENLGLSSDLSKILAACALTWKFLCSFIAYVTIDRL
                     GRRAVFMISGTGMCVCMIVLAITNSFGSDNKKASIVSALFIFLFNSFYPIGFLGGNFL
                     YCTEIAPVKLRVAMSSMSTANHWLWNFVVVMITPVALDTIGYQYYIMYAVISACIPII
                     VYFWYPETMNRNLESINHVFRDASSTWKIVSMARHLPQGEATEVAMMENSKEKFEVEQ
                     KETV"
     gene            complement(<1099353..>1100574)
                     /locus_tag="ACHE_70361A"
                     /db_xref="GeneID:66985876"
     mRNA            complement(join(<1099353..1099694,1099788..1100278,
                     1100340..>1100574))
                     /locus_tag="ACHE_70361A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282685.1"
                     /db_xref="GeneID:66985876"
     CDS             complement(join(1099353..1099694,1099788..1100278,
                     1100340..1100574))
                     /locus_tag="ACHE_70361A"
                     /note="COG:E;
                     EggNog:ENOG410PK25;
                     InterPro:IPR019818,IPR024084,IPR011829;
                     PFAM:PF00180;
                     go_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA];
                     go_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140040.1"
                     /db_xref="GeneID:66985876"
                     /translation="MSPYKIAVIPADGIGPEVVDAGIEVLQALAAKLNLSFEFTNYDW
                     NSETYKTTGAYIPAGGLDDLKRHDAILFGAVGAPDVPDHISLWGLRLAICQPFQQYAN
                     VRPTRILRGTQSPLRNCPPGSLDWVIVRENSEGEYAGQGGRSHRGFPWEVATETAIFS
                     RAGVERIMRFAFDTAAKRPKKHLTVVTKSNAQRNGMVLWDEVAAIVAKDYPQVTVEKM
                     LVDAMTTKMVLKPESIDTLVASNLHADILSDLAAALAGSIGIAPTSNLDPTRQHPSMF
                     EPIHGSAFDITGKGVANPVGTFWTVAEMLDWLGEEAAAQKLMECVEKVCEKGILTADL
                     GGSAKTKEVTAAVVGEIGGLS"
     gene            complement(<1107477..>1110063)
                     /locus_tag="ACHE_70362A"
                     /db_xref="GeneID:66985877"
     mRNA            complement(join(<1107477..1107706,1107765..>1110063))
                     /locus_tag="ACHE_70362A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282687.1"
                     /db_xref="GeneID:66985877"
     CDS             complement(join(1107477..1107706,1107765..1110063))
                     /locus_tag="ACHE_70362A"
                     /note="COG:E;
                     EggNog:ENOG410PM5M;
                     InterPro:IPR014746,IPR008146,IPR006680,IPR032466;
                     PFAM:PF00120;
                     TransMembrane:1 (o735-754i);
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004356 - glutamate-ammonia ligase
                     activity [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     go_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140041.1"
                     /db_xref="GeneID:66985877"
                     /translation="MDSLKHLIQSHPLIDNHAHNILSRPSATNYTKYPFEQITSEAHG
                     PALQNAPSTLPLLRAANQLAELYGCAPDWTAVKAARDELVQRDYEGLVRRCLEGTHAV
                     LLDDLLSDEDVEGFEWHDRFTVSETKRIVRIESVAEKVLAGLPKDDGSSLEKLRGEFV
                     RLISEAIADSKVVGFKTVVCYRTGLNVQQPAEDAVVGALSRTLQQDGSYRVEDKALND
                     WLVLQTLDLLKEAKVSSGVNKPLQLHTGLGDADISLILANPAYLQPVIAQYPEVDFVL
                     LHSSYPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQESIVRDSLDIVPSTRLLWSTD
                     GHYFPETFWLGNKQFRQALETVLVDYVNRGDYTIEQAKNTAAEILFHNSNKIYNLNQQ
                     PQYTSSLPVRSSLSSIDALYAFMRANPDVKYIWMQWVDYTATIRVRIFPILEFAKIVR
                     KQRRIGISLAVFWMLQDDTVTPEGSTTGQFYMEPDLSSLRRNVGIDSKSATVMTYWRS
                     EEGTELEGCPRTTLQNVTNKLKTEHDIDVTCGFEIEVVLMKPVTNANGDEDFVPCVRN
                     HSWSNMTSDTRRMVPLLEEISDSLASIGINLEQFHAESCPGQFEFILPPNSPVAAVDT
                     LLKARQVVVNVAEQHGLRATLYPRPIPKAAGTASHAHVSISPATKEDSFLAGVLEHYP
                     ALVSFTLSQDVSYDRVKAGIWAGSEWVTFGTQNRETPIRKISPGHWEIKSLDGLANMY
                     FAMAAFIAAGYVGITEQKELTNKDCQYDAATLNDTERAALGITTKLPKTLAQSLSAIE
                     SDRTLQDLLGPELVKNYCIVKRAESKKLSAMDEYSRRMWLMEKY"
     gene            complement(<1111469..>1113114)
                     /locus_tag="ACHE_70363A"
                     /db_xref="GeneID:66985878"
     mRNA            complement(join(<1111469..1111599,1111658..1112902,
                     1112956..1113043,1113094..>1113114))
                     /locus_tag="ACHE_70363A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282688.1"
                     /db_xref="GeneID:66985878"
     CDS             complement(join(1111469..1111599,1111658..1112902,
                     1112956..1113043,1113094..1113114))
                     /locus_tag="ACHE_70363A"
                     /note="COG:C;
                     EggNog:ENOG410PH7W;
                     InterPro:IPR015590,IPR016161,IPR016162,IPR016163;
                     PFAM:PF00171;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140042.1"
                     /db_xref="GeneID:66985878"
                     /translation="MAQLPFQLDDPSLLHFDSFVGNEWVQSKHGERFEVVDPGTNIPW
                     ASCPTNTSDDVDAAVKTAHTAFQQYRNVTPRQRAQWLLRWDTLIREAKPDIARILTHE
                     TGKPLAEAMGEIDYATSFTWWFAGEAERIHGTISASSMPNRRVLTVKQPIGVAVALVP
                     WNFPIAMILRKAGAAFAAGCTMIVKPSPETPIATLAVAHLAQKAGFPPGVFNVLTTDL
                     ANTPSLSENLCKHPLVKKVSFTGSTRVGKLIAGHCATGLKKVTLELGGNCPFIVFDDA
                     NLDLALDQLMALKWRHAGQACITANRVYVQAGIFDAFAQRLKERTNALVVGHGAKEGT
                     TMGPLTTPQGVDKARKQVEDAQKRGATVLCSGTVPENKEGYFFPPTILTGMTPEMLIS
                     QEESFAPIAALYKFDTEEEAVRCANDTSMGLASYAFTRDVNRVWRLMENLEAGMIGLN
                     TGNSSAAESPFGGIKESGYGKESGMEVAVNEYLVTKTGTLTVEQ"
     gene            complement(<1113947..>1117912)
                     /locus_tag="ACHE_70364A"
                     /db_xref="GeneID:66985879"
     mRNA            complement(join(<1113947..1114191,1114251..1117528,
                     1117584..>1117912))
                     /locus_tag="ACHE_70364A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282689.1"
                     /db_xref="GeneID:66985879"
     CDS             complement(join(1113947..1114191,1114251..1117528,
                     1117584..1117912))
                     /locus_tag="ACHE_70364A"
                     /note="COG:T;
                     EggNog:ENOG410QDWC;
                     InterPro:IPR004358,IPR003594,IPR003661,IPR036890,
                     IPR036097,IPR011006,IPR001789,IPR029016,IPR005467;
                     PFAM:PF00512,PF02518,PF00072;
                     go_function: GO:0000155 - phosphorelay sensor kinase
                     activity [Evidence IEA];
                     go_function: GO:0016772 - transferase activity,
                     transferring phosphorus-containing groups [Evidence IEA];
                     go_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA];
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA];
                     go_process: GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140043.1"
                     /db_xref="GeneID:66985879"
                     /translation="MDSSPRAQNDHHIGRRVRELYRYFQPEPSPQPTLVSSYFDSWAS
                     GDTLSSDNATVPAVSTASLSTPDPTAGLCAGPSPGEGLVLGNPNQTLSSFAQLAALRL
                     GVQRVLISVSDRDSQHILANSTALPIDSGQTDGWSDLSTSNHTWSICKVSMIPPGTVN
                     PGLCTEQHGPVKATVALPPSTRNPPQYRFLVIDDMSKDDRYASLPFVQGEPGFRFYAG
                     TPLTTETNINIGCFFVLDTQPRSELTDAEKETLGSLGMIIMDYLKISRQAHEGRRATR
                     LSRGLSCFVEGGRSLTEEVHPSYMGSPAFPNDNSNSRLGGSLDSGGPPSRRSHSSDTR
                     SISSESESKADSLPSEWGSSGHKGAPFDETQDTSWPFKRAANLLRECLELGGDGGVIF
                     LEAGNNCTLDSDSGSDSAGETGNPAPTLAISTLEDPFGPSTESKVTCPAMNLDRGFLL
                     RLFRRYSKGRLWGFHRDGMLSSSDDDDNDEPRVSRSRSLRSKTGDMPLPRSGKGKWKA
                     MENKLLNQYFPNACQVLFVPLWNAGNSQWFSGCFCWNTVETRVFSPNVELSSVLGFGS
                     SIMADYSRIQSLISDRQKGDFIGSISHELRSPLHGILAAAEFLQGTQLDEFQSSLLET
                     VNACGRTLLDTMNQVLDFSKIVSLERTWRNIKRHKASPLEVRGMEKVHLDSYVSTDLA
                     VLAEEVVEGVCMGHAYGQRATASAEQPVILPHTTARGRSQSQGDPSKRTDVEVMMDIA
                     HNNWVYRTQPGALRRILMNILGNAMKYTDFGRVSIRLEVTEVSESRLRRGSSGGAEDL
                     VTLTVSDTGRGISEEFMRARLYTPFAQEDSLAVGTGLGMSIVRSLVRALNGSVNTYSR
                     PGKGTMVKVTLPLERPQPEIKDAPESPAPQPSDKVTLTQARLLRDAFAGRRATILGVD
                     TVTAAQHPLWSVIAHYVTEWYGLELVSWPPPTSTPVNLVLADEQMLAVEQDTGFITSV
                     PALLVVCNKSVDYGTAKTKWAHLAHSVETIRQPSGPHKLARSIRKSLESVPDTSNTSM
                     SIVLPNRTTSQDTVFSQGSTGSLKDRRIDLTGVNLDLTTPPELTNSSSGGSTSSKSPE
                     SESEPPMPYTTTTGPLPLSSPYVEKDEQYLPTAPHSPTTTVTELPQIEFEGEPEPEVQ
                     DHAKARVLVVDDNSINLKLMMTFMKKRDLLALDAAENGKIAVDAVERMQGYDLIFLDM
                     SMPVMDGFEAARTIRSLEKENRTWRRATIIALTGLSSPRDEADALTSGVDLFLTKPVS
                     FKSVAGLVDEWEEKRRGTVKT"
     gene            complement(<1118943..>1121226)
                     /locus_tag="ACHE_70365A"
                     /db_xref="GeneID:66985880"
     mRNA            complement(join(<1118943..1119130,1119189..1120907,
                     1120965..>1121226))
                     /locus_tag="ACHE_70365A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282690.1"
                     /db_xref="GeneID:66985880"
     CDS             complement(join(1118943..1119130,1119189..1120907,
                     1120965..1121226))
                     /locus_tag="ACHE_70365A"
                     /note="COG:G;
                     EggNog:ENOG410PH2S;
                     InterPro:IPR020846,IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i160-183o203-222i227-244o256-279i286-309o315-335i501-
                     524o544-568i589-610o616-642i654-673o685-706i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140044.1"
                     /db_xref="GeneID:66985880"
                     /translation="MDSAWRRENNIEDKMTSGAMPHGAVSDEGAMENKPETSEDQARQ
                     VTPRWKRWLGGNSKDEESPEVKEPYRAKSTLGILSDKQTDEVPGTVLLLSHDRNEPLG
                     LRRQPERTAPSSFPQPNPPTRSPSRDPIKKTTDGVVLSPQPDDSANDPLNWPVWRRDA
                     ALLSLGFYSLLGGGMTPVLAAGFNNVAATYDVSTQQVAYTTGLYMLGLGVGSVIMSPT
                     AILFGKRPVYLLGATLFILSAVWCALSPDYASLVVARVFQGIAVSPVECLPSASIAEI
                     YFLHERAYRIGIYTLLLLGGKNLVPLVSAAIINSMGWRWVFWIVAIITGGCLVCLFFF
                     VPETFWDRTPRPHRHHKRPNLHRSVSNIISHGRRGRPPYAESLADKVEEEIQPPSPVA
                     RRHSDRHVEFDSHEKVEEGGHGGQEGDRITAISTTGAENRAADPEKPDHPNDPEAAKH
                     AGNDSPAPVTGAARYTNRLRERGPIPFAQYLRPWSGRIAHDKWLRVAVRPFILFAYPA
                     ILWSTAVYALSVGWLIVMSELVSHIYQGGSYNFTSLQAGLIYISPFVGGLIGTAVAGK
                     VSDIIVKFMTRRNGGVYEPEFRLVMGIPIALSTTAGLMAFGWSAQEKDAWIVPTIFFG
                     LVSFGCCLGSTTAITFAVDSYRQYAGEALVTLNWSKNVFHGLIFSLFVVDWMESDGAR
                     TVFLALGGIQLGCLLFTIPMYMYGKRARMWTVRKRLMEKF"
     gene            complement(<1122743..>1124803)
                     /locus_tag="ACHE_70366A"
                     /db_xref="GeneID:66985881"
     mRNA            complement(<1122743..>1124803)
                     /locus_tag="ACHE_70366A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282691.1"
                     /db_xref="GeneID:66985881"
     CDS             complement(1122743..1124803)
                     /locus_tag="ACHE_70366A"
                     /note="COG:S;
                     EggNog:ENOG410PXJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140045.1"
                     /db_xref="GeneID:66985881"
                     /translation="MASVLLPLIPRGRRSTGTSKTSVGLSPPKSASSTGDQSSKSKDR
                     PKGNEDNDVAVWLSIFFGNTDAEAPELDHARFNGRVPKETWEPRTQPYTNHIEKLLFD
                     TKEANRLSAQQSVHLKNPEAKLPIFFAAGKLAVRFSDEILSSQKGACRMCRRREVKCF
                     VFRPLSATKNGYLDLSDFEKMHRILRTIASHTTHFRKRAEVDWAIGNFASDRPYMCCL
                     AVPVCSLEDHCFREAMLSSQNYIMGVMEGSIKPRPLKEDIKRAKRKMTNTSVGRSFSS
                     TPGAMSPTGWMSPGWMSPTSPESSFGAYTTPPSSFSQLNDPAQKQPKLCTIGTTVFIG
                     RPDLQVRLPPQPGQLTCLVLSSTWPQTLLPTQSKNEADEAFDYCRIAGYHERHILETA
                     DYRCAICSDAVPARSLVHRPIAYIRTGRKELQDKQLRYALMRFAPYVEGRWNCPDTID
                     FFGGYSDAQVFDLVVPVCRSKSICEEVARTAAREFVKLFIPRDMKLVFPGLSPDTDLA
                     TIEFGDDLAYEGNPELLVKKIGPHALISETGDRGEDPMDCALTVTKLRRWYELCFKEE
                     VAKREYLKQIGYKRTGDISGSDSDSDDESVIDDSVIWVYERESRNDGAESHSSSSKTA
                     RPENQLSRETAIQRLENQMLFAPALNLDFLLLCEAVGNSWGLRDEDRESEGSSSTIRT
                     EWIE"
     gene            <1125657..>1127162
                     /locus_tag="ACHE_70367S"
                     /db_xref="GeneID:66985882"
     mRNA            join(<1125657..1126106,1126160..1127036,1127092..>1127162)
                     /locus_tag="ACHE_70367S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282692.1"
                     /db_xref="GeneID:66985882"
     CDS             join(1125657..1126106,1126160..1127036,1127092..1127162)
                     /locus_tag="ACHE_70367S"
                     /note="BUSCO:EOG092646CB;
                     COG:S;
                     EggNog:ENOG410PJC6;
                     InterPro:IPR001727;
                     PFAM:PF01169;
                     SECRETED:SignalP(1-18);
                     TransMembrane:6
                     (n3-13c18/19o202-225i232-252o264-281i368-389o409-430i442-
                     460o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140046.1"
                     /db_xref="GeneID:66985882"
                     /translation="MKVSQLLFLLPVISTVAADLAPNPANPTQPALAQRDVTNANGET
                     IGASKAGSKGALDAPVDEHAGHKQTGQGRTAEGHEKFDATVSSVEVGSGVTGTEKDAQ
                     GAGVASEKQSGEKKVPEGPKEAPPLPYSEQKKASEEGVSGKGTKGVPAKPSTPPETYD
                     IATPKSATSSKDTHTYTGTKGTSSTSKLELDEQPAADPLHSLIFSFTMIIVSEIGDKT
                     FLVAALMAMRHPRLLVFSAAFSALIGMTVLSAILGHGIPTLIPKTFTKFMAALLFFVF
                     GLKMLKEGREMSPDEGVGEEMKEVEMELEEKEQEQIRLGRRRSSVTPHSLEAGRGRSS
                     KNRMPSPPESLSSSSSRESSPSPGRRWDDMLVGLNNLFSLLLSPAWVQTFAMTFLGEW
                     GDRSQIATIAMAAGQDYWWVTVGAATGHGICTAAAVIGGSAIAGKVSMRVVTLGGATA
                     FLVFGVIYLIEAFYE"
     gene            <1127764..>1130446
                     /locus_tag="ACHE_70368S"
                     /db_xref="GeneID:66985883"
     mRNA            join(<1127764..1127839,1128042..1130280,1130347..>1130446)
                     /locus_tag="ACHE_70368S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282693.1"
                     /db_xref="GeneID:66985883"
     CDS             join(1127764..1127839,1128042..1130280,1130347..1130446)
                     /locus_tag="ACHE_70368S"
                     /note="COG:S;
                     EggNog:ENOG410PU4Z;
                     InterPro:IPR009057,IPR017877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140047.1"
                     /db_xref="GeneID:66985883"
                     /translation="MVVAVVVVVVSRGRDGGRGGGILRVKLDAIEESPAKTQTPQRRI
                     SNPVQVQGSPEDAVNMSGTTILPSEPETDLDPDMMIETLPSLEREANDVLHILVPGSV
                     DPVSIVNTAKKLRDPQNPQRKRLKRLMSNLDAETQYFGHQTYIDTKQVNPLLISALEK
                     KGTGTSREWSPDPILHKVNCARLALEVLLADASSGKKTESQRKAIHDLEGRFPSPFMN
                     ELGKGLQGGHGQSALEKDTFDLALEIRTQSLLVKLETHQNEDRFDPEAIVSGVFFDDV
                     MGDEDDSYQDGQEPPRGFNIKLFENENGRLPERFTEAVYDRVNEIRVTLAEEDDDGIR
                     GLQGAYRWQKFVLRVAQWIRKRENEINRDLKSQSDAETVREEYFSEPQRESSSFSRWS
                     SSPTAVREVSTIQTVPVKAPKEPVQKPEQKPVQEPVQEQTQEPVEPAQELGPVVGPAK
                     SERRKSYKSQWLNASMIERISQRQRRQTDYVRPVSQEKSPEASNRRQTLSGPVTAEPT
                     VPPESREIPASPENPPTFLQNEEDLFVDSSSHLQPHRGEPAPEKSHSPPMRRQTISIP
                     PNELPSSEEVWNAATKATPRLTANPRRKTPAAFVDRQEHARRVSPISLSDPHSAERRE
                     RPQPPASRKRQRTAEEDDDDDDEFSRYERAIDPSVKRAQKPDQSRHLKRPRVDDARRR
                     ERTSPPSSTAAAATTTTTATTSTDSKVRVRWSSEEDKRLMRLIRECGTSWSDLVRQNH
                     AEPVQEGEVRIEDRDQVQYKDRARNLKIIYYREGRQDELPKQFEYVTMSKRDKESLRK
                     RGIEID"
     gene            complement(<1130893..>1132021)
                     /locus_tag="ACHE_70369A"
                     /db_xref="GeneID:66985884"
     mRNA            complement(join(<1130893..1131686,1131745..>1132021))
                     /locus_tag="ACHE_70369A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282694.1"
                     /db_xref="GeneID:66985884"
     CDS             complement(join(1130893..1131686,1131745..1132021))
                     /locus_tag="ACHE_70369A"
                     /note="InterPro:IPR002889;
                     PFAM:PF01822;
                     SECRETED:SignalP(1-18);
                     TransMembrane:1 (n4-12c17/18o337-355i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140048.1"
                     /db_xref="GeneID:66985884"
                     /translation="MKNVAILALTTAASAAAANNCYQSLGAEPLVLPASTFLSNAYCQ
                     ALCLSRNYAFSGTKDGKECACVKELPSKDLKVDEKECSVPCPGYPADKCGGHDAWTVT
                     VPQAPSSGASSSSAAAPTASVVRRSDHPAWLDSGSSDSSSSDSSSDDSSSSDSGDTPV
                     AGVGPAVSATPSSDSSSSESTSSASSESTGSASASVEGGIVVDSEPTSSASSDSGSDA
                     AAATSSSSDSSEEKTTAAAAATTTAAGAATSTAAGSSASATGGSDSDSNTTQTTSIPN
                     TLLTAPSSTGSSSGASASPSSGSSSNSDSSSSSSSTSDSSSSSSSASASATPSGENAA
                     GRVGSSFSMVGAVMGVMVAYLL"
     gene            <1132533..>1134310
                     /locus_tag="ACHE_70370S"
                     /db_xref="GeneID:66985885"
     mRNA            join(<1132533..1132855,1132910..1134201,1134252..>1134310)
                     /locus_tag="ACHE_70370S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282695.1"
                     /db_xref="GeneID:66985885"
     CDS             join(1132533..1132855,1132910..1134201,1134252..1134310)
                     /locus_tag="ACHE_70370S"
                     /note="COG:E;
                     EggNog:ENOG410PHSC;
                     InterPro:IPR001261,IPR017141,IPR002933,IPR011650,
                     IPR036264;
                     MEROPS:MER0001269;
                     PFAM:PF01546,PF07687;
                     SECRETED:SignalP(1-24);
                     go_function: GO:0004181 - metallocarboxypeptidase activity
                     [Evidence IEA];
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140049.1"
                     /db_xref="GeneID:66985885"
                     /translation="MRSLLVILLPTALALPSFPFSASAQRPLQDTSEISCPLAPKIAP
                     DSDGFLSSLHFIQDEGIRAQQVERLSRAVQVDTSVGDAVTDRDNEAFAPFVDFQDLLR
                     DLFPLVHKTAQLDHINTHALLYTLPGKLPHLQPILFLAHQDVVPIDDPTDWTYPPFSG
                     HYDGTYIWGRGASDCKNTLIGLLSAIEDLLNQGFKPSRTVIFSFGFDEESHGFLGAGH
                     LAPELEKRYGKDSIALILDEGGNGVQVLPDDEDVVYALPAVGEKGALDLILELAVPGG
                     HSSIPPAHTGIGIMADIIHTLERKDLFVPELNEIHPTRKTLECQVVHSPEHIESWLGH
                     ALSTNDYRSLAEKLGQSRGDNFRVTLQTTQATDIIRGGVKSNALPEKISAVINYRVAL
                     HQTPDTVISRAVDLITPIVQGYNLSFSHPYSSGEGEGTINHLTLRPLSSPLVPAPLSP
                     TDVSADQIWTRFSGVARAVFESVPALKGKKVVVSGDVMTGNTDTRFYWNLSRNIYRWN
                     PSRERFLNNIHTVDEKQSIDTHLEGMMMYYDLIRAFDQWEETNEFAHEL"
     gene            complement(<1134487..>1136859)
                     /locus_tag="ACHE_70371A"
                     /db_xref="GeneID:66985886"
     mRNA            complement(join(<1134487..1134556,1134602..1134737,
                     1134784..1135130,1135177..1135760,1135812..1136254,
                     1136322..1136614,1136666..>1136859))
                     /locus_tag="ACHE_70371A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282696.1"
                     /db_xref="GeneID:66985886"
     CDS             complement(join(1134487..1134556,1134602..1134737,
                     1134784..1135130,1135177..1135760,1135812..1136254,
                     1136322..1136614,1136666..1136859))
                     /locus_tag="ACHE_70371A"
                     /note="COG:S;
                     EggNog:ENOG410PHIS;
                     InterPro:IPR033433,IPR032514,IPR014870;
                     PFAM:PF17168,PF16335,PF08760;
                     SECRETED:SignalP(1-19)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140050.1"
                     /db_xref="GeneID:66985886"
                     /translation="MNLYRLGLLVASLVSAVTAESTFTPARPPSLPLAVKSPYLSTWL
                     PAGQDGGNGGYLAGEWPRFWEGQIIGWAGIIRVDGNSYTWMGLPGTTTVNQTAYEYTS
                     TKSIFTMNVGGEVQLNLTFLSPITPNDLKRQSLVFSYLNVEVASLDGQSHDVQVYSDI
                     SAEWVSGDRSTAVQWDYGVTDDEVAYHKIQRQTQLLFSESRDQSEWGSWYWATHNGTG
                     VTYQSGNAEDVRSAFRKNGKLSNSKDNNYRAISTNWPVFGFSIDLGSVSSQTADRLFT
                     IGLDQQDAIQFSGATGTRAVPSLWTSYFKDGLAALDFFYHDYEEANKLSSEFDDRVAR
                     DSIAAAGQDYLTITSLSGRQAFAATQLTGTIEEPYLFMKEISSNGNMNTVDVIFPAHP
                     VFLYTNPELLLLLLKPLYEIQESGNYPNAYAMHDIGTHYPNATGHPEGNDEPMPLEEC
                     GNMVIMALAYALKSGNTTYLSDHYTKLTQWTNYLVQDAIYPANQISTDDFAGSLANQT
                     NLALKGIIGIEAMATISSITDHPDDSENRTTVAQDYIDRWQTLGIANNTEPAHTTLSY
                     GDNSSHGLLYNLYADRELGLNLVPQSVYDMQSSFYPTVEATYGVPLDTRHSYTKSDWE
                     LFAAAVASNSTRDMFIKDLATWINKTPTNRPMTDLYETSTGDYPGITFIARPVMGGSF
                     ALLILN"
     gene            complement(<1138556..>1141359)
                     /locus_tag="ACHE_70372A"
                     /db_xref="GeneID:66985887"
     mRNA            complement(join(<1138556..1138855,1138933..>1141359))
                     /locus_tag="ACHE_70372A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282698.1"
                     /db_xref="GeneID:66985887"
     CDS             complement(join(1138556..1138855,1138933..1141359))
                     /locus_tag="ACHE_70372A"
                     /note="COG:S;
                     EggNog:ENOG410PG1M;
                     InterPro:IPR037104;
                     go_function: GO:0005509 - calcium ion binding [Evidence
                     IEA];
                     go_function: GO:0005544 - calcium-dependent phospholipid
                     binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140051.1"
                     /db_xref="GeneID:66985887"
                     /translation="MSLQVNGPWSRGRSSSRTRERSKSRGARSRSRVSSAVPRTSKSS
                     LTSLDDNPPRSRSRGPRSSRAPSAVRGHRSKSRSRYDIDTEGGDGGNASDYYRRGTSR
                     RPRREYYHSGDEGDDGQEASYYLKSTPSTGSKFDKKAEESDDSSVDERLAYGDMPGER
                     KKSSNRRSKFWSTLRDSATELAQQAVAAQAAQNKPESPKPNLPPRPGSQPLPEAPGPG
                     YARPEPFKYGYASPQQHNYPTYPPTSSAMPSNWAPIPECEMPGFVPPSSQGEEHSSMP
                     GAFPPPETSQPATTGPPMPQYANPAPYTNAYVPHSAHYSASPVYSSTTGAYNPGSYAP
                     APHTSSGEGPPRPAYANLPPFQYAQIDPNIRYGSKNSSRPFSYPAVPQPSRPPAASSS
                     HQKPAPPPAAPAPPASRPPAAPAPPAPAAPTPPPKRPAKPQISVSTGQAPTTSNDHHY
                     VEITPGGRTRPPSNSVSSANLTVDRPDPSQRPASPLQEPYQGTYQTISPMPSPIVIPA
                     RPEDDFSDSETLDPKRTHRRKKSRDDRESKDEGSSRRERSRVRHERHSSTQSLEPDNV
                     LLISPGVSQNKRVSFYNPTRDALAMQEALSHTRHIDHKTLIHILPRLSDEEILDMRKE
                     YKHHVKVHGKGVNVAKHIHLKLGNTPFGKVCYATALGRWESEAFWANCYYQSGSSRRE
                     LLIESLMGRRNSEIRAIKESFRDSRYNDSLEKCMKSELKADKFRTAVLLALDEGRQSE
                     RQPMNEELIDRDVEELHRALISRDGGETAMIFIIVRRSDSHLREVLRTYEKVYRHNFA
                     KAMISKSPNLVGETLAHILNGAINRPMRDAMLLHQALHESQTGKERSELLISRLVRLH
                     WEPKHLEQVKHEFRRRYRERLEEAIAEEVLPINGGSEWGEFCIELARSCNKE"
     gene            complement(<1141656..>1142036)
                     /locus_tag="ACHE_70373A"
                     /db_xref="GeneID:66985888"
     mRNA            complement(<1141656..>1142036)
                     /locus_tag="ACHE_70373A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282699.1"
                     /db_xref="GeneID:66985888"
     CDS             complement(1141656..1142036)
                     /locus_tag="ACHE_70373A"
                     /note="TransMembrane:1 (o17-37i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140052.1"
                     /db_xref="GeneID:66985888"
                     /translation="MLFRKTILWRMTLYLRVWWNAAWAVWTWFIPLLLFFVRNLCILD
                     SHSEIAVPQAGISWYRPYEHMPSVILRDSLVQGSTKLFRDSPDGIHVHLCAIRASLLR
                     PTSFPRPIAALLNGPSVSRRPKTA"
     gene            complement(<1142499..>1144272)
                     /locus_tag="ACHE_70374A"
                     /db_xref="GeneID:66985889"
     mRNA            complement(join(<1142499..1143693,1143746..>1144272))
                     /locus_tag="ACHE_70374A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282700.1"
                     /db_xref="GeneID:66985889"
     CDS             complement(join(1142499..1143693,1143746..1144272))
                     /locus_tag="ACHE_70374A"
                     /note="COG:S;
                     EggNog:ENOG410PIU7;
                     InterPro:IPR030379,IPR027417;
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140053.1"
                     /db_xref="GeneID:66985889"
                     /translation="MATASPRSSTPGRGQELPPITENHSNSTSNSKDQRKSSSLGFLR
                     RSKSTEPLGERKLSGSRTKRSKTQAMEEERRQREAMPKQPPRLPDLSPTPRLETFGGD
                     DRPDSVAMFSARPYENTAAPGTALSSPAPSVYPDPYARTESMTHRGRFSYASSAVSTS
                     NNPRRLRRRKDPTPYNILVIGARNSGKTSFLNFLRKSLTMPPHKHPSRLPEEFEEIQR
                     HSGSNDGFTSHYLETDFDGERVGLTLWDSQGLERNIVDIQLRGVTNFLEGKFEETLNE
                     EMKVIRSPGVRDTHIHCTFLILDPVRLDENIAAAERAANGKPKRSDSPVVGILDKYLD
                     LQVLQTVLGKTTVVPVISKADTITTAHMAYLRKAVWNSLKQANIDPLEVLTLEDQEYT
                     SSESADEEETTPTESQHEGTQPEATPEATPEATPEAENPDQDKEASAMSKSEPVPSDE
                     KAESQNPPSERSRKSSGSEAVAKSLPFSILSPDPYSLEAGDEPVGRRFAWGFADPYNP
                     EHCDFVKLKNHVFNDWRSELREASRLIWYENWRTSRLNRNGIHAAPPQRKAYGGRMGP
                     FDGRRTR"
     gene            complement(<1145946..>1147342)
                     /locus_tag="ACHE_70375A"
                     /db_xref="GeneID:66985890"
     mRNA            complement(join(<1145946..1146324,1146380..1146541,
                     1146590..1146646,1146698..1147028,1147090..1147236,
                     1147300..>1147342))
                     /locus_tag="ACHE_70375A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282701.1"
                     /db_xref="GeneID:66985890"
     CDS             complement(join(1145946..1146324,1146380..1146541,
                     1146590..1146646,1146698..1147028,1147090..1147236,
                     1147300..1147342))
                     /locus_tag="ACHE_70375A"
                     /note="COG:S;
                     EggNog:ENOG410PIDW;
                     InterPro:IPR009291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140054.1"
                     /db_xref="GeneID:66985890"
                     /translation="MDLFGATDGLLGVFGSQQSNFSMYLTTMQLALKSLMFVSGVLSG
                     NTPPTDLSVTPIPSYVLEYAPLIWLHSQDPYRPSDIAQQLVHTTPMINWTAVQDLPAP
                     VTLSNLDSLNEHGNTSVFLTSKEGIDADPQPAWLYGDTFDQNNNTGDAVSSVVITRDH
                     GNGTLDAFYFYFYAYNEGNTVLGMEFGNHIGDWEHNMIRFQNATPEAIWYSQHASGQA
                     FTYDATEKQGKRPLGYSGNGTHATYSTPGNHDHTIPGLNLPAGFLVDKTDRGILWDPT
                     KSAYAYSYEPATKTFQAYDPSFPVNWLYYNGQWGDDALPGGPELFGQKKWAAGPNGPK
                     FKHLEREEVCPSHPCVVLPFRSWHEGEGVPDAKGAFDD"
     gene            complement(<1147743..>1148511)
                     /locus_tag="ACHE_70376A"
                     /db_xref="GeneID:66985891"
     mRNA            complement(join(<1147743..1148062,1148125..1148182,
                     1148247..1148379,1148441..>1148511))
                     /locus_tag="ACHE_70376A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282702.1"
                     /db_xref="GeneID:66985891"
     CDS             complement(join(1147743..1148062,1148125..1148182,
                     1148247..1148379,1148441..1148511))
                     /locus_tag="ACHE_70376A"
                     /note="COG:Q;
                     EggNog:ENOG410PND2;
                     InterPro:IPR023389,IPR014980;
                     PFAM:PF08883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140055.1"
                     /db_xref="GeneID:66985891"
                     /translation="MTDQFAYTYPSPLEGYENLEPLPEERNDDGKSFKNPQHGILSKA
                     YEEFPDPLSKGRRGGFDIHIYHFQNNPDQVTYARALWERIRREFPELRIYTFFDRPVG
                     PHPVAMFEVNLFTPAQFGAFIPWLVINRGPLSALLHPNTADSEEERNHTQRATWLGER
                     IPLDLRVFKLMKEREKREEEEREWEKKAVEGRL"
     gene            complement(<1148988..>1150352)
                     /locus_tag="ACHE_70377A"
                     /db_xref="GeneID:66985892"
     mRNA            complement(join(<1148988..1150152,1150222..>1150352))
                     /locus_tag="ACHE_70377A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282703.1"
                     /db_xref="GeneID:66985892"
     CDS             complement(join(1148988..1150152,1150222..1150352))
                     /locus_tag="ACHE_70377A"
                     /note="COG:S;
                     EggNog:ENOG410PPHP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140056.1"
                     /db_xref="GeneID:66985892"
                     /translation="MPPRPGAIGDLSDDDYVAQVLATEARDNSKRYALEGLGAYMPKK
                     PSGAAPKPNTRFLRHIIRETDNHNAALKRKEERDARERMRQLREQQAASSTSRDTRRH
                     RDQDQRESGGRNGERERRDDRQRGHRSHRRRHRSWSASEDRDGARARRHRRRHESEYE
                     RTKYRRRDRDDERDYSRRRRSYSRSRSRSPRDGQERDSRGSRRRHGRSYQSRSPSRSR
                     SRSPERTKRRHKEDGDRRNEHRSSLEHRSTHRSSQHPRRSSPTTTDRNQASDHDSDPL
                     EDLVGPLPQRDDGTAPMRSRGRGAYKPSHSTIDAHFAKDYDPTLDVQPDDDDPSSGNR
                     STRRPVAGLMTEDDDWELALEALRDRARWKQKGEERLRQAGFSESTVDRWKNNAAFTG
                     GDMEGHIEDVKWSKKGEGREWDRGKVFDEDGHVDVRASW"
     gene            <1150614..>1151554
                     /locus_tag="ACHE_70378S"
                     /db_xref="GeneID:66985893"
     mRNA            join(<1150614..1150838,1150910..>1151554)
                     /locus_tag="ACHE_70378S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282704.1"
                     /db_xref="GeneID:66985893"
     CDS             join(1150614..1150838,1150910..1151554)
                     /locus_tag="ACHE_70378S"
                     /note="COG:S;
                     EggNog:ENOG410PMYM;
                     InterPro:IPR037475;
                     go_component: GO:0031617 - NMS complex [Evidence IEA];
                     go_process: GO:0034501 - protein localization to
                     kinetochore [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140057.1"
                     /db_xref="GeneID:66985893"
                     /translation="MTEPNASEALSHLQSLENEHGDIKTHLSILRISEPISLESETES
                     QERSPSKRGSDVSALDNPTPSSLEADLTHYKELFSKLRFSYVEQVTKEKFLRAIVGDP
                     PLVVDNNENLRLETQLAEVKAELKARKEDVRVMIEEMEKKGRDLAARYKHIQLQGTQL
                     SELPESIANIESTIAGLRAKQVANMDDASSSQRLPLPATLSLLAEREAELAALNRQLA
                     TVQNALPRKTREAEAIERELGVLERRKTEEIAQAREAQRKKQQGESDGLEEMGRWYRG
                     AEETLKKIVGVRE"
     gene            complement(<1151791..>1152663)
                     /gene="RPS9"
                     /locus_tag="ACHE_70379A"
                     /db_xref="GeneID:66985894"
     mRNA            complement(join(<1151791..1152202,1152261..1152359,
                     1152439..1152457,1152543..1152580,1152650..>1152663))
                     /gene="RPS9"
                     /locus_tag="ACHE_70379A"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_043282705.1"
                     /db_xref="GeneID:66985894"
     CDS             complement(join(1151791..1152202,1152261..1152359,
                     1152439..1152457,1152543..1152580,1152650..1152663))
                     /gene="RPS9"
                     /locus_tag="ACHE_70379A"
                     /note="COG:J;
                     EggNog:ENOG410PG10;
                     InterPro:IPR036986,IPR022801,IPR001912,IPR002942,
                     IPR018079,IPR005710;
                     PFAM:PF00163,PF01479;
                     go_component: GO:0015935 - small ribosomal subunit
                     [Evidence IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_function: GO:0019843 - rRNA binding [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_043140058.1"
                     /db_xref="GeneID:66985894"
                     /translation="MAPVPRVYSKTYKVPRRPFESARLDSELKVVGEYGLRNKREVWR
                     VQLTLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRIE
                     DFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFAL
                     TSPYGGGRPGRVQRKKARAAEGGGEDGGEEDEE"
     gene            <1152930..>1153679
                     /locus_tag="ACHE_70380S"
                     /db_xref="GeneID:66985895"
     mRNA            join(<1152930..1152965,1153071..1153138,1153218..1153265,
                     1153355..>1153679)
                     /locus_tag="ACHE_70380S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282706.1"
                     /db_xref="GeneID:66985895"
     CDS             join(1152930..1152965,1153071..1153138,1153218..1153265,
                     1153355..1153679)
                     /locus_tag="ACHE_70380S"
                     /note="COG:J;
                     EggNog:ENOG410PHM8;
                     InterPro:IPR036948,IPR018259,IPR008991,IPR001147;
                     PFAM:PF01157;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140059.1"
                     /db_xref="GeneID:66985895"
                     /translation="MGHSHGLRRGTRYAFARNFKEHGQIRLSTYLKTYRVGDIVDIHV
                     NGAVQQGMPHKVFNGKTGVVYNVTKSSVGVLLYKIVDNRYIEKRVNVRIEHVKHSRSR
                     EDFIKRVKENAEKKRQAKEQGVHLHLKRQPAQPREAHTVEGATPETIAPVAYDTHI"
     gene            <1154573..>1155869
                     /locus_tag="ACHE_70381S"
                     /db_xref="GeneID:66985896"
     mRNA            join(<1154573..1154760,1154822..1155769,1155830..>1155869)
                     /locus_tag="ACHE_70381S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282707.1"
                     /db_xref="GeneID:66985896"
     CDS             join(1154573..1154760,1154822..1155769,1155830..1155869)
                     /locus_tag="ACHE_70381S"
                     /note="BUSCO:EOG09263HED;
                     COG:C;
                     EggNog:ENOG410PI6Y;
                     InterPro:IPR018108,IPR023395,IPR002067;
                     PFAM:PF00153;
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140060.1"
                     /db_xref="GeneID:66985896"
                     /translation="MSLPANPNTGTSQAYLATGNQSPQIGNDKLVQSRETGNVVPQRV
                     RPDEAETKPKPFAHFVAGGLGGMTSATLTSPLDVLKTRLQSDFYQAQLQALRASHPVP
                     PSSSITALPRLAILHFSETFQILRSIHVHEGWRALFKGLGPNLIGVVPARAINFAVYG
                     NGKRIISDYYDYRDAKETPVGVHLTAAAAAGIATGTATNPIWLVKTRLQLDKSNSEAG
                     KGRQYKNSWDCIKQTVRHEGIRGLYKGLSASYLGVTESTLQWVMYEQMKMFLGRREEE
                     KLVNPNHEYGYWDTVELWGGRIASAGMAKLVAAALTYPHEVVRTRLRQAPTVSTAEGK
                     VEMKYTGLVQCFKTVWKEEGMVGLYGGLTPHLLRVVPSAAIMFGMYELLLRAFGATS"
     gene            <1157853..>1158068
                     /locus_tag="ACHE_70382S"
                     /db_xref="GeneID:66985897"
     mRNA            <1157853..>1158068
                     /locus_tag="ACHE_70382S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282709.1"
                     /db_xref="GeneID:66985897"
     CDS             1157853..1158068
                     /locus_tag="ACHE_70382S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140061.1"
                     /db_xref="GeneID:66985897"
                     /translation="MNPDFQHIGGWVNGNTKRDSKREITSPADPRAPEMPQQSPSSKN
                     RSHMMDRFIEEGPKETPWSSAKMGSKP"
     gene            <1161323..>1162288
                     /locus_tag="ACHE_70383S"
                     /db_xref="GeneID:66985898"
     mRNA            <1161323..>1162288
                     /locus_tag="ACHE_70383S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282710.1"
                     /db_xref="GeneID:66985898"
     CDS             1161323..1162288
                     /locus_tag="ACHE_70383S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140062.1"
                     /db_xref="GeneID:66985898"
                     /translation="MPTPRACWRCSKTVGSWKEWFECIANHCRIPSTESDPLSRRGSR
                     DHGNNDGNNSGRPGGGEGNPPGKTFQDHVTGAGAQFDFFSDTGFSGTDCNYYGAAGTY
                     TSSGQTFEDGTNSDESSSAGSDAESPFFSFEESEPRPMEFLGSGLLHTGELPSTEHRS
                     RPNNRDPHISEMKRLSRAQTQFPEGISPDQSRSEQALVHKSADACSPTEASTSTHLAK
                     NERRPKLREKANVIRQLLVLQSAAAARSRRVTEVTEEIDVSLLDPKPNLTWLPKPATD
                     LIVLEPQWLLKQLIEPFLAECDASEKPSPFWLAASRFLESIVIHE"
     gene            <1163853..>1164152
                     /locus_tag="ACHE_70384S"
                     /db_xref="GeneID:66985899"
     mRNA            <1163853..>1164152
                     /locus_tag="ACHE_70384S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282711.1"
                     /db_xref="GeneID:66985899"
     CDS             1163853..1164152
                     /locus_tag="ACHE_70384S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140063.1"
                     /db_xref="GeneID:66985899"
                     /translation="MVPRLQIEECQSYIEKLDNRKGDPLEPEARLYLLTLLIVQYQGS
                     RETEERVTLATETWNHARIFSEKVVRMTLQCYQEFQSLCNKVQVLDVPHPSPTLS"
     gene            <1164404..>1165024
                     /locus_tag="ACHE_70385S"
                     /db_xref="GeneID:66985900"
     mRNA            join(<1164404..1164634,1164701..>1165024)
                     /locus_tag="ACHE_70385S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282712.1"
                     /db_xref="GeneID:66985900"
     CDS             join(1164404..1164634,1164701..1165024)
                     /locus_tag="ACHE_70385S"
                     /note="COG:A;
                     EggNog:ENOG410PFMB;
                     InterPro:IPR027417,IPR014001,IPR011545;
                     PFAM:PF00270;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140064.1"
                     /db_xref="GeneID:66985900"
                     /translation="MSSQKFSRREDDTGVLIYVAPTKALVNQIAAEIHARFTKKHPSN
                     SGQSVWVIHTRDIRFNDLMKCQVLVTVPHMLQIMLLSPANAKTGAPRVKCIVFDEIYS
                     IGQADDDLVWEQLLLLAPCRIIALSATVGNPTELADWISVTQKSLGIDLKLVQYGQRY
                     SDLGKYFSTPPKKDQVPGASSNDT"
     gene            <1165158..>1167093
                     /locus_tag="ACHE_70386S"
                     /db_xref="GeneID:66985901"
     mRNA            join(<1165158..1165876,1165933..1166497,1166761..>1167093)
                     /locus_tag="ACHE_70386S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282713.1"
                     /db_xref="GeneID:66985901"
     CDS             join(1165158..1165876,1165933..1166497,1166761..1167093)
                     /locus_tag="ACHE_70386S"
                     /note="COG:A;
                     EggNog:ENOG410PFMB;
                     InterPro:IPR027417,IPR001650;
                     PFAM:PF00271;
                     TransMembrane:2 (i244-263o516-534i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140065.1"
                     /db_xref="GeneID:66985901"
                     /translation="MVKHSSAEFPVPETLRPENHMPSSIRRSDVLEWERCLKDHLATW
                     MINPQSSFNEVRAELDTKFSSSDRLPKETATMGKDDMCDSLFPPLVNLHQQNALPALL
                     FNYERMACEQITESVLNKLCTAEGFYKDDTAWNRKMAEYQKYQASKAKKACEAGKRKS
                     SQDDLNPDPAEYERYAFDGFNPERSLEQFSFAGIRGQDWEELKKDIHKLKRFNINPVL
                     LEALTRGIGVHHAGLNRRYCHFVERLFRRGFLCVVIATGTLALGINMPCPTVVFCSDN
                     PFLTALNYRQASGRTGRHGFDLLGNVIFHGISLLEEYQVISSRLPDLNGHFPITTSLV
                     LRLCILLHNSDLSPYAVQAINSLLAQPRLWLGSVDSRDKMFHHLRFFIEYLRRQKLMR
                     RHGEPTYLARSVAHLYYTENSAFVFHALLREGYFETPKPQSLSQAFQSAEPETHLSGH
                     SDDFTSIKDLCKTVRSEVFLEESVIPHLTVYPDGDMPLLNVYLYDFVCHGNPQPLEVA
                     NNILGSDAWFLLNDFSLILATIIVALESEY"
     gene            complement(<1168055..>1169343)
                     /locus_tag="ACHE_70387A"
                     /db_xref="GeneID:66985902"
     mRNA            complement(join(<1168055..1168176,1168240..1168844,
                     1168898..>1169343))
                     /locus_tag="ACHE_70387A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282714.1"
                     /db_xref="GeneID:66985902"
     CDS             complement(join(1168055..1168176,1168240..1168844,
                     1168898..1169343))
                     /locus_tag="ACHE_70387A"
                     /note="COG:S;
                     EggNog:ENOG410PP6N;
                     InterPro:IPR000504,IPR034772,IPR035979,IPR034771,
                     IPR012677;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140066.1"
                     /db_xref="GeneID:66985902"
                     /translation="MATEDDNFDIDIYGDGSGYTANEQGDIKHDEADIILDAPDNAQQ
                     GNAQATQQQAGNAGNATTNGQQQIPSSETVNQDQTPKETPTPQQGVKRQEDRPSDPDA
                     TTALLISDLFWWTTDDDIRGWVNEAGVEDELKDVTFSEHKVNGKSKGQAFIEFTTIQA
                     ATAAKHKIETINATGQTGRKHSLTYTSPHMNPFRTLPKDAPMRKDNQARSAAGFNSPN
                     PNMNFGMNNMGGGGGFRGGRGGFNNRGGMNNMGFNRNFQNPMGGFQAAPMVGGFQPNP
                     MGGMQSYGFNNRGNMMGGGMRGGPGGMRGRGGGMAGPNMMGMPAMNPMGGMGMNPMGG
                     GMNPMMGGMGGNMGMQGQGGFQGPNPAFNQGFSFPNQGVGGDGAWNPHGAKRSRQE"
     gene            <1170386..>1170643
                     /gene="SSS1"
                     /locus_tag="ACHE_70388S"
                     /db_xref="GeneID:66985903"
     mRNA            join(<1170386..1170470,1170534..>1170643)
                     /gene="SSS1"
                     /locus_tag="ACHE_70388S"
                     /product="Sec61p translocation complex subunit"
                     /transcript_id="XM_043282715.1"
                     /db_xref="GeneID:66985903"
     CDS             join(1170386..1170470,1170534..1170643)
                     /gene="SSS1"
                     /locus_tag="ACHE_70388S"
                     /note="COG:U;
                     EggNog:ENOG410PRYA;
                     InterPro:IPR023391,IPR001901;
                     PFAM:PF00584;
                     TransMembrane:1 (i34-53o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_process: GO:0006605 - protein targeting [Evidence IEA];
                     go_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Sec61p translocation complex subunit"
                     /protein_id="XP_043140067.1"
                     /db_xref="GeneID:66985903"
                     /translation="MSDNFQELADIPKDFVRDGSLFIKRCTKPDQREFIKISQAVGMG
                     FLIMVWKIAPSALRLDQKAC"
     gene            complement(<1171254..>1173575)
                     /locus_tag="ACHE_70389A"
                     /db_xref="GeneID:66985904"
     mRNA            complement(join(<1171254..1171513,1171575..1172346,
                     1172403..1172771,1172822..1173147,1173200..1173298,
                     1173365..>1173575))
                     /locus_tag="ACHE_70389A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282716.1"
                     /db_xref="GeneID:66985904"
     CDS             complement(join(1171254..1171513,1171575..1172346,
                     1172403..1172771,1172822..1173147,1173200..1173298,
                     1173365..1173575))
                     /locus_tag="ACHE_70389A"
                     /note="COG:S;
                     EggNog:ENOG410QDP4;
                     InterPro:IPR036322,IPR015943,IPR001680,IPR020472,
                     IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140068.1"
                     /db_xref="GeneID:66985904"
                     /translation="MSSGFPPAGDQRESSSREFGTVWHPAREWLEQGENDDEQDLDYE
                     PWGDMDDEMDEEITSEHAEAEYQAYLDFTGDPELRNIDIEFTLDGRDSEEEDEEYPVE
                     RVSAARIVNVMSYHGLRPLMRHSRISDEDDDDGSGYFVYGRPRRPRQDRFPKVPSEAG
                     RDLMGSGDFGSNSHYVDELKKRKRALTTKLMWRELGIDVNGARRRATQSIFQDLIPRS
                     VADKIIHYDSRCYSGQFSDDGNFFYSCAQNFKVRMYDTSNPHDWKYYKTVEYPFGQWT
                     ITDATLSPDNRLLAYSSIRNLVCLSSTDPADQSDPTILDLSNLPGARSEREIYGSSHF
                     GIWSLRFSGDGREIVAGTSHKTVVVYDIEARKCVLRLPNHEEDVNAVCFGDKSSPHIL
                     YSGSDDTTLRVWDRRSMGDGREAGVFMGHIEGLTYVDSKGDGRYVLSNSKDQTMKLWD
                     LRKMMTTAKFDTIDAKSYTTGFDYRFEPYPDEYYEPHPHDCSVVTFRGHRVLKTLIRC
                     HFSPPGSTNSRYVYTGSEDGKVYVYNLDATLVGTIDVGMATLNSRPRDPDLLMNAYDF
                     GLRSGELLWRTCVRDASWHPSAPVLAATSWNGWGLSSGTCTLHSWNDCPTEDEGNPPV
                     GLSYDARLDEEPDFNHYKQTMQAYRRGGPLPRMRHRFISSDEDEDEDENEDEFE"
     gene            <1174664..>1175040
                     /gene="SNX3"
                     /locus_tag="ACHE_70390S"
                     /db_xref="GeneID:66985905"
     mRNA            join(<1174664..1174949,1175012..>1175040)
                     /gene="SNX3"
                     /locus_tag="ACHE_70390S"
                     /product="sorting nexin-3"
                     /transcript_id="XM_043282717.1"
                     /db_xref="GeneID:66985905"
     CDS             join(1174664..1174949,1175012..1175040)
                     /gene="SNX3"
                     /locus_tag="ACHE_70390S"
                     /note="COG:U;
                     EggNog:ENOG410PNAS;
                     InterPro:IPR001683,IPR036871;
                     PFAM:PF00787;
                     go_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="sorting nexin-3"
                     /protein_id="XP_043140069.1"
                     /db_xref="GeneID:66985905"
                     /translation="MYTSYEIVCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRV
                     TIPPLPGKVFTNRFSDDVIEHRREGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRN
                     AW"
     gene            complement(<1175990..>1178047)
                     /locus_tag="ACHE_70391A"
                     /db_xref="GeneID:66985906"
     mRNA            complement(join(<1175990..1176866,1176918..1176947,
                     1177023..>1178047))
                     /locus_tag="ACHE_70391A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282718.1"
                     /db_xref="GeneID:66985906"
     CDS             complement(join(1175990..1176866,1176918..1176947,
                     1177023..1178047))
                     /locus_tag="ACHE_70391A"
                     /note="COG:K;
                     EggNog:ENOG410PGHY;
                     InterPro:IPR001005,IPR009057,IPR017930;
                     PFAM:PF00249,PF13921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140070.1"
                     /db_xref="GeneID:66985906"
                     /translation="MDYNGVNNYHNRPLDESLIRELPQLQNLRIAPLRHPVSSRALSV
                     PSPLEPNASGVCESKASSAAVSSGSAGSYTNLPTVTELSNNTQTKKNDDSMLNLEPPP
                     KPILPAFVNLRALERFPYSSFDEDFHLIRKRRRLDVHPDAFGEHLQLPIPQQQKEQRP
                     PPFGPFAILNGLNEPPPNAALLPPIEAGSITHLLSKPTKEDAVVEPTLLTTNNATDSH
                     TSERREGKIEEILASPVDSKAGHVDRNNVEESFTDRVRTSKTGSEQTNDTSPNKGAPP
                     PAEKSPEPPSPKTRGRSRKNLRKWTEEETTDLLRGVIKCGIGNWTAILAQSEFRFNKR
                     SASNLKDRFRVCCPWAYRAADPNEATRQVREKLAETLQRTETEGDGAAVKIHLPPPQP
                     SNSGSDSNWSEVRPVLHTNDSSSSGCSLTTIKTDTSTSEAGYSSSRTISNESVSTLAS
                     LGVTEPHYTVKPRRRARRPFTSAEDEALVKGYAVHGFQWTLIQQDKRLNLGHRRATDL
                     RDRFRTKFPHAYREGGSISGNSLQSEAQNPPPTDETSQVTGTKRSRRAERRPASAHHG
                     KADNAHHTVSAMPGPSGSAFPHHVPAPQGLSENSTVGVPPAGPSFPFHLDSNSTAISN
                     AEAPWTDSTLAPMVWDEIP"
     gene            <1178607..>1179135
                     /locus_tag="ACHE_70392S"
                     /db_xref="GeneID:66985907"
     mRNA            join(<1178607..1178671,1178724..>1179135)
                     /locus_tag="ACHE_70392S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282720.1"
                     /db_xref="GeneID:66985907"
     CDS             join(1178607..1178671,1178724..1179135)
                     /locus_tag="ACHE_70392S"
                     /note="COG:S;
                     EggNog:ENOG410PPPJ;
                     TransMembrane:4 (i12-38o58-77i89-107o127-148i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140071.1"
                     /db_xref="GeneID:66985907"
                     /translation="MVSTIFPTWPHLLFGVIEPISLIAGWALPIIDLNWFILDQAPNP
                     DLISDAIHPSSIALAYQLANLYGLLFLLGVGICYTTTEPKVLRNYLFCLAVADFGHIY
                     VTYLAMGAEATFDVAGWNLLTWGNISITGFLFVNRLAYLAGVFGDAKSPLEDKKRT"
     gene            complement(<1181209..>1181805)
                     /locus_tag="ACHE_70393A"
                     /db_xref="GeneID:66985908"
     mRNA            complement(<1181209..>1181805)
                     /locus_tag="ACHE_70393A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282721.1"
                     /db_xref="GeneID:66985908"
     CDS             complement(1181209..1181805)
                     /locus_tag="ACHE_70393A"
                     /note="InterPro:IPR025659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140072.1"
                     /db_xref="GeneID:66985908"
                     /translation="MSSHLLQFPSAHHNPSQETTLYLLPKVSPRCATDYTINNAINGK
                     AVFRVTGKKYGSTPGREFRDESGLPLFKLTRGAVLSRWPWRITLPDNKEKDLGRVCAR
                     DPSMKIKLHIARNCVIGDRKREDEMVRLEVRRTTTLYMLGVLVEDGDNEEKWKVADIR
                     ECVERNKTVGHWPGGPYDHVPPKRVLDMKVAEGWICRF"
     gene            complement(<1182264..>1183987)
                     /locus_tag="ACHE_70394A"
                     /db_xref="GeneID:66985909"
     mRNA            complement(join(<1182264..1182569,1182698..1183186,
                     1183259..>1183987))
                     /locus_tag="ACHE_70394A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282722.1"
                     /db_xref="GeneID:66985909"
     CDS             complement(join(1182264..1182569,1182698..1183186,
                     1183259..1183987))
                     /locus_tag="ACHE_70394A"
                     /note="COG:S;
                     EggNog:ENOG410PU94;
                     InterPro:IPR023578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140073.1"
                     /db_xref="GeneID:66985909"
                     /translation="MNFVISPYEKTAFGPIFTTAEDTSPYLAVDNGMDSFISLTPQSP
                     LAESTFVPVQSTYPSLFRPSAERPHFSVSYKWWEDEATTVLWAFDAGEIQRVIRYGLF
                     PDENLPRTALQSRNESTVDSFLFTLVQPHERPFIANLSHVQKVEEILRRSKGTSPALV
                     PWSWFPSVMSREQDPEAIAKAIDAESRLHFTRIPFEEWVRYSLGYRSTLVDSFLEEHT
                     KLFHHLLHYFDGLPEELKRYAEVEKHLRKRSPFAHRALVQSLLTVQSGGEQRPPLSPV
                     PGFDFVAGPIQRLFKEHPPSLTAILKVLCVLEVRFRSMYLHIPEMDWNESFDTTVTFF
                     EDVLASTSAVDLARTLTTTDEGHFSELDEQGLMTEGPVARQIIVEWHKLSMAVWEACS
                     ALPDLIAYIQECVQALFLIRNYHSLTAMLNGLQKYSILAMTFNNVNSITGTVTLGPVL
                     PADLFYLLNPFHNYLAYRQQFHEAPGIPFLLPHIREFKQHGQGVLRQLFQEIQIPLP"
     gene            complement(<1188968..>1190202)
                     /gene="RPS4"
                     /locus_tag="ACHE_70395A"
                     /db_xref="GeneID:66985910"
     mRNA            complement(join(<1188968..1189021,1189078..1189372,
                     1189545..1189829,1189903..1190040,1190189..>1190202))
                     /gene="RPS4"
                     /locus_tag="ACHE_70395A"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_043282723.1"
                     /db_xref="GeneID:66985910"
     CDS             complement(join(1188968..1189021,1189078..1189372,
                     1189545..1189829,1189903..1190040,1190189..1190202))
                     /gene="RPS4"
                     /locus_tag="ACHE_70395A"
                     /note="COG:J;
                     EggNog:ENOG410PFCX;
                     InterPro:IPR041982,IPR032277,IPR038237,IPR000876,
                     IPR002942,IPR018199,IPR013843,IPR013845,IPR014722;
                     PFAM:PF00900,PF08071,PF01479,PF16121;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_043140074.1"
                     /db_xref="GeneID:66985910"
                     /translation="MPRGPTKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPL
                     IVFIRNRLKYALNGREVKAIMMQRLIKVDGKVRTDTTYPAGFMDVISIEKTGENFRLI
                     YDTKGRFTVHRIQAEEAEYKLGKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTV
                     KIDLATGKIVDFVRFDTGVVVMCTGGRNMGRVGVITHRERHDGGFNIVHIKDAVENTF
                     ATRESNVFIIGQDKPWISLPKGKGVKLSIAEERDRRRAHAIAQ"
     gene            complement(<1190511..>1191726)
                     /locus_tag="ACHE_70396A"
                     /db_xref="GeneID:66985911"
     mRNA            complement(join(<1190511..1191316,1191383..1191640,
                     1191696..>1191726))
                     /locus_tag="ACHE_70396A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282724.1"
                     /db_xref="GeneID:66985911"
     CDS             complement(join(1190511..1191316,1191383..1191640,
                     1191696..1191726))
                     /locus_tag="ACHE_70396A"
                     /note="BUSCO:EOG09262YAU;
                     COG:E;
                     EggNog:ENOG410PHPF;
                     InterPro:IPR036291,IPR012280,IPR000534,IPR005676;
                     PFAM:PF02774,PF01118;
                     go_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     go_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     go_function: GO:0050661 - NADP binding [Evidence IEA];
                     go_function: GO:0051287 - NAD binding [Evidence IEA];
                     go_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140075.1"
                     /db_xref="GeneID:66985911"
                     /translation="MAPAIAKKKCGVLGATGSVGQRFILLLAEHPLLELHALGASERS
                     AGKAYKDAVKWKQARPMSEALSNLVVRDCKAENFKDCDLVFSGLNSDIAGDTEMEFIK
                     NEIPVFSNAKNYRKHPTVPLVVPTVNPQHMDLIPHQRQQFGLKKGFLICNSNCAVIGV
                     VIPFAALQAKFGPVEEVEVFTEQAVSGAGYPGVSSMDIVDNVIPYISGEEDKLENEAQ
                     KILGSLNADATAFEEQSSLRIGATCTRVGVTDGHMAFVSLRFKNRQVPSAEEVKQALR
                     EYQSEAQKLGCPSAPEQAIRVFDEPDRPQPRLDRDISRGYTVSVGRVRDGLPGGYFDL
                     RFAALSHNTVIGAAGSSILNAEVAVIKGYI"
     gene            complement(<1192312..>1194219)
                     /locus_tag="ACHE_70397A"
                     /db_xref="GeneID:66985912"
     mRNA            complement(join(<1192312..1192464,1192519..1192700,
                     1192750..1193803,1193872..>1194219))
                     /locus_tag="ACHE_70397A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282725.1"
                     /db_xref="GeneID:66985912"
     CDS             complement(join(1192312..1192464,1192519..1192700,
                     1192750..1193803,1193872..1194219))
                     /locus_tag="ACHE_70397A"
                     /note="CAZy:AA4;
                     COG:C;
                     EggNog:ENOG410PGHW;
                     InterPro:IPR016171,IPR006094,IPR036318,IPR004113,
                     IPR016164,IPR016166,IPR016167,IPR016169;
                     PFAM:PF02913,PF01565;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_function: GO:0071949 - FAD binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140076.1"
                     /db_xref="GeneID:66985912"
                     /translation="MRLPTVPRRLPPHLRLLYRRPQICQPTRVARLYSTTSSSEGKGD
                     YNNAVRSESLADNASSPSFWNTKTSLIAAAAAAGLGYTYATLSQPSHSQSPSLSQSQS
                     AKKPQYGSIQDYEKAIVELRAKLGDDAISTEEDDLELHGYSEWSSVNADRLPVAIAYP
                     QTTEDVSEIAKICHKYKMPMIPYSGGSSLEANFSAPYGGMTIDFALMNRILELHEDDM
                     DIVVQPSIQWMDLNEKIKDSGLFFPVDPGPSAMIGGMVGTNCSGTNAVRYGTMKDWVI
                     NLTVVLADGHVIKTRRRPRKTSAGYNLTGLFVGSEGTLGIVTEATLKLAVTPEKTRVG
                     VVAFPTMRDAASTAMQLIRKGIPVQCMEILDDVQMDVINRAGGTGRSWKVLPTLFFKF
                     SGTNAGVADSISLTTELAKGNNASSFEFAQNEREGNDLWSARKQALWSMLALRKEGSD
                     VWSTDVAVPISRLPDIIDISSKEIAGLGLFASILGHIGDGNFHSSIMFNRADPAELAR
                     VEKVVHDMVDRAIEMEGSCTGEHGVGLGKKGSLKKELGLDTINVMRSVKASLDPHWLL
                     NPGKIFDFDNES"
     gene            <1194896..>1198555
                     /locus_tag="ACHE_70398S"
                     /db_xref="GeneID:66985913"
     mRNA            join(<1194896..1194970,1195050..1195197,1195254..1195348,
                     1195416..1196033,1196083..1196235,1196287..1197489,
                     1197555..1197683,1197771..1197887,1197941..>1198555)
                     /locus_tag="ACHE_70398S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282726.1"
                     /db_xref="GeneID:66985913"
     CDS             join(1194896..1194970,1195050..1195197,1195254..1195348,
                     1195416..1196033,1196083..1196235,1196287..1197489,
                     1197555..1197683,1197771..1197887,1197941..1198555)
                     /locus_tag="ACHE_70398S"
                     /note="COG:S;
                     EggNog:ENOG410PU4R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140077.1"
                     /db_xref="GeneID:66985913"
                     /translation="MQDRLVSLVREVERVVTAPYVPSLQDLYGIVCQVSFPAIDSWSF
                     CKPCQVAALVDVLVDGLSYSNVALELIGIFASAAAFRDALLERYPAILDHFLQKAVET
                     EESKYLSTCTALLSSPLSSGFTAPARLAGFITKLVHRMAKCPNADTIRPINNLLTGLQ
                     TSPKALYDIPAETMTTLQGELLKTLRNMDDHMGNLLCLSTYACIASSQKLDYEHEYGP
                     QPPSWLHNVRHFFGSKRGLKTLDLVVLRVILACSANCNNLAPSEAAESVRLAIAVCDT
                     VEPEQKQVWISGNASKIAKLCEKVTREGINYEVQMMGVMFLISLLPTNTLPPQILALG
                     LQGLLSNDSLQVLEAIPLGLIPRLVEANAIISGKSTFHDSLNYVLSALKSPALEMNTI
                     QIATLILSGLQISEPRLSSAVTEVSHALVRDSMRELIESFPRSPRQSQCNESKICYAA
                     LSTAENGLLIDLFDLYYCASMSQNVEDDGALRVEAGLISKFIARVKNTMCESNCLLAT
                     VKPSDAYDKLSYLEPRQVSPNPRRDWKAEVSNTLRSSARMSHDGLMKKVEEVCRDLEH
                     RCYNLEAPLRVIEEERNNASSEAEKLRQQNFELETRLQQAFSTINDLQQNMSYLEGHA
                     EAASTRIEKLSTSLEAAQKELEDQRCAYEESSQSEKEKARTKELDFMATLTEKEDLLE
                     ELQAENHEQRAENEKLRKTLDLVSKDNGSTLETVASLRKEVSRLEEFSVSNQQLAAQK
                     DEEILVLVASKEQMSSEIGNLQQKLENEISGSNRLRNTLRDAEDHFKSETDTLRKQHE
                     MQLSEASAENAKQREDNKALHESMQTAASNATAELQTKDKRIRHLERKIQSLLDERAA
                     KAREFSVAQEHIGRLMTVMGFKPDSETKLSSKQQRSRSTLEPTQITPVQRAINPDDDG
                     TQSQADHLFGDSFGFEIPNPNGRNPKRPRGNSIPLDLAPAPRNRNHDPTPNGLPSRSH
                     TSLPQRERRPLHDVDENSQAASQRTPRPSQAQSQFPESQVDINRNKLQELDLDMDVEF
                     TKDFLFTSTSLSDANDPASP"
     gene            <1199098..>1204032
                     /locus_tag="ACHE_70399S"
                     /db_xref="GeneID:66985914"
     mRNA            join(<1199098..1199906,1199990..1200146,1200200..1200665,
                     1200722..>1204032)
                     /locus_tag="ACHE_70399S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282727.1"
                     /db_xref="GeneID:66985914"
     CDS             join(1199098..1199906,1199990..1200146,1200200..1200665,
                     1200722..1204032)
                     /locus_tag="ACHE_70399S"
                     /note="COG:A;
                     EggNog:ENOG410PFI8;
                     InterPro:IPR007855;
                     PFAM:PF05183;
                     go_function: GO:0003968 - RNA-directed 5'-3' RNA
                     polymerase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140078.1"
                     /db_xref="GeneID:66985914"
                     /translation="MRRQRLEFHEQALETHKVNEKNHPTIHQYPAAFEVMDTQSSVSF
                     SSSDFSSSSFPSHPSRRRNARRGRSEGNILHQAAGPHANSPAPGFHTSSSSSSSSSPL
                     DDYSTFSSSYPSSSPSPLVDTSDKSVLVDGNANMLTLSPPRSHNHSFSRGRGRGRGKS
                     RRRVPRMTTTTTTTTTLTTAAATALPPLSHPLPTTATTTRPKETAGQPSSQPLPWWKH
                     WETVAVNLANVPLEADTFALWKAFSKEGSIFSIDLFTDIHGNRDPKGKIRFKPAPHTD
                     FWRKNTYIITLPDGQPATIFVTLDNKQQVCRIPSPVQHNISFPAEVKLPIVSLDIGVL
                     INETTMMSMRTVGTGLNEQPSLVLDLKRRALFIYFQLPIFNSIYKPTSSADVYQEYRL
                     KIPFPQLTRIFQTRDSLSGCTSHFTFLKSPAIYHRRIKNIQSTFVDETSWRDEDTWYR
                     QTHVVHNPQAQATLPISLRKQNPVIDIGRWNAFKIMYPKNSDDKGSLMLACNILRDYN
                     VAIEDTDRFTQCDSTQQKNPPIWRWIDLSESRNKALSSSLDDLIDEEYINLPFSVRYQ
                     LEVCLSNGYLSEFTMPREFASKLLELGEKDAKKLLEHVAMKEKVFHDPMKIFDFKFIR
                     GMTNAKIPPYCCYMRSARITPSTIYYSTPSVDISNRVIRYFIEYADRFLRIRFTDEKL
                     VGRINSTNDNTMDEVFTRVKRTLANGITIGDRHYEFLAFGNSQFREHGAYFFAPLPNL
                     TAANIRAWMGHFNDIRNVAKYAARLGQCFSTTRAVAGCPVQVRKIDDVVRNGYTFSDG
                     VGRISKFLAQMATSELKIRTLTGHVPSAFQFRLGGSKGMLTVSSQAQRQEVHIRDSQD
                     KFAAVHNGLEIIRWSQFSLATLNRQLIIVLSTLGIRDEVFHARLRTMLKSLDEAMASD
                     PQAIHLLKKYVDPNQMTLTVSQMVLDGFRKSQEPFLTSILRLWRAWHLKYLKEKAKIV
                     VDQGASVLGCMDETGTLKGYFHNSVPSKRASYEEKLAALPEIFLQISRPDKGGKYEVI
                     EGVCILARNPSLHPGDIRVVKAVNVPELSHLQDVVVMPQTGDRDIPSMCSGGDLDGDD
                     YLVIWDEELVPGDWFREPMDYASNKARDLDHEVTVDEITSFFVTYMKNDCLPCIAHAH
                     LAWADYLEEGVDNDKCMQLAHLHSDAVDYNKTGNPANMVRTLQPKKWPHFMEKRHKRK
                     EQIYHSKKVLGQLYDSVERVDFVPGLELPFDIRILDCDLAVTEDLMEFSRKLKYEYDS
                     AMRRIMAQHEIKTEFEVWSTFVLSHANMSKDYKFHEELGTISLSLREMYRKQCYEKVG
                     GRNFQQLAPLAVAMYRITHEEMAAALSKHRQDNPPDGKLFHRSAPKMHKLPLISFPWL
                     LPHILGKIALGHYESPGKPTEKSDEGPNVSKEASPNPDDHDNVVERVPGDQKSDDQKA
                     NVTKITQSDPFGLFTGDDHLPDDPSPAIKLPTPGVEESFGFQDQLLDFGFSKAPPTIA
                     GQANTDLGMFSNLLDLENLTPGCDEPTATTTATATATAASPKHDTENTGTTENVVEGT
                     ETDCIEIVEDEGGLEPNAVDKLNTLLGF"
     gene            complement(<1204408..>1208802)
                     /gene="REV3"
                     /locus_tag="ACHE_70400A"
                     /db_xref="GeneID:66985915"
     mRNA            complement(<1204408..>1208802)
                     /gene="REV3"
                     /locus_tag="ACHE_70400A"
                     /product="DNA polymerase zeta"
                     /transcript_id="XM_043282728.1"
                     /db_xref="GeneID:66985915"
     CDS             complement(1204408..1208802)
                     /gene="REV3"
                     /locus_tag="ACHE_70400A"
                     /note="BUSCO:EOG092602FH;
                     COG:L;
                     EggNog:ENOG410PFY9;
                     InterPro:IPR043502,IPR006172,IPR036397,IPR025687,
                     IPR012337,IPR030559,IPR017964,IPR042087,IPR006133,
                     IPR023211,IPR006134;
                     PFAM:PF03104,PF14260,PF00136;
                     go_component: GO:0016035 - zeta DNA polymerase complex
                     [Evidence IEA];
                     go_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003887 - DNA-directed DNA polymerase
                     activity [Evidence IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA];
                     go_process: GO:0019985 - translesion synthesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA polymerase zeta"
                     /protein_id="XP_043140079.1"
                     /db_xref="GeneID:66985915"
                     /translation="MFKPVASNERLVPSMASLWQDETRRRKKRLGIHEPGSSPFGPEE
                     LISMSADPRSKTDGDWIHEEEFREMVLQRAAEEKRYSDGKDVNFENFLKKDSFEDNVK
                     TALESIEDFFPDNIRQSRLEMYQARSTGERGDAEISVDESAVLSSEHDRDHYGSDGDL
                     TDKLDDTDEAADPFDDELGDDLFGIGFEYLKGQQGLNTEDFPQVDTRNSSKNHLGEIS
                     ESESELEPGNTNGGSRNATLKRPRFVKTDDDISRKRQRTPKEQHLHNSQTSSFQDRRQ
                     PAHPSTQNVNDITGRAPGTQDRKLTPRSKPSYQTANRPKGSTQDIRLNFPVVKNANDP
                     SPALAFNLEGDFTPKATADTLLTQESAISSKTDTKNSQDAHTGTYSQHQSFSTDTGLD
                     IYSSPVYELASSICQSFNMLLDTRIYCFRAPCPTPDEVSSTLNDHGYPSVIYQKAHYG
                     DEKDVPERPREYAGREFRLEGSSIHYLPDFDPSGRSPAMLGAQGAASVDRDNQGVIDQ
                     QLRESTSCRVWEFAPVPPSRSEVVQWFENMMSDLKSQPAQANKTRIEPNLKPNVLSQI
                     EGPTQKDYSTKYPAKGQSTSMEHQNQYTSIMSLEVHVNSRGVLSPNPEEDEVSCVFWC
                     IQSEDEDLDPNGNIPGVHVGMIYQGEGDVPETKIIRALRIETDQQATELDLINRMVDI
                     VRFYDPDIITGYEVHNNSWGYLIERARKKYDFDLCDELSRVKSQAHGRFGKDSDRWGF
                     NHTSSIRVTGRHIINLWRAMRSELTLLQYSMENVVFHVLQRRIPHYSFQDLTAWYQSG
                     KPRNLMKLVSYYASRVQMNLEILESNELISRTSEQARLLGVDFFSVFSRGSQFKVESL
                     MFRIAKPENFMLVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLVVLDFQSLYPSVMI
                     AYNYCYSTFLGRARQWRGRDKMGFMDYQRQPQLLELLKDKINIAPNGMLYTKPEVRTS
                     LLARMLTEILETRVMVKTGMKLDKNDKILQRLLNNRQLALKLIANVTYGYTSASFSGR
                     MPCSEIADSIVQTGRETLEKAIALIHSVESWGAEVVYGDTDSLFVYLKGRTREEAFDI
                     GEEIAKTVTDTNPRPVKLKFEKVYHPCVLLAKKRYVGFKYEHRDQKEPEFDAKGIETI
                     RRDGTPAEQKIEEKALKTLFRTADLSQVKSYFQKQCTKIMQGNVSIQDFCFAREVRLG
                     TYSERGPPPPGALISTKKMLEDPRLEPQYGERVPYVVVTGAPGSRLIDRCVAPETLLN
                     DAQLDLDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKFHRIRRIEGTTTSTSSTL
                     SSSLLIPQTTTTIGKTLESYMKSSLCLVCKANKISESTSSSHKNLPLCDDCLRTPHIS
                     LLTLTSRRQVAEKRVLDLHRICRSCMGVSFGDDVNCDSKDCPVFYLRTRHMANWRHAR
                     VVLDPVVKALEDWGDDDFAGNRNGSLDW"
     gene            <1209992..>1211404
                     /gene="SLU7"
                     /locus_tag="ACHE_70401S"
                     /db_xref="GeneID:66985916"
     mRNA            <1209992..>1211404
                     /gene="SLU7"
                     /locus_tag="ACHE_70401S"
                     /product="mRNA splicing protein"
                     /transcript_id="XM_043282729.1"
                     /db_xref="GeneID:66985916"
     CDS             1209992..1211404
                     /gene="SLU7"
                     /locus_tag="ACHE_70401S"
                     /note="BUSCO:EOG09262NNS;
                     COG:A;
                     EggNog:ENOG410PI74;
                     InterPro:IPR021715,IPR039974;
                     PFAM:PF11708;
                     go_function: GO:0000386 - second spliceosomal
                     transesterification activity [Evidence IEA];
                     go_function: GO:0030628 - pre-mRNA 3'-splice site binding
                     [Evidence IEA];
                     go_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mRNA splicing protein"
                     /protein_id="XP_043140080.1"
                     /db_xref="GeneID:66985916"
                     /translation="MSSRKPADVASKERNEYIPSFISKKPFYIDDETTANDYLEHQRL
                     HKAEKSDITKWYDRGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGAKWTGKN
                     IEADEVLQNVELGWDAKRDRWNGYDPTEYRQVVEEFEELENIKQSTKAERGEDEDDDE
                     GKNEEARYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDAGAS
                     EDDAAALVAEEDFVRSSGDAAEFERAQRYAWESQEQGKPQIHLQANPTSGEVMRKKTQ
                     AESEAKRQAQRKALLEKYGGEEHMAPTPLRDAMVVENEKFIEYDETGAIKGAPKKAAK
                     SKYPEDVLNNNHTSVWGSWWHNFDWGYACCFSTVKNSYCTGEDGKKAFLEADSLLMLP
                     GKKEAEGPSYDPEEGDGSRESRDMGNQNGRKDASSSGKKRTLMEIQSGISEEELESYK
                     RSRLAADDPMAAFTGKDEVA"
     gene            <1211970..>1212563
                     /gene="RPL37A"
                     /locus_tag="ACHE_70403S"
                     /db_xref="GeneID:66985918"
     mRNA            join(<1211970..1211973,1212048..1212110,1212245..1212316,
                     1212421..>1212563)
                     /gene="RPL37A"
                     /locus_tag="ACHE_70403S"
                     /product="60S ribosomal protein L37A"
                     /transcript_id="XM_043282731.1"
                     /db_xref="GeneID:66985918"
     CDS             join(1211970..1211973,1212048..1212110,1212245..1212316,
                     1212421..1212563)
                     /gene="RPL37A"
                     /locus_tag="ACHE_70403S"
                     /note="COG:J;
                     EggNog:ENOG410PQSM;
                     InterPro:IPR001569,IPR018267,IPR011331,IPR011332;
                     PFAM:PF01907;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L37A"
                     /protein_id="XP_043140081.1"
                     /db_xref="GeneID:66985918"
                     /translation="MTKGTSSFGKRHNKTHTLCRRCGKRSFHIQKSTCANCGYPSAKT
                     RKFNWGEKAKRRKTTGSGRTRHLKDVHQRFKNGFRVGVPKGARGPETAQ"
     gene            complement(<1213040..>1214225)
                     /locus_tag="ACHE_70402A"
                     /db_xref="GeneID:66985917"
     mRNA            complement(join(<1213040..1213366,1213424..1213915,
                     1213968..>1214225))
                     /locus_tag="ACHE_70402A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282732.1"
                     /db_xref="GeneID:66985917"
     CDS             complement(join(1213040..1213366,1213424..1213915,
                     1213968..1214225))
                     /locus_tag="ACHE_70402A"
                     /note="COG:S;
                     EggNog:ENOG410PPCY;
                     InterPro:IPR018627;
                     go_component: GO:0033588 - Elongator holoenzyme complex
                     [Evidence IEA];
                     go_process: GO:0002098 - tRNA wobble uridine modification
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140082.1"
                     /db_xref="GeneID:66985917"
                     /translation="MPTQPPLPPLLTPYVSSLPQSSLTLLSSVLGATGNWLVLRYLYA
                     ALSASTNTTFGADGLDNGKKRKVVLVSFLRSWDFWRSEAKRLGLDLARLSDKGQFAFV
                     DGLSELFYTPQTHTAAPIVLPAPAPFAAAGRPIPPRTALPVREPPGTSAPAPTPAVPG
                     GCLNRVTTEAGPGPAKRLHLIGQGTSALDALEKDILDVVSQLKATGAENDSEEAEVLL
                     IVDQPDLLLAATGPSKGIGATETGDWVMGLQQHSHATIVAVSADSPLIHNASEFVNHP
                     ATPLEKEHAAFAVGLAHRAQMVVQLRNLETGAARDVSGVLRASKGGAWSDDGSTDAET
                     KWEEKEVLYFIQRDGSVNVFGRGE"
     gene            <1215345..>1217704
                     /gene="LAC9_2"
                     /locus_tag="ACHE_70404S"
                     /db_xref="GeneID:66985919"
     mRNA            join(<1215345..1215377,1215433..1215462,1215514..1215608,
                     1215659..1215972,1216022..1216713,1216772..>1217704)
                     /gene="LAC9_2"
                     /locus_tag="ACHE_70404S"
                     /product="lactose regulatory protein lac9 and GAL4-like
                     protein"
                     /transcript_id="XM_043282733.1"
                     /db_xref="GeneID:66985919"
     CDS             join(1215345..1215377,1215433..1215462,1215514..1215608,
                     1215659..1215972,1216022..1216713,1216772..1217704)
                     /gene="LAC9_2"
                     /locus_tag="ACHE_70404S"
                     /note="COG:K;
                     EggNog:ENOG410PIUD;
                     InterPro:IPR036864,IPR007219,IPR005600,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (o546-565i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="lactose regulatory protein lac9 and GAL4-like
                     protein"
                     /protein_id="XP_043140083.1"
                     /db_xref="GeneID:66985919"
                     /translation="MTSTRDSHAYACDECRLRKSKCSKERPTCVQCQQLGKECNYSPK
                     VTRSPLTRQHLTHVEDRLQAFETALGRLFPGGDLDATVRSLLQDHETPPRTASSKSSS
                     RHSTPAKTEDRSEAAPEALPQQADGFDWAEKEISLGGLTDGMAALSIKPEGSGYFGAS
                     SSVVPLRALMKHGFDLSIPSSATKPNGGTDKVPLKSQLLNSAPSGLIEQAFMDAYFLN
                     YHSSYPFVHEATFRAQFHEHIPRPHGLSWHILLNTILALGAWSIGDDNSDLDITFYQE
                     ARGHLQQVSVFETGNLTLIQALLLMSNYAQKRNKPNTGWNFLGLAVRMAMSLGLHKEF
                     PGWRISLLQREIRRRLWWGVFIFDSGAAKTFGRPILLPEDRVMDAKHVLNIQDEALTS
                     STTTLPKESDGPTLYSGIIAQAKFHLLTNSVYQRLISSPALTPEETLSLQKPMEEWYN
                     NLPDYFKQPASMPEPDSLALVRRRLMWRDWNLRTLIYRPILLRWAARRWTPTPGPPPE
                     REDPLEGDCRMLCLRNARLTIASISEYMDNYICTRLGAWYMLYFLFQAGLIPIIFLMT
                     DPTSTDAPAWLQDIQTTKQLLSHPSLSNNRLATRCLAVVNKLCTPVSYYCYPNNGNAN
                     TGAAPIQGVPAAANKPVTGGAGEGGQQQQPPILMHFPDQLFNDPTFGGMFPDVDQELN
                     LNMSGMDFSEWLNFTP"
     gene            complement(<1218369..>1220239)
                     /locus_tag="ACHE_70405A"
                     /db_xref="GeneID:66985920"
     mRNA            complement(join(<1218369..1218447,1218504..1218971,
                     1219025..1219296,1219358..1219623,1219677..1219740,
                     1219811..1219897,1219964..>1220239))
                     /locus_tag="ACHE_70405A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282734.1"
                     /db_xref="GeneID:66985920"
     CDS             complement(join(1218369..1218447,1218504..1218971,
                     1219025..1219296,1219358..1219623,1219677..1219740,
                     1219811..1219897,1219964..1220239))
                     /locus_tag="ACHE_70405A"
                     /note="COG:O;
                     EggNog:ENOG410PI7S;
                     InterPro:IPR042467,IPR003323,IPR042468,IPR019400,
                     IPR038765;
                     MEROPS:MER0029066;
                     PFAM:PF10275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140084.1"
                     /db_xref="GeneID:66985920"
                     /translation="MSLSDVSFAHFLPYNHNHYFPDYHGLSAANSIYQDRTFHSPAPV
                     LSHGGSSHFSASVKNRSAAKSSFNMNTLSTEEMERFQKLSNEFEPDVQGPLVSTKQST
                     QAIAMDYANADPTLATKTSTLALTHPTSRIMKGDGNCGWRAVAFGYFENLFALRDLVL
                     IQNELVRIKSLSSLLDQVGHQDYLYEIFVDATEQVFTQLIQVIRDGVRDDSFLVDTFN
                     VEYSSNAILTHFRLLTGAWMKLNPQRYQAFVPMPLDQYCATRIETVKSEIDEVGLQAL
                     VDGVIERSGFAVEILYLDRSQGDAVTPHLLTTNQASIETIRLLYRPGHYDLLYRPEPT
                     VNMEPVVNYQYAMTSNYSPWDQGALSFDVNPTLMSIPNLMMDPAFAMGAPPMSPAPIS
                     PPAPSSPYRVSSPQEVYQAQIPTSPPPPVQMPSPPAPRMSAPPSGPPPPMSSLPNRSS
                     DGPQIRLNPLVMKPNLSHSLPITTPFKNSPYNQAHFQNQDFEPIHWEPSDSRK"
     gene            complement(<1221938..>1223610)
                     /locus_tag="ACHE_70406A"
                     /db_xref="GeneID:66985921"
     mRNA            complement(join(<1221938..1223173,1223224..1223284,
                     1223347..1223505,1223567..>1223610))
                     /locus_tag="ACHE_70406A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282735.1"
                     /db_xref="GeneID:66985921"
     CDS             complement(join(1221938..1223173,1223224..1223284,
                     1223347..1223505,1223567..1223610))
                     /locus_tag="ACHE_70406A"
                     /note="COG:O,T;
                     EggNog:ENOG410PG16;
                     InterPro:IPR036390,IPR037750,IPR000717;
                     PFAM:PF01399;
                     go_component: GO:0008180 - COP9 signalosome [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140085.1"
                     /db_xref="GeneID:66985921"
                     /translation="MSDDDDFMQDSGDEDYDFEYEDADDDESGDVGIENKYYNAKQMK
                     ADNPEEAIDEFLGVPALEEEKSDWGFKGLKQAIKLEFKLERYGDAVEHYRELLTYVKS
                     AVTRNYSEKSINNMLDYIEKGSDDAKAYQCMEEFYSLTLYSFQNTNNERLWLKTNIKL
                     ARLWLERKEYGQLSKKVRELHRACQREDGSDDPSRGTYLLELYALEIQMYAETKNNKR
                     LKALYQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWEEAQSDFFESFRNYDEAGSM
                     QRIQVLKYLVLATMLMKSDINPFDSQETKPYKSDPRISAMTDLVDAFQRDDIHTYEAI
                     LSKNPDVLADPFIAENIDEVSRNMRTKAILKLIAPYTRFSLNFISKNIKISVQEVQDI
                     LSFLILDRKLDAKIDQENGIVVVESNSDVDRLRSLQEWISSLRTLWEATLNGEGFKAD
                     EAAQLQGMAAGSMFPLGFGDDGPVGASTMRTRSRGGFKGRGGKVGSRAF"
     gene            <1225021..>1226042
                     /gene="RHO3"
                     /locus_tag="ACHE_70407S"
                     /db_xref="GeneID:66985922"
     mRNA            join(<1225021..1225070,1225127..1225177,1225254..1225271,
                     1225342..1225358,1225419..1225433,1225488..1225609,
                     1225667..1225868,1225924..>1226042)
                     /gene="RHO3"
                     /locus_tag="ACHE_70407S"
                     /product="Rho GTPase"
                     /transcript_id="XM_043282736.1"
                     /db_xref="GeneID:66985922"
     CDS             join(1225021..1225070,1225127..1225177,1225254..1225271,
                     1225342..1225358,1225419..1225433,1225488..1225609,
                     1225667..1225868,1225924..1226042)
                     /gene="RHO3"
                     /locus_tag="ACHE_70407S"
                     /note="BUSCO:EOG09264YNR;
                     COG:S;
                     EggNog:ENOG410PFG4;
                     InterPro:IPR005225,IPR001806,IPR027417,IPR003578;
                     PFAM:PF00025,PF08477,PF00071;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA];
                     go_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Rho GTPase"
                     /protein_id="XP_043140086.1"
                     /db_xref="GeneID:66985922"
                     /translation="MELCGRQKVVQRKMVLLGDGACGKTSALNVFTRGFFPTVYEPTV
                     FENYVHDIFVDNVHMELSLWDTAGQEEFDRLRALSYEDTHVIMLCFSVDSPDSFENVA
                     SKWVEEISENCPGVRMVLTALKCDLRKDEDLNDNPNAITFEQGLAKAKEIGAVKYLEC
                     SAVQNRGIRETFGEAAKVALDVKTQGTKSSKQGCVIL"
     gene            complement(<1226426..>1227307)
                     /locus_tag="ACHE_70408A"
                     /db_xref="GeneID:66985923"
     mRNA            complement(<1226426..>1227307)
                     /locus_tag="ACHE_70408A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282737.1"
                     /db_xref="GeneID:66985923"
     CDS             complement(1226426..1227307)
                     /locus_tag="ACHE_70408A"
                     /note="BUSCO:EOG09264AWW;
                     COG:H;
                     EggNog:ENOG410PPYW;
                     InterPro:IPR020605,IPR004143,IPR000544;
                     PFAM:PF03099;
                     go_function: GO:0033819 - lipoyl(octanoyl) transferase
                     activity [Evidence IEA];
                     go_process: GO:0006464 - cellular protein modification
                     process [Evidence IEA];
                     go_process: GO:0009249 - protein lipoylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140087.1"
                     /db_xref="GeneID:66985923"
                     /translation="MRLAHLHLPSITPFSRVSHLQETLTTRLLAYKKLTSQSPFQSPT
                     PTPTSIPSTPPDPTIITFTPNPVYTTGRRDLPPSNTASTKTLSLPPGLEPIRPLLVPD
                     GDGHSFSPAGERKAEYHPTLRGGQTTYHGPGQMVAYTILDLKRLGLTPRCHIRVLENS
                     VVDVLRKYGITGVITEDPGVWVPSSSSSGTDAPKKITAVGVHLRRNISSYGIGFNVTE
                     EPMWYFRQIVACGLEGREATSLEGQGVQSPIGDVADQFVEAFTKRINADFACGDGASG
                     EKIEEVYNVREEDLLRA"
     gene            complement(<1227656..>1228509)
                     /locus_tag="ACHE_70409A"
                     /db_xref="GeneID:66985924"
     mRNA            complement(join(<1227656..1228300,1228354..>1228509))
                     /locus_tag="ACHE_70409A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282738.1"
                     /db_xref="GeneID:66985924"
     CDS             complement(join(1227656..1228300,1228354..1228509))
                     /locus_tag="ACHE_70409A"
                     /note="COG:S;
                     EggNog:ENOG410PNI4;
                     InterPro:IPR011576,IPR012349;
                     PFAM:PF01243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140088.1"
                     /db_xref="GeneID:66985924"
                     /translation="MVFCPLIKEAAMNDPYNPNPPLSYEASATTTHPHIATTLPPEVV
                     SCLRNSRFLHLATCDGLIPHISLMSYTYLPSTPFDPHPTIIMTTNPSSRKTNHLLTNP
                     HVSLLVHDWVSHRPPLRASNPGDREGSPPPAATRSSLAGMLLNLNTSALSSISTTLAG
                     EARFLEPGSEEESWCKERHLENNTFEEEEMNLFGLQQQQQQQQSGETAGQRRPSMTVD
                     DSARVVTVRVREGRIADWKGGVRDWTIVTDGQEQPATAPVNGVPSSSS"
     gene            <1229486..>1230711
                     /locus_tag="ACHE_70410S"
                     /db_xref="GeneID:66985925"
     mRNA            join(<1229486..1229741,1229871..1230161,1230227..>1230711)
                     /locus_tag="ACHE_70410S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282739.1"
                     /db_xref="GeneID:66985925"
     CDS             join(1229486..1229741,1229871..1230161,1230227..1230711)
                     /locus_tag="ACHE_70410S"
                     /note="COG:S;
                     EggNog:ENOG410PJ4C;
                     InterPro:IPR011008,IPR012577;
                     PFAM:PF07978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140089.1"
                     /db_xref="GeneID:66985925"
                     /translation="MLASRAVRPASFLARPFSSSAAVFRTPSIRDITADSASEFNARQ
                     KEFRENLEVARKRKEQQESQSVDASASSSPSPSPPASRDRFRDEQLKDQSPKRGPLSS
                     LIYGTKEGQQLDKDIERSFSQVLARGKYVHSIVFHEVKPDKVDEYVDLISTWYPRMAQ
                     MEENKLHLVGSWRTQVGDNDTFVHIWEYQRYDGYHSSLHSISQHPEFPEFDRKLKKLI
                     KSKKTSLMQEFSFWPTTPPRRLGGIFELRSYTLHPGNLLEWETHWRRGLTARREVMEG
                     VGAWFVQIGDLNTVHHLWQFANLEERKIRREQSWQIEGWAETVHKTVPLIQTMQSRIL
                     IPMPWSPVG"
     gene            <1231669..>1233244
                     /locus_tag="ACHE_70411S"
                     /db_xref="GeneID:66985926"
     mRNA            join(<1231669..1231808,1231878..1231887,1231980..1232137,
                     1232194..1232336,1232391..1233058,1233119..>1233244)
                     /locus_tag="ACHE_70411S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282740.1"
                     /db_xref="GeneID:66985926"
     CDS             join(1231669..1231808,1231878..1231887,1231980..1232137,
                     1232194..1232336,1232391..1233058,1233119..1233244)
                     /locus_tag="ACHE_70411S"
                     /note="COG:I;
                     EggNog:ENOG410PGVP;
                     InterPro:IPR014472,IPR000462,IPR043130;
                     PFAM:PF01066;
                     TransMembrane:8
                     (i50-68o80-98i167-192o228-250i262-281o293-314i326-345o351-
                     370i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0016780 - phosphotransferase activity, for
                     other substituted phosphate groups [Evidence IEA];
                     go_process: GO:0008654 - phospholipid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140090.1"
                     /db_xref="GeneID:66985926"
                     /translation="MVYIRQHQLPNLKSYRYAGVDHSFISRYILKPFYNNFVIHCFPM
                     SMAPNAITLTGFIFVVINFFTVLYYNPTLDQDCPPWVYASCALGLFLYQTFDAVDGMQ
                     ARRTRQSGPLGELFDHSVDACNTALGVLIFCSTMNFGQSWATVLTLFGSTMTFYVQTW
                     DEYYTQVLTLGVVSGPVEGVLTLCVVFAFTAYEGGGSFWHRSMFDTVGVPKLDWIPEA
                     AYDMSFTQWYLIYGALLLFFATGSSIYHVVQVRRERGQDPIKPLFGLLPLVATWIFVP
                     AYLYLQPAILENHLIPFVLYVGLINAYSVGRMIVGHLVKAPFPYFNILQVPLALAVFD
                     NTGPFFGLWSSVLGADFSSQVTFVFVSLGLAVGVYGSFVHDVITTICDYIDIWCLTIK
                     HPHVEEAQATAREGVAVAKKAQ"
     gene            <1233894..>1234369
                     /gene="CRP6"
                     /locus_tag="ACHE_70412S"
                     /db_xref="GeneID:66985927"
     mRNA            join(<1233894..1233983,1234043..1234105,1234187..>1234369)
                     /gene="CRP6"
                     /locus_tag="ACHE_70412S"
                     /product="40S ribosomal protein S27"
                     /transcript_id="XM_043282743.1"
                     /db_xref="GeneID:66985927"
     CDS             join(1233894..1233983,1234043..1234105,1234187..1234369)
                     /gene="CRP6"
                     /locus_tag="ACHE_70412S"
                     /note="COG:J;
                     EggNog:ENOG410Q169;
                     InterPro:IPR000592,IPR011332;
                     PFAM:PF01667;
                     go_component: GO:0005840 - ribosome [Evidence IEA];
                     go_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     go_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="XP_043140091.1"
                     /db_xref="GeneID:66985927"
                     /translation="MSCLCYGDEDIVAVGWGNFIVVAVASHRPTVLAVDLLNPTPQAE
                     ARKHKLKTLVPQPRSFFMDVKCPGCFTITTVFSHAQTVVICAGCSTVLCQPTGGKARL
                     TEGCSFRRK"
     gene            <1234666..>1235031
                     /locus_tag="ACHE_70413S"
                     /db_xref="GeneID:66985928"
     mRNA            <1234666..>1235031
                     /locus_tag="ACHE_70413S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282744.1"
                     /db_xref="GeneID:66985928"
     CDS             1234666..1235031
                     /locus_tag="ACHE_70413S"
                     /note="TransMembrane:1 (o15-33i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140092.1"
                     /db_xref="GeneID:66985928"
                     /translation="MGSSGYLAYGQSTSYVNTFFIIVLFYCLFVRLVSMNAHAIAITT
                     TANDESATRAAAATTPATLATHLSHDDFDMSYEGCGIGYGYCLGLEVRLQHGSGDLLL
                     CWPESCPSTSVAVSSGRPP"
     gene            complement(<1235321..>1235757)
                     /locus_tag="ACHE_70414A"
                     /db_xref="GeneID:66985929"
     mRNA            complement(join(<1235321..1235621,1235693..>1235757))
                     /locus_tag="ACHE_70414A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282745.1"
                     /db_xref="GeneID:66985929"
     CDS             complement(join(1235321..1235621,1235693..1235757))
                     /locus_tag="ACHE_70414A"
                     /note="COG:S;
                     EggNog:ENOG410PTSJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140093.1"
                     /db_xref="GeneID:66985929"
                     /translation="MSAEQLNVNLDKVDSQMGELLTAFESHPQMQPPATHPTIFFLFD
                     FVRTTHRTLKSIDAEKFRTGDNEAREQAQEVLSRNQFANMLVSDRSGKLALMTGGDPT
                     NPLDFGDDIRGKARALTEV"
     gene            <1238319..>1239326
                     /locus_tag="ACHE_70415S"
                     /db_xref="GeneID:66985930"
     mRNA            <1238319..>1239326
                     /locus_tag="ACHE_70415S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282746.1"
                     /db_xref="GeneID:66985930"
     CDS             1238319..1239326
                     /locus_tag="ACHE_70415S"
                     /note="COG:E;
                     EggNog:ENOG410PPSZ;
                     InterPro:IPR005645,IPR029058;
                     PFAM:PF03959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140094.1"
                     /db_xref="GeneID:66985930"
                     /translation="MYNRRPLLLLSLQRRPFTRPSFRKPSYITYCFLSTTTPRPPPTM
                     TSKNPRQPLKLLMLHGYTQSGTLFHAKSRALIKHITKAFPLHEVAAIYPTGPIHLDPA
                     DIPGYEPSSQSPETEEKIEAYGWWRRSNTANPPLYLGIEEGLAAVAKVLKEEGPFDGV
                     IGFSQGAALAAMVAGLLESGRKGAFEKYADARAACEGVDLSDSTEKDVASIAFPKSFE
                     EVQHPPLKFALCYSGFRAPGPRYRAFYESPAIQTPMLHVLGSLDAVVDDSRSRALIEA
                     CAGDPEKEGKIVWHPGGHFLPSQRPFLDAAVRFIQERLENKDDKGKEEDEDVNNMDLP
                     F"
     gene            complement(<1239524..>1241205)
                     /locus_tag="ACHE_70416A"
                     /db_xref="GeneID:66985931"
     mRNA            complement(join(<1239524..1240111,1240164..1240652,
                     1240705..1240941,1241012..1241068,1241122..>1241205))
                     /locus_tag="ACHE_70416A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282747.1"
                     /db_xref="GeneID:66985931"
     CDS             complement(join(1239524..1240111,1240164..1240652,
                     1240705..1240941,1241012..1241068,1241122..1241205))
                     /locus_tag="ACHE_70416A"
                     /note="BUSCO:EOG09262P1W;
                     COG:O;
                     EggNog:ENOG410PIGS;
                     InterPro:IPR036388,IPR040134,IPR036390,IPR040896,
                     IPR035297,IPR000717;
                     PFAM:PF18098,PF01399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140095.1"
                     /db_xref="GeneID:66985931"
                     /translation="MSDGILKPEKDYSKDADQLIPEAEQLAKTDVQSAIDKLLGLEKQ
                     ARQATDLATTSRLLVAIVTICKNAGDWNLLNDQVLLLSKKHGQLKQATTRMIQTAMTF
                     IDQTPNMDVKLSVIETLRTVTEGKIFVEVERARVTRILSNIKKSQGDLNSAADILCEL
                     QVETFGSMTRREKTEFILEQVSLCIERGDWTQATILSRKINRRYFSRKPKKTSEQIEQ
                     LKKEAEEREKTRAPDEAPMEVDDDVTDLKLRYFEQQIILANHEYKYLDVCKHYREVLD
                     TESVENNPEQLQAVLARIVYYIVLSPYDNEQSDLLHRIQQDSRLSAVPVESRLVKLFT
                     IPELMRWPYVSEEFGPHLCNTDVFDAQPGQSAEDQAYKRWQDFRKRVIEHNVRVVAKY
                     YTRIQMGRLTQLLDLAEEETEKYISDLVTSKTIYAKIDRPARLINFAKPRDADDVLNE
                     WSSDMKNLLNHLERIDHLITKEEMMARILPAKAH"
     gene            <1242195..>1243931
                     /locus_tag="ACHE_70417S"
                     /db_xref="GeneID:66985932"
     mRNA            join(<1242195..1242519,1242577..>1243931)
                     /locus_tag="ACHE_70417S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282748.1"
                     /db_xref="GeneID:66985932"
     CDS             join(1242195..1242519,1242577..1243931)
                     /locus_tag="ACHE_70417S"
                     /note="COG:H;
                     EggNog:ENOG410PF8D;
                     InterPro:IPR006367,IPR006366,IPR012066,IPR035996,
                     IPR014777,IPR014776,IPR028162,IPR036291,IPR003043,
                     IPR000878,IPR028281;
                     PFAM:PF14824,PF13241,PF14823,PF00590;
                     go_function: GO:0004851 - uroporphyrin-III
                     C-methyltransferase activity [Evidence IEA];
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0000103 - sulfate assimilation [Evidence
                     IEA];
                     go_process: GO:0006779 - porphyrin-containing compound
                     biosynthetic process [Evidence IEA];
                     go_process: GO:0019354 - siroheme biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140096.1"
                     /db_xref="GeneID:66985932"
                     /translation="MKDASCDNGPRAPLLAAVNVESQVHLIIGSNPLAAARCSKSLDA
                     GAKPIIIAPETADLQYTLSERIQNGSAEWVRKEFQDDDLTTLGREEVDRVVDMVFVTL
                     GGNHPLSPHIAKLCRRFRIPVNVSDAPELCTFTLLSTYSDGPLHVGITTSGRGCKLAS
                     RLRREVSSSLPTNLGSAIDRLGAVRRRLWEEDQAAGLCDTAFEGDDDDATGQKHTFNT
                     LATDDEVYMTRTRRIRWLSQICEYWPLRKLASITDSDIDDILKAYSSGNNNAREVNGV
                     TARKGKIILAGSGPGHPDMLTRATYHAIQSADIILADKLVPEPVLNLIPRRTEVQISR
                     KFPGNADQAQEEFLQMGLKALRSGKQVLRLKQGDPYLYGRGGEEFEFFRNEGHIPLVL
                     PGITSALSASLFAEIPATHRGATDQVLICTGTGRNGAAPEPPTYVPTQTVVFLMALHR
                     LSALVESLVNAPAEDSGARPRTPWPRDTPCAIIERASCTDQRVIRTTLEHVCTAFEAE
                     GSRPPGLLVVGVSCHVLHRPNEQKWVVEEGFKGLDELRDPSIMNEEGWKDF"
     gene            <1244239..>1244784
                     /locus_tag="ACHE_70418S"
                     /db_xref="GeneID:66985933"
     mRNA            join(<1244239..1244291,1244364..1244445,1244590..>1244784)
                     /locus_tag="ACHE_70418S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282749.1"
                     /db_xref="GeneID:66985933"
     CDS             join(1244239..1244291,1244364..1244445,1244590..1244784)
                     /locus_tag="ACHE_70418S"
                     /note="COG:O;
                     EggNog:ENOG410PZTW;
                     InterPro:IPR024491;
                     PFAM:PF10961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140097.1"
                     /db_xref="GeneID:66985933"
                     /translation="MAGDNNKTYVSNGEVLEGPPVSVRISRFFESVYVFFGLYFTSLL
                     SFDPYTAAQNSQFNVARRGDRLGGYSGSGAGGPGGPGGPGPRRIGRVGRVDDIRDPEC
                     APCRGGC"
     gene            <1245222..>1246031
                     /locus_tag="ACHE_70419S"
                     /db_xref="GeneID:66985934"
     mRNA            <1245222..>1246031
                     /locus_tag="ACHE_70419S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282750.1"
                     /db_xref="GeneID:66985934"
     CDS             1245222..1246031
                     /locus_tag="ACHE_70419S"
                     /note="COG:F;
                     EggNog:ENOG410PQA3;
                     InterPro:IPR011343,IPR028581,IPR002915,IPR013785;
                     PFAM:PF01791;
                     go_component: GO:0005737 - cytoplasm [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004139 - deoxyribose-phosphate aldolase
                     activity [Evidence IEA];
                     go_function: GO:0016829 - lyase activity [Evidence IEA];
                     go_process: GO:0009264 - deoxyribonucleotide catabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140098.1"
                     /db_xref="GeneID:66985934"
                     /translation="MTSIKTPNTNDEWAALISAMRDSLPSTYNVYHTPRPGIIYRSLD
                     HTLVLDSATEEDVDKLCADAQFHRFASVCVRPKHVRQAVRGLEKAQEVAVDCVVGHPD
                     GKEDTESKENEARVALEQGATEIDMVVNFSFLKQQRYTEVYADILEVRKVAADAKLKV
                     TLETPVLTRDEVIAGCVIASLAGADFVKSCTGTKEPYPSTETIGLMRATVDAVGRGTK
                     VKASGDFKTSEEVIEMMKAGADRVASSSSGEVLEQLNSEELHEQGASHSMY"
     gene            <1246250..>1247497
                     /locus_tag="ACHE_70420S"
                     /db_xref="GeneID:66985935"
     mRNA            join(<1246250..1246270,1246320..1246465,1246531..>1247497)
                     /locus_tag="ACHE_70420S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282751.1"
                     /db_xref="GeneID:66985935"
     CDS             join(1246250..1246270,1246320..1246465,1246531..1247497)
                     /locus_tag="ACHE_70420S"
                     /note="COG:L;
                     EggNog:ENOG410PGU9;
                     InterPro:IPR029028,IPR012340,IPR029026,IPR003750;
                     PFAM:PF02598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140099.1"
                     /db_xref="GeneID:66985935"
                     /translation="MKGPNAKKRKTSHDQNNGRNDNQDDIFTSKPTAVFTPKGGRSHT
                     LSIAIPGSIVANCHSVEQKSFLAGSIARALAVFCVDEVIIFDDDEKSNNTKKNYNDSN
                     DANDSPMTETKHQISRDGSQPGYFTAYSDPSHYLAHLLSYLETPPYLRKHLFPMHPNL
                     RTAGLLPSLDMPHHLRANEWCDYRDGVAISETVVDTGLPQKVNVTNEQYFDNARVTVR
                     FSSQDEPDNAEAVDSSAPRTEAGYYWGYSVRRCGRLSSVFEECPFDGGYDLSFGTSER
                     GAPLTEVLKQDEGDGGGGDPGYKHLLIIFGGVAGLETAVRNDHQLREMGIRPTEAEKL
                     FDHWVNILPGQGSRTIRTEEAVWLGLTGLRGLVEGTHRLRGSS"
     gene            complement(<1247800..>1248753)
                     /locus_tag="ACHE_70421A"
                     /db_xref="GeneID:66985936"
     mRNA            complement(join(<1247800..1247862,1247924..1248651,
                     1248711..>1248753))
                     /locus_tag="ACHE_70421A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282752.1"
                     /db_xref="GeneID:66985936"
     CDS             complement(join(1247800..1247862,1247924..1248651,
                     1248711..1248753))
                     /locus_tag="ACHE_70421A"
                     /note="COG:Q;
                     EggNog:ENOG410Q2B0;
                     InterPro:IPR036291,IPR002347,IPR020904;
                     PFAM:PF00106,PF13561;
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140100.1"
                     /db_xref="GeneID:66985936"
                     /translation="MAFARRLAILPGGLGGLGSSIGKKLRQQGARLAILYAPFEADRR
                     DELLEAGYAGATNTADDIRTYACDITSPESVQSAFDTLEKEMVAPSTSSPAERAFPSI
                     LVNTAGYVSLNDMEHTPPAETMKHLTTNVMGPMLCSQAFARLYFAASKAAESSTSPPP
                     PGRIVNIASQAAYVALPKQSAYCASKAALLGLTRSMASEWGGRGIASNTVSPTVAWTE
                     LAQKAWGDASVKEAMLQAIPTGKFAMPEEVADSVLFLCQDSSAMINGADIKIDGGYTI
                     R"
     gene            complement(<1249827..>1251554)
                     /locus_tag="ACHE_70422A"
                     /db_xref="GeneID:66985937"
     mRNA            complement(<1249827..>1251554)
                     /locus_tag="ACHE_70422A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282754.1"
                     /db_xref="GeneID:66985937"
     CDS             complement(1249827..1251554)
                     /locus_tag="ACHE_70422A"
                     /note="COG:S;
                     EggNog:ENOG410PI2K;
                     TransMembrane:1 (i90-107o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140101.1"
                     /db_xref="GeneID:66985937"
                     /translation="MLLPRNISRIPRITRPLRPPSIRPQVHHQNRLFTQTSNHQLVSP
                     ALTRPQLPFLSTSTRLTPWPIHLRQHFARLMSTESRDYYRRRISRGLRIGLSFYAILV
                     LFQVIKLGMYQEGIEHQWPTPEEWTWKSRWCLRSARALMHPEEIGRLMTNWPMVAGYL
                     RELIERLEDLNGEGKGLEVGENGFDVSGKSEPWRRGYFQALMGAAKAAENLDGWLTDR
                     KQRISAPAEYVVGPSNPRPKPMPAGQKKVPREEDSEAASPSAETFYIKILTTNGFETR
                     QKVDAALAYADWLDYKGLKETAGDMYIWAMDIASTGLSVDAGKVVDRRTGVLKNNSNA
                     PASDNIIRVSTALAVHHAKQGNLSNALSIFTSVLKARRSSPPGDTATIPAVPSPATAN
                     NDAISSLFYSIRNMLVPAEYPPPPPSGNDPPLRNPSAICDEAALMTYIGEIIYASSSK
                     ETGLAWTRDAVDTAEATVLELGSPTVDSDGNPRQRCAECLKVGLENWRTMVGNLVARA
                     ELEEIQAADKAQSSWFGGEKSVKAKALERKRWEAEKLILEDRARKLRSIIEGETGFEG
                     IIPGSSLFV"
     gene            complement(<1251843..>1253851)
                     /gene="MET3"
                     /locus_tag="ACHE_70423A"
                     /db_xref="GeneID:66985938"
     mRNA            complement(join(<1251843..1253187,1253354..1253536,
                     1253595..1253622,1253683..>1253851))
                     /gene="MET3"
                     /locus_tag="ACHE_70423A"
                     /product="sulfate adenylyltransferase"
                     /transcript_id="XM_043282755.1"
                     /db_xref="GeneID:66985938"
     CDS             complement(join(1251843..1253187,1253354..1253536,
                     1253595..1253622,1253683..1253851))
                     /gene="MET3"
                     /locus_tag="ACHE_70423A"
                     /note="COG:P;
                     EggNog:ENOG410PFXE;
                     InterPro:IPR027417,IPR025980,IPR024951,IPR002650,
                     IPR015947,IPR014729,IPR027535,IPR002891;
                     PFAM:PF01583,PF14306,PF01747;
                     go_function: GO:0004020 - adenylylsulfate kinase activity
                     [Evidence IEA];
                     go_function: GO:0004781 - sulfate adenylyltransferase
                     (ATP) activity [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0000096 - sulfur amino acid metabolic
                     process [Evidence IEA];
                     go_process: GO:0000103 - sulfate assimilation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="sulfate adenylyltransferase"
                     /protein_id="XP_043140102.1"
                     /db_xref="GeneID:66985938"
                     /translation="MANSPHGGVLKDLLARDAPRNNELSAEAETLPAVVLNERQLCDL
                     ELIMNGGFSPLEGFMNEKDWSSVCENVRLADGNLFSMPITLDVSQQTVSDNNLQPGAR
                     ITLRDFRDDRNLAILTIDDIYRPDKQKEAKLVFGGDEDHPAVKYLYTKTEEFYVGGKI
                     EAVNKLAHYDYVALRYTPAELRIHFDKLGWNRVVAFQTRNPMHRAHRELTVRAARAQQ
                     ANVLIHPVVGLTKPGDIDHFTRVRAYQALLPSYPNGMAVLGLLPLAMRMGGPREAIWH
                     AIIRKNHGATHFIVGRDHAGPGKNSKGEEFYGPYDAQHAVEKYKAELGIEVVEFQQVT
                     YCPDDDEYRPKDEVPAGVRTLDISGTELRKRLRTGAHIPEWFSYPEVVKILRESNPPR
                     ASQGFTIFLTGYINSGKDAIARALQATLNQQGGRSVSLLLGDTVRHELSSELGFSRED
                     RHKNIQRISFVAGELTRAGAAVIAAPIAPHEHSRKAAREAVSQLGGSFFLVHVNTPLE
                     YCEKTDKRGIYAKARAGEIQGFTGVDDSYETPTDADLTVDVSKQSVRSIVHEIVLMLE
                     SEGYFDRA"
     gene            complement(<1256282..>1257267)
                     /locus_tag="ACHE_70424A"
                     /db_xref="GeneID:66985939"
     mRNA            complement(join(<1256282..1257027,1257090..>1257267))
                     /locus_tag="ACHE_70424A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282756.1"
                     /db_xref="GeneID:66985939"
     CDS             complement(join(1256282..1257027,1257090..1257267))
                     /locus_tag="ACHE_70424A"
                     /note="BUSCO:EOG09264FVQ;
                     COG:E;
                     EggNog:ENOG410PI92;
                     InterPro:IPR011800,IPR002500,IPR014729,IPR004511;
                     PFAM:PF01507;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004604 - phosphoadenylyl-sulfate
                     reductase (thioredoxin) activity [Evidence IEA];
                     go_process: GO:0019379 - sulfate assimilation,
                     phosphoadenylyl sulfate reduction by
                     phosphoadenylyl-sulfate reductase (thioredoxin) [Evidence
                     IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140103.1"
                     /db_xref="GeneID:66985939"
                     /translation="MPAKTPINYPSEEAIDARDSQTESGYVSGGSSDDYMPEIVFTKP
                     HLQFLNRQLQFLEPQDVLRWCITSLPHLFQTTAFGLTGLVTIDMLSKLEVPRPQVVDL
                     IFLDTLHHFKETLDLVDRVRRRYPNNNIHVYKPEGVNSEEEFAKKFGPRLWETDDQFY
                     DWVAKVEPAQRAYRELNVHAVLTGRRRSQGGKRGDLDVIEVDEAGLIKINPFANWSFD
                     QVKRYVKENNVPYNELLDRGYKSVGDYHSTQPVKENEDERSGRWKGQEKTECGIHNPR
                     SKYAQYLMDLERKRQEEALTSALQTQLSTAQ"
     gene            <1258344..>1259881
                     /locus_tag="ACHE_70425S"
                     /db_xref="GeneID:66985940"
     mRNA            join(<1258344..1259183,1259242..1259499,1259549..>1259881)
                     /locus_tag="ACHE_70425S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282757.1"
                     /db_xref="GeneID:66985940"
     CDS             join(1258344..1259183,1259242..1259499,1259549..1259881)
                     /locus_tag="ACHE_70425S"
                     /note="COG:E;
                     EggNog:ENOG410PMA2;
                     InterPro:IPR036412,IPR023214;
                     PFAM:PF00702,PF12710,PF06888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140104.1"
                     /db_xref="GeneID:66985940"
                     /translation="MAQANPTGTSRPVRPTLRHTLSGTSVIQDHQQYKPQVPINQSIG
                     DVLGSATEPARGPLTFNANPISPDPEKVTDSGIIHSIFDHQANPLPAGTPQLVATIYY
                     KSSDPIHPHLHPDVSGNVRSGDKLPSPMVPVGSAPTVDIEKIPREPPAPEPEPLDHLY
                     GPFVSQLCLTNFLQILETLPTPYQRMNTSHRCLDQDDQPRVVEVTFSPPPNPNYLTFA
                     DLRKHESIWRFEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIQNEVIDEIAKFIGVE
                     KEVSEITERAMNGELDFSQSLQERVGLLKGVPADVFDKLKSVITISPGARELCKSLKA
                     LGFKMAVLSGGFQPLAEWLAGELGLDYAFANHLEVDPASQTLTGKLVPTFPIIHAEQK
                     RSLLHSLAAENNIPVSQTIAVGDGANDLPMLHAAGLGVAWRAKSKVQLEAPTRLNGES
                     LTDILYLLGLDKRDVKELTGELVDDA"
     gene            complement(<1260441..>1261691)
                     /locus_tag="ACHE_70426A"
                     /db_xref="GeneID:66985941"
     mRNA            complement(<1260441..>1261691)
                     /locus_tag="ACHE_70426A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282758.1"
                     /db_xref="GeneID:66985941"
     CDS             complement(1260441..1261691)
                     /locus_tag="ACHE_70426A"
                     /note="BUSCO:EOG0926131E;
                     COG:H;
                     EggNog:ENOG410PI7C;
                     InterPro:IPR031691,IPR006638,IPR007197,IPR003698,
                     IPR013785;
                     PFAM:PF04055,PF16881;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016992 - lipoate synthase activity
                     [Evidence IEA];
                     go_function: GO:0051536 - iron-sulfur cluster binding
                     [Evidence IEA];
                     go_function: GO:0051539 - 4 iron, 4 sulfur cluster binding
                     [Evidence IEA];
                     go_process: GO:0009107 - lipoate biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140105.1"
                     /db_xref="GeneID:66985941"
                     /translation="MAAVSSSPFRLLNATSRVVPQVGAAVPIGARSYATTDPSPSATS
                     SPTTLRRKTTFKDKLNAGPSFADFVSGGNDSTPLDPSEAYELKTALVGPAGKKKEMTR
                     LPSWLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGNDKSAATATIMLM
                     GDTCTRGCRFCSVKTSRAPPPLDPHEPENTAEAISRWGLGYVVLTSVDRDDLVDGGAR
                     HFAETVIKIKQKAPNMLVECLTGDYAGDTEMVSLVARSGLDVYAHNVETVEALTPQVR
                     DRRAKFQQSIRVLDAAKKARPDLITKTSLMLGLGETEEQLWDTLRQLRAVNVDVVTFG
                     QYMRPTKRHMAVHEYVTPDQFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLK
                     KRRAGAGSAETVSDKTIAVGEATR"
     gene            complement(<1261895..>1264073)
                     /locus_tag="ACHE_70427A"
                     /db_xref="GeneID:66985942"
     mRNA            complement(join(<1261895..1261930,1262188..1263072,
                     1263135..>1264073))
                     /locus_tag="ACHE_70427A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282759.1"
                     /db_xref="GeneID:66985942"
     CDS             complement(join(1261895..1261930,1262188..1263072,
                     1263135..1264073))
                     /locus_tag="ACHE_70427A"
                     /note="COG:S;
                     EggNog:ENOG410PYYU"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140106.1"
                     /db_xref="GeneID:66985942"
                     /translation="MVPSYANRNMPPYYMKENIMPHSNNFNHHNNSTSPSAPRYSPNL
                     RPWRRQHSHGSLSFMTSPRLEQTEYTTSQQQRRPADGAPVCVSPFRSVRRMKQPFQLM
                     LPTSPACESTATFAKEPRRLHPSPSLSDSRESHPSSSSTYFSPKPESESDNEPEFNIA
                     CACAPGENICDNCNVQQSPQIQNEEQKRSVEITNVHMAHSTLVKQYGDVTANDRETTP
                     TSAEIESTPSPNSEETGEEDTLGRLQRARAGTTSTQASWVPDNFSYCQNWFQGVETMD
                     VKDEKSREHSRRKFQIVQVENKITPSSPPSNHDVKDVKLAVASRTKPKLVDISRQSSP
                     LMSCSVPAHQDPVPSTPDHRQQEVSAFSPDTPLEIADSGYVTHLACFSLDDSRDDKED
                     DEYTDASSIASESVSSTVVCEKPAINSDRPILPNKTDQPPNATLAPKPDASPGTSSNK
                     SEREQLEKWWDHEWTIDQLEQSVKDFPESKLKLTSPVIMFLRESDEKSLIRQFEKVFP
                     DAAEYQLDCLCASLIARNYIFELCSNHRRNSGLSRRLNVASEKNCPNLGIRFAQALPS
                     QIKDQVLGSRSTELCKDLDAMVNDMLFAVTGKADETLKSAITQNMSNDRPWIP"
     gene            <1265304..>1267099
                     /gene="IPI3"
                     /locus_tag="ACHE_70428S"
                     /db_xref="GeneID:66985943"
     mRNA            join(<1265304..1265651,1265714..>1267099)
                     /gene="IPI3"
                     /locus_tag="ACHE_70428S"
                     /product="pre-rRNA-processing protein Ipi3"
                     /transcript_id="XM_043282760.1"
                     /db_xref="GeneID:66985943"
     CDS             join(1265304..1265651,1265714..1267099)
                     /gene="IPI3"
                     /locus_tag="ACHE_70428S"
                     /note="COG:S;
                     EggNog:ENOG410PKTI;
                     InterPro:IPR036322,IPR015943,IPR019775,IPR001680,
                     IPR017986;
                     PFAM:PF00400;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="pre-rRNA-processing protein Ipi3"
                     /protein_id="XP_043140107.1"
                     /db_xref="GeneID:66985943"
                     /translation="MLSECFIASTLTSGKAPASASLRDVGICLQEFQPAPALRSTFKK
                     SSTAGNCLAVSPSHVFAAQSEKAIVHVYSREKGNQEATVPFPERIRSLAVAGGKNGDI
                     LVLGTEGGRLILWETCTGRQVATTASHLQPVTSLVVDRTSNFILSGSSDASIHVWSLA
                     NILSFIKPPSGRDRQQPNSPIRTFSNHRAAITSIALGHSAGRYNIAVSTAKDNTAVAW
                     DYHTGRALRTFLLPSSATCVTLDPVDRAFYVGYEDGSVQCVEFYKNQSVQHPLHDPSL
                     QSTPAQPSAEDRWLPPSSDTGAVQSLALSYDGTILLTGQHNGKVLSWNVARRKYATIV
                     ADYTHPVTNLSMLPPNGLPHPSLDLTRIAHTIVKPRYDQTLSESSVNPGAVPADYAFQ
                     THLLPTPKDTQKSKTKADPFSEALTHAFFPDSMMEEGLAELAALSQGQQQPGTQQPSS
                     STVHSTQALEDTTAKDTQIATLEAELSILKKKSTVSETARQTTTDEATKLRSDLIHLQ
                     DYVNELHQKQEQAQREKVQRQARKEKREAKRREAWFAAEKKGRNGDAVVKMMDLADGA
                     QTSDSDDQSSD"
     gene            complement(<1267551..>1270111)
                     /locus_tag="ACHE_70429A"
                     /db_xref="GeneID:66985944"
     mRNA            complement(join(<1267551..1268731,1268782..>1270111))
                     /locus_tag="ACHE_70429A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282761.1"
                     /db_xref="GeneID:66985944"
     CDS             complement(join(1267551..1268731,1268782..1270111))
                     /locus_tag="ACHE_70429A"
                     /note="COG:S;
                     EggNog:ENOG410PNCU;
                     InterPro:IPR000742;
                     TransMembrane:1 (o513-540i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140108.1"
                     /db_xref="GeneID:66985944"
                     /translation="MNPNPMGNPGPLSELEKAPERKGSVQRARQMLEAGKRPRVQEPE
                     SSKDRRDVCSISSKALHMTQWPLPDNSTMPGNFLDPQASLIPRRPPPRRPPRPDAPSP
                     SIYSERSAPGFAPSPLHSREPRQSFSQPSPYQNPSRIPPRDSPSPSGRSNPHVSIFNE
                     DLSDTDSVLSILNYPLPPQQGRTAGLVPPPSNSVRHTFGRRSSVSPIPEELTESPTNV
                     DDSYASSRAIPSDYGSPTHESEILGTYLDDESDDCQEAKKPVEENGEGLVRSASVGTR
                     GKPSLRVVRKPSSESPAPSEGQSRALEASTIGRALSGTPADEDLRAPVPSPKESYSSL
                     SDRSYEFDLEKGAFVLDIGQPRPEFQHDPGNQPGLPRAAPTMSDKRPGARRPPRLDMD
                     AVRDAQARGSLTSLPDLIRRATKLASHLDHGRTASGNDNLSSSNDSRSLPWNRHRNSG
                     SLQDTLENFPPPPRRNTEGYSSWPMFLRRSTLHNIETLNSHSDHGEAEEKPAKRSRRC
                     CGMPLWLFILICVAVIIIITLAVLLPIFLVAVPKDRANNESTCEASHPCKNGGFSVSS
                     GSVCSCVCTNGYTGSQCTIAGDSSCTTTDIDGGSTSKTATMGSGLPQLFQDSQETFNI
                     RLDPVTIMALFSKSNVSCTTQNELVSINDVSSKTRRFFPVQLDDLASQTLAARDAVAT
                     INGIIFDDSSPTAEPLPTATDITTASPPPQETSTTSSSETSTTSAPTTTAQTTTPTTS
                     PTSTSTSNPTSTATSVPQKALTFSQVAILYIFEMTGTLNAAIQSEEDIRHYLKSTYST
                     SNGGNYDVDLSRSGVQANFALDFGEWTITMGNGTKAGG"
     gene            complement(<1274483..>1275347)
                     /locus_tag="ACHE_70430A"
                     /db_xref="GeneID:66985945"
     mRNA            complement(join(<1274483..1274954,1275009..1275106,
                     1275162..>1275347))
                     /locus_tag="ACHE_70430A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282762.1"
                     /db_xref="GeneID:66985945"
     CDS             complement(join(1274483..1274954,1275009..1275106,
                     1275162..1275347))
                     /locus_tag="ACHE_70430A"
                     /note="COG:S;
                     EggNog:ENOG410PS2Q;
                     InterPro:IPR040357;
                     go_process: GO:0070072 - vacuolar proton-transporting
                     V-type ATPase complex assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140109.1"
                     /db_xref="GeneID:66985945"
                     /translation="MAQILTPPASRHTSESPEVRKETEVDASAELLQSLDTLLERYLH
                     LLDRHQKLQADLAKRLSSGFFSLAQANYTCPPGRRYGADYYDERMKATRKVSLRTPSK
                     ETEESEDSTEAKDYGHTFAIEYTPDNRGYEQEKDKGTSESPSDTAPSDENPDHHKEGE
                     NSTRKPDNASAPENLETEFTAQKPRPIKKFGSSDPITWYGILVPPSLRSAQKSFTEAV
                     NEHLSELANVIVEMRAFEKKIEEVRNRLNHNGS"
     gene            <1275803..>1276438
                     /locus_tag="ACHE_70431S"
                     /db_xref="GeneID:66985946"
     mRNA            join(<1275803..1275853,1275924..1276088,1276193..1276255,
                     1276309..1276358,1276429..>1276438)
                     /locus_tag="ACHE_70431S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282763.1"
                     /db_xref="GeneID:66985946"
     CDS             join(1275803..1275853,1275924..1276088,1276193..1276255,
                     1276309..1276358,1276429..1276438)
                     /locus_tag="ACHE_70431S"
                     /note="COG:A;
                     EggNog:ENOG410PPKQ;
                     InterPro:IPR008011;
                     PFAM:PF13233,PF05347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140110.1"
                     /db_xref="GeneID:66985946"
                     /translation="MSVAALNRDTAFQARSLFRSLLRQSSQFSAFNFREYARRRTRDA
                     FREHQNEKEDRKIQELFQEGLQNLRMMKRQTVISQFYQFDKLVVEGQETGKQTGGQGD
                     IVRQKDTGWD"
     gene            <1276904..>1279205
                     /locus_tag="ACHE_70432S"
                     /db_xref="GeneID:66985947"
     mRNA            join(<1276904..1276915,1276968..>1279205)
                     /locus_tag="ACHE_70432S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282765.1"
                     /db_xref="GeneID:66985947"
     CDS             join(1276904..1276915,1276968..1279205)
                     /locus_tag="ACHE_70432S"
                     /note="COG:S;
                     EggNog:ENOG410PPDI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140111.1"
                     /db_xref="GeneID:66985947"
                     /translation="MPPTFRSSRSGRHLGETTTARTRTGQIDHDVFEGLPVRRWTRQH
                     QMVSQAPKPDEAESIFQGPGGKQTLPEHPMPRDSQLLTPTSKALLRAARAGCIYIRQA
                     PKEAEDINLIVNEEKETTDAEEGGAAASGQSKAERSFVTRKWMTVPRHMEPPEVEFLA
                     KRRPGLPSLYGAAATGVDGTPNVPMRRTRFKKMDPATGNVSVYEAWVPEGHRIEGEIT
                     ADDQVVPGNAEATVNSEAPAPGTVVEGVGTVNAEGVVVAEAGSAAVMTPPKRRPPPPK
                     RKGKGFKGRRKKVMFAPGEGVDASAVHGAGAAGDGVMGTDGTKSEDGDVSRGDQGGQE
                     DEDDDGEEGEESDEGDESMMDAKTPETPAAEPAQPTQTPQPVPAETAPEPQAPGDASP
                     VAEQTPAPVSDKPSDEKPAPADVTMTDYQPEPAASEPQPAPGTQQPTAPEQPAPAAET
                     TTDNQQQAEQPALHAPEESTEKPQETVKTEPDQQESQDAMDTSTDQPLEQQQQQQQQQ
                     QQPQEQEAAPKPEPEQQEHDTTTTENQDADVLGTLERSLDAPASSEQTETQPEPEAEP
                     EPEPEPEQIQASTEPAAPTPAAATETGPTEEQPSTDNREVEKPAEEQQQPQQQQEQEQ
                     QPKKEVEDRPPVQQSIEQPQEQEQQTKEEVEDQPPVQQPIEQLQEQQQQQPEGEQQLT
                     ERFAAGPTESSKHSAEQPAESPAEQPEEEPEAQPQPQQEADEAQQRQEQKQQEQPPAP
                     AQEGEPGQN"
     gene            complement(<1280004..>1282669)
                     /locus_tag="ACHE_70433A"
                     /db_xref="GeneID:66985948"
     mRNA            complement(join(<1280004..1280751,1280804..1281003,
                     1281052..1281425,1281481..>1282669))
                     /locus_tag="ACHE_70433A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282766.1"
                     /db_xref="GeneID:66985948"
     CDS             complement(join(1280004..1280751,1280804..1281003,
                     1281052..1281425,1281481..1282669))
                     /locus_tag="ACHE_70433A"
                     /note="COG:K;
                     EggNog:ENOG410PHWP;
                     InterPro:IPR006560,IPR003616,IPR001214;
                     PFAM:PF17907,PF00856;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0018024 - histone-lysine
                     N-methyltransferase activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140112.1"
                     /db_xref="GeneID:66985948"
                     /translation="MKETQVASAATSTLLTDLPQKIEIQEHTHIDEITGLETPEQLLT
                     PENSRSETSSNNENASSNDEKEKPVARRRSTRVTRASLQAAQLETPETESNDASSATN
                     GDTSVNAGLGGKRASSRLRHSIAVMEWSKASETNESQSHANTDKHPLTPDTSVSETSQ
                     EPASEEADMSIQPRTLRKRADKSKEDTVEDKEEGTAESKDNDEEQTLRRSSRRGVAER
                     VASRLAEQANTILGKRTRGAKAKEPDRRSSLRPRSIAPLKEEPAPSTNNDPSAKKRRV
                     SDSDLPSSTKSQQEEVFTQKEEEEEEEAESAPVLRRSKRWLAHGLYSGQEPEGTRPTQ
                     TKKNKTTFRRRQRDAPRKYLPMPMFAGDRLLQNGRDFQLPFDIFSPLPPGQPKPNEWR
                     KTNKNVFVGEAGSIWRANKDMELSKCMCTADTGCDENCQNRYMFYECDNGNCGLGRDC
                     GNRSFDELKQRTKAGGKYNIGVEVIKTSDRGYGVRSNRTFEANQIIVEYTGEIITQSE
                     CEKRMRTTYKKNECYYLMYFDQNMIIDATRGSIARFVNHSCEPNCRMEKWTVAGKPRM
                     ALFAGDRGIMTGEELTYDYNFDPYSQKNVQQCRCGSANCRGVLGPRPREKEQRSKERE
                     EQKKQNASAKKTQTKTTTKRKIGSVIDESASRLNKKRKTVKTGVKKAVSRSRASVSRS
                     TTTKKTEPATKYTTKRTTKATTKSKAATAIATATKTAPRTKRNVKLPKVTTKAKVKTT
                     VCTTTKAKPAAKAQPSKTKAASTLKRPSAETKAKILAAAKGTGRKRGPYKKKTDAKEE
                     VKPKAGRGRWGGARTKTAKAAKGTAPKKTGRGVKAGKK"
     gene            complement(<1283698..>1285536)
                     /gene="ERF2"
                     /locus_tag="ACHE_70434A"
                     /db_xref="GeneID:66985949"
     mRNA            complement(<1283698..>1285536)
                     /gene="ERF2"
                     /locus_tag="ACHE_70434A"
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /transcript_id="XM_043282767.1"
                     /db_xref="GeneID:66985949"
     CDS             complement(1283698..1285536)
                     /gene="ERF2"
                     /locus_tag="ACHE_70434A"
                     /note="BUSCO:EOG09264FYY;
                     COG:S;
                     EggNog:ENOG410PGMU;
                     InterPro:IPR001594;
                     PFAM:PF01529;
                     TransMembrane:4 (i310-334o340-362i459-480o500-522i);
                     go_function: GO:0016409 - palmitoyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /protein_id="XP_043140113.1"
                     /db_xref="GeneID:66985949"
                     /translation="MADNRGPGDAINLPSSQHALGLPRPPSVGGISSRATDIISEDGE
                     QSQSFTGASSQPPRSQPSVSRRGPPPARSSIAASSHVASRPGSSASRISRTHIPSLTA
                     QGFFRPMSSQRLQAHRGRPMTKETFASASTDDWNDRASQKRRSLVSNSTHHQGSLPPV
                     EHEAPPSRGTEFTDPIIPDRTNSASPTGNMTARSLGESARLLHERERIQQKTPPQQLN
                     LPAANYRFPEPHDQPQKSPLSFLSMQDKPHPHDCRDNGAHERLSSNASSRRSIEKQGQ
                     KPAKSHLGKNYEYFMGNTIFFARGRFQNSRDKPINIATGILVVVPSALFFAYSAPWLW
                     HNISPAIPILFAYVFCVCFSSFVHASVVDPGVIPRNLHPMPPPDPTDDPLAIGPPTND
                     WVMVKLATSEVAAMDVPVKYCRTCNIWRPPRCYHCRVCDNCVETLDHHCVWLNNCVGR
                     RNYRYFFTFVSYSTILAFFLLGASLAHILVYREREGISFGSAIDTLRVPWAMVIYGAL
                     AGPYPASLWAYHLFLVGRGETTREYLNSHKFVKADRHRPFTQGNVITNWISVFFRPRP
                     PTYMEFKRPYEAGDQRLSNEKRKYRKPDLEAQTGIEMQQVPAEQQG"
     gene            <1286209..>1286926
                     /locus_tag="ACHE_70435S"
                     /db_xref="GeneID:66985950"
     mRNA            join(<1286209..1286352,1286412..1286455,1286599..1286800,
                     1286876..>1286926)
                     /locus_tag="ACHE_70435S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282768.1"
                     /db_xref="GeneID:66985950"
     CDS             join(1286209..1286352,1286412..1286455,1286599..1286800,
                     1286876..1286926)
                     /locus_tag="ACHE_70435S"
                     /note="COG:S;
                     EggNog:ENOG410PQWI;
                     InterPro:IPR039965;
                     TransMembrane:1 (i47-66o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140114.1"
                     /db_xref="GeneID:66985950"
                     /translation="MSSIAAMASRRAFARQSILRAPPRRFYSASKMEEADLEKAPKRD
                     PELYVLLGVMSGAFLIAGWYFGRKPTSVTSESNVRIGQSAMPWHAAEEDGKVCKYQYH
                     PHGDTSQPLRNAPSAMNTVIVPKVTLPEDLHERFNKLGKEEWDY"
     gene            complement(<1287364..>1290399)
                     /locus_tag="ACHE_70436A"
                     /db_xref="GeneID:66985951"
     mRNA            complement(join(<1287364..1287954,1288037..1290071,
                     1290137..>1290399))
                     /locus_tag="ACHE_70436A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282769.1"
                     /db_xref="GeneID:66985951"
     CDS             complement(join(1287364..1287954,1288037..1290071,
                     1290137..1290399))
                     /locus_tag="ACHE_70436A"
                     /note="CAZy:GT39;
                     COG:O;
                     EggNog:ENOG410PFPS;
                     InterPro:IPR036300,IPR016093,IPR027005,IPR027004,
                     IPR003342,IPR032421;
                     PFAM:PF16192,PF02815,PF02366;
                     TransMembrane:11
                     (i60-77o144-165i172-189o195-215i227-246o252-274i286-
                     310o613-634i655-677o683-701i713-733o);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0000030 - mannosyltransferase activity
                     [Evidence IEA];
                     go_function: GO:0004169 -
                     dolichyl-phosphate-mannose-protein mannosyltransferase
                     activity [Evidence IEA];
                     go_process: GO:0006493 - protein O-linked glycosylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140115.1"
                     /db_xref="GeneID:66985951"
                     /translation="MMTRSRDTLEVKPLPKSGRSPSRSPNSRSRKKESAGSSSYASDG
                     VTDNNIFALPTKDYRVLAFITIVAAVVRLFRIYQPSSVVFDEVHFGGFASKYIKGRFF
                     MDVHPPLAKLLLTLAGWLGGFDGNFDFKDIGKDYLEPAVPYVAMRMLPAVMGVLTVPL
                     LFLTLRASGCHITSAAMGAGVLIFENALVTQSRLILLDAPLVFFTALTALSFTCFTNQ
                     QEQGPSHAFGGLWWFWLASTGLCLGATLSVKWVGLFTVAWVGSLTILQLWVLLGDTRT
                     VTPRVWFKHFFARVFCLIIIPIGFYCGMFAIHFLCLVNPGDGDGFMSSEFQATLNSKS
                     MQDVPADVVYGSRVTLRHVNTQGGYLHSHPHMFPTGSKQQQITLYPHKDENNIFVLEN
                     QTQPLGPYGEVPGIFAWDNITAENIYDGAVLRLYHPITHRRLHSHDERPPVTDVDWQF
                     EVSAYGFEGFAGDANDLFRVDIVKSASQGEEAKKRLRTIETKFRLIHIMTGCVLFSHK
                     VKLPEWGWGQQEVTCARGGSLPNSLWYIESNAHPMLPADTEKVNYKHPGFLGKFWELQ
                     KVMWTTNAGLTESHNWDSRPPSWPTLLRGINFWGKDHRQIYLLGNPFIWWSSTVAIVI
                     YIVFKGISIIRWQRHCGDYRNVNFKRFDYEIGTNVLGWFFHYFPFFLMARQLFLHHYL
                     PALYFAILALTQEIDFLANRIKSLGLPSKPVIGKLLMGVFLTLSIFTFTLYSPLVYGN
                     PWTQDACRKVKLLGSWDFDCNTFHTDLNHYVTQYVGKAAAVPTTQQQAPPIQVPPVQA
                     PPAQAALVQEPPAEQAPAQQQPQEEVKEAASEVEDPSANVTPEALPSIRGKKARVEFR
                     DQNGNVLPESLVAQLQQDGKVSVETRYEYRSRLANGHEVDVVDGKVKVAPPHPDVQGS
                     NPETAENKEKHQPVEDIPAPIAEESSVAVKESGSPEPKPASEGNEATD"
     gene            <1291089..>1292812
                     /gene="PRP21"
                     /locus_tag="ACHE_70437S"
                     /db_xref="GeneID:66985952"
     mRNA            join(<1291089..1291182,1291238..1291291,1291362..>1292812)
                     /gene="PRP21"
                     /locus_tag="ACHE_70437S"
                     /product="SF3a splicing factor complex subunit"
                     /transcript_id="XM_043282770.1"
                     /db_xref="GeneID:66985952"
     CDS             join(1291089..1291182,1291238..1291291,1291362..1292812)
                     /gene="PRP21"
                     /locus_tag="ACHE_70437S"
                     /note="BUSCO:EOG09264RIE;
                     COG:A;
                     EggNog:ENOG410PG4Z;
                     InterPro:IPR035967,IPR022030,IPR000061;
                     PFAM:PF01805,PF12230;
                     go_function: GO:0003723 - RNA binding [Evidence IEA];
                     go_process: GO:0006396 - RNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="SF3a splicing factor complex subunit"
                     /protein_id="XP_043140116.1"
                     /db_xref="GeneID:66985952"
                     /translation="MASTTNGNTPMPPEEVSKPPEGVVLPPKDIRAIVEKTAGYVSRN
                     GFVFEDRVREKERSNPKFSFLNPSDAYAPFYQWRLVEIKEGRGTAVAAGRPGEAVAAP
                     EPEERKGPAEPPGFYFSARMPIINAQDLEVVKLTALYVAKRGKSFMTALSQREARNFQ
                     FDFLRPQHSLYQFFTRLVDQYTILLRQEGIDEATSEKKRLLELEYNVKNKFHILDRAK
                     QRAEWVKYQEQQKQKREEEEEQERIAYAQIDWHDFVVVETVLFTEADDQAELPPPTSL
                     NDLQSASLEQKAMISLNPMRIEEAMPTDLEEPTYYNAYPVQPEPVPAVQPAGPVLPQQ
                     PIQPMPVPAAAAAATQEEEQRAAFQAQQAAAPPTGPRHAQQPMRIRSDYVPRAQARRL
                     NNAGPTALCPNCHQQIPVAELDQHMRIELLDPRWKEQRAKAESRSATTNLSTTDVYNN
                     LKRLASQRGDVFDSSVLPGAADPEEEARRKRMATGAPPAPGADGVPGMAPMQPMVGPS
                     GAPPHPQNMNVEDQIRHLHERYKQ"
     gene            complement(<1293240..>1294859)
                     /gene="ERG11_2"
                     /locus_tag="ACHE_70438A"
                     /db_xref="GeneID:66985953"
     mRNA            complement(join(<1293240..1294595,1294659..>1294859))
                     /gene="ERG11_2"
                     /locus_tag="ACHE_70438A"
                     /product="lanosterol 14-alpha-demethylase"
                     /transcript_id="XM_043282771.1"
                     /db_xref="GeneID:66985953"
     CDS             complement(join(1293240..1294595,1294659..1294859))
                     /gene="ERG11_2"
                     /locus_tag="ACHE_70438A"
                     /note="COG:Q;
                     EggNog:ENOG410PFY8;
                     InterPro:IPR001128,IPR002403,IPR017972,IPR036396;
                     PFAM:PF00067;
                     TransMembrane:2 (o6-27i39-55o);
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="lanosterol 14-alpha-demethylase"
                     /protein_id="XP_043140117.1"
                     /db_xref="GeneID:66985953"
                     /translation="MLSISLLGAYMAVAMPIAILINVAYQLIFHRWNKTQPPLVFHWI
                     LFLGSTISYGIDPYKFFFDCQEKYGDLFTFILLGQRTTVYLGVQGNEFILNGKLKDVN
                     AEEVYSPLTTPVFGSDVVYDCPNAKLMEQKKFIKFGLTQSALESHIPLIEKEVLEYLD
                     TSPYFQGFSGRVNISAAMAEITIFTAARALQGEEVRSKLTAEFADLYHDLDKGFSPIN
                     FMLPWAPLPHNNKRDAAHARMRAIYTDIINDRRHGEKGHNITQTSDMISNLMNCTYKT
                     GQPIPDKEIAHIMITLLMAGQHSSSSIGSWIMLRLAAHPEVIEELYQEQLANLNRDGQ
                     KLPPLRYQDLGRLPLHQNVIRETLRLHSSIHSLMRKVKNPLHVAGTPYIIPTSHVLLA
                     SPGVTALSDYYFPNANKWDPHRWDKGNQRDDNDDVNGEVVDYGYGAVSKGTSSPYLPF
                     GAGRHRCIGEKFAYVNLGVIMATIVRHVRFFNVDGKKGVPGTDYSSLFSGPVKPAVIG
                     WERRDDQPKI"
     gene            <1296516..>1297048
                     /locus_tag="ACHE_70439S"
                     /db_xref="GeneID:66985954"
     mRNA            join(<1296516..1296649,1296715..1296917,1296972..>1297048)
                     /locus_tag="ACHE_70439S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282772.1"
                     /db_xref="GeneID:66985954"
     CDS             join(1296516..1296649,1296715..1296917,1296972..1297048)
                     /locus_tag="ACHE_70439S"
                     /note="COG:S;
                     EggNog:ENOG410PR5C;
                     InterPro:IPR037523,IPR029068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140118.1"
                     /db_xref="GeneID:66985954"
                     /translation="MITGLAHINLLVPPGTLDQAYTFYGGTLGLYAAPVPERQKGTIA
                     WFNLTDDPKPQQIHVAFGTNEPDSTRHPCFRIESMEALQALRQRLWEHHLKGDAAAPM
                     HVDKPGEKISGPSGFEYPNRFFARDFAGNLLEFSV"
     gene            <1297877..>1299153
                     /locus_tag="ACHE_70440S"
                     /db_xref="GeneID:66985955"
     mRNA            join(<1297877..1298054,1298111..>1299153)
                     /locus_tag="ACHE_70440S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282773.1"
                     /db_xref="GeneID:66985955"
     CDS             join(1297877..1298054,1298111..1299153)
                     /locus_tag="ACHE_70440S"
                     /note="SECRETED:SignalP(1-22)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140119.1"
                     /db_xref="GeneID:66985955"
                     /translation="MRASASLFIFAAALSGFHGASGAAIPPNGQSLADSSIHYHIGTP
                     IQTPEAGAVKRDENAVLPTTTQGSMDEVNGVETNGGIERRGRGRGRGRGQGRNHNNNN
                     NHINHNNKTTPKSQNSAKPSKTPQPSHPATNKPTLTNKPATNKPAHPSQPVPSQSAHP
                     SQPAHPSQPAHPNEPAGPNNPAETDEPSGPSHNIEFNPEINLPDPTQDPQDPAQDPAQ
                     DPAEEQEAPQNPENPEGEAPPAPARRDLSKRKKHSRPSKPANKPANKPSNSPKPNDKP
                     SSIPKPTSKPTTTQHAQPTPSNHASSSAHPQPTPSNHPNEPSNQPDNDPDNEPGHEIS
                     IDPEINLPDPTQEQEQEQNPDENNQDGNIARRDPRGGRGRHHHHHIELNPVFNVDPTQ
                     NIGDDDNSNDDGQN"
     gene            complement(<1301455..>1303653)
                     /gene="SEC2"
                     /locus_tag="ACHE_70441A"
                     /db_xref="GeneID:66985956"
     mRNA            complement(join(<1301455..1302867,1302928..1303567,
                     1303646..>1303653))
                     /gene="SEC2"
                     /locus_tag="ACHE_70441A"
                     /product="rab guanine nucleotide exchange factor S2"
                     /transcript_id="XM_043282774.1"
                     /db_xref="GeneID:66985956"
     CDS             complement(join(1301455..1302867,1302928..1303567,
                     1303646..1303653))
                     /gene="SEC2"
                     /locus_tag="ACHE_70441A"
                     /note="COG:U;
                     EggNog:ENOG410PJPE;
                     InterPro:IPR040351,IPR009449;
                     PFAM:PF06428;
                     go_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IEA]"
                     /codon_start=1
                     /product="rab guanine nucleotide exchange factor S2"
                     /protein_id="XP_043140120.1"
                     /db_xref="GeneID:66985956"
                     /translation="MADLIAFHTYYSRHSFLSPSTMISRPNNHRRSLSSGNRSPSPDR
                     AVTRAKSTDGLSRFESKKPAPAVRSTSVGNFTDSGFSTLKDPRLAAPVEESEELSPAS
                     HHPDLNDEVAALSIKLVQAINNQTTLDDTLVATRQELEQAQAMVQTLELENEKYRRDI
                     DQEVLIRKADSDQEISRLQDALAEEKAQRAAVEKGKKTIEQELETLTAALFEEANKMV
                     AAAKLEREEIEKKNEQLRAQVKDTEYLLASHQDQLAELKAVMQGMNAAKDDTDTRTIA
                     STAPSSPAARRQSLQGMVKKNQETAQLPDQDQPAQPFEDILPGPSTSFPHLVKTVCRT
                     DHQAFEDFRDLFYVPQSRPPSRAPSGSYSGLNVMSLANFGSGSFGSTSSSPSKSQTHS
                     PSGSMSSPQPGSSHSPLKEKRFYKRALVEDIEPTLRLDLAPGISWLTRRTVINGICEG
                     SLLVEPMPPTGRDPCSMCGERRTAPEYQRCHRFRTSDSEAAQRYPLCSLCLERMRSCC
                     EFTGYLRLILDGHVRAGDSEEEKDVWEETVRLRERMFWSRVGAGVVPLHSQASAPVNG
                     LTGAQFDGPQPSILESTGVQTDAENDYHEYYNDDSDYDRASVYEDPFVSAGSASPAST
                     AYSGMNADQPERLDLGQEIYEPTVEQVTVSAAIQSPKSGESDAPIKQLTTQTVEPVIE
                     KETA"
     gene            <1305521..>1305869
                     /locus_tag="ACHE_70442S"
                     /db_xref="GeneID:66985957"
     mRNA            join(<1305521..1305527,1305586..>1305869)
                     /locus_tag="ACHE_70442S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282776.1"
                     /db_xref="GeneID:66985957"
     CDS             join(1305521..1305527,1305586..1305869)
                     /locus_tag="ACHE_70442S"
                     /note="BUSCO:EOG09265HEP;
                     COG:D;
                     EggNog:ENOG410PRK4;
                     InterPro:IPR002836,IPR036883;
                     PFAM:PF01984;
                     go_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140121.1"
                     /db_xref="GeneID:66985957"
                     /translation="MESERRSAILNQILEPEAVDRLNRIRLVKESRAADIESRLIMLA
                     QTGQLRQKVTEEQLKDLLNAISENQRKAEEESKIVISRRKGGWDDDDDLLDL"
     gene            complement(<1306069..>1306978)
                     /gene="COQ4"
                     /locus_tag="ACHE_70443A"
                     /db_xref="GeneID:66985958"
     mRNA            complement(join(<1306069..1306712,1306768..>1306978))
                     /gene="COQ4"
                     /locus_tag="ACHE_70443A"
                     /product="ubiquinone biosynthesis protein"
                     /transcript_id="XM_043282777.1"
                     /db_xref="GeneID:66985958"
     CDS             complement(join(1306069..1306712,1306768..1306978))
                     /gene="COQ4"
                     /locus_tag="ACHE_70443A"
                     /note="BUSCO:EOG092643VB;
                     COG:H;
                     EggNog:ENOG410PGMW;
                     InterPro:IPR007715,IPR027540;
                     PFAM:PF05019;
                     go_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA];
                     go_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein"
                     /protein_id="XP_043140122.1"
                     /db_xref="GeneID:66985958"
                     /translation="MSVPASRGALCIRALTRSTSLTPACCCVRSFSVLNRPPPKYPGH
                     VPLTFVERGALAVGSAVGSLLNPRRGDLIAALGEATATPYFIYRLRDAMLSDPTGRRI
                     LRDRPRITSENLPLPYLRSLPENSVGHTYAAWLDREGVSPDTRDNVQYIDDEECAYVM
                     QRYRECHDFYHAVTGLPVFVEGELALKAFEFLNTVIPMTGLSLFASVRLKPAEKERFF
                     SLHLPWAVRAGLKSKELINVYWEEVLEKNVDELRRELNIEAPPDLREIRKMIRQQKKR
                     EKEQQMSR"
     gene            <1307300..>1308783
                     /locus_tag="ACHE_70444S"
                     /db_xref="GeneID:66985959"
     mRNA            join(<1307300..1307440,1307491..1308045,1308098..1308152,
                     1308202..1308264,1308315..1308426,1308474..>1308783)
                     /locus_tag="ACHE_70444S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282778.1"
                     /db_xref="GeneID:66985959"
     CDS             join(1307300..1307440,1307491..1308045,1308098..1308152,
                     1308202..1308264,1308315..1308426,1308474..1308783)
                     /locus_tag="ACHE_70444S"
                     /note="COG:S;
                     EggNog:ENOG410PJG5;
                     InterPro:IPR001214;
                     PFAM:PF00856;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140123.1"
                     /db_xref="GeneID:66985959"
                     /translation="MKPTWWPGEQHESFTEWAISQGIIPNGVTPARFPGRGLGMIATR
                     NIKKGENLLRVPLEAMFTINCVPESFSSKFPEGTPVHALFAAFFTNGNAEDLQRYNLW
                     RSTWPSRQDFQDSMPIVWPEFLRGSNRDQTLLPPSISGTWNTFQKRKAEYPYDSSHQN
                     LLPQQTKRLQDAWEKVISVFPDTDWETFSFHWLIVNTRSFHYLMPGEEPPEDRNDAMA
                     LLPFADYFNHSDVIDDVKFNGKEYVFRSTESYVEGEEVYMSYGPHPNDFLLAEYGFFL
                     DKNECETLYLDDIIFRDLGPSLQEELNLHQYYGNYQVTSTGACYRTEIAACIKYMTPK
                     EWQNYVLGYSTKGVDDKKTETIIREWIKAYGEEANTTIAKLGDIRSSSETDGKVEMLL
                     KRWKQIYDLCQQAVEAVSC"
     gene            complement(<1308856..>1310103)
                     /locus_tag="ACHE_70445A"
                     /db_xref="GeneID:66985960"
     mRNA            complement(<1308856..>1310103)
                     /locus_tag="ACHE_70445A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282779.1"
                     /db_xref="GeneID:66985960"
     CDS             complement(1308856..1310103)
                     /locus_tag="ACHE_70445A"
                     /note="COG:H;
                     EggNog:ENOG410PMYW;
                     InterPro:IPR003710,IPR013752,IPR036291,IPR013332,
                     IPR008927,IPR013328;
                     PFAM:PF02558,PF08546;
                     go_function: GO:0008677 - 2-dehydropantoate 2-reductase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_process: GO:0015940 - pantothenate biosynthetic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140124.1"
                     /db_xref="GeneID:66985960"
                     /translation="MQDTNEVARETGTRPLSGRIHLLGIGNVGSFVAHSLAGRQSPPP
                     MTLLLHHSNVYRSWISKKECIAINVNGLDDVKSGFDVNVKSSDSDTWYSLPWDKEGTS
                     EERDRILSEKLKDGNIEKSLAQSEVDDSTIECAIVTVKANQTVRAVSSIRHRLTRDST
                     ILLLQNGMGTIDELNEKVFPDPSNRPHYMTGIFSHGLYQMSPFQVVHTGIGTTVLSPA
                     PSREVAATAGDNAADWAPTTKYLLRTLTLTPPLVAFAETPSSIVQYQLEKLAMNAVIN
                     PLTSLMECKNGEILYNYKFTRVMRLLLIEISSVILALPEVQGIPGIEARFDPERLRWM
                     AVQLASKTRHNMSSMLQDMLSGKATEIEYINGYIVRRGEELGIKCVVNFMIKEMVQAR
                     VALLHQRESGAVPMDLSGFEDEQ"
     gene            <1310558..>1311413
                     /locus_tag="ACHE_70446S"
                     /db_xref="GeneID:66985961"
     mRNA            join(<1310558..1310738,1310800..1310966,1311015..>1311413)
                     /locus_tag="ACHE_70446S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282780.1"
                     /db_xref="GeneID:66985961"
     CDS             join(1310558..1310738,1310800..1310966,1311015..1311413)
                     /locus_tag="ACHE_70446S"
                     /note="COG:A;
                     EggNog:ENOG410PR5T;
                     InterPro:IPR011082,IPR007146;
                     PFAM:PF04000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140125.1"
                     /db_xref="GeneID:66985961"
                     /translation="MEAKELFPVLEQLDDDIDDVEEMIQPLLNRSLAETSKNLPVLDK
                     AKFYVMVTYALENVIFSYLNLRGEDPKAHAVWRELTRLRQYFDKIKTAETGPEQRTMT
                     LDKEAANRFIKHGLAGNDRIDLERKEREAKERAVARRKELELLMNSAKSEQSSKDHSG
                     DSRSDANSGPDEDEDDDSDNDETTVKKSASDPKLVDDPHFEKTERTGKNKGKNKRFKQ
                     GKKLDKEGLRKENAERKQKKKKNRKERNGK"
     gene            <1312225..>1312882
                     /locus_tag="ACHE_70447S"
                     /db_xref="GeneID:66985962"
     mRNA            join(<1312225..1312454,1312534..1312786,1312850..>1312882)
                     /locus_tag="ACHE_70447S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282781.1"
                     /db_xref="GeneID:66985962"
     CDS             join(1312225..1312454,1312534..1312786,1312850..1312882)
                     /locus_tag="ACHE_70447S"
                     /note="BUSCO:EOG09265RGS;
                     COG:S;
                     EggNog:ENOG410PQKG;
                     InterPro:IPR009069,IPR018648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140126.1"
                     /db_xref="GeneID:66985962"
                     /translation="MPRQRRGAAPAPTPARSAPTRPTAAPPRPATAPQQQQYQPHSTA
                     AHPSQSQQHAPHPPQVQQSQGPGLFGQMASTAAGVAVGSSIGHAIGGMFSGGSSAPAE
                     PQQAAPADAQPMDNGLWQSNAATQSYENTPCATDIKNFRQCMDDHRGDMSICGWYLDQ
                     LKACQAAAKPY"
     gene            complement(<1313311..>1314961)
                     /locus_tag="ACHE_70448A"
                     /db_xref="GeneID:66985963"
     mRNA            complement(join(<1313311..1313349,1313406..1314447,
                     1314519..1314637,1314697..1314752,1314883..>1314961))
                     /locus_tag="ACHE_70448A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282782.1"
                     /db_xref="GeneID:66985963"
     CDS             complement(join(1313311..1313349,1313406..1314447,
                     1314519..1314637,1314697..1314752,1314883..1314961))
                     /locus_tag="ACHE_70448A"
                     /note="COG:O;
                     EggNog:ENOG410PNS0;
                     InterPro:IPR029071,IPR001012;
                     PFAM:PF00789;
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140127.1"
                     /db_xref="GeneID:66985963"
                     /translation="MFYQGTLQEGIALAVSQSKAVVCFVRDDEELSNVWENEYLADDP
                     TFARLFVEEAITLRLPTGSEGATYLTSFCPIPKLPGLVVIRNGMMREYIIPEISKDDF
                     RARLRAVLEDERKSSQVPRQTQSDVGHNSAASPAAPTSGPAPVTQLATSAPQVAQSQP
                     QTTPATNETKRHRDENERAGKPSGQKQEPPRRATPSKTPSQKPQQQQESRINQTKQPD
                     KKTPQTRKAAPEPSTTSKTSDTEVRPKPALAPPKKYRLQIRLFDGSSIRSSFDPSQTI
                     SKDVRPWLDDQMDEKRPFNLKHILTPLPNRTLTIADEEQTLQAYLGLGATANLVMVPI
                     QSYTEAYTGSGSLPVRAVSSAYDLATSTVGAAAGYVGSWFGYGQTSASQGSPATEPSS
                     ASDHTGRTASRLAGSRGPNIRTLADQRREQGNNQFYNGNQLNFQPRDNSDQR"
     gene            <1315205..>1316355
                     /gene="SHY1"
                     /locus_tag="ACHE_70449S"
                     /db_xref="GeneID:66985964"
     mRNA            join(<1315205..1315457,1315521..1316033,1316084..1316189,
                     1316256..>1316355)
                     /gene="SHY1"
                     /locus_tag="ACHE_70449S"
                     /product="surf-like protein"
                     /transcript_id="XM_043282783.1"
                     /db_xref="GeneID:66985964"
     CDS             join(1315205..1315457,1315521..1316033,1316084..1316189,
                     1316256..1316355)
                     /gene="SHY1"
                     /locus_tag="ACHE_70449S"
                     /note="BUSCO:EOG09263V60;
                     COG:C;
                     EggNog:ENOG410PJEJ;
                     InterPro:IPR002994;
                     PFAM:PF02104;
                     TransMembrane:2 (i81-99o288-306i);
                     go_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /product="surf-like protein"
                     /protein_id="XP_043140128.1"
                     /db_xref="GeneID:66985964"
                     /translation="MRSIFSVLNRTAARSWQPPTRAFRSPRIASKLDSICARCRQHQI
                     RHFSSSNRKMGEDERWLSVVDHPAQVVRVGRKHGPGLIILALIPIISFALGTWQVQRL
                     DWKTNLITKFEDRLLKPPLPLPPRVDPDAITDFDHRRVYATGTLRHDQEMLVGPRMRE
                     GQDGYVVVTPLERDDGQSTVLINRGWISKKLADQKDRAVGLPQGEVTVEGLLREPWKK
                     NMFTPENEPEKGRFYFPDIEQMAELTGSQPVWVEETMVPDMVEAYDREAKGIPIGRAP
                     AVNLRNNHGQYIMTWYGLSLATSVMLYMIIRKRPNEATRRVRQNRNW"
     gene            complement(<1316462..>1318094)
                     /locus_tag="ACHE_70450A"
                     /db_xref="GeneID:66985965"
     mRNA            complement(join(<1316462..1316561,1316616..1317173,
                     1317229..1317655,1317717..1317945,1318008..>1318094))
                     /locus_tag="ACHE_70450A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282784.1"
                     /db_xref="GeneID:66985965"
     CDS             complement(join(1316462..1316561,1316616..1317173,
                     1317229..1317655,1317717..1317945,1318008..1318094))
                     /locus_tag="ACHE_70450A"
                     /note="COG:S;
                     EggNog:ENOG410PRI1;
                     InterPro:IPR009072,IPR035425;
                     PFAM:PF15630,PF15511;
                     go_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140129.1"
                     /db_xref="GeneID:66985965"
                     /translation="MSTPRPRERRSPFGTPGTSTPVGNSTLTGRSRIPRYPLTPSRLG
                     AATPRSTSRFTPRRGALGAPSTPYGVRAMQRRAANTPGRDRRKSGRMQRETTFDILKN
                     LGKALAPTSQPIRSSPQEKPPPESEPEPPKDEIEELDNEPEIERPRLSLPLDDVDEED
                     EESPEIPAPRLSLAFEEEDITVEYPRRATSDRDRARLSMMSFGGPRLSENFGDSTRLE
                     SGSESGGDTGLHDVGGPDETVISQGAFDRGGETEDLGRFNFDFNFPSPPPPGEGDQDE
                     PLDDDEGFELPAMDLQPDTGPIPDEDMDIGGGFDDDDDDAAGGFGLELDIPHQASPES
                     LAGGGLRDEDHIAPDPKQKQYSRHGIPVPKMPSGVVKKLATQFARGRAGSKAKINKQT
                     LAAIEQASSWYFEQVGEDLAAYSKHAGRKTIDESDVTTLMRRQRHINNSTTVFSLAQK
                     HLPKELLQDMRLAMPP"
     gene            <1318404..>1319448
                     /locus_tag="ACHE_70451S"
                     /db_xref="GeneID:66985966"
     mRNA            join(<1318404..1318776,1318827..1319007,1319062..1319160,
                     1319214..>1319448)
                     /locus_tag="ACHE_70451S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282785.1"
                     /db_xref="GeneID:66985966"
     CDS             join(1318404..1318776,1318827..1319007,1319062..1319160,
                     1319214..1319448)
                     /locus_tag="ACHE_70451S"
                     /note="BUSCO:EOG09264KTU;
                     COG:S;
                     EggNog:ENOG410PMXA;
                     InterPro:IPR032704;
                     PFAM:PF14617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140130.1"
                     /db_xref="GeneID:66985966"
                     /translation="MSKEESNAASGLSTKVEKKRKRQADEEPLTAKDATTPTTTNTNA
                     TSESGPSLKKQKNKQKLKEKKKLKAQQAQQDDMRGEERKEGIDGSIGKMDGPLLADYF
                     AQKAKRHNKEISAVELSDLSVPDSAFLDTSSYDGSRALDKLPEFLKAFSPNKGAGLSK
                     ASEEKGTPHTLVVSGAALRAADVVRALRPLQNKESTVGKLFAKHIKLEEAKQFLQRAR
                     MGIGAGTPARISDLIESGTLKLDELERIVIDGSFIDQKKRGIFDMKETHLPLLQLLTR
                     PEFRDRYGAKQKKIQILVF"
     gene            <1319744..>1320999
                     /locus_tag="ACHE_70452S"
                     /db_xref="GeneID:66985967"
     mRNA            join(<1319744..1320407,1320471..1320699,1320777..>1320999)
                     /locus_tag="ACHE_70452S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282787.1"
                     /db_xref="GeneID:66985967"
     CDS             join(1319744..1320407,1320471..1320699,1320777..1320999)
                     /locus_tag="ACHE_70452S"
                     /note="BUSCO:EOG09265DRM;
                     COG:S;
                     EggNog:ENOG410QDTF;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140131.1"
                     /db_xref="GeneID:66985967"
                     /translation="MGDKKRKLTQNPVEEEGHAVQPEKKPKHEKASKDKKEKKEKEEK
                     KERKSKSRDVEETVNEKETEEKAEGKAEENGEEVKEEKKEKKDKKEKKDKKDKKDKKD
                     KKEKKDEKDKKAKKETSEGKEEKEEEVEDKAGPAAEEETADAMDVDVESTEKKDDEKK
                     DGESKEETQEEKRERRKKNKKEKKEKKAAERAQAQSQQSEEQQEQQQQQEQQKSARFI
                     AFVGNLPYSANNESIKEHFVKNPPVSIRVATEKDKPTKCRGFAFIEFENFDRMKTCLK
                     LYHHSTFNDGKYPPRRINVELTAGGGGKSEYRQSKIETKNKKLNDERQRTAKQMSKEK
                     DRKARHKNGEQEGDAEAAGGGDDNFAGIHPSRRMRLQ"
     gene            complement(<1321502..>1322470)
                     /gene="RAC1"
                     /locus_tag="ACHE_70453A"
                     /db_xref="GeneID:66985968"
     mRNA            complement(join(<1321502..1321562,1321628..1321860,
                     1321946..1322126,1322199..1322257,1322334..1322366,
                     1322441..>1322470))
                     /gene="RAC1"
                     /locus_tag="ACHE_70453A"
                     /product="Rho GTPase protein rac1"
                     /transcript_id="XM_043282788.1"
                     /db_xref="GeneID:66985968"
     CDS             complement(join(1321502..1321562,1321628..1321860,
                     1321946..1322126,1322199..1322257,1322334..1322366,
                     1322441..1322470))
                     /gene="RAC1"
                     /locus_tag="ACHE_70453A"
                     /note="COG:S;
                     EggNog:ENOG410PIRJ;
                     InterPro:IPR005225,IPR001806,IPR027417,IPR003578;
                     PFAM:PF00025,PF08477,PF00071;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA];
                     go_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Rho GTPase protein rac1"
                     /protein_id="XP_043140132.1"
                     /db_xref="GeneID:66985968"
                     /translation="MASPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDN
                     YTASVMVDGRPISLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKW
                     FPEIEHHAPNVPIILVGTKLDLRDDKATADSLRARKMEPVSYEQALAVAKEIRAHKYL
                     ECSALTQRNLKSVFDEAIRAVLNPRPATKPKTKKCMIL"
     gene            complement(<1323599..>1324060)
                     /locus_tag="ACHE_70454A"
                     /db_xref="GeneID:66985969"
     mRNA            complement(join(<1323599..1323746,1323821..1323936,
                     1323998..>1324060))
                     /locus_tag="ACHE_70454A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282789.1"
                     /db_xref="GeneID:66985969"
     CDS             complement(join(1323599..1323746,1323821..1323936,
                     1323998..1324060))
                     /locus_tag="ACHE_70454A"
                     /note="COG:S;
                     EggNog:ENOG410Q204;
                     InterPro:IPR011008,IPR007138;
                     PFAM:PF03992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140133.1"
                     /db_xref="GeneID:66985969"
                     /translation="MASEAINLVAIIYPKPDKAAELSALMAEVTQKVQANEPDTLLYY
                     AFTNEQNKDEIIVVERYRNAAALDAHVKGPHFQEFVKKASALMAKPFELKKGGFLPAS
                     AGVARL"
     gene            complement(<1324441..>1326952)
                     /locus_tag="ACHE_70455A"
                     /db_xref="GeneID:66985970"
     mRNA            complement(join(<1324441..1324643,1324707..1325213,
                     1325263..1325528,1325589..1326026,1326077..1326385,
                     1326450..1326556,1326668..>1326952))
                     /locus_tag="ACHE_70455A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282790.1"
                     /db_xref="GeneID:66985970"
     CDS             complement(join(1324441..1324643,1324707..1325213,
                     1325263..1325528,1325589..1326026,1326077..1326385,
                     1326450..1326556,1326668..1326952))
                     /locus_tag="ACHE_70455A"
                     /note="COG:K;
                     EggNog:ENOG410Q2P8;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o528-544i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140134.1"
                     /db_xref="GeneID:66985970"
                     /translation="MELQFRGILPPNGFAAAAQGQANGHLISPQGPGSSDIRNNAGFP
                     RPVTGYDFSSRNSEPCDMEKIPPMTGGSTGATTGKRRGGSRKACNECKQQKLRCDIVQ
                     TPAAACSRCRRLQIECKVEPTFKRISKRRRNAEMEREIADLRRRLATNSDHPQTVEAN
                     ASDDMSQCSEDVFCGPDSAVSNRTRPLSAPLEPQPLATPLTMRRDESIISQEDSLWRL
                     EDVSLSRSRVARLFEQFFKYYHPFLPLLDPQKGPDEHLHRSSLLAWTIICVASRRAPS
                     EPGLLSSLSGPFSRLLWSTITGVPQDYHVVKALCILCTWPLPTTSQRTDATFMLSGLM
                     MQIAMQLGLHRPVQAEEFTTFRMEVQGEAMKDRLQTWVICNIVAQNVATGYGQPPGTI
                     YDWALEPTSLKDADYHPPVDLRTRLRIEKFCDRVTKALYSSKPEPAEFISSEKLLIVQ
                     LLESELKDMEVDFGRNVSHINMIHLRAAELHLRYFVFLGSNARSDDLTKLFIATTSFL
                     GRVLDLETSPGELIGHATNYILQMIVSAAFALMKLLKSDFSRHIDFNHGKLLFNGAIS
                     AIRRISVMEHDRPVRLADILAQMWNAGSSETEADEDGLQLKVRCRMSMSHVYDTVWRW
                     RQRFRPMRSIEDQAMANPNMSTAAGPLSRQQDNSLDDPSLIYQANFDGGFISEAGFSE
                     VFDSLNWVFDGIPDSLVAPPVM"
     gene            complement(<1327424..>1328797)
                     /locus_tag="ACHE_70456A"
                     /db_xref="GeneID:66985971"
     mRNA            complement(<1327424..>1328797)
                     /locus_tag="ACHE_70456A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282791.1"
                     /db_xref="GeneID:66985971"
     CDS             complement(1327424..1328797)
                     /locus_tag="ACHE_70456A"
                     /note="COG:O;
                     EggNog:ENOG410Q19B;
                     InterPro:IPR000073,IPR029058,IPR005152;
                     PFAM:PF12697;
                     SECRETED:SignalP(1-26);
                     go_function: GO:0004806 - triglyceride lipase activity
                     [Evidence IEA];
                     go_process: GO:0016042 - lipid catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140135.1"
                     /db_xref="GeneID:66985971"
                     /translation="MSFKMLSIGLSLLGLMTGSLTVASKAANFDLPSATFRQYGCDEQ
                     CEQVFNLAEKQDRQLFSSDFDYDFYATAPGFTSSHPGDLLKFELIDPSDLNITSGVTV
                     YRLQYTSRALNGTFVPATGFIGLPDTSSRADNKHPVIAFAHGTSGVFRGCPPSTTPTL
                     ADYSSWSLLVKSGYAVVAPDYAGLGNDYIEHQYLSFPAHANDLYYGVVAARQALPHAF
                     TDEWMSVGHSQGGGASWKLSESPLHHRGAAGTYLGSVAIAPATKVYDTAVATMDILFQ
                     RPDYASYDIIYELAWLPIALKRVFPRASVSFVAEKLRERISLATEAQSCMSGILSLPH
                     GLKPKELVTDPAWVKHNRLLRRWQDWVAPANGARATGPLMIIQGLNDTAVLPEITTDS
                     YDDTCHHGNEAHIRLYEGAGHIDVFHASAPDWLEFLSNQFGQKKGNFHGACSSATRDA
                     VTDQEND"
     gene            <1329896..>1332327
                     /locus_tag="ACHE_70457S"
                     /db_xref="GeneID:66985972"
     mRNA            join(<1329896..1330057,1330138..1330191,1330251..1330857,
                     1330919..1331118,1331172..1331676,1331731..1331874,
                     1331928..1332022,1332084..1332154,1332216..>1332327)
                     /locus_tag="ACHE_70457S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282792.1"
                     /db_xref="GeneID:66985972"
     CDS             join(1329896..1330057,1330138..1330191,1330251..1330857,
                     1330919..1331118,1331172..1331676,1331731..1331874,
                     1331928..1332022,1332084..1332154,1332216..1332327)
                     /locus_tag="ACHE_70457S"
                     /note="COG:T;
                     EggNog:ENOG410QDQC;
                     InterPro:IPR001060,IPR027267,IPR008936,IPR000198,
                     IPR031160;
                     PFAM:PF00620;
                     go_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140136.1"
                     /db_xref="GeneID:66985972"
                     /translation="MADVTLPDGAGSPREDPPSSAGSQPAAPLEAALAAPPVMSDELK
                     GRLDKVIYSDIGITTLLTRLKQSVASARDYSTFLKKRAALEEEHAQGLRKLSRSLHDA
                     AQRSENRQGTYGNSINELHRFQDRMADHGLQFSVSLQQMADDLHELASNIEKGRKQWK
                     QTGLTAEKRVVEAETAAEKAKAKYDSLAEQYDRVKTGDKQGGKFGLKGPKSAAQHEED
                     LLRKVQNADGDYSSKVLAAQAARQELVSTHRPQTVLNIQQLIRECDAGLTLQLQKFAT
                     FNEKLLLGQGLSISPLKDSPTVGPKSLYEIIYTIDNQKDYHDYVLSHEGNPAAVTKDQ
                     LKYECHPTLASSSGPVVPAAQTSTQNKRQSFLPQSFSQQRLASPQSSPQPSPAPPSAI
                     AAPVDQKPALPYPQEPEPYSNLSFQPPYPVSVPPPAQEHPVAPPPVGAPPPSNGLPPI
                     KPVFGISLDDLYARDGTAVPMIVYQCFQAIELFGLDMEGIYRLSGSATHINHMKSLFD
                     NDSTQVDFTNPEYFYHDVNSVAGLLKQFFRDLPDPLFTTQFYPDFINAARIDDDIQRR
                     DSLHALVNNLPDAHYATLRALVLHLNKVQEHYTQNRMNAGNIAICFGPTLMGANSTGA
                     IADAGWQVRVIETVLINTFQLFDDD"
     gene            complement(<1335954..>1337054)
                     /locus_tag="ACHE_70458A"
                     /db_xref="GeneID:66985973"
     mRNA            complement(join(<1335954..1336464,1336530..1336637,
                     1336696..>1337054))
                     /locus_tag="ACHE_70458A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282793.1"
                     /db_xref="GeneID:66985973"
     CDS             complement(join(1335954..1336464,1336530..1336637,
                     1336696..1337054))
                     /locus_tag="ACHE_70458A"
                     /note="COG:S;
                     EggNog:ENOG410PQM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140137.1"
                     /db_xref="GeneID:66985973"
                     /translation="MASSSRLPVGSLLSAARPGSHSITIAAQTCQCRAFSRSSIAQRA
                     MRGMPQTMSVKQPAQPSMKTRGKEMSKSEMPQDLGLLPGTFIRPLWRDMPSIFQLPRE
                     RMQLEWLWIKQAFQNFLGILAYSKWLNKGLPLRLRERRQVACELYERMYTAYAEGDVA
                     TLRKICCTGLANSLTSRITIRPKDERVTWTLNKYNRTPATFLTGVRVLADRATQIPEI
                     PKSGVRQVVLRITSRQSTGKVKLPTNKRGVVDETAIEAQDAAPAKQRDCTEYIVLQKL
                     MWFGEEQEWRIWGHATPTTVEDLESPFFAPGLSLSDRMEAMKAMMEGKR"
     gene            <1337934..>1338447
                     /locus_tag="ACHE_70459S"
                     /db_xref="GeneID:66985974"
     mRNA            join(<1337934..1338038,1338103..1338158,1338213..>1338447)
                     /locus_tag="ACHE_70459S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282794.1"
                     /db_xref="GeneID:66985974"
     CDS             join(1337934..1338038,1338103..1338158,1338213..1338447)
                     /locus_tag="ACHE_70459S"
                     /note="COG:S;
                     EggNog:ENOG410PNUC;
                     InterPro:IPR021100;
                     TransMembrane:2 (i29-47o63-84i);
                     go_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA];
                     go_process: GO:0034599 - cellular response to oxidative
                     stress [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140138.1"
                     /db_xref="GeneID:66985974"
                     /translation="MGHEGWATAIIGSIGQDWDVERRFRVTEVALAIMWCCASAYLSY
                     FFADCMMSRWLLNYTPPAVVIRLLTTNGLIAYITSWVLYLSGASSDPRLLLPAWISIT
                     TVRSSINQKMTGRSQSHATRPHKLTTNLL"
     gene            complement(<1339493..>1340256)
                     /gene="SUI1"
                     /locus_tag="ACHE_70460A"
                     /db_xref="GeneID:66985975"
     mRNA            complement(join(<1339493..1339641,1339700..1339792,
                     1339895..1339969,1340229..>1340256))
                     /gene="SUI1"
                     /locus_tag="ACHE_70460A"
                     /product="eukaryotic translation initiation factor eIF-1"
                     /transcript_id="XM_043282795.1"
                     /db_xref="GeneID:66985975"
     CDS             complement(join(1339493..1339641,1339700..1339792,
                     1339895..1339969,1340229..1340256))
                     /gene="SUI1"
                     /locus_tag="ACHE_70460A"
                     /note="COG:J;
                     EggNog:ENOG410PNPS;
                     InterPro:IPR001950,IPR005874,IPR036877;
                     PFAM:PF01253;
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA];
                     go_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-1"
                     /protein_id="XP_043140139.1"
                     /db_xref="GeneID:66985975"
                     /translation="MSIENLKTFDPFAEADEDTGETKQSQNYIHIRIQQRNGRKTLTT
                     VQGLPKKFDQKKILKVIKKKFACNGTIVTDTEMGDVIQLQGDQRKDVQEFLTDKKEGL
                     ELDAKTIKVHGF"
     gene            complement(<1340983..>1341767)
                     /locus_tag="ACHE_70461A"
                     /db_xref="GeneID:66985976"
     mRNA            complement(join(<1340983..1341054,1341117..1341133,
                     1341198..1341295,1341350..1341361,1341436..1341452,
                     1341511..1341542,1341614..1341664,1341731..>1341767))
                     /locus_tag="ACHE_70461A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282796.1"
                     /db_xref="GeneID:66985976"
     CDS             complement(join(1340983..1341054,1341117..1341133,
                     1341198..1341295,1341350..1341361,1341436..1341452,
                     1341511..1341542,1341614..1341664,1341731..1341767))
                     /locus_tag="ACHE_70461A"
                     /note="COG:S;
                     EggNog:ENOG410PPRR;
                     InterPro:IPR005351;
                     PFAM:PF03669;
                     TransMembrane:2 (i45-62o74-95i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140140.1"
                     /db_xref="GeneID:66985976"
                     /translation="MAAKKDMRRLDLAIPYIEPPTSKNDADVSGAMSSTMPMAAMFTR
                     NRMIGWVSFVFSLQNWLGETEDQKSSSSTPAYMSVFMSFMALVVTYFPIFLSPQNQRA
                     GATPAPSAS"
     gene            <1342828..>1347860
                     /gene="SRB8"
                     /locus_tag="ACHE_70462S"
                     /db_xref="GeneID:66985977"
     mRNA            join(<1342828..1343440,1343501..1344945,1344997..1345292,
                     1345345..1346215,1346271..1346795,1346850..>1347860)
                     /gene="SRB8"
                     /locus_tag="ACHE_70462S"
                     /product="RNA polymerase II mediator complex subunit"
                     /transcript_id="XM_043282798.1"
                     /db_xref="GeneID:66985977"
     CDS             join(1342828..1343440,1343501..1344945,1344997..1345292,
                     1345345..1346215,1346271..1346795,1346850..1347860)
                     /gene="SRB8"
                     /locus_tag="ACHE_70462S"
                     /note="BUSCO:EOG092605ZA;
                     COG:K;
                     EggNog:ENOG410PK8U;
                     InterPro:IPR016024,IPR019035;
                     PFAM:PF09497;
                     TransMembrane:2 (o422-449i1019-1038o);
                     go_component: GO:0016592 - mediator complex [Evidence
                     IEA];
                     go_function: GO:0003712 - transcription coregulator
                     activity [Evidence IEA];
                     go_process: GO:0006357 - regulation of transcription by
                     RNA polymerase II [Evidence IEA]"
                     /codon_start=1
                     /product="RNA polymerase II mediator complex subunit"
                     /protein_id="XP_043140141.1"
                     /db_xref="GeneID:66985977"
                     /translation="MIPLSSAGAQPRGQHPLRAVNTASGQPNTFQVFAQSEANLPTPV
                     SQAQFRQQPTVIDLTSGEDAQEREPPAKRPRLDIPTGTSSRTASPVPGVGGVGGGDLR
                     SAPGGPTTPRPSSTTSWRGRPVWSFQSLVSETPGVGDVNGDNAAALAQGGKPASPPPL
                     PTPPWRFALRPSSSRSRDYSPVKAVQTTPYRIETPAAAPALKGEKVADFSPWTGNHPE
                     DVLNEQTAKQGYYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFASAFEKRQSHN
                     TVVTSSTFKPPPRVTLTDNKRESWLRDLANPAVPLRRLSRTIPHGIRGKVLLDQCLGK
                     WIPVARAVWLAKCVGANEIRAFKRKGTSGPLAIGLEAKWVRDWTVNVQQFLENVIAAC
                     GTADWKMKMTYAVSLVARLFHENLLDHDHYIGWFLSCLEAAPLKILPVWLLMLGIYWD
                     SIMRYRKRGCRLAELLLAKLTQLSKSEHAGALKPLIDRLSLYVKRLVREYTSSAILPT
                     SWASYRDFVSSSLDLDDKVDRAIFQNIAERNVRVQRPMHCQSAAHHSGQQQQQHIIRL
                     FDSIRTAHDISSVSVVCLDTFEDRATLIYKLLEWTATPFRHGLRRVYIAVRLLRKWKM
                     AGIDVDSHILGFLSDSPKANENMDMVYHAISELVRSQTFSVGRYLQWLMAKGVSRDSL
                     SDHSVIPGGVGLLSQLPVSHLPEHVSNLRDTLLVRVGIASSEEATIISQVKSSIATRL
                     PKVFGGFEVDSIPESSYQSLTWAVKSEIGQWIRRAVAQHCRDPTKSISGVPFLADLKV
                     SSLTPDEFYEIRSLLESFGDISMLADVVKQAASSDDNIVLASAADTVNYHCDSFNVIG
                     AATDLFRRLVDAYSLLKRLGTADLDLIYSLIELGLQLPNEYNTVAILRQDLSRIENRS
                     AQAAPSPLSDHIPDTVNETDSSFLEKLDQFLSSGSGMDEPTMDAIFDALVKILDMGDG
                     QTKLSANDACRYLAHLRPFHPKHFDTKLVRWVCGALKMHDRAEFFKSLPPLIGVGCVT
                     IQAFLSLVKKLLQVNPASIPNVDELQIDLFELLAPSATQDGCHDLVTYRFYLAQHEFR
                     TKHLEETLEVIRGAVASIGRKEGLSSDPTRNHLETSMVILLCDLLTNEPGNAAQQSMQ
                     KLTDQHPAFLVALQNALDRLLGLDSPSQAKNDLSEAERVISMTSDFSLPFCQLKLQML
                     FNAASGEEVKNGVVDVMFKMAVEDSRSKRSNWVGLVALMNQDAVRQIRERAEKEFLSV
                     PMLPLEASVDEDGSPSVNYTNAIETARIYLMIIEELAYSVPESGVPSIASVLVEKMDL
                     LLNKFVIMQTNSMNFTENKNDTGEGGQQNIARSNFERGLAFWFSVLLRMVVIHRSAFT
                     SSTRPTGLQEQTRILISIFSIALARFPNSLLRLFPTADYFPHPHQPEDYRPCPGILLQ
                     THALDVAASLIDTFPDEARHHCARFLKEKCSPFAQFQNDSRFLYLLGPLPGYGAAANS
                     AQPASLPSPASGSTPTPSQAQATAAAAPSPGLSVGVSSAEEPDCSLRLQHRGRIVGAY
                     QIRPWELLEDAAPLAGINDTAISLRYFDARRIRA"
     gene            complement(<1348352..>1350238)
                     /locus_tag="ACHE_70463A"
                     /db_xref="GeneID:66985978"
     mRNA            complement(join(<1348352..1349149,1349208..1349380,
                     1349440..1349530,1349594..1349726,1349781..>1350238))
                     /locus_tag="ACHE_70463A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282799.1"
                     /db_xref="GeneID:66985978"
     CDS             complement(join(1348352..1349149,1349208..1349380,
                     1349440..1349530,1349594..1349726,1349781..1350238))
                     /locus_tag="ACHE_70463A"
                     /note="COG:S;
                     EggNog:ENOG410PIMT;
                     InterPro:IPR000504,IPR012677,IPR035979,IPR039715;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140142.1"
                     /db_xref="GeneID:66985978"
                     /translation="MPSLNPGVAPFIINTNADNSHTNGNNNSNVNANSIGNGNLNSNG
                     NGNGNGNVNTNNNANANSNDCNDSSTDNGSSTGNDSSTGNGSGSSSPSSTSTSANVNA
                     SPSNSSNNSRGGSSHNSPAIRPIRSDRMNCAPTASNAQGLYPPAACVFVGNLSTRVPL
                     EQQGKELEKKFSTIGPCYVKTNVDRKKELPSAFVQFEKVEHAEIALTWHNTMQLHDRL
                     LRVEVSKAIRAGIMGHRNGEPITLDLVEKVLRGRGALDYCILERTTSGAVVSKVVFSF
                     VGDYQDAIRHFQNDHFIYLKPDHGIRPISSSSSSSSSSYSSSSSSSCSSSSSPPPPPP
                     LPRYSQSQSPYYPPAPAPFLQTSYPQRSGAYYQGSYSQAPLPPFPCFPHYNNWTYPQE
                     PYHPQSYAQWSYSQGTYPSYAQGTWYPPQNWSEPGYHAVKAPQTNTHVQALNPGMFFP
                     PEPWSAAHYTASAPPASGFHSAQAQPAASQSTGNANGNEITPPSSPGNGEERTEEQDN
                     DNTVAEEKTGEKEENKEKEAGNEKKDEKNRPLIVGATSRLRF"
     gene            <1351418..>1352577
                     /locus_tag="ACHE_70464S"
                     /db_xref="GeneID:66985979"
     mRNA            join(<1351418..1351505,1351568..1351801,1351865..>1352577)
                     /locus_tag="ACHE_70464S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282800.1"
                     /db_xref="GeneID:66985979"
     CDS             join(1351418..1351505,1351568..1351801,1351865..1352577)
                     /locus_tag="ACHE_70464S"
                     /note="COG:S;
                     EggNog:ENOG410PGSM;
                     InterPro:IPR013857,IPR039131,IPR008979;
                     PFAM:PF08547;
                     go_process: GO:0032981 - mitochondrial respiratory chain
                     complex I assembly [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140143.1"
                     /db_xref="GeneID:66985979"
                     /translation="MIPTARCMAAKPAGFFKRSADELSRLSKIAWNTEGLHTPTKPYT
                     MLDFEDERAVAGCKTMADRAVGGFSTANLDYVPADPSSNTPAHARFHGNISTKLPNNW
                     RVERTGYAAFRNKDRGLWLFGRLYWDVDPYAYLALRVKSDGRRYTVNIQTDSIVETDI
                     HQHRLYTRHHRVQSRPTSDEHLPPYSSAEASESAESADTKYPGGIPPSLSDIPPESTV
                     MSSASATTSGSTGWETILLPFNAFVRTNHGFVMEPQTSLLRQRVKSIGIGLTDRVEGP
                     YDLRIHRMWATNGIGEQEAQEDRLICGADALPVDEGVKSGWTDKGIEGQQQDRPKAKG
                     LKGLRSEWNQ"
     gene            complement(<1352748..>1353770)
                     /gene="ADE1"
                     /locus_tag="ACHE_70465A"
                     /db_xref="GeneID:66985980"
     mRNA            complement(join(<1352748..1353124,1353185..1353560,
                     1353621..>1353770))
                     /gene="ADE1"
                     /locus_tag="ACHE_70465A"
                     /product="bifunctional purine biosynthetic protein Ade1"
                     /transcript_id="XM_043282801.1"
                     /db_xref="GeneID:66985980"
     CDS             complement(join(1352748..1353124,1353185..1353560,
                     1353621..1353770))
                     /gene="ADE1"
                     /locus_tag="ACHE_70465A"
                     /note="BUSCO:EOG09260LS9;
                     COG:F;
                     EggNog:ENOG410PFD3;
                     InterPro:IPR001636,IPR018236,IPR028923;
                     PFAM:PF01259;
                     go_function: GO:0004639 -
                     phosphoribosylaminoimidazolesuccinocarboxamide synthase
                     activity [Evidence IEA];
                     go_process: GO:0006164 - purine nucleotide biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional purine biosynthetic protein Ade1"
                     /protein_id="XP_043140144.1"
                     /db_xref="GeneID:66985980"
                     /translation="MAEAFTNTDLQGALPLVARGKVRDLYEVDEKTLLFIATDRISAY
                     DVIMENGVPNKGVLLTLCTRTWFKTLTEAIPSLRTHFISLDLPPQIPESLRPVLQNRS
                     MQVRKLKILPIEAIVRGYITGSAWKEYQKSGTVHGIKIAPGLQESEAFPDGPIYTPST
                     KAEQGEHDENIHPDQAVNIVGESYASTIASLSIQLYKTAHAYALERGVIIADTKFEFG
                     LDLETNEVVLADEVLTPDSSRFWPKDSYAIGRGQSSFDKQYLRDWLVQEGLKGKEGVR
                     MSEEVAQKTSEKYKEAWEKITGGN"
     gene            <1354133..>1356745
                     /gene="APC5"
                     /locus_tag="ACHE_70466S"
                     /db_xref="GeneID:66985981"
     mRNA            join(<1354133..1354853,1354904..1354997,1355044..1355455,
                     1355502..1355625,1355680..1355786,1355839..1355975,
                     1356025..>1356745)
                     /gene="APC5"
                     /locus_tag="ACHE_70466S"
                     /product="anaphase promoting complex subunit 5"
                     /transcript_id="XM_043282802.1"
                     /db_xref="GeneID:66985981"
     CDS             join(1354133..1354853,1354904..1354997,1355044..1355455,
                     1355502..1355625,1355680..1355786,1355839..1355975,
                     1356025..1356745)
                     /gene="APC5"
                     /locus_tag="ACHE_70466S"
                     /note="COG:D;
                     EggNog:ENOG410PHQY;
                     InterPro:IPR026000,IPR037679,IPR011990;
                     PFAM:PF12862;
                     SECRETED:SignalP(1-22);
                     go_component: GO:0005680 - anaphase-promoting complex
                     [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="anaphase promoting complex subunit 5"
                     /protein_id="XP_043140145.1"
                     /db_xref="GeneID:66985981"
                     /translation="MSRYLTPSKVALLCLISIYTEGVVPNSSAIHVLSFLVSCLFPIE
                     NTGTSTSKKWETDATVSISDLEKTLSAQPSSVPGRSVWDLFLKKIWSLDSCDALEVFF
                     AGISKMLVKSREEQIRDRDNGLAPEPETGPMRLSRNSPLGTFVRRAQLEFTRLQFHDS
                     VRLWKGFVKYRLPTYRIWAKKNPSSEQASIDMNLLELQLDETSYLAQVVYGNMADDTE
                     YERNVSTKDVERLLEFQIGELQRLGGRVPDEMKAQLERIIASGVTLPNLTHYIKFLDA
                     WRAGDYPSSFDNLHRYFDYTMHSRDRSAYQYALLNLAVLQADFGCHGEAVSAMQEAVS
                     IARESHDVNCLNFCMSWLYHFGKAFPEQMKDVQNTGMLGNEKEGLAFLKAKAKETEMW
                     SLLSTTLLSEAKLEMQNGESLASAIENMVRASHLNVTKNHVSSMGPQLLLQTALYARI
                     GVTHLSWLSSEIFRECYANNAPFEDYLRSTFRNCQLLAQQGRYRDVSALMKQIAPEKL
                     RSLKANQQWTCFSGLLQLQRQIYRDDKVAADHLVTQLQSIHLPDSDISPLISFLAIEH
                     QIRQGNYSQAFETVEKAAQTMHQDNFDIHFQVKLLCLKARILEKTDQPQRGFSLAMRA
                     ASIAHGSRLLPGLWEAICVLGGVLLSLGEFEAVSELIESIMPRVLETDDCDLAAKAHS
                     LLVDANMGIAGVMWSQGQGNTPARKEYVNRALGYIDFAYDQYAEIEDIQGQCEMMAKK
                     ATIMHLTGDLVLANDYAAKYLDLRKQHAVEV"
     gene            complement(<1357145..>1357914)
                     /gene="COX13"
                     /locus_tag="ACHE_70467A"
                     /db_xref="GeneID:66985982"
     mRNA            complement(join(<1357145..1357190,1357324..1357331,
                     1357390..1357549,1357639..1357663,1357746..>1357914))
                     /gene="COX13"
                     /locus_tag="ACHE_70467A"
                     /product="cytochrome c oxidase subunit 6A, mitochondrial"
                     /transcript_id="XM_043282803.1"
                     /db_xref="GeneID:66985982"
     CDS             complement(join(1357145..1357190,1357324..1357331,
                     1357390..1357549,1357639..1357663,1357746..1357914))
                     /gene="COX13"
                     /locus_tag="ACHE_70467A"
                     /note="BUSCO:EOG092654RM;
                     COG:C;
                     EggNog:ENOG410PNPT;
                     InterPro:IPR001349,IPR036418;
                     PFAM:PF02046;
                     TransMembrane:1 (i62-82o);
                     go_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA];
                     go_component: GO:0005751 - mitochondrial respiratory chain
                     complex IV [Evidence IEA];
                     go_function: GO:0004129 - cytochrome-c oxidase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6A, mitochondrial"
                     /protein_id="XP_043140146.1"
                     /db_xref="GeneID:66985982"
                     /translation="MFPQRNIFRFSQRAAQQLRVAGQRRANSTQSNFPWAVDNAFNRE
                     RDAVKHHAAETSDLWRKLALYAVPPCLILAAINAYNLWEEHWEHWAHEPPLEERTEYP
                     YQNIRVKNFPFGDGDKTIFWNSSVNYHNKDKPT"
     gene            <1358407..>1360336
                     /gene="APN2"
                     /locus_tag="ACHE_70468S"
                     /db_xref="GeneID:66985983"
     mRNA            join(<1358407..1358611,1358660..1359369,1359422..>1360336)
                     /gene="APN2"
                     /locus_tag="ACHE_70468S"
                     /product="class II abasic (AP) endonuclease"
                     /transcript_id="XM_043282804.1"
                     /db_xref="GeneID:66985983"
     CDS             join(1358407..1358611,1358660..1359369,1359422..1360336)
                     /gene="APN2"
                     /locus_tag="ACHE_70468S"
                     /note="COG:L;
                     EggNog:ENOG410PJN6;
                     InterPro:IPR020848,IPR004808,IPR036691,IPR005135;
                     PFAM:PF03372;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0004518 - nuclease activity [Evidence
                     IEA];
                     go_function: GO:0004519 - endonuclease activity [Evidence
                     IEA];
                     go_process: GO:0006281 - DNA repair [Evidence IEA]"
                     /codon_start=1
                     /product="class II abasic (AP) endonuclease"
                     /protein_id="XP_043140147.1"
                     /db_xref="GeneID:66985983"
                     /translation="MEREAVIRGIPCTISCRIPIDRRQAMFDTLEADIVVFQETKIQR
                     KDLRDDMVLVPGWDCYFSLPRMKKGYSGVVIYTRNAKCAPIRAEEGIAGVLYPPNTST
                     PFRELPEEQQIGGYPTIEQLSQFEVDPAILDSEGRCVILEFPAFVLIGTYCPANRDES
                     RDSFRQNFIEALDARVRNLIAMGKRVFLTGDLNIARGEIDSAHAGEAIRKGAATEDEY
                     VSTRVRRIFNQLLSDGKVIGERDEGREKPALYDICRAYHPDRRGMYTCWEQRLNARPG
                     NFGARIDYVLCSLDMQDWFCDSNIQEGLLGSDHCPVYATFKDSVTIDGNPVNILDVMN
                     PHGMFQNGERQQEYSTKYLLPISGRLIPEFDRRRNIKDMFARKPVQKSSTVSATPERT
                     TSVQEKESQSPATSDGNNTPSAQVTDETKITKGITRKRNQSAPTASIKRTKSTATQLP
                     APSAPGQKTLKGFFKPKSSPSKPSPTQISDDTPSERPESPSKRSIPSSSQPEDTPPQT
                     KPHDPSTNEHAPSASQESETVIDPIVSKEDWSKLFSKKPPPTCDGHEEPCISLTTKKP
                     GVNCGRAFWICQRPLGPSGNKEKGTQWRCPTFIWASDWNSTME"
     gene            complement(<1360997..>1362184)
                     /locus_tag="ACHE_70469A"
                     /db_xref="GeneID:66985984"
     mRNA            complement(join(<1360997..1361598,1361650..1361942,
                     1362006..>1362184))
                     /locus_tag="ACHE_70469A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282805.1"
                     /db_xref="GeneID:66985984"
     CDS             complement(join(1360997..1361598,1361650..1361942,
                     1362006..1362184))
                     /locus_tag="ACHE_70469A"
                     /note="COG:K;
                     EggNog:ENOG410QDNT;
                     InterPro:IPR009071,IPR036910;
                     PFAM:PF00505,PF09011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140148.1"
                     /db_xref="GeneID:66985984"
                     /translation="MATVPYTTNPTTKSSDTVTELLWKDALRHLKYTNNEVLLPTNVR
                     DMIGQDNVDKIKSRLSALLGAPVVGFIDESINAFRLMRTPTFSGSAVSVASHDTLVKV
                     PKKGSFGSSTNQREKPPVSSKAAKVPRPPNAFILYRQHHHPKIKEAYPDFQNNDISIM
                     LGKQWKAEPEEVRAHYKALADEQKKKHAEEYPDYQYTPRRPCERKRRASSRQYAKHSK
                     AAAAAGLAAASAKAKSYASTGIGLGLGSIPESGAGTTTRHTPKAESPTSMTSGATLST
                     VSTPAMQAANGMDHDLSEFNVFFGPSDLQDEQFNFDTVSFDAMVQQLRNDQNQDVFLQ
                     PLNPTEQAAVDSFEFSDYIADCF"
     gene            <1363116..>1363501
                     /locus_tag="ACHE_70470S"
                     /db_xref="GeneID:66985985"
     mRNA            join(<1363116..1363210,1363258..>1363501)
                     /locus_tag="ACHE_70470S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282806.1"
                     /db_xref="GeneID:66985985"
     CDS             join(1363116..1363210,1363258..1363501)
                     /locus_tag="ACHE_70470S"
                     /note="COG:S;
                     EggNog:ENOG410PYBK"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140149.1"
                     /db_xref="GeneID:66985985"
                     /translation="MERMTNEHLAYLTQKYGYHFVFRVSPQMYYMIRTVAEEIDFWGH
                     NPRGTEERIRTQSICYEAFEHQLRLHDVEKRILVNITNCSARDAMVFCTCFPPPVFFF
                     FFFSSKLTSF"
     gene            complement(<1364755..>1368290)
                     /gene="SLA2"
                     /locus_tag="ACHE_70471A"
                     /db_xref="GeneID:66985986"
     mRNA            complement(join(<1364755..1364841,1364930..1366144,
                     1366194..1367874,1367943..1368018,1368069..1368086,
                     1368159..1368205,1368283..>1368290))
                     /gene="SLA2"
                     /locus_tag="ACHE_70471A"
                     /product="sla2 Src-like adaptor 2"
                     /transcript_id="XM_043282807.1"
                     /db_xref="GeneID:66985986"
     CDS             complement(join(1364755..1364841,1364930..1366144,
                     1366194..1367874,1367943..1368018,1368069..1368086,
                     1368159..1368205,1368283..1368290))
                     /gene="SLA2"
                     /locus_tag="ACHE_70471A"
                     /note="BUSCO:EOG09261A3K;
                     COG:Z;
                     EggNog:ENOG410PHTB;
                     InterPro:IPR013809,IPR030224,IPR035964,IPR011417,
                     IPR002558,IPR008942;
                     PFAM:PF01608,PF07651;
                     go_function: GO:0003779 - actin binding [Evidence IEA];
                     go_function: GO:0005543 - phospholipid binding [Evidence
                     IEA];
                     go_function: GO:0030276 - clathrin binding [Evidence IEA];
                     go_process: GO:0006897 - endocytosis [Evidence IEA]"
                     /codon_start=1
                     /product="sla2 Src-like adaptor 2"
                     /protein_id="XP_043140150.1"
                     /db_xref="GeneID:66985986"
                     /translation="MSRTEADLAINIRKATSIEETAPKRKHVRSCIVYTWDHKSSAAF
                     WAGMKVQPVLADEVQTFKALITIHKVLQEGHPVVVREAQQHVNWVDSLMRGVAGEGIR
                     GYGALIREYVFFLESKLNFHRDHPEFNGLFEYEEYISLKTINDPNEGYETINDLMNLQ
                     DQIDAFQKLIFSHFLSGTNNECRISALVPLVQESYGIYKFITSMLRAMHTTTGDDEAL
                     EPLRGRYNSQHYRLVRFYYECSNLRYLTSLITIPKLPQDPPNLLAEDDDRPALPRRPA
                     KEVEREPTPPPKPRAVEPEPINDFWTTEAKRQQEEFEAEQARLQQQWEEQQRQQLLMQ
                     QQAQRDFEEQQRLQAEQARLAQEQLMQQQYQSHTQGRLAELERENLNARAQFERDQLM
                     LQEYDRRVKDLEEQMNQLIANTNMQNTSRDEQIRSLQEQVNTWRAKYEALAKLYSQLR
                     QEHLDLLQTTKSLKIKAASAQEAIDRREKLERELKTKNLELADMIRERDRALHDRDRL
                     TGSNKEELEKVKRELRFAIDRAENAERSKGTEISSLLSKYNREMADLEEALRNKSRAI
                     EEDSSKVGDRQREHDLALQEKDEEIEVYKSGMEQALMELEEMKMNQGDTDTALDTQID
                     HVLHGAVSKINDIIDSVLQMGVQRVDDALYELDSSMQAGNQNASPPYVLSQLEKASAS
                     ATEFSTAFNNFIADGPNSPHAEIIRTVSVFSGSIADVLSNTKGLTRLANDDKSADQLT
                     NGARKSAQATVRFFRGLQSFRLEGLDALKKTDVVINNNLEVQRDLQSLSKLVDAFAPK
                     SSKISTSGDLGDLVDQELNKAADAIDAAAERLAKMKKKPREGFSTYELRINDSILEAA
                     IAVTTAIAELIKAATATQQEIVREGRGSSSKTAFYKKNNRWTEGLISAAKAVASSTNT
                     LIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKASFMSKTQDRLENASKAVG
                     VACRKLVRQVQDIISERNRDETEAVDYSKLSSHEFKVREMEQQVEILQLENNLSRARQ
                     RLGEMRKISYQED"
     gene            complement(<1368994..>1371871)
                     /locus_tag="ACHE_70472A"
                     /db_xref="GeneID:66985987"
     mRNA            complement(join(<1368994..1371307,1371372..>1371871))
                     /locus_tag="ACHE_70472A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282809.1"
                     /db_xref="GeneID:66985987"
     CDS             complement(join(1368994..1371307,1371372..1371871))
                     /locus_tag="ACHE_70472A"
                     /note="COG:S;
                     EggNog:ENOG410PFA6;
                     InterPro:IPR031468;
                     TransMembrane:1 (i7-34o);
                     go_function: GO:0008289 - lipid binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140151.1"
                     /db_xref="GeneID:66985987"
                     /translation="MGSVGSFLFVYLLGGLTFFPLVLSLVFLFIYLSLPDTPTSPSQK
                     QQKQQQECEHARVPDFLRRPSDDQDSLKSGTDALAEEFHRTHESDVAAGYFAVCREYV
                     PGGVNGKPPERTTPAGEVIAAESPSVYQTMYRSLFDRKQTPSIEPAKTNGKSGKRARN
                     VFYIVLRHGHLMLYDDANQVEVRYVISLAHHDVSICGGDKEEKIPEGELWLKRNAICL
                     SRRLESLGDLGGPTPPFYLFSENLSEKEDFYFALLQNQAKMWDPDSRPPKCQQFDTRH
                     IVTLVQRLHSSEEQLQTRWINAVLGRLFLALYKTPEMEEFVRGKITKKISRVNKPNFI
                     SKIGLRKIDMGEGAPFITNPRLKDLTVDGNCCVETDLQYTGNFRVEISATVRIDLGPR
                     FKAREVDIVLAIVLKKLEGHMLLRFKPPPSNRMWISFETMPNMVMDIEPVVSSKQITY
                     GIILRTIESRIREVVAESVVLPFWDDMPFLDTFSQPFRGGIWEREIPKHDPNAVIPDE
                     SQKQEGNKDESLNVLKSKDDRTMSMPVLSEPAPAAVKSRKGSKSSIPEDPNSPTASSS
                     GVEKLAPLPRAIRSQTFSNAADPVVTADNAKIDKVYDGKSEEKSTATSAMIEISHRSP
                     PSSPDKTAASTPATESLVPPQLPSTLPPNREPSSFESLDGVGELSSESRPSSSHRPSS
                     SSVNLTNVARSSTTSVGTTTSIGSTKTKRRGTFDSLAKSISSTPSEDGKSQASITFGQ
                     ATAVAKKWGLNMLGRGEQNAGQDAPRPAGTPEEPIGRGHPLPPPGTPLPHPDRYGGFK
                     RNSVSTKRKPVPPPLPERSTHEGNKRPVPKPPLPRRKPVSNSEESVGQSDDLLVIEAP
                     LDSGPDSPVVDLASSKGLLGQGAEQAVEDEPFESPVENHDIPGEADESLKCQETSQNS
                     PPVARPSTPHGMEILSATDGFFP"
     gene            complement(<1372647..>1374052)
                     /gene="COQ1"
                     /locus_tag="ACHE_70473A"
                     /db_xref="GeneID:66985988"
     mRNA            complement(join(<1372647..1372808,1372865..>1374052))
                     /gene="COQ1"
                     /locus_tag="ACHE_70473A"
                     /product="coq1 putative hexaprenyl diphosphate synthase"
                     /transcript_id="XM_043282810.1"
                     /db_xref="GeneID:66985988"
     CDS             complement(join(1372647..1372808,1372865..1374052))
                     /gene="COQ1"
                     /locus_tag="ACHE_70473A"
                     /note="BUSCO:EOG092634B5;
                     COG:H;
                     EggNog:ENOG410PJ43;
                     InterPro:IPR033749,IPR008949,IPR000092;
                     PFAM:PF00348;
                     go_process: GO:0008299 - isoprenoid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="coq1 putative hexaprenyl diphosphate synthase"
                     /protein_id="XP_043140152.1"
                     /db_xref="GeneID:66985988"
                     /translation="MKVRTSSASGLVLSSRAVPSTSICWQCLRNDLSNQIQLQSRKYH
                     PSRRKDAPPFGAAVSAAQTIFKGLPKAPPGISVDPLRIVGKELKFLTKNIRQLLGSGH
                     PTLDKVAKYYTRSEGKHMRPMLVLLMSQAIALAPRLSADSANALSVDDSITSSDVLSD
                     MNPDTNPLVARSAEAKYDFEGDENILPSQRRLAEITELIHTASLLHDDVIDNAVTRRG
                     ANSANIQFGNKMAVLAGDFLLGRASVALARLRDPEVTELMGTVIANLVEGEFMQLKNT
                     AEDEKNPVFTDETISYYLQKTYLKTASLISKSCRSTAVLSQSAPEVIEAAYSYGRNLG
                     LAFQLVDDMLDYTVTEVELGKPAGADLELGLATAPLLFAWKQNPELGPLVGRKFSQEG
                     DVQRAREIVHKSDGVEQTRALAREYANNAIAAISDFPDSAAKSGLIEMCEKTMKRRK"
     gene            complement(<1374557..>1376646)
                     /gene="RPN3"
                     /locus_tag="ACHE_70474A"
                     /db_xref="GeneID:66985989"
     mRNA            complement(join(<1374557..1374700,1374766..1376063,
                     1376157..1376285,1376349..>1376646))
                     /gene="RPN3"
                     /locus_tag="ACHE_70474A"
                     /product="26S proteasome non-ATPase regulatory subunit"
                     /transcript_id="XM_043282811.1"
                     /db_xref="GeneID:66985989"
     CDS             complement(join(1374557..1374700,1374766..1376063,
                     1376157..1376285,1376349..1376646))
                     /gene="RPN3"
                     /locus_tag="ACHE_70474A"
                     /note="COG:O;
                     EggNog:ENOG410PFHZ;
                     InterPro:IPR000717,IPR036390,IPR013586,IPR035267;
                     PFAM:PF08375,PF01399;
                     go_component: GO:0000502 - proteasome complex [Evidence
                     IEA];
                     go_function: GO:0030234 - enzyme regulator activity
                     [Evidence IEA];
                     go_process: GO:0042176 - regulation of protein catabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="26S proteasome non-ATPase regulatory subunit"
                     /protein_id="XP_043140153.1"
                     /db_xref="GeneID:66985989"
                     /translation="MPERRSLRSNSKSEIPCSANDNQAFCSSQYPSSNKDKPAPARST
                     ANKSKSAAPSKKAGSTNSSADSNMGKGDQRQANGSDPTKDGAKGSEDVEMGEDTAVPP
                     TKGSRLSGGQGPDKEGDVAMDEGDESKSEPKIDPKVKAIQDIKTNFTLLERAVTQFDP
                     RFTLRVLRSISSMRKHITADVLSEVIVETYPPSSLTASFLLDAIDRSGAIESAVASSE
                     MEVDSEKNKSSPKEILPEVDTYLSILAQIYLYDKKDIQKGAKFSTELIERLRTLNRRT
                     LDSLAARVYFYYSLFFEQIAPLPPSPAATVTSIRQPLLAALRTAVLRKDADTQATVMT
                     LLLRNYLSTSHISQADLLISHNQFPASASNNQIARYLYYLGRIRAIQLQYTDAHDNLI
                     GATRKSPTSNIARGFYQASHKLLVVVELLMGDIPDRAIFRQPALERAMHPYFLLSQSV
                     SVGDLDGFLNIVTTHTATFRKDGTYTLILRLRQNVIKTGIRMMSLSYSRISLRDICLR
                     LGLDSEESAEYIVAKAIRDGVIEASLDHESGYMKSKEVGDIYATREPGEVFDERIRAC
                     LALHDESVKAMRFPMNQHRLELKSAQEARERERELAKEIQEGDMDDEDAGGDFDAI"
     gene            <1377205..>1378060
                     /locus_tag="ACHE_70475S"
                     /db_xref="GeneID:66985990"
     mRNA            join(<1377205..1377269,1377328..1377696,1377757..>1378060)
                     /locus_tag="ACHE_70475S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282812.1"
                     /db_xref="GeneID:66985990"
     CDS             join(1377205..1377269,1377328..1377696,1377757..1378060)
                     /locus_tag="ACHE_70475S"
                     /note="COG:S;
                     EggNog:ENOG410PNCE;
                     InterPro:IPR013966;
                     go_component: GO:0005876 - spindle microtubule [Evidence
                     IEA];
                     go_component: GO:0042729 - DASH complex [Evidence IEA];
                     go_process: GO:0008608 - attachment of spindle
                     microtubules to kinetochore [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140154.1"
                     /db_xref="GeneID:66985990"
                     /translation="MSLLANHLEQIALSSNAIADLSFPPPRIFTNSLLSSPDITALIR
                     DTEAHERALFQIDPAAKAFNPSQRRATRRGTTFQPEAERESMASRIYAAKNNRNQSAV
                     ARVLGSDMMEEIRRSAGTSTRGPRGEVNVEVLLRGAEILCNVYPVAGAQDRITSLRYR
                     HEIISGSIANLEERVARNTVELDQMRGSYGDDDDYDNPALSQAAIPEITDEDIERELE
                     EIRKLERRKRAMEARVTGMERDLGGLE"
     gene            <1379000..>1380890
                     /gene="TAF12"
                     /locus_tag="ACHE_70476S"
                     /db_xref="GeneID:66985991"
     mRNA            join(<1379000..1380577,1380636..>1380890)
                     /gene="TAF12"
                     /locus_tag="ACHE_70476S"
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /transcript_id="XM_043282813.1"
                     /db_xref="GeneID:66985991"
     CDS             join(1379000..1380577,1380636..1380890)
                     /gene="TAF12"
                     /locus_tag="ACHE_70476S"
                     /note="COG:K;
                     EggNog:ENOG410PFPR;
                     InterPro:IPR009072,IPR003228,IPR037794;
                     PFAM:PF03847;
                     go_component: GO:0000124 - SAGA complex [Evidence IEA];
                     go_component: GO:0005669 - transcription factor TFIID
                     complex [Evidence IEA];
                     go_component: GO:0046695 - SLIK (SAGA-like) complex
                     [Evidence IEA];
                     go_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA];
                     go_process: GO:0006352 - DNA-templated transcription,
                     initiation [Evidence IEA]"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /protein_id="XP_043140155.1"
                     /db_xref="GeneID:66985991"
                     /translation="MDGSQPQTNPPQNNQPMVAPQHSNLIRTDQVQKLPHLNDQQKAQ
                     HTQIVRSFWEILNTRDPQSTEYQSAHLKLAQLSQTLMKGMRLFQANRQQQLQQQQAAA
                     GVAQSQPVQRSQSTNPQSFGQLLPQIQQKVNSLNFFLPPNISQEQIQSWLPEARLRYG
                     IALQKQELGRVRIAELRQQFSQRQAAGNLSQEEVQEFKNRQLASEKLYREGSDFLNKF
                     KEQQEGFKAQQQQNQQFNRANIQNAPQAQVHPAQTGEPAAAATPVTAGSDNRPVNAAP
                     GTMNQAPTPAPHTINSAVNAARNQAGQVAMTPTTSQPGQVPPTAQAPGAAATTTPAPS
                     QQPTQPQAPQGTQPQMTYPQPPNMNGTTPTPTTAPQPMNQQQVPPRPLSHQAAMNQAA
                     QTYANTNAPNNVNNAGNMTQPAATNQTASSTTTPGYIPNRASENSARNINMAIPKNLN
                     VPPPEPVAMSPARPTLSGGPSHGAMGMMGQPAIQKHPGYVLEGEGQRVLSKKMLDILV
                     RQVTGGGEGEGLTPDAEEFILQMADDFVDDVITAACRLAKLRPSSTLELRDIQLVLER
                     NYNMRISGFSTDDLRTVKKPQPTQGWTQKMSAVQAAKVTQGKAE"
     gene            complement(<1383030..>1385778)
                     /gene="MSS4"
                     /locus_tag="ACHE_70477A"
                     /db_xref="GeneID:66985992"
     mRNA            complement(join(<1383030..1383536,1383586..1384543,
                     1384610..>1385778))
                     /gene="MSS4"
                     /locus_tag="ACHE_70477A"
                     /product="phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_043282814.1"
                     /db_xref="GeneID:66985992"
     CDS             complement(join(1383030..1383536,1383586..1384543,
                     1384610..1385778))
                     /gene="MSS4"
                     /locus_tag="ACHE_70477A"
                     /note="COG:T;
                     EggNog:ENOG410PH70;
                     InterPro:IPR027483,IPR002498,IPR023610,IPR027484;
                     PFAM:PF01504;
                     go_function: GO:0016307 - phosphatidylinositol phosphate
                     kinase activity [Evidence IEA];
                     go_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_043140156.1"
                     /db_xref="GeneID:66985992"
                     /translation="MPSFANDYHTATPPPVDSPQGKPHEKAPVGNTFLWTNNWPNGDT
                     ASHRDAAAPSTDRLTNLKNASAYSVNGHRSSISSSHNRDLPQSKDGSMYSLGNGSARD
                     PRDTGRPSTTLDRDIIAGTGSGAGSAAASISSQQFMGTSQSSRSLYNGRPTVNGDHTP
                     RPSVDQLVASDCAANASMSALSSSQPEESFGRLSSDPGRLSPRTTSPHRYSSPPVPTG
                     IDEAASGNPPQSPTQQQQQQDQSSLRQRHTLQVPRSASARRNSRDHSEDTAQSSGRLS
                     PTAGIRRTSMSLARRTTRTNHSDSIADESIPDEDAARYAEAIKQRRASRRRRRDDDDD
                     DRVIVGTKVDQNHVNWVTAYNMLTGIRFTVSRINAKLERELTPADFEAKHKFSFDITG
                     NELVPSAKYDFKFKDYAPWVFRSLRAKFRIDPADYLMSLTSKYILSELGSPGKSGSFF
                     YFSRDYKYIIKTIHHAEHKLLRRILPEYYKHVEKNPNTLISQFYGLHRVKMAYGRKIH
                     FVVMNNLFPPHRDIHQTFDLKGSTIGRDLHESDLEKNPRATLKDLNWVRRSRHIECGP
                     SKREFFIAQLQRDVELLKRLKIMDYSLLVGIHDLDRGNEEKLRDKTLQVFQPGGDQED
                     SSQNMLMRTPSKLESERKARELRMLIKRERPVPLDKAAAKMPEEILDERKYHVFYADD
                     GGFRATHENGAPGEEIYYLGIIDCLTHYGTIKRIENFFKGLSNDRTQISPIPPEGYGD
                     RFIKFIRGITMSKEEAERHQESRALGRPSAERTPSVERTMQQAEKEASKDVSITHPRT
                     LSTVRDPADANGPGPSSTLPIVDEAGEASSVGGHSQHSRQGPPPPAEKDLPPIPNQNG
                     TEMSEKGKAAVRDENLRPNRG"
     gene            complement(<1388174..>1389442)
                     /locus_tag="ACHE_70478A"
                     /db_xref="GeneID:66985993"
     mRNA            complement(join(<1388174..1388293,1388348..1388590,
                     1388648..1388706,1388829..1388959,1389079..1389101,
                     1389252..1389277,1389373..>1389442))
                     /locus_tag="ACHE_70478A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282815.1"
                     /db_xref="GeneID:66985993"
     CDS             complement(join(1388174..1388293,1388348..1388590,
                     1388648..1388706,1388829..1388959,1389079..1389101,
                     1389252..1389277,1389373..1389442))
                     /locus_tag="ACHE_70478A"
                     /note="COG:B;
                     EggNog:ENOG410PYKB;
                     InterPro:IPR005818,IPR005819,IPR036388,IPR036390;
                     PFAM:PF00538;
                     go_component: GO:0000786 - nucleosome [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_process: GO:0006334 - nucleosome assembly [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140157.1"
                     /db_xref="GeneID:66985993"
                     /translation="MPPKKTAAASATKKAAAGHASYRDMIKDAIVNLKERNGSSRQSI
                     KKYVQNNNDLNNASPAVFDNQFNKAIKAGVEKGDFTQPKGPSGPVKLAKKDAVEKPAP
                     KKAAPAKAAPTKAAAPKKAAAKKTEKAEKAEKAEKTEKAPKKATKATTATTSTAKKAT
                     TATKKKTTAKPKANTAKPRKTPAAAPAIIEKPKIISTTKSGRVTKTTAQPESAPKRAA
                     PKKKA"
     gene            complement(<1390739..>1392197)
                     /gene="FEN1"
                     /locus_tag="ACHE_70479A"
                     /db_xref="GeneID:66985994"
     mRNA            complement(join(<1390739..1391257,1391313..1391874,
                     1391943..1391947,1392017..1392102,1392185..>1392197))
                     /gene="FEN1"
                     /locus_tag="ACHE_70479A"
                     /product="elongation of fatty acids protein 2"
                     /transcript_id="XM_043282816.1"
                     /db_xref="GeneID:66985994"
     CDS             complement(join(1390739..1391257,1391313..1391874,
                     1391943..1391947,1392017..1392102,1392185..1392197))
                     /gene="FEN1"
                     /locus_tag="ACHE_70479A"
                     /note="BUSCO:EOG092634B1;
                     COG:L;
                     EggNog:ENOG410PFFR;
                     InterPro:IPR023426,IPR006086,IPR006084,IPR006085,
                     IPR019974,IPR029060,IPR036279,IPR008918;
                     PFAM:PF00867,PF00752;
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004518 - nuclease activity [Evidence
                     IEA];
                     go_function: GO:0016788 - hydrolase activity, acting on
                     ester bonds [Evidence IEA]"
                     /codon_start=1
                     /product="elongation of fatty acids protein 2"
                     /protein_id="XP_043140158.1"
                     /db_xref="GeneID:66985994"
                     /translation="MGIKQLYQVIAENAPDAIKTGDIKQHFGRKVAIDASMSIYSFMI
                     AVRSEGQQLMSDTGETTSHLMGMFYRTLRMVDNGIKPVYVFDGAPPKLKSGELAKRSA
                     RKSEATEAHEEAKETGTAEDVEKFSRRTVRVTREHNAECKKLMKLMGVPYIDAPTEAE
                     AQCAALARAGKVYAAASEDMDTLCFETPILLRHLTFAEQRKEPIQEIHLKRALEGLGM
                     DRNQFIDLCILLGCDYLEPIPKIGPNTALKLIREHGSLEKVVEYMESDPKKKFTIPED
                     WRYQDARELFIKPDVRDADHPDCDFKWEAPDVEGLIDFLVRDKGFNEDRVRNGAARLQ
                     KNLKSAQQSRLEGFFKPVARTDEEKASLKRKNDEKIQEQKKRKKDEAKAKKEAKAKPR
                     AS"
     gene            <1392638..>1394979
                     /locus_tag="ACHE_70480S"
                     /db_xref="GeneID:66985995"
     mRNA            join(<1392638..1392888,1392956..1393802,1393853..1394129,
                     1394177..>1394979)
                     /locus_tag="ACHE_70480S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282817.1"
                     /db_xref="GeneID:66985995"
     CDS             join(1392638..1392888,1392956..1393802,1393853..1394129,
                     1394177..1394979)
                     /locus_tag="ACHE_70480S"
                     /note="COG:S;
                     EggNog:ENOG410PICM;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172;
                     TransMembrane:1 (o537-555i);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140159.1"
                     /db_xref="GeneID:66985995"
                     /translation="MKRNRIQFEANGEHASNSPPQGAVAPEGHIPKISRRIRACTECK
                     KHKVRCNMNPGESICQRCRRMNLECVVHKSLQTLLEDETDWKTTVELAMSDLLRKAQL
                     PELSYYQTVSRTIDAPSKRQDRKGSTASTDDIGIATGSDRRTHPIDANVAAPTAPRNS
                     SDYNFSRQPARYSPDREENGTSSLVTAPMGSLYEVTQLSDIRANSPGENESSDHSLAT
                     DFISRGVVELQEAEELFQYFDQVLNRYLWDGIALVHKDLASVRNSSSMLSAAILAVTA
                     LHMPNKERTFDTCYTEFAKLASGSMLDRHHTLDDLRGLCIAAFWLADVSWKLSGYAVR
                     IATERNLHQCFRKATQGSPEHKEQARLWYLLYTLEYHFSIAYGRPPIIHEDPSITNHN
                     TFVLSPTAPQCDIRLHSQVDLFIILTRIYHAFGPDVDLEVPESDFSKIDKFDADLDEW
                     CTTWLPRIAGSWHVGAYPYRAVYLHYHFSRLQVNSVALRTYHSPTSTRIMSPERKKRA
                     KLAVESAIGTLLTVLEEPDIQRGLVGVPLYLHSMITFAAVFLLKIAAKGCQGQRNSIA
                     SADLHIDVAYVRELVGRIIELMVSCSKRASERHLSHHLARGLRKMLTGFEEWEKRNSY
                     SQPFSRQNSHDVSPMFKPIIIPGAQPLGQRDTILNHPPPLLGVAPLSAERSNGFEPST
                     VSEDEQLGLSEGSIDPMMGDLWGFDEEHFPMGVFDFLQSQMPA"
     gene            <1395720..>1397197
                     /locus_tag="ACHE_70481S"
                     /db_xref="GeneID:66985996"
     mRNA            join(<1395720..1395948,1396018..1396933,1396988..1397097,
                     1397151..>1397197)
                     /locus_tag="ACHE_70481S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282818.1"
                     /db_xref="GeneID:66985996"
     CDS             join(1395720..1395948,1396018..1396933,1396988..1397097,
                     1397151..1397197)
                     /locus_tag="ACHE_70481S"
                     /note="COG:I;
                     EggNog:ENOG410PFTG;
                     InterPro:IPR006091,IPR009075,IPR037069,IPR009100,
                     IPR036250,IPR013786;
                     PFAM:PF02770,PF00441,PF02771,PF08028;
                     go_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA];
                     go_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140160.1"
                     /db_xref="GeneID:66985996"
                     /translation="MNRFSLRAASRHFQSATRRPTPIAQGLAARNTSVRDYATFNWED
                     PLVASELYTEEELAIQDTARQYCQERLMPRVLDAYRKEDYDRKILEEMGELGLLGANL
                     HGYDCAGVSTVAYGLITKEVERVDSGYRSGMSVQGSLAMTGIYEFGSEELKQRLLPGL
                     AKGKLSGCFGLTEPNHGSDPGSMETVAREHPTQKGVYLLSGSKTWITNSPIADVMLVW
                     AKLQSTGKIRGFVVERSRCPPGTLETPAIKNKSALRASITGMIQMDECPVPAENMLPD
                     VEGLKGPFTCLNSARLGIAFGAMGALEDCLARAREYSLERKQFKGNPLAKYQLIQKKL
                     ADAATDAAYGTLAATQVARLKDEKKNTPEMISMVKRQNCDRALTNARVLQEILGGNAT
                     SDEYHIARHAANLFVVQTYEGQSDIHALILGRAITGVQAFV"
     gene            <1398117..>1398888
                     /gene="UBC4"
                     /locus_tag="ACHE_70482S"
                     /db_xref="GeneID:66985997"
     mRNA            join(<1398117..1398281,1398430..1398459,1398513..1398696,
                     1398749..>1398888)
                     /gene="UBC4"
                     /locus_tag="ACHE_70482S"
                     /product="ubiquitin-conjugating enzyme E2 4"
                     /transcript_id="XM_043282820.1"
                     /db_xref="GeneID:66985997"
     CDS             join(1398117..1398281,1398430..1398459,1398513..1398696,
                     1398749..1398888)
                     /gene="UBC4"
                     /locus_tag="ACHE_70482S"
                     /note="COG:O;
                     EggNog:ENOG410PI8T;
                     InterPro:IPR016135,IPR023313,IPR000608;
                     PFAM:PF00179"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 4"
                     /protein_id="XP_043140161.1"
                     /db_xref="GeneID:66985997"
                     /translation="MSYPRLPLRGVLVRCSHHPTTLRGGCRRYPRNMDTDYCLSDPPS
                     SCSAGPLGEDLFHWQATIMGPSDSPYSGGVFFLNIHFPTDYPFKPPKVNFTTRIYHPN
                     INSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTDRPRYE
                     STAREWTRKYAI"
     gene            complement(<1399418..>1400892)
                     /locus_tag="ACHE_70483A"
                     /db_xref="GeneID:66985998"
     mRNA            complement(join(<1399418..1400769,1400817..>1400892))
                     /locus_tag="ACHE_70483A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282821.1"
                     /db_xref="GeneID:66985998"
     CDS             complement(join(1399418..1400769,1400817..1400892))
                     /locus_tag="ACHE_70483A"
                     /note="COG:C;
                     EggNog:ENOG410PK92;
                     InterPro:IPR001834,IPR008333,IPR001433,IPR001199,
                     IPR017927,IPR001709,IPR036400,IPR018506,IPR017938,
                     IPR039261;
                     PFAM:PF00173,PF00175,PF00970;
                     TransMembrane:1 (i114-136o);
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140162.1"
                     /db_xref="GeneID:66985998"
                     /translation="MAEYTIKDLASHKSRDDLWIAIHGKVYNITPYIRDHPGGPDVLL
                     DTAGTDATEAYDEVGHSEDADEILQTYYIGTLRDAQEHRPKNKTVRVIQQPAKSTVEV
                     SKTAKGPGLGSILKAIALIATSSAGVALPAYLFFSSGGTVDIHRFLPKSLPSWPSIAS
                     LQQSATAGKGSFTTGFTTATLLMSTLAVLAIPKLSALTSPDSGFARYPPHMKSRRAPK
                     PNPHLANGFLNPKGYKSLPLVRKDELAPNVYRFVFDLPKSTDVIGLPIGQHVAIKAVI
                     NGETVSRSYTPTSNNTDLGRLELVIKCYPDGLLTGKYLANLQIGDTVQFRGPKGAMKY
                     SRGLCKKIGMIAGGTGITPMYQLIRAICEDDADETEVSLVYANRAEGDILLRRELEAF
                     AKAYPRKLRIWYMLDQPEKGWKYGSGYVTPDVMREKLPGAAPDTRIMLCGPPGMVNAA
                     KKGLVGLGFQAPGAVAKMSDQIFCF"
     gene            <1401269..>1403343
                     /locus_tag="ACHE_70484S"
                     /db_xref="GeneID:66985999"
     mRNA            join(<1401269..1401398,1401448..1402284,1402342..1403017,
                     1403319..>1403343)
                     /locus_tag="ACHE_70484S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282822.1"
                     /db_xref="GeneID:66985999"
     CDS             join(1401269..1401398,1401448..1402284,1402342..1403017,
                     1403319..1403343)
                     /locus_tag="ACHE_70484S"
                     /note="COG:Q;
                     EggNog:ENOG410PFCN;
                     InterPro:IPR001128,IPR002403,IPR017972,IPR036396;
                     PFAM:PF00067;
                     TransMembrane:1 (o341-368i);
                     go_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA];
                     go_function: GO:0005506 - iron ion binding [Evidence IEA];
                     go_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     go_function: GO:0020037 - heme binding [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140163.1"
                     /db_xref="GeneID:66985999"
                     /translation="MSQQFYLLGEPVSSARHLPVEKTLDLEGLQYVVAAHFAIVEAKG
                     IGFQDEETIFSEVHDILASKNPIAITIDGHAVRDPPGPNGLPYVGNYFEVYPDHLGNH
                     QRLFDTYGPIFKATSLGRTTYHTNDPQISAIAFTESDFFSKEINDAHPLSALKTPAAG
                     IFLGDTDTEEWKVTHKFLPPALGPKAVRHYAPTMQTTVEDACKIFDELDKQGEAWNVY
                     QYMLKLGSQAVGKLTLGLDFGHFVGPDAPLHEMVGAIAEMLSLNKKVTSKGDWYAKLP
                     FGEPKKLQELRKRIEEMVEESIRNAERGGVEDLPLQDAALRAANMVDYAIRATDNKGE
                     KLPKTSLVWSLVVATAAGFTTTSSLLSWLIYGLCTYPGMQERLLQELIDNEIDENTQI
                     TADVIDRLSFLDKYIKETQRRHNPSFQPGRTAQLDLILPGGYKIPKGSVIIVALHHIH
                     NNPALWDNPARFDPDRWDTDAVKNRHRAAYVPFGTGQRMCIGFNFALQEIKVFLPKLV
                     YRYEFRREGDGAIEYDPMFQLIRPNNLYVRAERRTKWPANPKNFTTE"
     gene            <1403876..>1404885
                     /locus_tag="ACHE_70485S"
                     /db_xref="GeneID:66986000"
     mRNA            join(<1403876..1403954,1404015..1404659,1404725..>1404885)
                     /locus_tag="ACHE_70485S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282823.1"
                     /db_xref="GeneID:66986000"
     CDS             join(1403876..1403954,1404015..1404659,1404725..1404885)
                     /locus_tag="ACHE_70485S"
                     /note="COG:I;
                     EggNog:ENOG410PJW8;
                     InterPro:IPR006176,IPR022694,IPR006108,IPR036291,
                     IPR008927,IPR013328;
                     PFAM:PF02737,PF00725;
                     go_function: GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase
                     activity [Evidence IEA];
                     go_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     go_function: GO:0070403 - NAD+ binding [Evidence IEA];
                     go_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA];
                     go_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140164.1"
                     /db_xref="GeneID:66986000"
                     /translation="MSTWNAEDYRNRPVTILGGGVLGRRIACVWSSAGYATRIFDPSP
                     DQRQAAIMYITENASTYAQRTYAQPSNDIQAFDNLGDAVSTAWLVIEAVPEKLALKID
                     TFAELATLAPKDCILASNSSSYKTSEMLDKIPAEAEARSRILNTHYYMPPGNMIVELM
                     TDGHTSASIFPFLVERSKEAALVPYVARKESTGFIFNRLWAAVKREALMILAEGVSEP
                     SEIDDMWKRMFVEGGAVPCAMMDNVGLDTVAFIEEHYVKERGLSGEKTVGFLRENYLE
                     KGRFGSKCEKGGLYPPKQ"
     gene            complement(<1404938..>1407347)
                     /locus_tag="ACHE_70486A"
                     /db_xref="GeneID:66986001"
     mRNA            complement(join(<1404938..1405418,1405472..1405654,
                     1405705..1406333,1406385..1406465,1406516..1406841,
                     1406897..1407141,1407199..>1407347))
                     /locus_tag="ACHE_70486A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282824.1"
                     /db_xref="GeneID:66986001"
     CDS             complement(join(1404938..1405418,1405472..1405654,
                     1405705..1406333,1406385..1406465,1406516..1406841,
                     1406897..1407141,1407199..1407347))
                     /locus_tag="ACHE_70486A"
                     /note="COG:K;
                     EggNog:ENOG410PVUX;
                     InterPro:IPR036864,IPR007219,IPR001138;
                     PFAM:PF00172,PF04082;
                     TransMembrane:1 (i228-246o);
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140165.1"
                     /db_xref="GeneID:66986001"
                     /translation="MSTRRYRSAIACESCRRRKVRCSLTVTGIPCIGCAQDRAECVVD
                     ERRSLTLSRVQERRARQSHSQPHSPGHRSNDALPSSQPFNSHFRHVEPSESPSHASDR
                     IQDEERNGLEIAAAALGQREGVGQVPFYTGDQTGITSTLDLCSPEQHLPRHLLLPMHM
                     PAASLSDSLSDQDREYLASKGVFTLPGKEACDSLIRAYFRHVHPIMPIIEADGLLGAV
                     AAGRFEDYNVLLVWSVFFAAVNFIPIPICQSEGYESRKAMKAAMYSCARSMYNHTTDR
                     ITLLQSSLLLGFWHSETDQHAAPWYWTGISVNMCQILGLHRNPDNTNSTSTTRRNASI
                     TDRQRHLWRRLWWTCFFRDRWLSLTLGRPMRIDLNDCDMPMARAEDLLSDLEGVERGV
                     KEAFLPRDLERMAGFWVMLVEMSKVLGKVLKLNYQALRGRPGLGEVEALEAQILSCRC
                     PDVGDDNGSGLSREAFFYVYHLQLHYQAILIMFYRPYGTESPEGLHPAQQQKWQHRMR
                     READTAASRTNDILDMLAQENLLEFALPMTPPLLIPAMQMHLLNCNSANSLSRRLRLN
                     KLNVCMMVMEEFQKVYTVASIYRGIFAKAIQQFYARDAGVMGMPSPTWLAANAGASVN
                     ATEPPALVPVASVPMAVDAGAGGGDVQAQAVSVPFEGDLNMNTEMTSDLIDALVDEAS
                     TFNFWETWGQLWVDQ"
     gene            complement(<1407786..>1409912)
                     /locus_tag="ACHE_70487A"
                     /db_xref="GeneID:66986002"
     mRNA            complement(join(<1407786..1409565,1409612..1409683,
                     1409737..1409806,1409888..>1409912))
                     /locus_tag="ACHE_70487A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282825.1"
                     /db_xref="GeneID:66986002"
     CDS             complement(join(1407786..1409565,1409612..1409683,
                     1409737..1409806,1409888..1409912))
                     /locus_tag="ACHE_70487A"
                     /note="BUSCO:EOG0926142H;
                     COG:J;
                     EggNog:ENOG410PIFZ;
                     InterPro:IPR015943,IPR013979,IPR011387;
                     PFAM:PF08662;
                     go_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA];
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140166.1"
                     /db_xref="GeneID:66986002"
                     /translation="MAAPTQLAFRTVKGIGILDAAPVYESLPGFTRPEGNLRCAAYSP
                     CGRYYAWASPDKVTIIDPSVGHAVSTIPAENVFELAFSPLGSYLITWQRPSKDANGDA
                     VKNLKVWRAVGDEHTVVGSFVQKSQTGWNLQYSADEKLCARVVTNEVQFYQSENLSTV
                     WNKLRVEGVADFALSPGKNSQSIAVFVPERKGQPAAVKVFVVPQFGAPVSQKSFFKGD
                     KVQLKWNAQGTTLIVLAQTEVDRTGKSYYGETTLYLLSSNGGFDSRVELDKEGPIHDV
                     SWSPNSREFGVVYGYMPAKTTIFNFRGVPKHTFPLGPRNTILFSPSGRFVLVAGFGNL
                     AGQMDIIDVDKDYTKVTTVEASNASVCEWSPDGQYILTATTSPRLRVDNGVRIWHVSG
                     SLMYNEDMHELYDVFWRPQPDVQHNAGPADPLKNPPAPHPSALAYLSTRKAPVKPAGA
                     YRPPGARGQTTPLAFKREDEGGAAFIRDGAGSGVASASSFGKPRRREVPGADPEYLPP
                     GAAPGGGVPLPGSEQEKLSKSAAKNKKKREAKKKEADDAAAAAAAQKNGNRAANANGA
                     SKGNKTNGTAKAVEQPAEPAPAPVEEPGAQDKKIRGLLKKMRAIDELKMRLAGGEKLE
                     DTQMKKIQTEEGVRKELEGLGYNG"
     gene            complement(<1410644..>1411553)
                     /locus_tag="ACHE_70488A"
                     /db_xref="GeneID:66986003"
     mRNA            complement(join(<1410644..1411433,1411483..>1411553))
                     /locus_tag="ACHE_70488A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282826.1"
                     /db_xref="GeneID:66986003"
     CDS             complement(join(1410644..1411433,1411483..1411553))
                     /locus_tag="ACHE_70488A"
                     /note="COG:S;
                     EggNog:ENOG410PPBT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140167.1"
                     /db_xref="GeneID:66986003"
                     /translation="MSTPTLINLPPPPSGSVTPSDMGPGTPNSGTTSLSALSTTAIKD
                     GHQGQPQPHPHGRHAHHSSTTSLSSTNTLEAERADRISRLAGLERVATARASPTSQPG
                     SGLAAQITPGYFDSQYNNKERSTVGSASATTASVGGRTTWASGSDFTFDGDKMSEDPD
                     DGTSSVGNISDEGNASLVGFGEGASTVSGPISRPNLNRVSSGGRRTPSSLGSPTTSRA
                     NTIAAYLQGQGDSPMMPSPLSPAGSSSNVPEQGGEDARMIDGMTFDADVVDTTARTPR
                     LATPYNGEGS"
     gene            complement(<1412266..>1413777)
                     /locus_tag="ACHE_70489A"
                     /db_xref="GeneID:66986004"
     mRNA            complement(join(<1412266..1413650,1413735..>1413777))
                     /locus_tag="ACHE_70489A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282827.1"
                     /db_xref="GeneID:66986004"
     CDS             complement(join(1412266..1413650,1413735..1413777))
                     /locus_tag="ACHE_70489A"
                     /note="COG:S;
                     EggNog:ENOG410Q0TJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140168.1"
                     /db_xref="GeneID:66986004"
                     /translation="MSGLNPFRLSRKPDALPVTTQFVDDSLFAPAGAPVNDNENKNED
                     IKAFDAQDNVNQNPAAATHTAESTTTTASTRDVDTTSVSSDDGSTSDPFRQASHLSDN
                     DGDGGSYKETRRDSAVQPDSLSSAPFTSADTSVTKESNTLHPNSAKRASRPLPPPPTG
                     SRTANNSSTDVSQLSTRSGTVNKRTSVTDIDTRSLGSRSGNKEKKPPPPPKSHHGKLI
                     NNPAQPVPAESKRFSFHDSSSETSFYTPSTPSQSSKPSVQVDYFSSVSNENQNPNQNP
                     NTRATDTLKRSQSQYKRPPTPPLSRRHSQMKRSKSTLSSKQNQNRLSLPVGSESIKPS
                     PPPSPGATTTSLNPPVQRTSRPLSLQTDENTLKHTSSLKEQAPSPLSPTAESPLSRTT
                     SIRRTASGSSSATAPPPPPPPRRARYSNDSARPTSYVQPKKTEEESTFQPQPSNANNI
                     LEDLSRLQKEVDDLRGRYESRQSNH"
     gene            complement(<1414735..>1416073)
                     /gene="ECO1"
                     /locus_tag="ACHE_70490A"
                     /db_xref="GeneID:66986005"
     mRNA            complement(join(<1414735..1415950,1416042..>1416073))
                     /gene="ECO1"
                     /locus_tag="ACHE_70490A"
                     /product="N-acetyltransferase O1 (establishment of
                     cohesion protein 1)"
                     /transcript_id="XM_043282828.1"
                     /db_xref="GeneID:66986005"
     CDS             complement(join(1414735..1415950,1416042..1416073))
                     /gene="ECO1"
                     /locus_tag="ACHE_70490A"
                     /note="COG:L;
                     EggNog:ENOG410PMEH;
                     InterPro:IPR028009,IPR033257,IPR028005;
                     PFAM:PF13880,PF13878;
                     go_function: GO:0016407 - acetyltransferase activity
                     [Evidence IEA];
                     go_process: GO:0000070 - mitotic sister chromatid
                     segregation [Evidence IEA];
                     go_process: GO:0007062 - sister chromatid cohesion
                     [Evidence IEA];
                     go_process: GO:0045132 - meiotic chromosome segregation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="N-acetyltransferase O1 (establishment of
                     cohesion protein 1)"
                     /protein_id="XP_043140169.1"
                     /db_xref="GeneID:66986005"
                     /translation="MPWTVTNSFKRGLMKTYGRPLWRVYDDDQNPAAKKRRVQAGDES
                     DQAEANLQYAIRESSAAILSSPSRRNSIVLSEATQDDDLSTPPSSPPPRLSPPPANTR
                     KPTFSFLKRKHSATKDGANGTPLSEVNSNSVRSSADPPKKKQKQSSQPSQQRQQQQPT
                     LKQMQIDVGRDVRKTCTTCGMEYNPTNTEDAALHKKFHDMNSTGVDLGKAFMRANACR
                     WVYEATRFDEGYVVIVDRKASPSAKNQAKKVLEVISKELSSPEIPDDVLWSQVEPPKD
                     QQHESLEKVDRYKVFLHMKDSRCVGACLTERIWESKPVQKSATQANGVGAERPSNNSS
                     SITVGDETHPAIVGISRIWTSGSSRRKGIAMDLLDCVVVNFIYGMEIPREQIAFSQPT
                     ESGNRLIQSFFGPDEPWHVYNES"
     gene            <1418121..>1419271
                     /gene="EMG1"
                     /locus_tag="ACHE_70491S"
                     /db_xref="GeneID:66986006"
     mRNA            join(<1418121..1418163,1418472..1418731,1418795..>1419271)
                     /gene="EMG1"
                     /locus_tag="ACHE_70491S"
                     /product="18S rRNA pseudouridine methyltransferase"
                     /transcript_id="XM_043282829.1"
                     /db_xref="GeneID:66986006"
     CDS             join(1418121..1418163,1418472..1418731,1418795..1419271)
                     /gene="EMG1"
                     /locus_tag="ACHE_70491S"
                     /note="BUSCO:EOG09263DFA;
                     COG:J;
                     EggNog:ENOG410PGWK;
                     InterPro:IPR029028,IPR005304,IPR029026;
                     PFAM:PF03587;
                     go_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="18S rRNA pseudouridine methyltransferase"
                     /protein_id="XP_043140170.1"
                     /db_xref="GeneID:66986006"
                     /translation="MADTTQVAGKRKRARTQSCPPPELPQLVAEQHVPIPPHDKDTKR
                     LIVVLSNASLETYRAASGRSGPGRDEKYSLLNSDEHIGVMRKMNRDISEARPDITHQC
                     LLTLLDSPVNKAGRLQIYIHTAKGVLIEVNPSVRIPRTFKRFAGLMVQLLHRLSIRST
                     NSQEKLLKVIKNPITDHLPPNCRKVTLSFEAPVVRTTDYVESLGPNESICIFVGAMAK
                     GHDDFADSFKDDTISISNYSLSASVACSKFCHAAEEAWDIL"
     gene            <1421266..>1423307
                     /locus_tag="ACHE_70492S"
                     /db_xref="GeneID:66986007"
     mRNA            join(<1421266..1421441,1421489..>1423307)
                     /locus_tag="ACHE_70492S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282831.1"
                     /db_xref="GeneID:66986007"
     CDS             join(1421266..1421441,1421489..1423307)
                     /locus_tag="ACHE_70492S"
                     /note="COG:E;
                     EggNog:ENOG410PW2Z;
                     InterPro:IPR037523,IPR029068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140171.1"
                     /db_xref="GeneID:66986007"
                     /translation="MPLAHLTLTVRDVRAATSFFLACLQPLGYQFVGRHEDYIGFGQK
                     TNEPADFWITEQKPGLPAGAAHLAFPAPSREAVGKFFMAALKAGGRVHGEPKLRDPES
                     GYYSAAIIDSNGNSVEAVYRPGHSSARSAVSSSIDSTVSITTKSSSRASSRTQTTVPS
                     RSEARSHTSRASTKVERPHPSEKPRDLREPRESRESRDSRDSRDPREFREARESRESR
                     ESRGPRESREPRDMRESREPRESRGSKESTASSNSRRGSSTAQAQAYAAQQRDHQQRE
                     QQQQSDGSSRAAKTLVGSLIGAAAGAALAYAWSGNNSQSPSSEDTASQPTQPTQPAQP
                     TQSGQSAQQPPRERTYQQAPSSRSSSQTAQTLPIRAIEAGGSYFPPKQPDPPRPGLTR
                     SVTSKNPRASTIYEGSEYGGKSEASRTYLDDSGRRASDGGAAFGLPDIANLPLRAIEY
                     PPPTYSKANEPSRAIDDKRSMYSASTARPSNASYQYQYQDDRDRNRDSAYALSHSNSN
                     NNKYNPNSTASRTPRNIPLPDSIASYRPSNASGSGTDTGSYTSARGAPLTEGSLASFR
                     SNSTVPIPESVVNVDVDTDVTPDDSVSQISSNGHRSKAMPRQMPAPAPARSGVSASAL
                     SKRSSRFEEPVRPDDSISQVSCNSRSTARAGGGERRSQAV"
     gene            complement(<1424238..>1426212)
                     /locus_tag="ACHE_70493A"
                     /db_xref="GeneID:66986008"
     mRNA            complement(join(<1424238..1426101,1426154..>1426212))
                     /locus_tag="ACHE_70493A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282832.1"
                     /db_xref="GeneID:66986008"
     CDS             complement(join(1424238..1426101,1426154..1426212))
                     /locus_tag="ACHE_70493A"
                     /note="COG:S;
                     EggNog:ENOG410PMKM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140172.1"
                     /db_xref="GeneID:66986008"
                     /translation="MPSFPDTPLVRPRDDGLQLSYQLPHRVHAAKAYPILAPNGSSII
                     IYGYENGLKVVWRGGRRFSVPKAASPNGDKSKKPKDDAVMIIDSDDENSPEAQKEETV
                     YDFEEEETEVDPARPFEEILRQIDIPLGSKVLDLAVPRVLPEAARSVLDPFPPLLNRS
                     IVVAAVCADFSTRIVTLPLKPPHTVQTDPSTWDIQMLSIAGGVSHQEIPRGVSITFTC
                     QGVENNGNTAERWDLLVATHSAEASGLLLIHRITLSEESSHGQVSYRLSDEDIDSRRR
                     YLPAPAQTIAFNPSGYPSTRHATLLVAFHGCVKIYSCFSTKPSKASRRTGPQNDYEIT
                     ETEGRWLISLFPGFESTPSELPRRKTIIDADWVLGGRAVMVLMADGEWGVWDIEGAGP
                     GTAKGPLQRQSSVQGVTGGSLTTFSVSGRILSPLSNKTDLGETEQRPKFAPLTPATKR
                     VREDTLLKGSVGSSTNPSMCGELSVFQTNSARDALPDESILLRHGSQSAVIPSLLALW
                     RNTVKAAGTFDSSNRCRVSTIQDVHLMGEHFTGIGHLPAASRQTRKTGDRREFDILVT
                     AERRIMILAPQLVEPHYESASRPAEEPITTEVDQLMLRRGELDVNGMDRVLSGMASGN
                     RSLRMGSPIKRARIFT"
     gene            <1426618..>1432902
                     /gene="APC1"
                     /locus_tag="ACHE_70494S"
                     /db_xref="GeneID:66986009"
     mRNA            <1426618..>1432902
                     /gene="APC1"
                     /locus_tag="ACHE_70494S"
                     /product="anaphase-promoting complex subunit 1"
                     /transcript_id="XM_043282833.1"
                     /db_xref="GeneID:66986009"
     CDS             1426618..1432902
                     /gene="APC1"
                     /locus_tag="ACHE_70494S"
                     /note="BUSCO:EOG0926049S;
                     COG:D;
                     EggNog:ENOG410PHFM;
                     InterPro:IPR024990;
                     PFAM:PF12859;
                     TransMembrane:7
                     (o799-819i1390-1410o1430-1448i1623-1640o1683-1701i1721-
                     1739o1745-1762i);
                     go_component: GO:0005680 - anaphase-promoting complex
                     [Evidence IEA]"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 1"
                     /protein_id="XP_043140173.1"
                     /db_xref="GeneID:66986009"
                     /translation="MATVRSLGLHVPSALPFLIAENLLPPDPSEDQYSWKTCVHETQN
                     GPVADELVWTKECVVWSRAGIVTRVFRLDLEKEEIRHALITHFAPGKAKKLNANGNYT
                     WGFPVGAQRGPESKLAASGLTLGLRDGELQGTNGSGSTDGLPRALVVVLKSQAHIFFL
                     TGNSHVIPLPFEVDSVFATPRGLLLQRKVQDEDVSSTIYPMAPPNSFVSRPGTASQSQ
                     TKRPSLTVSPLQPSLKPKSKHANLPRVFSLMDPHSEMGLVVTSQSSRWLQSSTSSRHS
                     GLDVLDPADEIVYVSPTNELSDSSQALTKGPLILVVTVNSHTGLYTIWTARYRDEENA
                     TSSSSKKRERRETGGTRSRRRSSHFGMATGATTPVARPSTARESFGPRGDNWNTPGLS
                     HSQYSVDGRPDEEDLASRLGQDLSDLGVPSKNSRRVSSLLARADLATNQDRIAFSDLA
                     TGSQSTTVSHGGLRQSISGASTRGSFGFNPRGSLPPGSASIYSNASSAADGPVDRLLE
                     ELNNDSLYEGFESMDLKGSASGLPEEVLLNKIESFPMKFSGNFQVNARSKSRRLKIST
                     MTPSACGHSQNGLTAVLALCVVDQDAKSMAIVNLRADRIAFPKKDRVISKKTKRNVSP
                     DERTLLIQATGVHHYSNVLDACKIVDGEVSRFAILSVADQGEHEISLQSPWCSPMTVE
                     VPRKLMLYDPYGVSTNTSMNRPRESGLHRLMTDSSVTVTGLGHPSVRGRIDVIDDMER
                     KHSLQIQMEPSNEVVRSIIRVCRFVLRDTEKAGEGILVGWWKVMKWLRARETNENDLE
                     WTAMVIVLFSMAIPFISGHTPRTPVKTRRRRGLPRSSSGSYADLESWEAMLDQESGSA
                     GVVAPWMNNSAWGWIVEQDAEEEDHSSAPLTRGRRTSTMDQLNSSRSTFRKNSYLLRC
                     AALTREFLQSPQGTEASGPEGYLPTAESYNENSRRTALCTVFVGLHVLREEQKLSICE
                     TEQSRRTLGLLAPVLAQIGRYLGWKSWAWAEDAYFGCEIASIDRWQFEDAEISTLDVP
                     SEPFAPPSIFAYMENAWRQPSTPFLSLLDLISASDRSSKKGKLWQECFTLTPRMLALN
                     GFLSEVHRCSTSLDKVKLLHRWGLTRSVIETFPEGVSAPLYEAIMQSQIRASTSWNAA
                     LLELIDREDLNMSMNTDNSRPFSTAPQPAVLHEAVRDFHSLGNSALDIDTINSFEVSA
                     EADRFSVTKLIFREDKRFVEAARVLNQSKPPAAECVPEPSWTDSDLLEAQKEVVQLVT
                     LRTLSIPAGRAMLAFSGRLPLLTEKLPIPSFSLQCVMKPSNVTISADRASFSEEKVCW
                     AFFHNGVSTGLAISKASKGIDTSWILFNKPQDLTNRHAGFLLALGLNGHLKSLAKWVA
                     FKYLTPKHTMTSIGLLLGLSASYLGTMDTLITRLLSVHVTRMLPLGAAELNLSPLTQT
                     AGIMGIGLLYCNSQHRRMSEVMLSEVENSEQEDSSSTSNEDLRDEGYRLAAGFALGFI
                     NLGKGKDLRGMRDMHIVERLLAIAVGTKNVDLAHVLDRATAGATIALTIIFMKTNDVF
                     LAQKIDIPDTTVRFDYVRPDLFLLRTLARHLIMWDSIQASEEWIIKSLPKIYRRRYRL
                     TGVRRLKSDDMPFFNIIAGLCFTLGLRYAGTAQTHVRDLLVSYLDQFMRICRLPALNY
                     DGRLTRNSVRNCQDIVALSAAAVMAGTGDLVLFRRLRSLHGRVDPDTPYGSHMAAHMA
                     VGMLFLGGGSYTLGTSDLAIASLLCSFYPIFPTTVLDNKCHLQAFRHLWVLATEPRCL
                     IPRDIDTRRPISIPITVSTKHNGRRKLTAPCLLPDLSEVSKVEVRSTDYWPLVLDFGP
                     NQGLREKFRQGDQSVYLRRKTTYNPTGSSVFVSTFTGLSDIQDKPSAANPASIVTLAN
                     NQMTLGPLSLSIDSQTGKPSSPSAKSLWDWIFHLSSLRGLDIRERSLVMPSSFPTMSG
                     TRKGTLSSNAPWLRMSAVDTKLVLEHNVSNMVKAAMSARGAGPDEVRDRLWQLRLLFG
                     WVDAQVEKAIVDVDDDEDDTEVEGEDEDRDSQMVGSEITATSRKGKGGEGNGLWLRKE
                     FIEEVRWKIWGVQVGEDGHV"
     gene            complement(<1432990..>1434351)
                     /locus_tag="ACHE_70495A"
                     /db_xref="GeneID:66986010"
     mRNA            complement(<1432990..>1434351)
                     /locus_tag="ACHE_70495A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282834.1"
                     /db_xref="GeneID:66986010"
     CDS             complement(1432990..1434351)
                     /locus_tag="ACHE_70495A"
                     /note="BUSCO:EOG092606AD;
                     COG:K;
                     EggNog:ENOG410PI3M;
                     InterPro:IPR013930,IPR039913,IPR013929;
                     PFAM:PF08620,PF08621;
                     go_process: GO:0006366 - transcription by RNA polymerase
                     II [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140174.1"
                     /db_xref="GeneID:66986010"
                     /translation="MVFPGERFVINLDDDNELAPNIPSFDDTASPSSLIGEIQERAPT
                     AAAPPAPKPPTGTGFPEHKKRFQRSAFKQRRADKQQQQQEQQGQGLATPVSDDKKAID
                     EENRRQLASMSDAQIQQEREELMSSIDPGLLERFLRRAKIDDPEPQPKQKPESSTKPT
                     KSVSFEVPEPEPQTKQPSPPKPEPQLSQQTQPPINEDLPPPTPPSDLHPASELPPSFH
                     FPTPPSSSSSATLPPLDPSSPSFLSDLQTHYFPNTPHDPSSLTWLQPEPSAEEAGIDT
                     SRTSPYDPESTAEAIHPAAIRFSLTGTILAPSTSLSLPTTLGLHHHGNDPQAAGYTIP
                     ELTILGRSSFPAQRCVAWQVLGRILYRLGRGEFGERGSPLVEGLWEVVEKEGAVSIML
                     AEADGLNTNTNEGDDRKVPLKGAGIGRHASATAWAVEGVWLWQKSGGGDRGVLKEGTI
                     RPR"
     gene            <1435376..>1437627
                     /locus_tag="ACHE_70496S"
                     /db_xref="GeneID:66986011"
     mRNA            join(<1435376..1437129,1437180..>1437627)
                     /locus_tag="ACHE_70496S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282835.1"
                     /db_xref="GeneID:66986011"
     CDS             join(1435376..1437129,1437180..1437627)
                     /locus_tag="ACHE_70496S"
                     /note="COG:S;
                     EggNog:ENOG410PHVI;
                     InterPro:IPR014840;
                     PFAM:PF08729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140175.1"
                     /db_xref="GeneID:66986011"
                     /translation="MSTESDHNPVAQEQDATIDTETRAEDALKGRRVSAGTRRSRRKK
                     DDDNTTEPEDKKKETKPRNNRRKSNPASTTNNTTSSRKKPKLENNDAATLPPPYQPAP
                     QQHQQHPQQSQQQQPPPPQPPAFHHSYPNNHHHAPSQIPSSYPLSHSLPPSRPQSQPP
                     PPPPSVPQRTSGQNYDPIRSALDDTASPAPTPSATSPPTRSAFRASASPAIASIIDPP
                     STTTTSNPQPIYSPVPRRASPHVPSNLSSPAHPKAPTPSHPSLAPSPLPSSSSPSHPH
                     GSLLPPHHSSLPPALQPLQSSHSYAHQSPYPPAQQQQQPRYEEQKPPQPESARPVAES
                     QEHAQAPVAMDVDQPEAAVSQPTRTTKKDKEKEKDNQKEKKETSSKPPSPKFGRAKDK
                     DAPSKLPQGSGLISNALFGGGDNTDSSDAPTTPNIILHVPLNGTTNRIINFARLAEEQ
                     YGFAALHPRLAAHKEQLARVAAAGAMLERNEKSAKGLLSAGESADEDLSLDMERDSDL
                     DGDVTMTGAANMNGAAAADGAEGKKKRRKKIEDYDRDDPFVDDSEMAWQEHAAASKDG
                     YFVYSGPLVPEGEKVQVERADGTIKRGRGRGRGGRSRAAPATSHQVPLAAAVPISQET
                     GLPLRGPGSRGGSTTRRPRVSKAARQQMEAEKEKQGNQGNHSSPSSNGRGGGAAGRGG
                     GPGSRGGKTPSAANASNGGSNTNTNDLTPQPNVGPAPPGPSPLSGPELVMK"
     gene            <1439208..>1440325
                     /locus_tag="ACHE_70497S"
                     /db_xref="GeneID:66986012"
     mRNA            join(<1439208..1439454,1439512..1440066,1440118..1440188,
                     1440239..>1440325)
                     /locus_tag="ACHE_70497S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282836.1"
                     /db_xref="GeneID:66986012"
     CDS             join(1439208..1439454,1439512..1440066,1440118..1440188,
                     1440239..1440325)
                     /locus_tag="ACHE_70497S"
                     /note="COG:G;
                     EggNog:ENOG410PS5U;
                     InterPro:IPR023271,IPR034294,IPR000425;
                     PFAM:PF00230;
                     TransMembrane:7
                     (o73-94i115-136o142-160i167-189o209-229i236-256o288-307i);
                     go_component: GO:0016020 - membrane [Evidence IEA];
                     go_function: GO:0015267 - channel activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140176.1"
                     /db_xref="GeneID:66986012"
                     /translation="MVVITGLPDYDTERQSSVAPGIPPFAGRLGGQQEYPDRNDPRNT
                     KLLKEIPDAAPRMHLSEVFDLRGFVSLDLWKFALLECVGSMMCTFMTAWVTTHAPSKT
                     ESPKTEAGIYHTLTFFSPLFGGITNVLLIPLLIYTFSPSSGGHISPTITLATFFARMI
                     SFPRMVLYLGGQTFGGALAGFAMRTAYGSREFTVGGCYVDTELVPVKDALVIEFMSCL
                     VLVYVAFGVALDPRQASLFGHAASPWLVGLVLGIVSWGSAFTREGYIGASVNPARCFG
                     VYVASSFPGYHWIHWVGPLAASIGHGLIYYLDPLWVDPRPKSA"
     gene            <1443521..>1443995
                     /locus_tag="ACHE_70498S"
                     /db_xref="GeneID:66986013"
     mRNA            join(<1443521..1443748,1443801..>1443995)
                     /locus_tag="ACHE_70498S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282837.1"
                     /db_xref="GeneID:66986013"
     CDS             join(1443521..1443748,1443801..1443995)
                     /locus_tag="ACHE_70498S"
                     /note="COG:S;
                     EggNog:ENOG410Q1JS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140177.1"
                     /db_xref="GeneID:66986013"
                     /translation="MIRTNLSIAAEILRREIKQMIPEAAGPLPTIPENQRQQTHVDVD
                     VDEDTYGNKNYTGSLLEIKCTQLSKAMGVGEKDWGYRVTHFPGNTTIKNDRKEMYLVP
                     LSKGFILTPGGLLSEGTYTYVTHDMVISEGTAVFIVSE"
     gene            complement(<1459971..>1461137)
                     /locus_tag="ACHE_70499A"
                     /db_xref="GeneID:66986014"
     mRNA            complement(<1459971..>1461137)
                     /locus_tag="ACHE_70499A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282838.1"
                     /db_xref="GeneID:66986014"
     CDS             complement(1459971..1461137)
                     /locus_tag="ACHE_70499A"
                     /note="COG:K;
                     EggNog:ENOG410PHUC;
                     InterPro:IPR021858;
                     PFAM:PF11951;
                     TransMembrane:2 (o268-287i308-329o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140178.1"
                     /db_xref="GeneID:66986014"
                     /translation="MELSSSFAALNINSPHAEQFFHHFVKEMPDILTLPTEENESLVP
                     VIVAIARRDKMISKALLCVGASHLINNTPAAETRSVTEERLKLLQEAEKELSSRVAAM
                     KTADPEALFAGYLLLYLYELSEGTGNGAWRVRLDGARSIIFNMLGAYKEPSREDLEDL
                     GINQSLVQFFIYHDTLASVTLQQPPRKILISKKPSSNQSEHVFGVNNGLLNFIARVSA
                     LQSEARAAGAISSPIIAQAFSIWKDIDKWRPPAYSSDDEESFDYRNMCEAYVAAIFIW
                     LFVIVYPDNLADDKVQVMVRKGLENLDAIDEPWLMSFGLFPAFLIAVACVHAQDRELL
                     EDQLDRIEEARRFRNIQVCRNLIRSSWACYDAGERKSWDWICLMKAQGLSMSVT"
     gene            complement(<1461775..>1462622)
                     /locus_tag="ACHE_70500A"
                     /db_xref="GeneID:66986015"
     mRNA            complement(join(<1461775..1461888,1461983..1462388,
                     1462450..>1462622))
                     /locus_tag="ACHE_70500A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282839.1"
                     /db_xref="GeneID:66986015"
     CDS             complement(join(1461775..1461888,1461983..1462388,
                     1462450..1462622))
                     /locus_tag="ACHE_70500A"
                     /note="COG:E;
                     EggNog:ENOG410PI4V;
                     InterPro:IPR024688,IPR011004,IPR001451;
                     PFAM:PF14602,PF00132,PF12464;
                     go_function: GO:0016407 - acetyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140179.1"
                     /db_xref="GeneID:66986015"
                     /translation="MRLDINEEENLARMRRGELYYAFTPQLVAARKRCARVVSRFNSA
                     GELSRREVAEYWKEITNDDKPLPPPASATATDTDEDATLHAYPWIERPINIDYGTNIT
                     VGSGVFINFNSTFVDTCQVSIGSRTLVGPNVSFFSGTHPLDPDLRNGTNGPEMGACVT
                     VGEDCWIAGGVIILPGVVIGDGCTIGAGSVVTKDVPAYHVAAGNPARILRKVERKYKA
                     EQENRQIESQQQ"
     gene            <1465860..>1466624
                     /locus_tag="ACHE_70501S"
                     /db_xref="GeneID:66986016"
     mRNA            join(<1465860..1466522,1466574..>1466624)
                     /locus_tag="ACHE_70501S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282840.1"
                     /db_xref="GeneID:66986016"
     CDS             join(1465860..1466522,1466574..1466624)
                     /locus_tag="ACHE_70501S"
                     /note="COG:S;
                     EggNog:ENOG410Q1C2;
                     InterPro:IPR038595,IPR025659;
                     TransMembrane:1 (i208-234o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140180.1"
                     /db_xref="GeneID:66986016"
                     /translation="MSRATYNHARLDRNIIPKTSRPRYVLKAPERQVAFRQEHIADEK
                     TTLILKPHGDAQSENAYKITHEEGAPAFTATGRKHSDRSCREVRDASGLPLFDIYKKP
                     LSSPFSWVVTLPGSKPSADAAIAKATPQWSWGSINLSLEFRNVAAVETKDEEDKKLSL
                     MVKKHGMALSFFDVVDGDRRIADIRESVNHNEKLALRRGSRGGSHRPALDLIVAPGMD
                     ISLVAAIAIIVSDWFFGSD"
     gene            <1467183..>1469072
                     /locus_tag="ACHE_70502S"
                     /db_xref="GeneID:66986017"
     mRNA            join(<1467183..1467484,1467533..1467804,1467860..1468230,
                     1468287..>1469072)
                     /locus_tag="ACHE_70502S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282842.1"
                     /db_xref="GeneID:66986017"
     CDS             join(1467183..1467484,1467533..1467804,1467860..1468230,
                     1468287..1469072)
                     /locus_tag="ACHE_70502S"
                     /note="COG:C;
                     EggNog:ENOG410QE0F;
                     InterPro:IPR036188,IPR002938;
                     PFAM:PF01494;
                     TransMembrane:4 (o6-24i451-472o530-549i558-574o);
                     go_function: GO:0071949 - FAD binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140181.1"
                     /db_xref="GeneID:66986017"
                     /translation="MTPKPLKVIIAGGSIAGLSLALMLERNGIDFVVLEAYPTIAPQA
                     GASIGVLPNGLRILDQLGCCNEVVDMAEYPVEKVLFRDSAGQTFWSLDDFGREMVDCH
                     GYPVVFLDRRMLIQILYDKIEDKSKVLTSEKVATVKNTASHVTVTTQAGNSYTGDIVV
                     GADGIHSTVRKQMWQEAQQTDPTCIDPSEEKALPATYACVFGISKGVPGIEKGTLSSV
                     FNEHTSYLIPSGPGDRTYWFLVRNLGKTMYGSDIPRFTKREEEALVKEHWDDYVTPTV
                     RFSDIYEHKISSVYTSLPEYVYKKWYFQRIMTIGDASHKFEPITGQGGNNAIETAASL
                     TNHLISALNANASQPLSTEEISSVFGKVQQQRHDRVWDLVKASHARQRFECMETPTLK
                     FVAKYVFPLIPKQAIRDQWIQTYCPAVSLNMLPQPNRPRKIPYHDELLRAPVSRGPLQ
                     FMVYVAYISLAWLAFQLLFVAMEGNGTRDLIRDVVIRPMMTEKEVPLRQDYTGFQGID
                     RIMQVLVAMFFSTVTSPSPQQIVQILYFLTAVLPLITIFTVEGFRLKNKWTLLALYVP
                     ITVSLLTAEN"
     gene            complement(<1469923..>1471194)
                     /locus_tag="ACHE_70503A"
                     /db_xref="GeneID:66986018"
     mRNA            complement(join(<1469923..1470023,1470078..1471059,
                     1471108..>1471194))
                     /locus_tag="ACHE_70503A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282843.1"
                     /db_xref="GeneID:66986018"
     CDS             complement(join(1469923..1470023,1470078..1471059,
                     1471108..1471194))
                     /locus_tag="ACHE_70503A"
                     /note="COG:S;
                     EggNog:ENOG410Q2D4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140182.1"
                     /db_xref="GeneID:66986018"
                     /translation="MFQAQALSTPKAPSNMRGRTCQFPTSISEQQTQQRRKQIREAQR
                     AYRSRQQSHLESLKTRVAQLEDVVAQVGQVMGIFHDAVVKQDVLLPQSKLMQTVILLQ
                     EEVGEHLKRAEKATSPAVRGCEFQGKINRVLSEACQFTHGPANESPPELPLTSDFWRL
                     FFNSTNSILPPIQTTTSSHDDNATYPPLTPANQTIPYTTTPFTQKLYHACAKSGHRYL
                     TNPTVTDAHMWPEFGLMLEHLPRQEVISYFERVLSTSPCNPVLDDRFPFISLGNAGVR
                     FSSGMHNLLPFQGTNGVRVIPSEEEWFDVKDVEKYLFEKGIQLVGCYDPASYTGESSL
                     IVPGQVLMSNMIASLDEATLIDGLSHLCICMGCVAGFRRRDVESFIWQNVQWTLD"
     gene            complement(<1473383..>1475240)
                     /gene="STE7"
                     /locus_tag="ACHE_70504A"
                     /db_xref="GeneID:66986019"
     mRNA            complement(join(<1473383..1474069,1474133..1474670,
                     1474736..1474893,1474959..>1475240))
                     /gene="STE7"
                     /locus_tag="ACHE_70504A"
                     /product="MAP kinase kinase (MEK)"
                     /transcript_id="XM_043282844.1"
                     /db_xref="GeneID:66986019"
     CDS             complement(join(1473383..1474069,1474133..1474670,
                     1474736..1474893,1474959..1475240))
                     /gene="STE7"
                     /locus_tag="ACHE_70504A"
                     /note="COG:T;
                     EggNog:ENOG410PFNY;
                     InterPro:IPR017441,IPR008271,IPR000719,IPR011009;
                     PFAM:PF07714,PF00069;
                     go_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     go_function: GO:0005524 - ATP binding [Evidence IEA];
                     go_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="MAP kinase kinase (MEK)"
                     /protein_id="XP_043140183.1"
                     /db_xref="GeneID:66986019"
                     /translation="MADSFKPRTLKRKNVKGLALNAAPKPENPPDGDSQAPGAGGNSE
                     NRTDTLEIGLEFRLDLRSEDLVVLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKE
                     NVRKQILRELQVGHDCNSPSIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVR
                     VDVLGKITESVLAGLVYLYETHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIA
                     DTFVGTSTYMAPERIQGGAYTVRSDVWSVGLTVMELAVGRFPFDSTDTAAGNRASAGP
                     MGILDLLQQIVHEPAPKLPKSDAFPPILHEFVAKCLMKKSDERPTPRELYDRDAFLQA
                     AKRTPVNLEEWAVSMMERHNRKSYLGPAAPRSLKDKEKEKEKEKEKEKEKEKEKEKEK
                     ENEKKKEEEKEKKESSRPAPPPKPVSSQLSRTPPSDEIPLKINDTSSRYNYAPSSSSS
                     HSSRSNRSPLDHAPLVTRDDDPRVSRPTYSSHGSPTATLDVPARPQMASRSASSSNMR
                     SQAALHNTTLPIRAAPAPNGSSTSAQSSSGGPWRRMRDMMGAAHGS"
     gene            <1476607..>1481047
                     /gene="SPT6"
                     /locus_tag="ACHE_70505S"
                     /db_xref="GeneID:66986020"
     mRNA            join(<1476607..1476789,1476846..1477025,1477094..1480739,
                     1480797..>1481047)
                     /gene="SPT6"
                     /locus_tag="ACHE_70505S"
                     /product="transcription elongation factor Spt6"
                     /transcript_id="XM_043282845.1"
                     /db_xref="GeneID:66986020"
     CDS             join(1476607..1476789,1476846..1477025,1477094..1480739,
                     1480797..1481047)
                     /gene="SPT6"
                     /locus_tag="ACHE_70505S"
                     /note="BUSCO:EOG09260492;
                     COG:K;
                     EggNog:ENOG410PFNW;
                     InterPro:IPR028231,IPR003029,IPR042066,IPR032706,
                     IPR012340,IPR023319,IPR012337,IPR037027,IPR028088,
                     IPR017072,IPR035019,IPR035018,IPR028083,IPR035420,
                     IPR036860,IPR041692,IPR023323,IPR010994;
                     PFAM:PF14632,PF14633,PF17674,PF14635,PF14639,
                     PF00017,PF14641;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     go_function: GO:0003677 - DNA binding [Evidence IEA];
                     go_process: GO:0006139 - nucleobase-containing compound
                     metabolic process [Evidence IEA];
                     go_process: GO:0032968 - positive regulation of
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IEA]"
                     /codon_start=1
                     /product="transcription elongation factor Spt6"
                     /protein_id="XP_043140184.1"
                     /db_xref="GeneID:66986020"
                     /translation="MSANKFIEGEAMLDDDEENEQEPPDDYDEEVREGPAKPPRGYAN
                     DSSEEDEEEDDEEAARAVQEGFIVDEDEEIEDRAQRRQEKKKRRREEREREEEHLDEE
                     DLELIGELNPAIQPPVASESKFKRLKRGHKERDRPRPSRGIDDMFNSDEEEEAGEYAR
                     PRRPMHDEMDDFIEEDVFSDDEQIQREREDDLEIARPKARVTGLGPSDMAGLDENALE
                     DMRAAFGDGNEYAFALDLEDQEDEQEEHEERHLDLKDVFEPSQLAEKMLTEEDNHIRL
                     ADEPERHQLSRKPYTHVVLTDDQLREEAGWISNLMLLKKRIEPDLHEPFQRSVAKVLE
                     LLVTDDWEVPFIFQHRKDYMIHAAKVPTDGAMDGDGQYKIQAEKLLNMTDLWDIFDYD
                     LKFRALVDKRNTIQKAYDNIQSLFDVKDHVIEEMLPIAVTMEELQDIQDYIHFQYATQ
                     LRDMNLANGDANGDVQRRKASGNSFFERIRNSRAYEFVRAFGITADAFAQNAMKQGHR
                     QYTEDPAVRPDEMADGLLDSDFSNPSHVVKAAKAMFAEELALSPKVRKVIRQAYYMNG
                     AVDCFRTEKGLRRIDEHHPYYEFKYLRNQQLIDIARRPELYLRMLKAEEEGLVEVKVR
                     FENFEHFRQRLYPDIESDNYSELADAWNRTRRDVLDMALGKLERLINRSVKENIRQEC
                     ENHVAKECREAFSQRLDQAPYKPKGMVLGTVPRVLALSTGTGIVGREPIHWAYIEEDG
                     RVLENGKFSDLSIGDRDRAIPDGKDVEGFVDVVDRRRPDVIAVSGMSPEARKLYKLLA
                     EVIDRKDLRGAPYTDDRDEEVSDRLEVVIVNDEVARLYQHSERAKRDHPGFAPLTHYC
                     VALAKYLQSPLKEYASLGRDVVSIQFKPGQQLVAQELLTKQLETALVDMVNLVGVDLN
                     EAVSDTATANLLPYVCGLGPRKAAHLLKIVNMNGGLVNNRVELLGVNAQYPAMGIKVW
                     NNCASFLYIDYENADPDADPLDNTRVHPEDYDIARKMAADALELDEEDIKAETDENGP
                     GAIVRKLFREEAQDRVNDLILEEYAEQLERNLNQRKRATLETIRAELQQPYEELRKPY
                     VFLETDEIFTMFTGETADTLYEGMVVPISIKRITDDHIDGKLDSGIDALVPESEMTDR
                     YDIPVRALYSMHQTVPAKILFLNRKHFTCNVSLREEQVSRPSGKPNDQINGEWDHSQE
                     HKDRESLEEKTQDGGRAVRVIKHPMFRPFNSTQAVEYLGSQSRGDVVIRPSSKGPDHL
                     AVTWKVSDGVYQHIDVLELDKENEFSVGRTLKVGGRYTYSDLDDLIFNHVKAMSKKVD
                     EMMLNEKFQEGSKTETDTWLETYTKANPRRSAYAFCIDPKHPGYFYLCFKAGEKARLH
                     SWPVKVIPQGYELQRNPYPDMRALCNGFKLLFTNMQAGTRR"
     gene            <1481663..>1484676
                     /locus_tag="ACHE_70506S"
                     /db_xref="GeneID:66986021"
     mRNA            join(<1481663..1481698,1481798..1483010,1483070..>1484676)
                     /locus_tag="ACHE_70506S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282846.1"
                     /db_xref="GeneID:66986021"
     CDS             join(1481663..1481698,1481798..1483010,1483070..1484676)
                     /locus_tag="ACHE_70506S"
                     /note="BUSCO:EOG09261QYO;
                     COG:T;
                     EggNog:ENOG410PHWU;
                     InterPro:IPR041680,IPR011993,IPR001849,IPR036598,
                     IPR037239,IPR000648,IPR009038;
                     PFAM:PF01237,PF15409,PF00169;
                     go_function: GO:0008289 - lipid binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140185.1"
                     /db_xref="GeneID:66986021"
                     /translation="MAGMETLEVHSKSYLVRWVNVKSNHTISWSIQPHKKSLNFGIFK
                     HPGHSALPGSDSHSTDSNENLPGSAVTGGRHSNNNLSVIEKLTGIGLKQIKWVGKCEA
                     DKIAQGTYDVPQNEGGNYALVFDNTFSKQLSKTVTLVLLTYPTAVPPKSGLAPPASHA
                     NGQPFHDGASTESLRPISRRRGNSNARPPTAQNGEAAAPSTVHRGLLHKRRRKRHQGW
                     ARRFFALDFTSSTLSYYHDPNSATLRGSIPLHLAAVACNEKTREISVDSGAEIWHLRA
                     SNDQEFVEWKRALEKASHRTPPEEEKHPQGEVLLRVPSQRAAPPATSAAEDREWVQVE
                     TLVGRMSASRDMVRKLAKDTDPKYQSTASTLAPVPSERPRGRSSSPSPSQSAAELNNG
                     DVGAQNRPFWKRKTSGSSANPSVRRERKPSSLISHPEPMEEVHDNLMGLLRDMDSVLS
                     EFSSLITQSEQRRHPPTSAVSRRSMESDVSQEFFDAEAGDGNDSPLLTMHGDSDDEEV
                     DNIPAAAAQQAEEEVVADDAPSDSEEEETPEPSNDEERDRLSSLFPAKPKSLTPLPLD
                     KVSRRDNIPAPKVMPPSLIGFLRKNVGKDLSQISMPVSANEPLSLLQRAAEVLEYSSL
                     LDKATSVTDPVERLAYVTAFALASLSSNRVKERAIRKPFNPMLGETYELIREDLGFRF
                     VAEKVSHRPVQLAYHADGKDWSLTQSPMPTQKFWGKSAEIVTEGKIRLTLHATGEHYS
                     WSSATSFLRNIIAGEKYVEPVGEMSVLNETSGHKAISTFKAGGVFSGRSEEVSTKILD
                     PNGTETPLGLSGTWTQSLTLTKNSSGTGTIWSAGQLVPNAPKHYGMTAFAAALNEVTQ
                     IEKNTLPPTDSRLRPDQRALEDNDLDKAEDVKVKLEEGQRARRREMEATGENWTPRWF
                     TQVASDGEVVWRLRNGKEGYWEEREKGEWNGVVPVFG"
     gene            complement(<1485343..>1486988)
                     /locus_tag="ACHE_70507A"
                     /db_xref="GeneID:66986022"
     mRNA            complement(join(<1485343..1486618,1486798..1486807,
                     1486868..>1486988))
                     /locus_tag="ACHE_70507A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282847.1"
                     /db_xref="GeneID:66986022"
     CDS             complement(join(1485343..1486618,1486798..1486807,
                     1486868..1486988))
                     /locus_tag="ACHE_70507A"
                     /note="COG:S;
                     EggNog:ENOG410PJ54;
                     InterPro:IPR039777,IPR016024,IPR007701;
                     PFAM:PF05004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140186.1"
                     /db_xref="GeneID:66986022"
                     /translation="MRSKQQLSAAPENTKKMSRKAAANEYSAGSKATSRVASPNDLDS
                     LLDFTDDEVNNENWEQEFSDVVTNIVDRKRSSVQGREEAYAAFGRLSKFHYVHDELYG
                     RVGELTAALCKSVKQESSVRETTLALRAVELLALSANDNTVYENVEPVLTRAIRDSSS
                     NLVKSSAIRCLGSCAVFAGAGEDGMLDQMNFFLDIVASYGESISASHDTDCIDAALTE
                     WGHLATHIWDLSAESEEAIEIFAEQLGGNDTGVQIAAGENIALLYEKSFSPRANFGED
                     EEEDDENDEAEEDKKNNQDEDEEALLNYEGPRLVQRYEPYHDTPEILNQLKSLATAHS
                     KRISKKDKKSLHTNFISIYTSVEDARRGPMYNTAINYNTNRHFGSKTRVKIGRDGVVA
                     VDRWWKWIRLNKLRRLLLGGFYVHFNQGNQTVLDSLPLAVLRLDSETGTGQWKTDKGR
                     KPRDTRRFAIHHDEDDGE"
     gene            complement(<1487581..>1488778)
                     /gene="RRP4"
                     /locus_tag="ACHE_70508A"
                     /db_xref="GeneID:66986023"
     mRNA            complement(join(<1487581..1488508,1488576..>1488778))
                     /gene="RRP4"
                     /locus_tag="ACHE_70508A"
                     /product="exosome non-catalytic core subunit rrp4"
                     /transcript_id="XM_043282848.1"
                     /db_xref="GeneID:66986023"
     CDS             complement(join(1487581..1488508,1488576..1488778))
                     /gene="RRP4"
                     /locus_tag="ACHE_70508A"
                     /note="BUSCO:EOG09263IQ5;
                     COG:J;
                     EggNog:ENOG410PK9Y;
                     InterPro:IPR025721,IPR036612,IPR022967,IPR026699,
                     IPR012340;
                     PFAM:PF14382;
                     go_component: GO:0000178 - exosome (RNase complex)
                     [Evidence IEA];
                     go_function: GO:0003723 - RNA binding [Evidence IEA]"
                     /codon_start=1
                     /product="exosome non-catalytic core subunit rrp4"
                     /protein_id="XP_043140187.1"
                     /db_xref="GeneID:66986023"
                     /translation="MPITIHPPVVEDVGTPHVDYDSMSVDSDGGVEFEDSRPNKRPSI
                     GVLKVGTGIVTPGEVVTDDPQWMRGHGTYTNPLSTSIIATVAGNVQKTNKLLSVTPLR
                     ARYTPEIGDLVVGRIVEVQSRRWKVDVAAPLLANLPLSAINLPGGILRRRTSADELQI
                     RTYFSEGDLVVAEVQTVHQDGSASLHTRSLKYGKLRNGFFLAVTGAGGSGASNSTVKG
                     GNGTGNTSGGTVVRSRRQVWTIESANGGGQVDVILGVNGYIWISKHAEGTDAASSATE
                     NVSITRMEEMVSSSIYSSQNDDIAPQTRREIARLAQCIRVLVQGGVPVDEETVMTAYE
                     ACLNVDLEMGDDEDDDEGTQEGREYLEGRKARSILEMVTSRQ"
     gene            complement(<1491422..>1492531)
                     /locus_tag="ACHE_70509A"
                     /db_xref="GeneID:66986024"
     mRNA            complement(<1491422..>1492531)
                     /locus_tag="ACHE_70509A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282849.1"
                     /db_xref="GeneID:66986024"
     CDS             complement(1491422..1492531)
                     /locus_tag="ACHE_70509A"
                     /note="COG:S;
                     EggNog:ENOG410PRP5;
                     InterPro:IPR011685;
                     PFAM:PF07766;
                     TransMembrane:1 (i178-199o)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140188.1"
                     /db_xref="GeneID:66986024"
                     /translation="MLHSIQAHRAIRPIPTGTSTALKLFNPSTRTYASPSSKTHTRPS
                     SSAQPDSPATVPSTSSTSTTSPDDINPPPSTRPADINTPDSLPDDAAPVDKVKRYVAL
                     GRAYLSFYKTGLKNVYHNYRASLPLRKELGLPVYLPISPPPKSKPIVSFKKAIEKTGL
                     SRSNFQLIRRAAYDVRRMIPFTLMLIVCGEFTPVIVLALGSTVVPYTCRVPKQFTKDR
                     AQKAARKRAALVAHCVQSTGSVTYNPDTGKELDLLAQYASPEWVDSASSEEVLRACAV
                     FGLVKTHTRPPALVSLVYRTRLKRFAEYLAVDDGLIKRGGGVSAMKGVEVRIAIEERG
                     GVEMVMRETGEGESEEWEGEREQRRWLEGWLERRA"
     gene            <1492747..>1493505
                     /locus_tag="ACHE_70510S"
                     /db_xref="GeneID:66986025"
     mRNA            <1492747..>1493505
                     /locus_tag="ACHE_70510S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282850.1"
                     /db_xref="GeneID:66986025"
     CDS             1492747..1493505
                     /locus_tag="ACHE_70510S"
                     /note="COG:Q;
                     EggNog:ENOG410PQ1X;
                     InterPro:IPR000868,IPR036380;
                     PFAM:PF00857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140189.1"
                     /db_xref="GeneID:66986025"
                     /translation="MFDFLKPSSRNTPLPPLSSSLPTALILLDNQAAFAHPSGPASSR
                     SNPLFEVNLTSLLAAFRVAREMAQSPSQSPSILPLSSKDKDESNSKNDNENNLEVVHI
                     FHTSDNPASPLHPQHPMKLIRPLDFARPLSSDKISGDDGGGAGETVVWKPLNSKPIGP
                     ELEAYLRQRGFRQLIFAGLTTDHCVSTTVRVAANLGLADPGRIIVVADATAAWAKGGI
                     DAETVHNVSIASLEGEFAEIMRTEDVVKALRRMK"
     gene            complement(<1493611..>1495008)
                     /locus_tag="ACHE_70511A"
                     /db_xref="GeneID:66986026"
     mRNA            complement(join(<1493611..1494642,1494697..>1495008))
                     /locus_tag="ACHE_70511A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282851.1"
                     /db_xref="GeneID:66986026"
     CDS             complement(join(1493611..1494642,1494697..1495008))
                     /locus_tag="ACHE_70511A"
                     /note="COG:S;
                     EggNog:ENOG410PK05;
                     InterPro:IPR011042;
                     SECRETED:SignalP(1-23)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140190.1"
                     /db_xref="GeneID:66986026"
                     /translation="MGSFLNIAILAVLAAMLAGPLYRQVNLLGVLRKPIENNPYIEGH
                     NLIKIEDTMQCEDLHYHAPANKLFTACEDSVLPRFEWFPPMKAFKKPSLATGSIHVID
                     PTTMKSTRLTFEDNFSGPFITHGIDVLEDPERPDSVYIFAVNHAPHPAYRPGRSDREW
                     DWDGPKARSQIELFHHVLGATTVKHVRSIRHPLIKTPNDIYAESPYSFFVTNDHGYRD
                     GVRRAIEDIVPMAKWSSTIHVRLDELQAVDAEAAIDASVALTGLFNNNGFGHGKAADD
                     MLITSAQGGMLYLAQPVRDQDGDTISVKEEIPLDSSVDNPTYFTDVYRTSEADDASGF
                     VLAGLRRAVDMVTHHTDPTAKDGVMVWYTRPNTTASEHRSEREGEHEKNDDEKSSNNG
                     RYETRLLFEDDGTHIRTAATAVLVPIPPQPEQGKKAWLFVTGFFSESMIAVQVDL"
     gene            complement(<1495501..>1498321)
                     /locus_tag="ACHE_70512A"
                     /db_xref="GeneID:66986027"
     mRNA            complement(join(<1495501..1496805,1496865..1497076,
                     1497138..1497999,1498187..>1498321))
                     /locus_tag="ACHE_70512A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282854.1"
                     /db_xref="GeneID:66986027"
     CDS             complement(join(1495501..1496805,1496865..1497076,
                     1497138..1497999,1498187..1498321))
                     /locus_tag="ACHE_70512A"
                     /note="COG:S;
                     EggNog:ENOG410QEAD;
                     InterPro:IPR032350,IPR043145,IPR013783,IPR000433;
                     PFAM:PF16158,PF00569;
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140191.1"
                     /db_xref="GeneID:66986027"
                     /translation="MPAPAPSAASVGHDTLITVKVHYDGTTRRLKMPFKDMKAEVFPQ
                     KLLQLLHVPSDAEVIIERYSDSAASFVQLDSANAAVYKQLSRAARAKLRLVISVTTVN
                     NNPLPSPVSQESSDSSTEQETPARNDYLDTVLSHPLPEVPSEGTDATPMGDGAAKGTD
                     NLSVEPSTTDTVAAPKPQFREFENSDSPVVAHQSPAGLFCIDCNNCGQTVPNEHYHCS
                     ICDGGDYDLCLQCVASGISCPAEDHWLIKRCVKEGTVTNSTTEKIAPQNSKPKEEVKP
                     EVAPQDAPEPIPEQSSSETLSPVPEVSAPTIAPVATPAPVPAPVQCDERICNACLKEY
                     EESKMVTCVDCEDYDLCVNCLLENAHGHHPGHSFSLIQDRQFSLRSSVMSRCYPGRNQ
                     YHAAVCDGCDKQITGVRHKCLGCPDWDYCSDCVPSAPLTHPGHRFAPIYGALSEPRVS
                     AEVHSGIFCDGPLCKNQASTCIVGPRYKCTVCHDTDFCAKCEALPTNTHNHTHPLIKF
                     KTPVRHVSVSTVDEGILSGQGNTLGDRVVQKSVSTQATAPSQPEITPTKDSEEKAEEK
                     SDAAKEVPAPVIEQVTAPTVDATSGYQAFFVNDVVADGTVMAPNKTFRQTWKLYNPGP
                     LAWPVGTDVRFVGGDTMFNVDTVHPSSLRSVASAMESNKLTAPLEPEQTADFTVLLRS
                     PSREGSAISYWRLKLPNGTPFGHRLWCDIRVQAGASELEPQEVLPENEKQSEEPVVEE
                     KQPTTVETDETEQTGSRMIFPTLDKESPSIHEETAALRAAPSTAPSESNQTNELDYLT
                     ITDTMSMDDDEEVDGFLTDEEYDVLDASDQEYLEAKQSQ"
     gene            complement(<1499378..>1501468)
                     /locus_tag="ACHE_70513A"
                     /db_xref="GeneID:66986028"
     mRNA            complement(join(<1499378..1500758,1500813..>1501468))
                     /locus_tag="ACHE_70513A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282855.1"
                     /db_xref="GeneID:66986028"
     CDS             complement(join(1499378..1500758,1500813..1501468))
                     /locus_tag="ACHE_70513A"
                     /note="COG:S;
                     EggNog:ENOG410PKWB;
                     InterPro:IPR018545;
                     PFAM:PF09405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140192.1"
                     /db_xref="GeneID:66986028"
                     /translation="MAPHRRNIGASRRRRRDDEGEEEGSDGGLDDDSLSEGSDMSHQD
                     DDADAETSDGSEDDEASTATPQGDQANGIQVNGSGTQSGQRSERRNATSPGEQGNNPT
                     VSDTEAMLNGLQLSGDSSQVAEVHFDNTKEEQPGQQEGGTSSGPLTDPKRETFAEKKR
                     RENERYVKERDKNPAFVPTRGSFFLHDKRSTEPGTNGSRPPNKSKSRPYGLIVDGNVQ
                     RSQPKSDASEGLWTHDLHDTVAGDDPPASKPTSTAPNATSVPANYPVPTAPRSSPPNR
                     SFSSTVLIGNVPVVVFLPGMARPTQARPVPKKQHTRLPQHRPPLRRDKPVRISLPGQN
                     PRYIFPSTERSFIFIPRALRPNQQAFRGRGRGGFFGGRRSSIYANSAYSPSVALSRRS
                     SLGRAPEGYHSPAASILSRATMVTTDNGKPVVRLPPPRPPGGFPQTTSVPGAIPPTVP
                     PSMPPQPQHHIYRESHSDPIPMHQPRPQKTVSVADIETPETYTFNPPQPQQEQPFHHQ
                     VPMPVNGAAYPPDAPPPTHTPFSHIPERAIHAQPFQPYDYSQPQAFYPPGYGPQGVYY
                     PVPGAEYPPYSTAMGPGASTAPYPPPGQQVPYMMPAPPTSTTEQPSSQSQTVAHEADG
                     MVYYYDAAQMYSNPNPYAVPAPPGPGGVVGMGGMMTPPGTAYYYPQPPVYYPSQ"
     gene            complement(<1502311..>1503411)
                     /locus_tag="ACHE_70514A"
                     /db_xref="GeneID:66986029"
     mRNA            complement(<1502311..>1503411)
                     /locus_tag="ACHE_70514A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282856.1"
                     /db_xref="GeneID:66986029"
     CDS             complement(1502311..1503411)
                     /locus_tag="ACHE_70514A"
                     /note="BUSCO:EOG092645U1;
                     COG:K;
                     EggNog:ENOG410PJIH;
                     InterPro:IPR000504,IPR012677,IPR035979;
                     PFAM:PF00076;
                     go_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140193.1"
                     /db_xref="GeneID:66986029"
                     /translation="MVNLGEGNEKKRKLSGDELEIDVSAPEPPSKKALRKAKKQGIDL
                     TAKAIEEQQKKEQAEKAAKTRSEYGIWIGNLAFSINKDDLRKFFTSNCSFADTTITRV
                     HMPKGADKFNKAQNKGFAYVDFAHPNALKEAMGLNEQMLMGRRVLIKNSKSFEGRPDK
                     PQDDGQGSKATGASGHAPSRRIFVGNLGFDVTKEALEEHFGQCGTLAHLHMATFQDTG
                     KCKGYAWVEFENIAAAEAAVKGYVMVNEEEEEEESDSDSDSDAENRRSKPKKPKQRRV
                     WVNQLMGRRMRTEFAEDPTTRYKKRFGKEGEGKARGDQSEAVEEDTIGGQSAPALPKK
                     AKKPEYSRYDEGTVQKLSGAIVESQGKKVTFD"
     gene            <1503696..>1504821
                     /locus_tag="ACHE_70515S"
                     /db_xref="GeneID:66986030"
     mRNA            join(<1503696..1503775,1503834..1503950,1504008..>1504821)
                     /locus_tag="ACHE_70515S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282857.1"
                     /db_xref="GeneID:66986030"
     CDS             join(1503696..1503775,1503834..1503950,1504008..1504821)
                     /locus_tag="ACHE_70515S"
                     /note="COG:S;
                     EggNog:ENOG410PRHE;
                     InterPro:IPR032742;
                     PFAM:PF14612;
                     go_component: GO:0005634 - nucleus [Evidence IEA];
                     go_component: GO:0031011 - Ino80 complex [Evidence IEA];
                     go_process: GO:0006338 - chromatin remodeling [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140194.1"
                     /db_xref="GeneID:66986030"
                     /translation="MSGIHESQPVPGSLVEAPAKQSYRSFKKKYAKLKIKFELGIKES
                     EELVREEMRIEELSKRIQAQNDQLLEVLLEFNDNLHLSPSLRFGLDAPDDTPSLPTPE
                     REFPAFDDSESATVALRSAKADLEAGRIMPDDYRDLEDAVKRGRAFAPEKQYTSLLKV
                     PHTASQAEEEYNAGNGNTSESLGYFNPDYENEYYLGIDARLGDGSAALQLERIPKKPA
                     PSDRDSEVAVRNPVSVYSWLRREQPSIFRDDDNASEKSGLRPSNQRSSKKAQQARKEE
                     DDEDSASIDTVPASNSKNKRKRDDDTGYRPKGGSSRSRKKKDDGGASSRRASKRASGV
                     GA"
     gene            complement(<1510366..>1513149)
                     /gene="WC1"
                     /locus_tag="ACHE_70516A"
                     /db_xref="GeneID:66986031"
     mRNA            complement(join(<1510366..1511696,1511747..1512185,
                     1512242..1512339,1512399..>1513149))
                     /gene="WC1"
                     /locus_tag="ACHE_70516A"
                     /product="blue light receptor"
                     /transcript_id="XM_043282858.1"
                     /db_xref="GeneID:66986031"
     CDS             complement(join(1510366..1511696,1511747..1512185,
                     1512242..1512339,1512399..1513149))
                     /gene="WC1"
                     /locus_tag="ACHE_70516A"
                     /note="COG:K;
                     EggNog:ENOG410PJCC;
                     InterPro:IPR000679,IPR035965,IPR001610,IPR013088,
                     IPR013655,IPR000014;
                     PFAM:PF13426,PF08447,PF14598,PF00320,PF00989;
                     go_function: GO:0005515 - protein binding [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="blue light receptor"
                     /protein_id="XP_043140195.1"
                     /db_xref="GeneID:66986031"
                     /translation="MTACVYTLVPLQSQAIQSRAMSGFDDFYHPQYYSLPASNRDHDH
                     PQTVQDPDGDPVVTSSLMVYSQSGAYDFGHYQNVYDQSQEPSVFRDGIPSTSSSINTG
                     HPTHANQMQTQSQQSSHHVGYPAQGSNLEGRLSNVNISYDPWSGAETSMLMNPHASSA
                     FPYDFANAYSMPPQLTSQHMGLNPQSTYSTLQTQTPAQNTYWGMDGYRAPQQDEPVSQ
                     GQYQNRQAYPQTYAPQRTLQSRAIQPKNQPFQDSFPSKVKSESHFEASPYTNIYSTSG
                     FDILGVLARVISRPDPKINIGAVDLSCAFVLCDMTQADHPIVYMSEAFGRLTGYSEEE
                     IIGRNCRFLQGPDGNVEPGAQRKFADSNTVYRMRTTIEERNETQVSVINYRKGGQPFM
                     NLVTMIPIRWDTNEYRFYVGFQVDLVEKPDAVTKKNSNGTYMINYQRSQLPNYVVPQP
                     DIRQSHPDLVVQFDHDQVSAILRSISASRPEYKHYLDRILVENADDVIHVLSYDGVFL
                     YLSPSCQKILEYESVELVNKTLSSICHPSDIGTVTRDLRTSITTAPVSVVYRIRKKHS
                     GYAWFESHGAWHVEQGRGRTFLVLVGRERLVYHLGQVARLGSEALGETDVWAKISASG
                     IILYISTKARPVLGRTQDDLVGTSFKDLLGAESHSEVQQALQNSRNGQRTMFNHQVRH
                     KKGHMVQAQTVLFPGDTKEGTKPSFLVAQIRVLKSSQSSSEEPMPTETTTLIPARNRP
                     RSSTDQQQNLVNASSANHLPPDNQFTSPTEQITIFPELIPTRGSSWQFELRELEKRNR
                     GLSDELQRLLTRRKKRKRKQTSMPVGKSCVICHTKNTPEWRRGPSGNRDLCNSCGLRW
                     AKQVRSAAQLERSESG"
     gene            <1514388..>1515142
                     /locus_tag="ACHE_70517S"
                     /db_xref="GeneID:66986032"
     mRNA            join(<1514388..1514442,1514511..1514559,1514614..1514630,
                     1514691..>1515142)
                     /locus_tag="ACHE_70517S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282859.1"
                     /db_xref="GeneID:66986032"
     CDS             join(1514388..1514442,1514511..1514559,1514614..1514630,
                     1514691..1515142)
                     /locus_tag="ACHE_70517S"
                     /note="COG:S;
                     EggNog:ENOG410PGA4;
                     InterPro:IPR001806,IPR027417,IPR005225;
                     PFAM:PF00071,PF08477;
                     go_function: GO:0003924 - GTPase activity [Evidence IEA];
                     go_function: GO:0005525 - GTP binding [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140196.1"
                     /db_xref="GeneID:66986032"
                     /translation="MAEAPEKISITICGDGGCGKSSMTLRLVRSQWVHEYDPTIEDSY
                     SVTRTIDGLPYFLCITDTAGQEEYRGLWAASNLKSDAFLLVYDITNELSLSALDYFME
                     MIHMEADQREEDNYRLRKELGASAQSVDVGMPPPIIMLAGNKCDLKENRVIRSKEGLE
                     YARKHGCGFMETSAREMVNIEETFAREYTA"
     gene            <1517124..>1518219
                     /locus_tag="ACHE_70518S"
                     /db_xref="GeneID:66986033"
     mRNA            join(<1517124..1517228,1517292..1517389,1517454..>1518219)
                     /locus_tag="ACHE_70518S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282860.1"
                     /db_xref="GeneID:66986033"
     CDS             join(1517124..1517228,1517292..1517389,1517454..1518219)
                     /locus_tag="ACHE_70518S"
                     /note="COG:K;
                     EggNog:ENOG410PNYA;
                     InterPro:IPR036864,IPR001138;
                     PFAM:PF00172;
                     go_function: GO:0000981 - DNA-binding transcription factor
                     activity, RNA polymerase II-specific [Evidence IEA];
                     go_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     go_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140197.1"
                     /db_xref="GeneID:66986033"
                     /translation="MTARQSTPTSDHSHSDNVRKRVCKACDRCRLKKSKCDGASPCGR
                     CRADNAICVFGERKKAHDKVYPKGYVEMLEQQQTWLVHGLQEMYRRASEGEGWPGEPL
                     RCEANGHPLTHDLLTRLGALDHTKGERFEENTEIMQQELWRRNAMQRQDSSDASSESA
                     AQSPVASSRFPSDVFGAATAAPPQQQLPPTPPSFSPSSSRTAQPTPVIKQEPQQQPQH
                     QQMQSSMAPNNPAYAAQMSMQGVVNPIALQGPQPWPSNNGFGTFDEMDLLGSADYTNM
                     SFDDPMSSPMFNRQIPISCIGLDNTKNDYEDFNQFLNPNPTEITSI"
     gene            complement(<1519498..>1520376)
                     /locus_tag="ACHE_70519A"
                     /db_xref="GeneID:66986034"
     mRNA            complement(join(<1519498..1520008,1520273..>1520376))
                     /locus_tag="ACHE_70519A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282861.1"
                     /db_xref="GeneID:66986034"
     CDS             complement(join(1519498..1520008,1520273..1520376))
                     /locus_tag="ACHE_70519A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140198.1"
                     /db_xref="GeneID:66986034"
                     /translation="MAPVPVHQQGRERRWIMGYTSKRRATVDAVKMDQVTGPNIFTPL
                     RGLLKVLKRSSGLRNTVDMRDPEDPSQTYRTSYPVTALDDPHQSMPVDIKAAIREGLR
                     ENFPALADRPLARTQICWYVVCTSPIILAFKPRVLTRRKFEQTTTSDFLICPRPRFSP
                     RHRPFPAQLEIPPSIWRGCHRIYDRHATSARTEVGSKKGDIGPY"
     gene            <1521305..>1522352
                     /locus_tag="ACHE_70520S"
                     /db_xref="GeneID:66986035"
     mRNA            join(<1521305..1521807,1521854..>1522352)
                     /locus_tag="ACHE_70520S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282862.1"
                     /db_xref="GeneID:66986035"
     CDS             join(1521305..1521807,1521854..1522352)
                     /locus_tag="ACHE_70520S"
                     /note="COG:G;
                     EggNog:ENOG410PGD8;
                     InterPro:IPR014718,IPR008183,IPR018052,IPR011013;
                     PFAM:PF01263;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0016853 - isomerase activity [Evidence
                     IEA];
                     go_function: GO:0030246 - carbohydrate binding [Evidence
                     IEA];
                     go_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140199.1"
                     /db_xref="GeneID:66986035"
                     /translation="MSQEAAFSFLPLGAIIQEFRIADQNIVLNFNTQEQYVKYNTPHF
                     GATIGRVANRIEGAVIHNLNGRDYSLPMNNGHNSIHGGEKGWGQRVFDGPHTVKKDGK
                     DALLFKYLSRDGEEGYPGTVELRVWYTAGKEDVNEANEKTVLTAEYEIEFVGDECEET
                     VVNLTNHSYFNIAGTPTVEGTQAQLATNDYLPLDAAGIPTGEIAKFRKDLTSPFGLGP
                     SVPHIDDVFVMESDPSKIALDTRTQPLKRLAQFHHPTTKLHLEVHSTEPAFQLYTGKY
                     IDTPEVEGTPARGEGAGFCVEPSRFVNAVNEPGWRSMVVLKRGQVYGCKNVYKAWKA"
     gene            <1522850..>1523913
                     /locus_tag="ACHE_70521S"
                     /db_xref="GeneID:66986036"
     mRNA            join(<1522850..1523011,1523064..1523119,1523172..>1523913)
                     /locus_tag="ACHE_70521S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282863.1"
                     /db_xref="GeneID:66986036"
     CDS             join(1522850..1523011,1523064..1523119,1523172..1523913)
                     /locus_tag="ACHE_70521S"
                     /note="COG:F;
                     EggNog:ENOG410PG9R;
                     InterPro:IPR027277,IPR002638,IPR022412,IPR037128,
                     IPR036068,IPR013785,IPR004393;
                     PFAM:PF02749,PF01729;
                     go_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     go_function: GO:0004514 - nicotinate-nucleotide
                     diphosphorylase (carboxylating) activity [Evidence IEA];
                     go_function: GO:0016763 - transferase activity,
                     transferring pentosyl groups [Evidence IEA];
                     go_process: GO:0009435 - NAD biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140200.1"
                     /db_xref="GeneID:66986036"
                     /translation="MTSASPYGDLRHLLPNNYKALITAWLEEDTPNFDYGGFVVGESE
                     GEARLLGKSEGVVAGVPFFDEVFSQLGCTVEWHIKEGLSLNPNPTHHCATVRGPIRKI
                     LLGERVALNILARCSGIASKSASLLAALRAHGWAGTLAGTRKTTPGFRVIEKYGILVG
                     GADPHRHDLSHMVMLKDNHVWACANNSAAADGGNRAVGEESIAVAIPRAVQAAKSVGG
                     FATKVEVEVRNLEEANAAIEAGADVIMLDNFTADGVKVAAKQLKEEWAAKGKRNAFLV
                     EVSGGLTEANAASFACEDVDILSTSSIHQGTPTVDFSLKVSLR"
     gene            complement(<1526087..>1530880)
                     /gene="ORF1"
                     /locus_tag="ACHE_70522A"
                     /db_xref="GeneID:66986037"
     mRNA            complement(join(<1526087..1528747,1528796..>1530880))
                     /gene="ORF1"
                     /locus_tag="ACHE_70522A"
                     /product="anucleate primary sterigmata protein B"
                     /transcript_id="XM_043282865.1"
                     /db_xref="GeneID:66986037"
     CDS             complement(join(1526087..1528747,1528796..1530880))
                     /gene="ORF1"
                     /locus_tag="ACHE_70522A"
                     /note="COG:S;
                     EggNog:ENOG410PIYU;
                     InterPro:IPR024545,IPR012943;
                     PFAM:PF07989,PF12808;
                     go_component: GO:0005815 - microtubule organizing center
                     [Evidence IEA]"
                     /codon_start=1
                     /product="anucleate primary sterigmata protein B"
                     /protein_id="XP_043140201.1"
                     /db_xref="GeneID:66986037"
                     /translation="MVVDDHHYLRGDQLPTEDNNKNNNNHSDDGNENHHDTSFMMDEN
                     NDMAEKDVENHTQDEQGTERREEHEQERQGQGQGTDPNPSITGLEDQNDHDDSFLPPP
                     LPDRDDSSLLLLSSEDDGDHERGENETFLEEREMRRKLMDMESSFLPESSTMDMNVAT
                     NEDAGADDTYLVGALEKYANAPPPNPTQPEGQSQLSIGNETSHDLTSIQEDDTPAPQT
                     PRQSAGEGNTTIDMETTTPAGHPPERQHEDEATILENPTSSPAAQAAARNENLNLSAS
                     VSENTGLGQAYQEGKNPSADKSATPQSRRSSQQLRTSSQSGKSRIFNDSSDGEMAPRA
                     TVRRGNKPKYLNSRQSAQRLSYSSIATTNTEETHSDATLGADYALQSGGAAPESANDA
                     QPGQHGNLARSVSLGSVASGISGYSDENPLDKSSKNPAGASDSGLHTLSEEEGYTSQS
                     RPSSRPAPGSPQQETSTEDTEPMTPKAKSSEHSFPTDTAITERIKDIQVPSAFSRQFR
                     EELGHRALSPERRTGATSTPAFGRSGRSMTLKEQSSTIDRLSKENFDLKMRIHFLNEA
                     LNKRSEEGIKEMISENVELKSDKLKLQKDNQGLKRKVRDLEKQIKDQQSDKESMVNHD
                     PEGSDDEHRDPMQNEEILFLQERMESYELEIERLRSESIARESEKRRLAEMVKSLSNG
                     RPVDSDVGSREERDMWKDMLDAETAAREQAEEENKVLRDETLRLRSEMEFALGSTRSG
                     QRDPTVAGVSYYSSTTEREFNNRKSSGGTLVIELELLKQENAELRKEVSAQTSMLTSR
                     NREKERLYQEIEELKLGQRRDGSRSIAGDSIFDRSASRAHGRSSSRASEMAPEDEADR
                     EELELRNGQLRDQVSTLKLENQTVHDQLEECAQELEALDKAYQADVEQAEEEIQSLQQ
                     ERDQALQMAEERDAAFQDLRAEAQEELDALGGELEQKVEECQRLNEEVRNQDESLQVL
                     QAEMRSAGEGIIRLEEDAQNNLERYKAVQQELEDSNREMEQLENNLYEANTKVQRLTV
                     QIESSQNEIAFLREEQDGDKIKIGDLESELKTYEINLGSERDKTRELEARLAEERHQR
                     EVVGGKEKQEVQRIVNELNREASTAKDELRRLRKALSAQEVETATWRERLMDLENNLR
                     ETLGDLTGSRSSLITNIVKLQKELESTALELESTRSKLDEKESLLRNRDALLESHGLE
                     SRKLSELLDRERHARRADKQSFEQAIKSHHQTSRSITQSNSRITELEQARSKDHKRFT
                     GLEQQFKDQLSERNAMLLTIWKRLSAMCGPDWAHSNSLINGNLPSQEVIGNILFWPGF
                     SRNLMLAVKTMEAVIGGFKNRIKGVERDLAKQYQNLEHTFSLRVKKLDRLEEGIMNLR
                     AQQHSKNQSGMSPEIAKLRGENRLLKAELNLIQSHSRSRGPVAGSSAQPTSPTHESSN
                     GNNVDPDVQRGLVRSSTTTGIPQPSHFSETTLAEQQGALVHGYRARHGADAGNSEKWI
                     QRLRELEKRLKAEREARLLDRGGARKRLEERDAENQRLRAQIERQQRARRSIAAADEQ
                     YAGRIQSGDQQDDDHSSDEGTGFYVDIEV"
     gene            complement(<1531411..>1532577)
                     /locus_tag="ACHE_70523A"
                     /db_xref="GeneID:66986038"
     mRNA            complement(<1531411..>1532577)
                     /locus_tag="ACHE_70523A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282866.1"
                     /db_xref="GeneID:66986038"
     CDS             complement(1531411..1532577)
                     /locus_tag="ACHE_70523A"
                     /note="CAZy:CE10;
                     COG:I;
                     EggNog:ENOG410PNHB;
                     InterPro:IPR033140,IPR029058,IPR013094;
                     PFAM:PF10340,PF07859;
                     SECRETED:SignalP(1-28);
                     go_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140202.1"
                     /db_xref="GeneID:66986038"
                     /translation="MATPLAAVLSTLNLPLLALFYLPPQLRQERDWTYRQALMNKLLK
                     SFLRNYTAVHVKQPLSLKPRLEGDRFAVIEPASPELYTGVAEDKEIVPETIGGTWYPV
                     PYQVNESPVKDQHVALHLHGGSYVLGDGRTASCQSLVKTLLSNTPAKYVFSLQYRLAC
                     NPNARFPAQLQDLITAYSYLLHTLHIPPSRIVISGDSSGAHLTIALLRYIVDHPSILP
                     APKCSWLFSPWCDIPEATDTEIWRKSPNYQTEYIPPTFPAWGASQFLKDVEITERVER
                     YVAPLWHPFTVPSPVLVVTGEREVLAPEHIKMAQSLQNMTKDNNSRVELFVENKVPHD
                     VLMVGWILGFREEAKQCASRAGKFVGQVQTMPEKDQLDQSTHVPGSPLGEINQH"
     gene            complement(<1533364..>1537642)
                     /locus_tag="ACHE_70524A"
                     /db_xref="GeneID:66986039"
     mRNA            complement(join(<1533364..1535282,1535335..>1537642))
                     /locus_tag="ACHE_70524A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282867.1"
                     /db_xref="GeneID:66986039"
     CDS             complement(join(1533364..1535282,1535335..1537642))
                     /locus_tag="ACHE_70524A"
                     /note="COG:U;
                     EggNog:ENOG410PHQI;
                     InterPro:IPR035999,IPR041681,IPR011993,IPR023394,
                     IPR000904;
                     PFAM:PF15410,PF01369;
                     go_function: GO:0005086 - ARF guanyl-nucleotide exchange
                     factor activity [Evidence IEA];
                     go_process: GO:0032012 - regulation of ARF protein signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140203.1"
                     /db_xref="GeneID:66986039"
                     /translation="MNRTKPENGKAPQRDPSDLSPPRTPPSQMSRYQTIRKSPQGRPS
                     LQDAFPDDTTATDTANSSNESGDERDPHDLSLSPKHAARTSIVDNMLQSLDQFSAGTS
                     VLDDYRLFHSVLESDFYNRDSPASSSHGRYRGHTFSSSLSSETDLAYEEGVSHYGIQT
                     ANGRRSNSLRGTSSVRGYEGLYSRTQPHAGSSSLVYRPRKGSKGSSSSNYDFGPSSSR
                     NRADSGSDAQSASIDYDGRAPFPPFPEDYEPLRYDDLDAAPTPSIPAGPRKYHSPSQS
                     DYQNTLNPQSSMTPIASRRNSIKSPPDQGKKKHRPENIGTATIRRPVDLELEPPPPLG
                     DSLDPPAPSPTISYNKPIFPPPPDPNPPKERPGFFRRVFGSAKNSTPDDASYLSHHDN
                     DFPKVGRQPSKIDVPGPNTSVRSEGRQVVNKKSSFFRRRKKSVVDSVPPPISIPQHLA
                     PKALDLMKPEPSPVSSLRQVMNPYISEGVPAPNRSSREYHGRETSAEDADHAKSASLA
                     SQKKRGSSVPPSSGSRYKYPGAYPPVPSGGLDTSFLANSSGDEASTTKSVDIGVTSPL
                     SPPVSRDTDSESLGSPTQGRLAPPLPQISVPGTTLSPVVEDFPQKTPETPEAANPAKM
                     PTPGTDSVLSETSNYFTAASTPVIQSEEPKPAESSDTKQDDTPKDGEGSHPTIADREQ
                     AQKLFDSQDEVVGNEPAAAWLGDPDRAVIREAYMDLFDWSNMHILAGLRSLCNRLILK
                     GETQQIDRVLDAFSTRWCRCNPHHGFKAADVVHTICYSLLLLNTDLHLADIDQKMTKA
                     QFVRNTLPTIERVAIDAAPGDFENGNKNQVSSSSGADAPSKLVNRLSRADLSGKTSMA
                     DFENGTGPLVNQPFHGTMRAWEQQVETVLREFYSSIQKERLPLHGAQPERDTPQASSN
                     NLLSANQNSSLRRSPSTVSKSGSDIYPRGRSADSRYGTARWSSKPRSRARLYPPSAMG
                     SSRTSLDDQSSLWSPSASSTWSKYSLGKLTSVSVDSFGSDFPRGEYQQSIGFANALSQ
                     AIIREDGASIASTEDPEAAPLLEDETLQLAGAPWAKEGSLKHKHHLDSVDKRAKDRNW
                     NDCFAVIQQGWMRLFSFNPATKSGKQQKAKQRQAGSVVVGGGNWLSNAEEVWKFTLRQ
                     TIASQLPPPGYSKSRPHVWALSLPTGAVHLFQAGTPEIVREFVSTANYWSARLSKQPL
                     VGGISNIEYGWSDAVINSALIHADSNNSNSPNHNTNGKSTPTGTRTSIQSSIRSSMDQ
                     QGVRPKLPADRVNISDWTPPQQSMAASNLPEEDQLKALQAYVKNTEEEFQRHNERRAA
                     MILAFSPRHPNASKAMANFERKSSYLLREIVKFRTYIDSLHGALEQKKRIYPPGEENK
                     ESNPTDNDDSKAGDGQETPTKVSIETAHPA"
     gene            <1539631..>1540788
                     /locus_tag="ACHE_70525S"
                     /db_xref="GeneID:66986040"
     mRNA            join(<1539631..1539737,1539857..1539956,1540016..1540019,
                     1540081..1540418,1540480..>1540788)
                     /locus_tag="ACHE_70525S"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282868.1"
                     /db_xref="GeneID:66986040"
     CDS             join(1539631..1539737,1539857..1539956,1540016..1540019,
                     1540081..1540418,1540480..1540788)
                     /locus_tag="ACHE_70525S"
                     /note="COG:S;
                     EggNog:ENOG410PHGS;
                     InterPro:IPR007881;
                     PFAM:PF05216;
                     TransMembrane:5
                     (o83-102i114-136o188-207i214-238o250-273i)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140204.1"
                     /db_xref="GeneID:66986040"
                     /translation="MNPHISLPRQHASSTFGVSAPASRGSSIRMPRFFKRLFKFPQMD
                     FEMAIWEMTSLLIAPKKVFKSIYYHKQTKNTWHRPDPSFTHLLSFFLLLTALAWGLAY
                     TPSFGSIFRLSFFFIFFHFIGSSLLISTVAFFAIGRLFGPDGAAASLTGFRGSRGRRR
                     GAAQGLFTQPGEKDQLEFGYCFDVSSRAFFPLYLHLYVVQFLLLPLLTRSGNFLAAFL
                     GNTLYLSAFTYYTYITFLGYNALPFLHNTELLLLPILVFAVLWLVSLIAGWGVVLQGH
                     SVEGLFWGV"
     gene            complement(<1541019..>1541896)
                     /locus_tag="ACHE_70526A"
                     /db_xref="GeneID:66986041"
     mRNA            complement(join(<1541019..1541681,1541756..>1541896))
                     /locus_tag="ACHE_70526A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282869.1"
                     /db_xref="GeneID:66986041"
     CDS             complement(join(1541019..1541681,1541756..1541896))
                     /locus_tag="ACHE_70526A"
                     /note="COG:S;
                     EggNog:ENOG410PPX8;
                     InterPro:IPR019380,IPR039876;
                     PFAM:PF10252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_043140205.1"
                     /db_xref="GeneID:66986041"
                     /translation="MTTQDRSFAQGRTDRNADELNHETGGKHFSRDAQPTDKDGNPVS
                     LWRETQDEIPSSDEEEQEESGSGSGSDEESSEEEGEDKAGPSTSAAANMTREERRAAA
                     KAKKQAAITKRKQMALQPGDLPPSDSEDENDVKGKNGSESEGKGEGGELPANPNHTAS
                     SRKQLEKTDEESKPKKDLSQLSRREREALEAQQERERYMKLHAEGKTEEARSDLARLA
                     LVREQREAERARKQAEKEEKEALAKEKAAAREALLAKKNTNKKGGGKKK"
     gene            complement(<1542390..>1543847)
                     /locus_tag="ACHE_70527A"
                     /db_xref="GeneID:66986042"
     mRNA            complement(<1542390..>1543847)
                     /locus_tag="ACHE_70527A"
                     /product="uncharacterized protein"
                     /transcript_id="XM_043282870.1"
                     /db_xref="GeneID:66986042"
     CDS             complement(1542390..1543847)
                     /locus_tag="ACHE_70527A"
                     /note="COG:G;
                     EggNog:ENOG410PJIM;
                     InterPro:IPR011701,IPR036259;
                     PFAM:PF07690;
                     TransMembrane:12
                     (i96-114o134-154i161-180o186-209i221-241o253-273i294-
                     318o324-349i361-381o387-409i421-441o453-476i);
                     go_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     go_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized