GenomeNet

Database: RefSeq
Entry: NC_083676
LinkDB: NC_083676
Original site: NC_083676 
LOCUS       NC_083676            2058218 bp    DNA     linear   CON 21-NOV-2023
DEFINITION  Lodderomyces elongisporus chromosome 4, complete sequence.
ACCESSION   NC_083676
VERSION     NC_083676.1
DBLINK      BioProject: PRJNA1043637
            BioSample: SAMN33325380
            Assembly: GCF_030384665.1
KEYWORDS    RefSeq.
SOURCE      Lodderomyces elongisporus
  ORGANISM  Lodderomyces elongisporus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Lodderomyces.
REFERENCE   1  (bases 1 to 2058218)
  AUTHORS   Hpyer,L.L., Hogan,E.K., Freeman,B.A., Walden,K.K.O. and
            Hernandez,A.G.
  TITLE     A Lodderomyces elongisporus NRRL YB-4239 Genome Assembly
            Substantiated by its Electrophoretic Karyotype
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2058218)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2058218)
  AUTHORS   Hoyer,L.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-AUG-2023) Pathobiology, University of Illinois
            Urbana-Champaign, 2001 S. Lincoln Avenue, Urbana, IL 61802, USA
  REMARK    Annotation added by submtiter
REFERENCE   4  (bases 1 to 2058218)
  AUTHORS   Hoyer,L.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2023) Pathobiology, University of Illinois
            Urbana-Champaign, 2001 S. Lincoln Avenue, Urbana, IL 61802, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP128569.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: filtlong v. v0.2.1; hifiasm v. v0.16.1
            Assembly Name          :: UIUC_Lelong_1.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 645.0x
            Sequencing Technology  :: PacBio Sequel IIe
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2058218
                     /organism="Lodderomyces elongisporus"
                     /mol_type="genomic DNA"
                     /strain="NRRL YB-4239"
                     /isolation_source="Concentrated orange juice"
                     /culture_collection="ATCC:11503"
                     /culture_collection="NRRL:YB-4239"
                     /type_material="culture from holotype of Saccharomyces
                     elongisporus"
                     /db_xref="taxon:36914"
                     /chromosome="4"
                     /country="USA: California"
     gene            <2273..>3232
                     /gene="XYL1"
                     /locus_tag="PVL30_003157"
                     /db_xref="GeneID:85890349"
     mRNA            <2273..>3232
                     /gene="XYL1"
                     /locus_tag="PVL30_003157"
                     /product="NAD(P)H-dependent D-xylose reductase (XR)"
                     /transcript_id="XM_061119448.1"
                     /db_xref="GeneID:85890349"
     CDS             2273..3232
                     /gene="XYL1"
                     /locus_tag="PVL30_003157"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD(P)H-dependent D-xylose reductase (XR)"
                     /protein_id="XP_060975431.1"
                     /db_xref="GeneID:85890349"
                     /db_xref="PFAM:PF00248"
                     /translation="MSIKLNSGHSMPLVGFGCWKLSNNLAADQVYNAIKVGYRLFDEA
                     QDYGNEKEVGEGINRAIKEGIVSRDELFITSKLWNSFHDPKHVEYALDRVLSDLNLNY
                     LDLFLIHFPIAQKFVPIDEKYPPGFYCGDGNKFHFEDVPLLDTWKAMEKLVEKGKVRS
                     IGISNFSGALIQDLLRGAKIPPAVLQIEHHPYLQQDRLIQWVQSKGIAITAYSSFGPQ
                     SFIELESKKAIDTPTLFENNAIKKIADKHGKSPAQVLLRWATQRDIAVIPKSNNPDRA
                     LQNLNVAEFTLDDEDVQEIKKLDKELRFNDPWEWNNEHIPTFI"
     gene            complement(<3497..>4354)
                     /locus_tag="PVL30_003158"
                     /db_xref="GeneID:85890350"
     mRNA            complement(<3497..>4354)
                     /locus_tag="PVL30_003158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119449.1"
                     /db_xref="GeneID:85890350"
     CDS             complement(3497..4354)
                     /locus_tag="PVL30_003158"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975432.1"
                     /db_xref="GeneID:85890350"
                     /translation="MSLVLEITCTNLKVGNSGSKKPDLLGVEYQHSRTRPQLPPQYEL
                     NDHALAKEDRERIVSLFTPEMQALSDSFQKYYGTWLQLRDELWSKSLIQKLIYKALFQ
                     KQYSSKRVFVVDHDFSEKLKLAIYEIFTELRAKSVIFLPWSVLAVLGANVRNGLVLNY
                     TFESLKIQTVVDLRVIDCREYVSINSMTKGDSTQQGNSENLKAMEKSEELDKVQEIID
                     TIIRRSPIDIRKVLRENVIVIGDESNKHHKIDLTMEKHRFETRPSDGCWIACSLYSQI
                     GKKWVEYKP"
     gene            complement(<4551..>6959)
                     /gene="RAD3"
                     /locus_tag="PVL30_003159"
                     /old_locus_tag="LELG_02310"
                     /db_xref="GeneID:5233258"
     mRNA            complement(<4551..>6959)
                     /gene="RAD3"
                     /locus_tag="PVL30_003159"
                     /old_locus_tag="LELG_02310"
                     /product="TFIIH/NER complex ATP-dependent 5'-3' DNA
                     helicase subunit"
                     /transcript_id="XM_001525703.2"
                     /db_xref="GeneID:5233258"
     CDS             complement(4551..6959)
                     /gene="RAD3"
                     /locus_tag="PVL30_003159"
                     /old_locus_tag="LELG_02310"
                     /note="BUSCO:EOG09260ZWU"
                     /codon_start=1
                     /transl_table=12
                     /product="TFIIH/NER complex ATP-dependent 5'-3' DNA
                     helicase subunit"
                     /protein_id="XP_001525753.2"
                     /db_xref="GeneID:5233258"
                     /db_xref="PFAM:PF06733"
                     /db_xref="PFAM:PF06777"
                     /db_xref="PFAM:PF13307"
                     /translation="MKFYIDDLPVLFPYPKIYPEQYAYMSDIKKTLDVGGNCILEMPS
                     GTGKTVSLLSLTVAYQMHYPEHRKIVYCSRTMSEIEKALIELHKLMEFRASALGYVED
                     FRGLGLTSRKNLCLNPLISRERKGNVVDEMCRRVTNGQLKEKIERGVVTEDMQERDPE
                     KYSLCSFHENLNELDQHDLIPEGVYSFDALIKYCKQIGTCPYFTVRRMIPFCNIIIYS
                     YHYLLDPKIADRVSRELSKDSIIIFDEAHNIDNVCIEALSLDLTEDALKRATRGANKL
                     ADAVDEMKQQDSEKLQNEYEQLVEGLRQAEVAREEELFMSNPILPQDLLDEAIPGNIR
                     KGEHFVAFLKRFIEYLKTRMKVLHVISETPTSFLQHLKELTYIDRKPLRFCSERLSLL
                     VKTLELSEIEDFNALKDIATFATLVSTYDTGFQLILEPFETEGSTVPNPILHFTCLDA
                     SIAIKPVFDRFSSVIITSGTISPLDMYPKMLNFQTVIQESYAMTLSRRAFLPLIVTKG
                     SDQLALSSRFEIRNDPSVVRNYGSLLIEFSKITPDGMVVFFPSYLYMESIISMWQTMG
                     VLDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAVLLSVARGKVSEGIDFDHHY
                     GRTVLMIGIPFQYTESRILKARLEFMRDHLQIKENDFLSFDAMRHAAQCLGRVLRGKD
                     DYGIMVLADRRFARKKSQLPKWIAQALNDSDTNLSTDMALATGKKFLRSLAQPTNPKD
                     QEGVSVWNLAQLEDYQKQFNKVQVSEEKQNEINGFVDENINGTPKETVDDFMDIDDED
                     LDLL"
     gene            complement(<7341..>8009)
                     /gene="ADK2"
                     /locus_tag="PVL30_003160"
                     /old_locus_tag="LELG_02312"
                     /db_xref="GeneID:5233058"
     mRNA            complement(<7341..>8009)
                     /gene="ADK2"
                     /locus_tag="PVL30_003160"
                     /old_locus_tag="LELG_02312"
                     /product="Adenylate kinase 2"
                     /transcript_id="XM_001525704.1"
                     /db_xref="GeneID:5233058"
     CDS             complement(7341..8009)
                     /gene="ADK2"
                     /locus_tag="PVL30_003160"
                     /old_locus_tag="LELG_02312"
                     /codon_start=1
                     /transl_table=12
                     /product="Adenylate kinase 2"
                     /protein_id="XP_001525754.2"
                     /db_xref="GeneID:5233058"
                     /db_xref="PFAM:PF00406"
                     /db_xref="PFAM:PF05191"
                     /db_xref="PFAM:PF13207"
                     /translation="MLKPTRLLFLGAPGSGKGTISKRLLKRFPQLHPISSGDVLRSQI
                     SKGTEIGKEADKYIKTGSLVPDSTMVNLITEQLRELNGLNDKANWLLDGFPRTFAQAE
                     KLTEILDTTNANLNLVVELDVDQKLILHRIESRYVHLPSGRIYSLDYNPPKVPFKDDV
                     TGEDLVKREDDNAKTFKKRLDKYNEEIGPLREYYQKLGIWHSVSGETSDIIYPKVEKL
                     VYES"
     gene            complement(<8368..>9591)
                     /gene="LEO1"
                     /locus_tag="PVL30_003161"
                     /old_locus_tag="LELG_02313"
                     /db_xref="GeneID:5232927"
     mRNA            complement(<8368..>9591)
                     /gene="LEO1"
                     /locus_tag="PVL30_003161"
                     /old_locus_tag="LELG_02313"
                     /product="Paf1 complex component"
                     /transcript_id="XM_001525705.1"
                     /db_xref="GeneID:5232927"
     CDS             complement(8368..9591)
                     /gene="LEO1"
                     /locus_tag="PVL30_003161"
                     /old_locus_tag="LELG_02313"
                     /codon_start=1
                     /transl_table=12
                     /product="Paf1 complex component"
                     /protein_id="XP_001525755.2"
                     /db_xref="GeneID:5232927"
                     /db_xref="PFAM:PF04004"
                     /translation="MSDEEREEVSVAQEELDDLFGESGGEDQDQDQDQETKSDSEEQQ
                     SQSTSKRNRVDYDSQNEGSNDDDEEEEEEEVEKKVLEISLPRHAVSSISEGTKILKTP
                     AHLKIEPRPFDPNKFKDEVEYKMQERKEQGLTSKQIYNEQLAEKLINETTIRWRYHNS
                     GNDEIIKQSNAHFVQWNDGSVSLKIGNEMFDVKSLPVVDNLLVRSHKTAEFLQTDSII
                     ESNINLLPASTNSIHKRLLQVMKNVQFKDKILSTTTEVDPLMKQRIEDENEKKKLKMK
                     RMLEAKRRLQEQKWERGDSPAVGGSRAYSAYADEDEDDDDYGVGGGRGGAAEEYDEED
                     DFVAGDEEEVEQYDDEDEEEEEEEVEEQEEEFEKGAERLRKLKEEGAARYREASVEEE
                     TRKRRRIIDSDEDDE"
     gene            complement(<10058..>12268)
                     /gene="SAC7_1"
                     /locus_tag="PVL30_003162"
                     /old_locus_tag="LELG_02314"
                     /db_xref="GeneID:5233500"
     mRNA            complement(<10058..>12268)
                     /gene="SAC7_1"
                     /locus_tag="PVL30_003162"
                     /old_locus_tag="LELG_02314"
                     /product="GTPase activating protein (GAP) for Rho1p"
                     /transcript_id="XM_001525706.1"
                     /db_xref="GeneID:5233500"
     CDS             complement(10058..12268)
                     /gene="SAC7_1"
                     /locus_tag="PVL30_003162"
                     /old_locus_tag="LELG_02314"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase activating protein (GAP) for Rho1p"
                     /protein_id="XP_001525756.2"
                     /db_xref="GeneID:5233500"
                     /db_xref="PFAM:PF00620"
                     /translation="MSHSSSPNRSSSIFGWAKSLKRSHLLSNDSVNEISDSDNASSKF
                     SPTKSINAGAFPSIVPSSSMQQLQQQQQQQQQQQQQQQQQQQMPRLQPQRSPLNIPSN
                     TNNNNNINNNSIPMSSSISGNLEPGAISPSPSNYIPSPSHQRQSISSHNNAQSGFSTS
                     NYLGTSPTASSSTHDFLRPILNHKSRSTNNVSRVRSNSENSIRNHRDSFLQSNSLVDE
                     NSKYFGVPLQQALSEAAAKISVLSSDDQTSGLQYGEIPIVVAKCGVYLKKNGLTVEGI
                     FRVGGSSKRLKELQVIFNTPPDYGKKLIWDGYTVHDAASILRRYLNALPEPLIPLDVY
                     EEFRVVLKERPRIISYMKYKAENPTRSLRKKSEGDSSQMLTEANMGRHNDSHASSVNA
                     ESSSNARATPNTVPDSQAVPTSLTAQTAQTAQTAPASTITASLQQPTLSLSIPQSSQE
                     DFSNKQKKKKTKNYKKLTNDVHTAIDIYRVLLNNLPISSKQLLFYILDLLAMVQSNSE
                     RNLMSARNLAAIFQPSILSHPNHDLDPEEYALSQLVVEFLIQYSYKLLPSHKEPSPPP
                     PAPPIATSLDVNVSADEIGPQDSLSNSEATYEAQKGQSSVEETASGSSSSQVVQKQQQ
                     QQQQQQLTPRFQRQHSKSLSAAPQHEDIVMGFKHNATESIPGESDLEYEVSDGVGSDA
                     DELYFHEAHRPSTMSSPKTSPMELIGKPVIPAAEEDPVIVVTSPSSTSVDQKSE"
     gene            complement(<16298..>16945)
                     /gene="RCN1"
                     /locus_tag="PVL30_003163"
                     /old_locus_tag="LELG_02315"
                     /db_xref="GeneID:5233227"
     mRNA            complement(<16298..>16945)
                     /gene="RCN1"
                     /locus_tag="PVL30_003163"
                     /old_locus_tag="LELG_02315"
                     /product="calcineurin inhibitor"
                     /transcript_id="XM_001525707.1"
                     /db_xref="GeneID:5233227"
     CDS             complement(16298..16945)
                     /gene="RCN1"
                     /locus_tag="PVL30_003163"
                     /old_locus_tag="LELG_02315"
                     /codon_start=1
                     /transl_table=12
                     /product="calcineurin inhibitor"
                     /protein_id="XP_001525757.2"
                     /db_xref="GeneID:5233227"
                     /db_xref="PFAM:PF04847"
                     /translation="MPRDPTNSLILTNLSQASLDSPNELVSLLSNENDLIELVILSKL
                     SRIILICESASVAIRVKAVISQHMPHVNVSFSIKDNNFDINKAELDSATTGYQEKTYL
                     ELPHDLNSKRFLISPPMSPQGEWNDWGKMEEGPNQVDIYSPEELSNLLWQRLGNTSMV
                     EKVHSEPKTGRTIDLEIEPELLFNGIDNGVPAIILDKADHELVEEKLPKTSMPPV"
     gene            <17775..>19712
                     /locus_tag="PVL30_003164"
                     /old_locus_tag="LELG_02316"
                     /db_xref="GeneID:5233091"
     mRNA            <17775..>19712
                     /locus_tag="PVL30_003164"
                     /old_locus_tag="LELG_02316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525708.1"
                     /db_xref="GeneID:5233091"
     CDS             17775..19712
                     /locus_tag="PVL30_003164"
                     /old_locus_tag="LELG_02316"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525758.2"
                     /db_xref="GeneID:5233091"
                     /translation="MSCNNNFNGEITEIPGVYVDKFNSRGKLFFLTHSHEDHLQGLLN
                     QSFCKRVYCSKLTRDIIKLDPKYKNKVKYLVAKEFNNPFQLSTNAFTVTVTMIETYHC
                     PGSAMFLFETGNSACLVTGDIRAEEWWTSSLVKNRYLFPYIKGFKSLDTIYLDTTFAY
                     RGEPYISIPPNSDGIANLINLLKLYPEGKYGPSCNHRGNNNKKNDNRNNSENEEKECR
                     EIAFSFLNTVSGSEEAWFQVADYFKTDLKVPKSIRKRISLLEQAQSHEHHYKQQQHHQ
                     QHHHQQHSLSSQQGSRLIAVGDVEAQVVITIKHAINYTIGEYQEYYSPIDMSLLNTSL
                     LEPKENTKSGHSIYVYDNRQYIKPNTDSLSNQNSQHLLPTTILLVFSRHSSYQESINF
                     VRLFIPKSVYPCVSSAQFWKTGFSIERVFGKVCSSESHRYDIEMRNKYGEPLVNLATP
                     VTCVDPWHQNVSEKPFKGQLHFQTSSEYQTWRHNFFGENLISGRREARYRDIIQYHQK
                     QKYAYESDDDNETTITNSTITTNTTTTTSETPDTCSNQSSFNDSGKSTKSLPDPLPEA
                     LTKGDATLPNTVINNVTKDCENQTGLSNWQKKRLHASVHSQEQTLVSPLLNHNRIAKI
                     SKQLKQDRRNWKRFKLKCLHS"
     gene            <20429..>22861
                     /gene="AKL1"
                     /locus_tag="PVL30_003165"
                     /old_locus_tag="LELG_02317"
                     /db_xref="GeneID:5233076"
     mRNA            <20429..>22861
                     /gene="AKL1"
                     /locus_tag="PVL30_003165"
                     /old_locus_tag="LELG_02317"
                     /product="Ark- serine/threonine protein kinase"
                     /transcript_id="XM_001525709.1"
                     /db_xref="GeneID:5233076"
     CDS             20429..22861
                     /gene="AKL1"
                     /locus_tag="PVL30_003165"
                     /old_locus_tag="LELG_02317"
                     /codon_start=1
                     /transl_table=12
                     /product="Ark- serine/threonine protein kinase"
                     /protein_id="XP_001525759.2"
                     /db_xref="GeneID:5233076"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF06293"
                     /db_xref="PFAM:PF07714"
                     /translation="METVPRLNEGDELQVGKHKVEVVRYLSEGGFAQIYQVLTTFEVG
                     TTTATKTKATSTTTPTSTSASTPAKTQACLKRVIVPNKAGLDQLRKEVEVMKVFRHAR
                     NVVTYMDSHAEKLGNGTYQVLVLMELCPGGSLLDHMNAKIKTKLTEPEVLQIMLDVSQ
                     GVYEMHKQKLIHRDLKIENVLINSKGRFKLCDFGSTSPPIMPPQDQQQFKFISHDILY
                     HTTPQYRSPEMMDLYRQVPIDEKADIWALGCFLYKLCYYTTPFEANGEMAILHASFQF
                     PPIPQYSGDLKNLIIIMLQENPLYRPNIVQVLMLVSKLSNIEFESLGLRDFCNLGPYN
                     FQQLQEYQMQKQAEVMREKQLYIHQQNMAQAAQAAQAAPTSQPVPAVSAVSATDAYQV
                     PGAPLTVNQQVDDEGKREGGREREREGEGEGQGEGQGKQEPAVDEEDENTADAKSGKS
                     DHLSVEAEPKVASSADSLVGFSSGNDQSFSDLEQLSDAEERFPSLEHLNINAEANDSK
                     QEKSERTSVDGIVDEPKPKADPPISKVNSGNNPFHNNKQTHNPWSMSPEFNPVTPIQS
                     RRLDAHKSSERAHDKFDSPHLNNAAFNYQNLQHVQSHPSSPPPLPPLPPAAQIQLQSS
                     SQSQPQPQSNPHPQQASLPSQVPHSSLVEAQPYSQQHKHQQQQQQQQQQQQDETAYAP
                     PLPKNRPIPASTQSFSTSSAQAPRVETNLIDLDNTSDAQKASENKANSYSKPNISKRF
                     SSNSQLMLQEEVVDFASDDENIDNASGMNRMKIRKSLKNNPKGRRSGELKRTESYSNN
                     ESKKRLSFFGGN"
     gene            <23205..>26000
                     /locus_tag="PVL30_003166"
                     /old_locus_tag="LELG_02318"
                     /db_xref="GeneID:5233497"
     mRNA            <23205..>26000
                     /locus_tag="PVL30_003166"
                     /old_locus_tag="LELG_02318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525710.1"
                     /db_xref="GeneID:5233497"
     CDS             23205..26000
                     /locus_tag="PVL30_003166"
                     /old_locus_tag="LELG_02318"
                     /note="BUSCO:EOG09260UXC"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525760.2"
                     /db_xref="GeneID:5233497"
                     /db_xref="PFAM:PF13181"
                     /translation="MDSVAQSLAQLVLLAPPNAYQPINEDRVDRLTKAILEGKYADLI
                     EISDFKELSSLPSLQAILARYPNEPLLDVLKDYVTELVKNGSNLLGESYWFSLETYAV
                     AFLQLFIQVNYTGPPVNFSAGTLWFPHADQQQLQTDCVRALDIEGQQAYDLMQDPIHL
                     IVAKLILEKLLNLPANFSLSYSSSVIDSLDKTMELSKNLVDTSSSPKDASIIWWLVRA
                     LQVHSNILSEPSSVLSSISGVLFNEKILTHFSAINQEHQKLLRTQFLLEQARIHIHAQ
                     TEHAATAPLLKATELSGLQILLSGAKAKRTKFQKFTTSNLIVLAKSQGKTAYDDSEKV
                     SHETFDLNSDLLLEKPQFETLEDLQSEVEDTSKRIKLDYGSIKIDLEENRLLPIAMRQ
                     EYIPEALRELDPNNQPALNCLDVLQILLRFQVIKQTSPADDPLISEELFALVARVIYH
                     ADSDGVDVNWLLFARALWERSLLESGKSRTVERGILQMTSLIEEMGLKIKSRVIPTSK
                     EVDEQDPLMEASKRLRFIHQLPLLSQWAMDIKLAEKYMSLGIIKSALEIYERLELPCE
                     AALCYAATDREREAEEILEKRLEENPKDARAMSILGDIRQDPTLWQMAWDTAHYAKAK
                     ASMSHYYHSPPPSSGLTRDLQLAISNMFESLSANPLNYENWFFYGCCGLEGGNFELAS
                     EAFTRCVSLDDSNSYAWSNLASALIKLDKTKPAFNALQKAIRCGGDKKSWRIYENYLN
                     VAVKLNEWNDVLMAYWELLQIRKDEGDGAIDIPVLEKLSQILLSSDYPQDESTRLTHF
                     QKSCIKLICEAIPEIITSSARCWNIVARVELWRKRPWAALECHEKAYRALLHSPDLDS
                     KEETWNEVVEACENLVSAFESLGELPGKHGAGDVVCKDWRYKARMTIRSLMSKGKHTW
                     EDSAGWEKLETLKDDLS"
     gene            <27016..>28128
                     /locus_tag="PVL30_003167"
                     /old_locus_tag="LELG_02319"
                     /db_xref="GeneID:5233560"
     mRNA            <27016..>28128
                     /locus_tag="PVL30_003167"
                     /old_locus_tag="LELG_02319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525711.2"
                     /db_xref="GeneID:5233560"
     CDS             27016..28128
                     /locus_tag="PVL30_003167"
                     /old_locus_tag="LELG_02319"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525761.2"
                     /db_xref="GeneID:5233560"
                     /db_xref="PFAM:PF05653"
                     /translation="MDDKYIGLALAMSSSLAIGTSFIITKKGLMDAAARNRGSSNNNG
                     SVQAADYLQNPIWWGGMITMAIGEIANFAAYTFAPAILVTPLGALSVIIGAVLAAIFL
                     KEELGTLGKMGCAICLMGSVIIILHAPPDKEVETVDEILGYATQPGFLFYCCAVGLYS
                     LFMIYKIVPKYGNQNPMIYLSICSSVGSISVMSIKAFGIALKLTLGGNNQFTHVSTYL
                     FLLVVALCIVTQMNYFNKALDQFDTSIVNPLYYVTFTTFTLAASFILFRGFNTTSAVD
                     IISLLIGFLIIFSGVYLLNISRKENDGHNREMFGVHSSKDMAPLDNGVGGFSTMRRSM
                     QMNRSVDYDDEEMLGLRRVDSFEIDSDGEGERNYRH"
     gene            complement(<28565..>29023)
                     /gene="TIF11"
                     /locus_tag="PVL30_003168"
                     /old_locus_tag="LELG_02320"
                     /db_xref="GeneID:5233062"
     mRNA            complement(<28565..>29023)
                     /gene="TIF11"
                     /locus_tag="PVL30_003168"
                     /old_locus_tag="LELG_02320"
                     /product="Translation initiation factor 1A"
                     /transcript_id="XM_001525712.1"
                     /db_xref="GeneID:5233062"
     CDS             complement(28565..29023)
                     /gene="TIF11"
                     /locus_tag="PVL30_003168"
                     /old_locus_tag="LELG_02320"
                     /note="BUSCO:EOG092652Y6"
                     /codon_start=1
                     /transl_table=12
                     /product="Translation initiation factor 1A"
                     /protein_id="XP_001525762.1"
                     /db_xref="GeneID:5233062"
                     /db_xref="PFAM:PF01176"
                     /translation="MGKSGKGKGGKNRRRGKNDNSGQKRELILKEEGQEYAQITKMLG
                     NGRIEVQCFDAVKRMGHIRGKMRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNSDEAR
                     SLKQLGELPENAKINETDTFGADDDEDVNFEFGGADDSESEDEELDIDDI"
     gene            <29425..>30327
                     /locus_tag="PVL30_003169"
                     /old_locus_tag="LELG_02321"
                     /db_xref="GeneID:5233467"
     mRNA            <29425..>30327
                     /locus_tag="PVL30_003169"
                     /old_locus_tag="LELG_02321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525713.1"
                     /db_xref="GeneID:5233467"
     CDS             29425..30327
                     /locus_tag="PVL30_003169"
                     /old_locus_tag="LELG_02321"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525763.2"
                     /db_xref="GeneID:5233467"
                     /db_xref="PFAM:PF12243"
                     /db_xref="PFAM:PF12350"
                     /translation="MDSFEVASQFSTILRNLTPQFQSLSKATYFALKNYDKEDYIVPT
                     ITSVLEDAKLDLNSKATIFQFIDLLFAESFQNAQKFKNAYIESIKQLLPKYIDSICPK
                     ENPANFQSTYESLRRITKSCKRDFSEYEMMFRDSLLTTEDLSALDQGELEISSKSKFA
                     IEDNDDALVKAWKTLLEKKRDSQLQRYKLLNSSQTVEENVDEEQIFNMRLKSDSRQLL
                     SKRQIIARMEDERESHKRSKENIWCVNRNVGSSSRFVSEDEFFENYWTKCQPLSKAED
                     HEFVRNLQELNEMALKSYKDEQYF"
     gene            complement(<30513..>33069)
                     /gene="TPS3"
                     /locus_tag="PVL30_003170"
                     /old_locus_tag="LELG_02322"
                     /db_xref="GeneID:5233605"
     mRNA            complement(join(<30513..32955,33047..>33069))
                     /gene="TPS3"
                     /locus_tag="PVL30_003170"
                     /old_locus_tag="LELG_02322"
                     /product="Trehalose-6-P synthase/phosphatase complex
                     subunit"
                     /transcript_id="XM_001525714.2"
                     /db_xref="GeneID:5233605"
     CDS             complement(join(30513..32955,33047..33069))
                     /gene="TPS3"
                     /locus_tag="PVL30_003170"
                     /old_locus_tag="LELG_02322"
                     /note="CAZy:GT20"
                     /codon_start=1
                     /transl_table=12
                     /product="Trehalose-6-P synthase/phosphatase complex
                     subunit"
                     /protein_id="XP_001525764.2"
                     /db_xref="GeneID:5233605"
                     /db_xref="PFAM:PF00982"
                     /translation="MTIIIGSLFLPYTVHFQIDQDQYEILQSENSSKLESLRISTVPS
                     FKTEEARPSLSSSLGSSSALPLSRESRSIIPTLPQQQTNSILAPSTQNHVAVDRSSTS
                     ARSETPEGFFYTKRPGGLSRNPTSSSYPNTPVPAALHKPAPDRHYIQPKPRIGNMKVE
                     SSITDPKKPAEPYGSPALKISRSSTGLALMNGGGTPPSSATAAAASSSPLAVGGAHSA
                     GLPGAAATSARPPNYRSNSSFQRSLQSAESSKSSIPQSQAKLSSSQRSGGFTFHGNVS
                     TNSLVSEDSHAHFDDMEIVPSSFEDDDENGDGLTGFERNYKNSVSQNRSLAPFGGFSN
                     PGIEQNLWNDDNIFDTAEWSIVASDDGNGSLTKAIDISIKDGIINQTKWVGCIAMPSD
                     TISDSVKEDITASMAAEYNCEAVFPEDFTFDGHYKSFCKQILWPTLHYQIPDDPKSKA
                     FEDHSWGHYVLMNKLIADKLVDTFIKVNGEDNFDDNGNVIWVHDYHLLLVPKMIRKRL
                     PNVKIGFFLHVSFPSSEVFRCLAQRTELLEGMLGANCISFQTNEYVRHFLQTCTSLLK
                     AKTSEGSVLHNGKLTLVNTIPVGIDSPSLSKIVHSDSVSEWRQLIRDRWGKQNLIISR
                     DKLDKLRGIKQKLLAYEKFLKSNPEFIENTVLIQICIGGGSDPLYESEVMKIISRINS
                     MPDNMTIIQPVVLLNKDIEFDQYLALQCEAEVFIVSSMREGLNLTCHEFITATEDKKS
                     PLILSEFTGSSSLLSCDGEGALLINPWDLKKFSETIYEALTMDKSEKAKRWENCHDFV
                     LTQDSKHWVSECLDSINTAWSRK"
     gene            complement(<33814..>35157)
                     /locus_tag="PVL30_003171"
                     /old_locus_tag="LELG_02323"
                     /db_xref="GeneID:5233263"
     mRNA            complement(<33814..>35157)
                     /locus_tag="PVL30_003171"
                     /old_locus_tag="LELG_02323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525715.1"
                     /db_xref="GeneID:5233263"
     CDS             complement(33814..35157)
                     /locus_tag="PVL30_003171"
                     /old_locus_tag="LELG_02323"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525765.2"
                     /db_xref="GeneID:5233263"
                     /db_xref="PFAM:PF10406"
                     /translation="MSNVQESTFSQTLQSQQSLQANVLFTEAIAVILKNKELHVSQGF
                     FEQILDLASLYIDELLVQLLDHATIQRRRKPALSDLKMLLEFNRINPTDLFDELVASK
                     SINKARDNTKSNRSQKEANKHMHEESMNGENDDIEPSSLPFFQNEQYAISKLVPNMTK
                     KPSYIPSFLPDFPPDYTYQSSATYTKPLSDMKELRIRLVEESRLTEKSLYKLIENDEV
                     EQMSKRNFEQEIQKLMDQQATTVAKKDVDDGKKQREETLSKQETGGDIELSSTSVNGE
                     HHNEHHNEHQNEHQNENEIDVEHSDFKFDFIKYAQLRKSISEKRQKKLEEKRQLREQN
                     IFIKAERYYGPYAIEKPTRETNLLFKHELETSFKKVVASLRFDERMREEESKKLLELK
                     EKQEREAREQNEIKFDFSTRRNHDAFDSDSDSDDDSALFDHPMEEASPSQQDLVA"
     gene            complement(<35573..>36721)
                     /locus_tag="PVL30_003172"
                     /old_locus_tag="LELG_02324"
                     /db_xref="GeneID:5233180"
     mRNA            complement(<35573..>36721)
                     /locus_tag="PVL30_003172"
                     /old_locus_tag="LELG_02324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525716.1"
                     /db_xref="GeneID:5233180"
     CDS             complement(35573..36721)
                     /locus_tag="PVL30_003172"
                     /old_locus_tag="LELG_02324"
                     /note="BUSCO:EOG09264JQ1"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525766.2"
                     /db_xref="GeneID:5233180"
                     /db_xref="PFAM:PF00240"
                     /db_xref="PFAM:PF00627"
                     /db_xref="PFAM:PF11976"
                     /db_xref="PFAM:PF13881"
                     /db_xref="PFAM:PF14560"
                     /translation="MSDITITIKSSGDQKFEVTFDPKITVLELKELIATKSSTPAASQ
                     RLIYSGKVLKDDQTVESYKVQNSHTVHLVRSSTASSSSSSTASTAAAAAAAASAPQQQ
                     QQSSTNAASASVPSNIAAGQGAFNPLSDLTGARYAGYTQLPSASMFGPDGGMNSNLPN
                     PEQMNEMMSNPLFQEQMNAMLSNPQMLDFMIQQSPQLRALGPQAREMLQSPFFRQMLT
                     NPEMMRTAMQMGQQGGAGLGGGNIFGGANAAPSFPAPGANPTTEGANASGDDNGNGNT
                     NSSATTTGTAGTNSANPAANPFASLFPNGVPPIDPMSFFGGGAGAGAGAGAAAAPPQD
                     NRPPEERYESQLRQLNDMGFFDFDRNVEALRRTGGSVQGAIEYLLSHT"
     gene            complement(<37249..>39219)
                     /gene="ASH1"
                     /locus_tag="PVL30_003173"
                     /old_locus_tag="LELG_02325"
                     /db_xref="GeneID:5233256"
     mRNA            complement(<37249..>39219)
                     /gene="ASH1"
                     /locus_tag="PVL30_003173"
                     /old_locus_tag="LELG_02325"
                     /product="DNA-binding transcription repressor"
                     /transcript_id="XM_001525717.2"
                     /db_xref="GeneID:5233256"
     CDS             complement(37249..39219)
                     /gene="ASH1"
                     /locus_tag="PVL30_003173"
                     /old_locus_tag="LELG_02325"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription repressor"
                     /protein_id="XP_001525767.2"
                     /db_xref="GeneID:5233256"
                     /db_xref="PFAM:PF00320"
                     /translation="MSVVSQLMPELNSNIHMRSRSFELPNVASLSRPTKRSLSDDSEV
                     AKKRSRTAPPSPFDKEIINQQSNQQASPKDQALSYKIVSSAANPMKPILRSRSLSPSK
                     KFVQLSSPDVSVSVPVQTSGPASEPASASTIAAGSAPGSVSGSPMGSPTDLQKPVLNS
                     VQSPLNNVKLPSLSDALNRPISSITSSQKYRSDPIIPTVSLDYFDTYKPNDENWRYEL
                     LDKITKESKHFHLNQYNYLNKSSKSSKPEFDSKISSKIQHSTSPQGVKPSLHHTTSDF
                     SVNKKKINFPYESNYTYLNQTYMTDVQKYPEYLELAQSLVNLSHPHPYSNTNPKTNSN
                     FNSNFNSNPIPIASSNPPPPQKQQQRNQSATKASPLKMAHAQHPAHSISVAHSTSDAY
                     QKENTPRTPIRSQASIFQDREILQPLEFKYQQNTTASSVPLLSGPSTSQVPNLSSCLT
                     PTKQTTALTSASKTTSSSALPSLHQSLPGLLSEQGPPRMYTFSSEKIDQSHSSPLQPS
                     HHHQSHNHNHNHNHNHNHLPSPPSSQTVPISTHKFIPISSPSIKSKSRSETLLKSPPR
                     SYHSATRACISCGSDQSPCWRPSWSIKEGQLCNSCGLRYKKTAARCLNDKCRKIPAKG
                     EWSLMQSKGQVSFEDGSSGYSCLDCGWRVEVK"
     gene            <42409..>43054
                     /gene="MTR2"
                     /locus_tag="PVL30_003174"
                     /db_xref="GeneID:85890351"
     mRNA            join(<42409..42424,42531..>43054)
                     /gene="MTR2"
                     /locus_tag="PVL30_003174"
                     /product="mRNA transport regulator mtr2"
                     /transcript_id="XM_061119450.1"
                     /db_xref="GeneID:85890351"
     CDS             join(42409..42424,42531..43054)
                     /gene="MTR2"
                     /locus_tag="PVL30_003174"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA transport regulator mtr2"
                     /protein_id="XP_060975433.1"
                     /db_xref="GeneID:85890351"
                     /db_xref="PFAM:PF10429"
                     /translation="MNQDPTQPIEPFLKNFLSSLDALYISPNQTFTNVESYATQFGSS
                     LKRSSAIIVNGQPIIPSPTEDAKLQFQKKWLATPNSSHQLTSYDAHLIPGTNTFIINF
                     AAKVKFDQSGKNRLGESADLVQDNNNLAKSTRPIWGSWFGVNGNVVVDNNFAGNGEII
                     DSLDYRFTYVPKDSVMKVL"
     gene            complement(<43163..>44941)
                     /locus_tag="PVL30_003175"
                     /old_locus_tag="LELG_02326"
                     /db_xref="GeneID:5233316"
     mRNA            complement(<43163..>44941)
                     /locus_tag="PVL30_003175"
                     /old_locus_tag="LELG_02326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525718.1"
                     /db_xref="GeneID:5233316"
     CDS             complement(43163..44941)
                     /locus_tag="PVL30_003175"
                     /old_locus_tag="LELG_02326"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525768.2"
                     /db_xref="GeneID:5233316"
                     /db_xref="PFAM:PF00149"
                     /translation="MLIINFLTTALSISLAKTALVSTFNYGKEAGDVEIRNLTWNDIN
                     FLHTTDTHGWYSGHLNQKQYSANWGDFISFTTHMRNIAHANGQDLLLIDSGDRHDGNG
                     LSDITQPNGLKSTPIFIKQSYDILTIGNHELYVLQNSEMEYETVVKHFPNNYVCSNVD
                     FKLANGTFVPFGNKFKYFKTPVQEKRVLAFGFLFDFRRFNSGTKVTPIEREIEKQWFL
                     DVLETYKGKVDLIIVAGHTPITKEWPEFYILHKRLREYFPETIIQYFGGHSHIRDFAV
                     FDDKSTGIQSGRYCETVGWVSINATEEPLPVRERFSRSYIDFNVNSFQAHSRTLPSTF
                     TTQKGDKVKKLIETTRKELKLNKLIGTVKSNYYVDYVPIDHPKSIFRLLTEKVLPTLS
                     PASGERVIIINTGSIRYDLYKGPYTIDSQYIVTPFENKWVNLTIPKSIASRVADKLND
                     ATYIAASRLKPPQSYLMKEVGIDFEAQNHQQQQQQQTFEVSDNIQVNPQLSKGYVTHD
                     DFGSDGDDTPHRAVVQFKVPNVVQSIQFEDEVDRPVDLVFYDFITPNILWALKELKYQ
                     AGSSQPDDYSNIFLGELLNSYVKSLA"
     gene            complement(<45412..>46206)
                     /gene="RPS4_2"
                     /locus_tag="PVL30_003176"
                     /old_locus_tag="LELG_02327"
                     /db_xref="GeneID:5233322"
     mRNA            complement(<45412..>46206)
                     /gene="RPS4_2"
                     /locus_tag="PVL30_003176"
                     /old_locus_tag="LELG_02327"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_001525719.1"
                     /db_xref="GeneID:5233322"
     CDS             complement(45412..46206)
                     /gene="RPS4_2"
                     /locus_tag="PVL30_003176"
                     /old_locus_tag="LELG_02327"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_001525769.1"
                     /db_xref="GeneID:5233322"
                     /db_xref="PFAM:PF00467"
                     /db_xref="PFAM:PF00900"
                     /db_xref="PFAM:PF01479"
                     /db_xref="PFAM:PF08071"
                     /db_xref="PFAM:PF16121"
                     /translation="MGRGPKKHLKRLAAPSHWMLDKLSGAYAPKSSAGPHKLRESLPL
                     VIFIRNRLKYALNGREVKAILMQQHVQVDGKVRTDATFPAGFMDVITLEATNEHFRLI
                     YDVKGRFTVHRISAEEASYKLGKVKKVQLGKRGIPYVVTHDGRTIRYPDPLIKVNDSV
                     KIDLATGKITDFLKFDTGRLVMVTGGRNMGRIGTIVHREKHEGGFDLVHIKDALERTF
                     VTRLNNVFVIGEEAGKPWVSLPKGKGIKLSITEERDRARQQRGLIA"
     gene            complement(<46753..>48738)
                     /gene="GYP5"
                     /locus_tag="PVL30_003177"
                     /old_locus_tag="LELG_02328"
                     /db_xref="GeneID:5233121"
     mRNA            complement(<46753..>48738)
                     /gene="GYP5"
                     /locus_tag="PVL30_003177"
                     /old_locus_tag="LELG_02328"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_001525720.1"
                     /db_xref="GeneID:5233121"
     CDS             complement(46753..48738)
                     /gene="GYP5"
                     /locus_tag="PVL30_003177"
                     /old_locus_tag="LELG_02328"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase-activating protein"
                     /protein_id="XP_001525770.2"
                     /db_xref="GeneID:5233121"
                     /db_xref="PFAM:PF00566"
                     /translation="MDNDTKDDVETKDEVFEDTIEGHESLPTQAEIEEPQTSQVSLPS
                     RDPIQTCLQLNSSSIPLSQTSKSANDTANEPEFLQKISTVSTSYDKSTSNYLLQSKHN
                     ILSLKFKDKDSVTQRTLEDGALNIKNTFSNIKNIVGGMSQVNSPYKIDWDFWTWVVDD
                     YDYIVNNKSDQLNELIAQGIPSEIRGIIWQIVTKSKDSNLEDLYRSLKHESSIHEKAI
                     KRDLTRTSFFTNIDAVNKADELYNVIKAYSLYDPDVGYTQGMIFIAVPLIMNMHESEC
                     FCLLVLLMKEYQLRELFCPEMKGLHLLLYQFDCLLAKNVPTLYNHLVKQGIKSSMYAS
                     QWFLTFFAYKFPLDIVLRIYDVIITEGMESILKFAVNLMVQNEASLLALSFDKLLEFL
                     KDKLFNVYVNPAFIKNTKHDSKVSSPTKFSAILTRRVSHTSSAGSIPSPTSSNKKNGE
                     TNHHSFSNSNTITSPTSTTTFSSSSSPSSSSSSPSSYYQLDEFVQDAMKINIDPMDLT
                     KFENRFNQCFEEEKAKLSDIKQVKIENGKLRHELKQLEFEYANLERDHVDLMQGLVDL
                     KVTLPEVLSANEESRAKINKLEQEIKELESKTESSDQHDVPASIEEKIKELLLVNAEE
                     VELTANLEDELATLVEEEYQLDQELKKHNQGWFKWSS"
     gene            complement(<49851..>51548)
                     /gene="GAL4"
                     /locus_tag="PVL30_003178"
                     /old_locus_tag="LELG_02329"
                     /db_xref="GeneID:5233487"
     mRNA            complement(<49851..>51548)
                     /gene="GAL4"
                     /locus_tag="PVL30_003178"
                     /old_locus_tag="LELG_02329"
                     /product="transcription factor"
                     /transcript_id="XM_001525722.1"
                     /db_xref="GeneID:5233487"
     CDS             complement(49851..51548)
                     /gene="GAL4"
                     /locus_tag="PVL30_003178"
                     /old_locus_tag="LELG_02329"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor"
                     /protein_id="XP_001525772.2"
                     /db_xref="GeneID:5233487"
                     /db_xref="PFAM:PF00172"
                     /translation="MDSQDMSTIYEQQQARLLDQFDQCYQKSVLLNTSDSESDIADLF
                     FPPISSSSVTSSSNQSGNVTLVSDLLKQIDEIPSSSTTSSSSTTNTSTANTSNSDNIN
                     TTASDSSSSKLPPCPIEQACDSCRKRKLKCSKEYPRCSKCIQHKWCCSYSPRTVRSPL
                     TRAHLTEVENKLQKLEDLLAYILPSDYFAALDEIVGEGEEDLNFEVEWKPVRDQLKGL
                     KKNYEVKSKQNKTTPIVQEPSHKRKKSVSSNAQRKSIASNTTFVSKNNNMKENTNNSG
                     NKFNDKVTESSAIDASNNTSLNTTTSNKNNNKSNNNTKKSTATNTAINTATGTATSPT
                     NSSQKTFHNTNTNDKTALPTSNTTYEFPNDRVKIKQEIIQDFELNNIPTKPATTSTQS
                     PPLQPPLSQREFFETFLNTEYSAIDNQSNLKEDVTSTQIKQEESIPPFSSCSSMFQPS
                     ENTTKQNSMLTSPSSILSLSSWNNDEMREDDNETDIIDNDLELPKSYKKIKLENMDFD
                     MNRVVGNDNDNDDDDSLQQAQQHSLSDSFYNLLSIPGKVGGASNDNGTNNFDLMFDM"
     gene            <58861..>61089
                     /locus_tag="PVL30_003179"
                     /old_locus_tag="LELG_02331"
                     /db_xref="GeneID:5233347"
     mRNA            <58861..>61089
                     /locus_tag="PVL30_003179"
                     /old_locus_tag="LELG_02331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525723.2"
                     /db_xref="GeneID:5233347"
     CDS             58861..61089
                     /locus_tag="PVL30_003179"
                     /old_locus_tag="LELG_02331"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525773.2"
                     /db_xref="GeneID:5233347"
                     /db_xref="PFAM:PF00096"
                     /translation="MSNVIMVDPQQSHYQNQQQQQQQQQSQQQQQQSEQGQQQPLPPH
                     LNSQQYHHQQQQQQQQQQQQNHFIGHSTHSSDMSQQSTTFTPHQTFSTNNNNNNNSST
                     SSSNGGTGTSTSASASKSKRDGTRPYKCPHCDKAFHRLEHQTRHIRTHTGEKPHVCKF
                     PGCSKKFSRSDELTRHVRIHTNPNSRKNKKSEKVKNEIVFTSNPTKEAMVSKQDMDAD
                     VDMDIDKEGQSQSQTKTKPKTKNQNQNQKSKSTLLNNGNSASSPPSSPVTSTIYAKQD
                     STIPQQQQQQQQQQQQQQQQVSQPLTPNATPTLKPKARKADDSSSPSYADNTTTPTTT
                     TSNTNTTYFNPINTVANNTNTTSGTTTTTKSSPGGTGIATRNIQDSITMAKHPSSIDI
                     LALTATQELESMEISKSLPSLTDHFNPQQRPLKLPTSVLQSNASPSASANGAGGDSHF
                     RAPPKFSFHSNNDTISNSTAAAGGGGGTTSSTTTTTSPIIGSIPTLHSADTLNLQHLS
                     NVASRFSTATNSNSNSFPRMTPLSDITQPMQPIQPIQPQPRKTHITQESDIDYIKQKL
                     KKSRPNSPKLPQFPGFNRTTSYNGNSSFHYSHYSNSNNNNNNNNNNNLHNVSSHQTLP
                     NSPILGLSTNSTPLISASNSCTNLAMLAMTPAVVGNSNGNGSGGTNGVGGGVGAHTLT
                     SATNATSHLPTTISGSTGAFGIKGNAITTPLHSNMASPKLSPAANEPLPSFKSLNLPM
                     SE"
     gene            complement(<61334..>68866)
                     /gene="GCN1"
                     /locus_tag="PVL30_003180"
                     /old_locus_tag="LELG_02332"
                     /db_xref="GeneID:5233493"
     mRNA            complement(<61334..>68866)
                     /gene="GCN1"
                     /locus_tag="PVL30_003180"
                     /old_locus_tag="LELG_02332"
                     /product="translational activator of GCN4"
                     /transcript_id="XM_001525724.2"
                     /db_xref="GeneID:5233493"
     CDS             complement(61334..68866)
                     /gene="GCN1"
                     /locus_tag="PVL30_003180"
                     /old_locus_tag="LELG_02332"
                     /codon_start=1
                     /transl_table=12
                     /product="translational activator of GCN4"
                     /protein_id="XP_001525774.2"
                     /db_xref="GeneID:5233493"
                     /db_xref="PFAM:PF12074"
                     /translation="MSEHNTWEQLKPVLAKNVQSSSVSTRLNTLSTIKENIEALEEAE
                     LKIISVLLLSTYNYYQDADSRNEVIETLKAIGSRDSRFLQIYVEFINKEISGPLLAQR
                     DYLTLLDWINAFVIELAKEHRLSDSCVSAQAKILSKSVEHLAGTRTKSTLNKSQQRIL
                     KSVMTSTKTAIARTLAKDATYLDLIVNNAQGSSFALLGPLNKAAEELIPTEPSIIEKF
                     QEQKTTILNSYVNHIVLGKSLPSDLVINSFAPCVASLVDPETYKELLQPAIEKSVLRS
                     SENAFELILPSFFENLPHKVSVSSKLLQSVISGIKSSKEHVRLGAYNILRLLSLKSDS
                     DLSGEIIKAIKATSNAESKSLLIKSLLFSSEADKIVEALLPLAAKEQNEHSLTSLVNV
                     LAHHAIKLEFPEQVVQAFITGFKSKFRRVWFVEYANEVYSNGNKQDHVVPSQFIPIFN
                     ETLESIEQAPAANIKAVACAFVVLALTDKKESSLLNDSKHFEKFDETDLVWFTRALTD
                     QANAWLFVLTGKKVPYSVRKIALDRFKQVAETDLSLGDKIVIHVHNLSPESYNLKLLS
                     PVFSILTQLQDVEQVKENAVSLLVAASDPRIAVNGGWIGLVQRSGHSQKVDIATLVKD
                     NFKHMFDLCNVDRSPASIKALAALAFIQPQLIHPIVKLLEDDLSLESAIDDTTRQIYH
                     GTEGEMVIDVLEKKPKALDKNSKDYEIKAWEEKMSKELKQAKKLTPEEKKLVAEQVAK
                     ESNIRAQVKQIISKVDYATDLIRELTEQAKFVNNGVEFWYPVAVKKLLDLAVIEGDLF
                     ESTIDTFLQLSELTSSRFESMRRFIGVAVLRLHDIKLDEELSQEPLVTLLGRILYRIK
                     ILSDQNPLDATSLSYVLPLLTKVLHRGQAAAFRNSKKIAVTSEFVENDPEEEQLLLCI
                     EIISAHAELFADPEIPRTSILEILISLMAIPSKAKLVKECFLSLCPYIAISTSEKDLQ
                     LLLKNVVSPHVFVRSTILEGLDSEFELEAYSKEVFVATFDTDHNSQELAQTIWEDNGL
                     IVPDTTNLLDLFGLTDAGLRLSVAHAYTEAAKTTSLQVEELFEFYIEKKNPPAPKLDE
                     FGLVIKSTIDQRDRWEERSTIAHSLKFLVPLLSKQDVEKVIKFLVNEALGDKDEHVRQ
                     QYQDAGIEAIKAHGADNIETLINIFEENLSSKNIKEPVVILYGSLASHLEMNDPRLKV
                     IFERLIKSLDTPAVQFAVAECIAPLVPAFQKELPKYFDDMFEKLFTAKTRSKRRGAAF
                     GIAGLVKGCGVKALADYDVIRNLTDASDDKKDPVKRESVSLAFESLSKTMSKYFEPFV
                     FEILPIILKSLGDAQAEVRQATDEAAKEIMKNTTSFGVKKLIPLAISNLDEIAWRSKK
                     GSVELLGAMAYLDPEQLSASLSVIIPEIVGVLNDTHKEVRKAAEQSLKRFGEVIRNPE
                     IQQIVPYLINAIGDPTKHLEEALDKLTKTQFVHYIDSSSLALIIHVIHRAMKDRSAST
                     KKKACQIVGNMAILVDSKDLQPYLNELVEELEMAMVDPVPATRSTAARALGSLVEKLG
                     EDQFPGLIPKLIDTLHDEQKAGDRLGSAQALSEVICGLGVNKLEELLPSIITSASSPR
                     AAVRAGFMPLLLFLPVCFGSQFSPYLSKIIPPILNGLADSDEEIRETALKSGRLIVKN
                     YAKKAVDLLLPELEAGLSNESYRIRLSSLELTGDLLFQITGLSGKNELIEDQAVNKTL
                     AESLGQDRRDRILAALFVCRSDVAGIVRNASADIWKALVSNTPRTVKEILPSLTTLIV
                     SKLASDDETQRIIAAQTLGDMVRRVGANALPQLLPTLQNAKDQEGACIALTELIKSTS
                     LEGLTTYQDTFITIIHDGLVTNDKPTRNAAAQAFEELHAKMGNFVVHEIIPQLLAELN
                     TTTVVALEELMANKADLIFPITLPVLLKEPVNYGALASLSSVAGTALYKKLSVIINTM
                     VEGIVAGEDLHDEFNQVLLSVEDDGAHLLMQQLLALMKNEDPKRREVIFAQLDQFFAE
                     ATMDYSMYLEDFVFQMILSLADPSPQVVKGSMESLTSLVKRQPKEILEKLVKPASQAL
                     NLTGYEVAGFALPKGPNSILPIFLHGLMYGTPEQRELSALAIADVIEKTPADNLKTLA
                     TVISGPMIRVIGEKVATSIKSAILVALNNLLNKIPQFLRAFIPQLQRTFVRCLSDVTN
                     ETLRKRAVVALSTLVQHQPRVDSLITELVSNAKATEDSGVKSSMLQGMLAVVETKGEM
                     LSEASKSSLLSIVEEESIDSISSAKLLGSLANVLTKEETNTLLEKKVLNNESKFSVLA
                     INSFLKYAPDLIKDNANVVEYVIACSDSPEPYISDNATIAIGKILLSSDELNVDLFKQ
                     LAKLVLAPASSSPDTKRLALIVIRSVANKHKDAISAELLDLVVPSVFASVRDPIIPIK
                     LAAEKAYLEIFQIVDQNLTVFDAWFDGKTEIVTVTGTSIVPRSISDYTKRVAVRLANV
                     ERERIEQGGDAETLFSDRIEDEKEIWSVGI"
     gene            complement(<70264..>71778)
                     /locus_tag="PVL30_003181"
                     /old_locus_tag="LELG_02333"
                     /db_xref="GeneID:5233010"
     mRNA            complement(<70264..>71778)
                     /locus_tag="PVL30_003181"
                     /old_locus_tag="LELG_02333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525725.1"
                     /db_xref="GeneID:5233010"
     CDS             complement(70264..71778)
                     /locus_tag="PVL30_003181"
                     /old_locus_tag="LELG_02333"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525775.2"
                     /db_xref="GeneID:5233010"
                     /db_xref="PFAM:PF00642"
                     /translation="MLTSSDISRKNKLTTQQQQVQRPVDFFRKNSVESKNTSSSISSL
                     SSSNSIVDLKGDLLPDLWQTSSNESYFSDTYETLKLNALNFSQPQQSQQPQQEKEQPL
                     YNPLDLHSQSQSPCQITINQPTIDSHLYLDTIIPSSTSPPSHPRLDFQSNNNLQSELL
                     PCVQPPKLPQPPPQTLTSAQEQQHQQNQQYQYQYQYQQFQHDLNNRDTSNGNINANYT
                     FQRATSPSLWNSPTSALLLAQDEISWNPLHHHHHHHHQQQQQQQRFTYEGLSASPPLL
                     LSPQYDVGIGSGIGSGIGSGIATGLGSATYNSHQTSNRSIRNSGLKSPNFIDEQLYNQ
                     QMYLLDEDVQSLGSSLEGLHFAKQLQQQSQQSQHPLSPQISQFDVQEFNGTFNHNYIH
                     KSEIQQNQQQQQPPQPPPQQLPQSPPAPTPAPVQQTPYQTAKVNTQLYKTELCAPFMK
                     TGVCTYGTKCQFAHGEQELKHVERPPKWRSKPCTNWAKYGSCRYGNRCCFKHGD"
     gene            <79356..>79862
                     /locus_tag="PVL30_003182"
                     /old_locus_tag="LELG_02335"
                     /db_xref="GeneID:5233137"
     mRNA            <79356..>79862
                     /locus_tag="PVL30_003182"
                     /old_locus_tag="LELG_02335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525727.2"
                     /db_xref="GeneID:5233137"
     CDS             79356..79862
                     /locus_tag="PVL30_003182"
                     /old_locus_tag="LELG_02335"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525777.2"
                     /db_xref="GeneID:5233137"
                     /db_xref="PFAM:PF00179"
                     /translation="MSRHPYQKRLLKEYQSLSRSQLPGITLVSSDDNLTSYIFQLCLS
                     NHTLYPSNYYLSIKITDEYPVDSPSVKFIKYADISADLDETRSDDVPTSVIPVHPHIY
                     SNGHICLNLLGDDWTPACSIESILLSIQSMLDTNVLDERPPDNDNYVSHAPDDPKRTR
                     FIYHDDNV"
     gene            complement(<80124..>80876)
                     /gene="ALG14"
                     /locus_tag="PVL30_003183"
                     /old_locus_tag="LELG_02336"
                     /db_xref="GeneID:5233421"
     mRNA            complement(<80124..>80876)
                     /gene="ALG14"
                     /locus_tag="PVL30_003183"
                     /old_locus_tag="LELG_02336"
                     /product="UDP-N-acetylglucosamine transferase subunit"
                     /transcript_id="XM_001525728.2"
                     /db_xref="GeneID:5233421"
     CDS             complement(80124..80876)
                     /gene="ALG14"
                     /locus_tag="PVL30_003183"
                     /old_locus_tag="LELG_02336"
                     /note="BUSCO:EOG092643QM"
                     /codon_start=1
                     /transl_table=12
                     /product="UDP-N-acetylglucosamine transferase subunit"
                     /protein_id="XP_001525778.2"
                     /db_xref="GeneID:5233421"
                     /db_xref="PFAM:PF08660"
                     /translation="MIISSLETFFCCAVVLTSIPITIALIRLIRILPCLRLSKSINTN
                     KPLHLNSGKTLAKVSRSDSSIAVFLGSGGHTGEMMKMLSKLDLSSLQRTWIYSSGDTR
                     SLDQVKSAEIQMKSIETTKSSSCDTQHSRSKVTYLSVPRARKVGQSYFTSVFTTVYSF
                     IVASVVLFFNKPDILLVNGPGTCIPIAYILFFYKFMGLCATKIIYVESLARVNRLSLS
                     GKLILPIADRFIVQWPQLSQVYARAEYYGILI"
     gene            <82780..>83178
                     /locus_tag="PVL30_003184"
                     /db_xref="GeneID:85890352"
     mRNA            <82780..>83178
                     /locus_tag="PVL30_003184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119451.1"
                     /db_xref="GeneID:85890352"
     CDS             82780..83178
                     /locus_tag="PVL30_003184"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975434.1"
                     /db_xref="GeneID:85890352"
                     /translation="MSTSSAQYDYGYDYIRRATQNVQVPTSTSTSSSLSSSSSKAAMT
                     IEKQSYQQHTSTTRSWLYNMYYVHFPFIMLTGVERMLLHAMVLLFMTFIFYGVYSYLP
                     TSIMVALSRGYYYISGVDVGVEDIGQKLAA"
     gene            <83626..>87051
                     /gene="RDH54"
                     /locus_tag="PVL30_003185"
                     /old_locus_tag="LELG_02337"
                     /db_xref="GeneID:5232932"
     mRNA            <83626..>87051
                     /gene="RDH54"
                     /locus_tag="PVL30_003185"
                     /old_locus_tag="LELG_02337"
                     /product="helicase"
                     /transcript_id="XM_001525729.2"
                     /db_xref="GeneID:5232932"
     CDS             83626..87051
                     /gene="RDH54"
                     /locus_tag="PVL30_003185"
                     /old_locus_tag="LELG_02337"
                     /codon_start=1
                     /transl_table=12
                     /product="helicase"
                     /protein_id="XP_001525779.2"
                     /db_xref="GeneID:5232932"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MYSRPSAAFKPPRPQSRSDVDATATATTSSTTTASSSNESRVGS
                     KNAAAIASVPLKARPNLKRVYADDASGYSTTTNITADTNTTHINSTKRPNTHTLLSSD
                     SVSSLNGSSSPSKKVSNTKYIVLWRRKTNKKNKSWDGDGQATIKYTPGNDACDIVLKG
                     SDGGIMSRKTFKPPPNLTEIIPIGGFEISLDEEIGLGSIIPREVITSTNNNGNNDQVR
                     LKPISSVASTSELKRAPTGLSKRATSAVGVAGGVAAAAVGAAGVAAAGAASSGTPSSG
                     TIAPVSRRASSLPKHAENKSADQMTKDTPSNNGEVKKELLDAKYLIQWRKKTTKKNKS
                     WDGDGSALIKFSGLGCEIVVKNSDGKVMSKKKFDKSPDLSEVIPIGVFEIFLDEKIAE
                     SENNIAETSEVQAIDAPSELSTHEQNPILSTLPGAPPPPPPPPPSTSTRASASASSTV
                     LHKSFKKVIPKDHEQVQEKRNALYEEKADEVQMTPPPEEPDPVKVSIDPHLASKLRPH
                     QIEGVTFMYECVMGFRDFVGNGCLLADEMGLGKTLMTITTIWTLLKQNPFPDQKKPIV
                     NKVLIVCPVTLINNWKAEFKKWLGTNKLNVLTLNNPMSDDKRDIVNFGRLNVYQVLII
                     NYEKVLAHLEELQTVNFDLLVCDEGHRLKNSSNKVLINLHKLSIPKRIVLTGTPIQNY
                     LVEFHTLISFINPAVLPDMKTFQRKFINPITQARDVNCFNPEVKRKGEELSKELIRLT
                     HKFILRRTQDLLEGYLTPKTDILLFVPPTQLQIDIFQSIRSSEKFKYLEPGSTSLALI
                     NVFRKICNSPSLLATDEFYQKIATNTFKLSTSSGKIHVLIPLLLEITECKERTVLISN
                     YTKTLDLLEHVLRKLNLRYTRLDGSTPNNMRNKLVNEFNRNEEIHVFLLSSKSGGMGI
                     NLVGASRLILFDNDWNPSTDLQSLSRIHRDGQTKPCFIYRLFTAGCIDEKIFQRQLMK
                     SKLSSKFLDNDNASKTDVFEQEDLKNLFEVNVGSKSNTHELLGCSCAGDGSLLTQEIF
                     TDDEIDADDDAKIEDEDYSDNDVSEVQVQASQRWMSAAELQKNMDRNGADVMEKRAVK
                     DALNDYHHYDPEISHDLAFDPVLLQIAKNSVTQGRLPFSFIMMKQSAGRDDKK"
     gene            complement(<90505..>91881)
                     /gene="TEF1_3"
                     /locus_tag="PVL30_003186"
                     /old_locus_tag="LELG_02340"
                     /db_xref="GeneID:5233306"
     mRNA            complement(<90505..>91881)
                     /gene="TEF1_3"
                     /locus_tag="PVL30_003186"
                     /old_locus_tag="LELG_02340"
                     /product="translation elongation factor EF-1 alpha"
                     /transcript_id="XM_001525732.1"
                     /db_xref="GeneID:5233306"
     CDS             complement(90505..91881)
                     /gene="TEF1_3"
                     /locus_tag="PVL30_003186"
                     /old_locus_tag="LELG_02340"
                     /codon_start=1
                     /transl_table=12
                     /product="translation elongation factor EF-1 alpha"
                     /protein_id="XP_001525782.1"
                     /db_xref="GeneID:5233306"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF03143"
                     /db_xref="PFAM:PF03144"
                     /translation="MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSVKW
                     DKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEASTNCPWYKGWEKETKS
                     GKVTGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVV
                     TFAPAGVTTEVKSVEMHHEQLAEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKG
                     AESFNAQVIVLNHPGQISSGYSPVLDCHTAHIACKFDTLIEKIDRRTGKKLEEEPKFI
                     KSGDAAIVKMVPTKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAGKVTK
                     AAQKAAKK"
     gene            complement(<92766..>95138)
                     /gene="DPB11"
                     /locus_tag="PVL30_003187"
                     /old_locus_tag="LELG_02341"
                     /db_xref="GeneID:5233212"
     mRNA            complement(<92766..>95138)
                     /gene="DPB11"
                     /locus_tag="PVL30_003187"
                     /old_locus_tag="LELG_02341"
                     /product="protein kinase activating protein dpb11"
                     /transcript_id="XM_001525733.2"
                     /db_xref="GeneID:5233212"
     CDS             complement(92766..95138)
                     /gene="DPB11"
                     /locus_tag="PVL30_003187"
                     /old_locus_tag="LELG_02341"
                     /codon_start=1
                     /transl_table=12
                     /product="protein kinase activating protein dpb11"
                     /protein_id="XP_001525783.2"
                     /db_xref="GeneID:5233212"
                     /db_xref="PFAM:PF00533"
                     /db_xref="PFAM:PF12738"
                     /translation="MTSRQPFEGLTFCCTGVQNKLRREINKYVKALGGIQYDDLMTDV
                     QYLIVGSRDTPKYQFCVKNRLDIVFLAEDAVSKIYKSWLLGEEVDQSRLDEHKLPIFA
                     NINACLSRTDLTQSQIVKLFEAAGGFRGDAVEMSYFNCNGLTHLLSDHGGSAKESLSN
                     DQTCMISADPRGTRYNKAIEWKIPVVHPIWVYDSLLRGAALDYNDYTLSSNNDEIYTN
                     GCTVWESLVEEKRKRKENKEDLENKENSPPRKKKLVFQSTGITKDVPKTLQKTNNREI
                     WDSIMDRTKAAKAPIAGAGAVAEEEAGTTTVASTRATAASASEQNKTKKDAENQAWDE
                     ESETENIEDVEKLEQKVEEQEKKTAKSTLFLGFNFLLVGFDSRESNLLSGGIEGYQGE
                     ITKDVNDDSITHIIIPAKRGSRSSSVLKPLPSTLKQKITNSDVKVVTEFFIEKSIYYK
                     KVVLDTWGQPIKGLMPSTRKFQVSTSGFTGIELLHIEKLIKFMNFEYCDTLSKDRDIL
                     MLNVNLFKESFMKNSPKLFEYKNTDILNCPVYQSGGSSVSLLSAKNKIEACKKWSIPV
                     VSLAYLWEIFELSKYKSEMMMPELTNSKWCIYAPINNTRPRSLMEYLKSMSDFTSTKP
                     GATNYGDLPPKSKSVSDRIDEDTDDGSVKLPSPRKITPRKKYGRLVGRSPQSIRNKLV
                     PSRENSVMGSVYENRNEENGDITRDEDFSSQVRYEDTTSMINQERLLKKLEHGATGTA
                     NINHSNDKDKTTNGNNPDAMEVEVENMEAEEEMAANASKRRRRTRTGPKP"
     gene            complement(<95607..>96323)
                     /locus_tag="PVL30_003188"
                     /old_locus_tag="LELG_02342"
                     /db_xref="GeneID:5233201"
     mRNA            complement(<95607..>96323)
                     /locus_tag="PVL30_003188"
                     /old_locus_tag="LELG_02342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525734.1"
                     /db_xref="GeneID:5233201"
     CDS             complement(95607..96323)
                     /locus_tag="PVL30_003188"
                     /old_locus_tag="LELG_02342"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525784.2"
                     /db_xref="GeneID:5233201"
                     /translation="MLKKIRKYHKLLDHKLSWATATNDGDKAGEDRKVEVEEEEHKDE
                     IGLLQSHNPYSENWVAEIGVDKDETSFQPQVQRLQSPLSLPPSLPTALSTALSSPPPP
                     TLAFQQLHRRNYTNMVKQKLRKFFMTKKRYRKYLKNRIRVIAYDTTALLDYQNVAPAR
                     HVTTNLAIPEFTHQCLKRIEKADLGVNIPLQQQHPFRCPITTSCKSSINSLFDKSDNE
                     GNLLFRATGVMTAESAMSNG"
     gene            complement(96908..96981)
                     /locus_tag="PVL30_003189"
                     /old_locus_tag="LELG_06042"
                     /db_xref="GeneID:5233625"
     tRNA            complement(96908..96981)
                     /locus_tag="PVL30_003189"
                     /old_locus_tag="LELG_06042"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:5233625"
     gene            <97600..>98433
                     /locus_tag="PVL30_003190"
                     /old_locus_tag="LELG_02343"
                     /db_xref="GeneID:5232899"
     mRNA            <97600..>98433
                     /locus_tag="PVL30_003190"
                     /old_locus_tag="LELG_02343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525735.1"
                     /db_xref="GeneID:5232899"
     CDS             97600..98433
                     /locus_tag="PVL30_003190"
                     /old_locus_tag="LELG_02343"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525785.2"
                     /db_xref="GeneID:5232899"
                     /db_xref="PFAM:PF00098"
                     /db_xref="PFAM:PF03732"
                     /translation="MSSEIHKMDIDTLKQSKEMLVLMELYKMRLDFTKLFIETLEKKR
                     LEALFGTYIRLPILNNPRNPEKLMHFIKEVEMNSCYYPRFEKDRVKCAVWHMTQDTID
                     FLLTLHPKLLQANWHEFKAILCNTFLNPNFVAKKKRELMNLQQVTTVEQYEEKFLSIK
                     AYLHQDDENVMFFKRLFVKGLKPEIRQFVIKELFDDEVSLIETATAAIRAESMLSFSR
                     EMSSDYEPGYSRDHYTPREQVDSSSRKLTPKQKKVLMANGGCFKCRKIGHKIRDCPMA
                     N"
     gene            complement(98979..99052)
                     /locus_tag="PVL30_003191"
                     /old_locus_tag="LELG_06043"
                     /db_xref="GeneID:5233624"
     tRNA            complement(98979..99052)
                     /locus_tag="PVL30_003191"
                     /old_locus_tag="LELG_06043"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:5233624"
     gene            complement(<99449..>100639)
                     /gene="PNG1"
                     /locus_tag="PVL30_003192"
                     /old_locus_tag="LELG_02344"
                     /db_xref="GeneID:5233623"
     mRNA            complement(<99449..>100639)
                     /gene="PNG1"
                     /locus_tag="PVL30_003192"
                     /old_locus_tag="LELG_02344"
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase"
                     /transcript_id="XM_001525736.1"
                     /db_xref="GeneID:5233623"
     CDS             complement(99449..100639)
                     /gene="PNG1"
                     /locus_tag="PVL30_003192"
                     /old_locus_tag="LELG_02344"
                     /codon_start=1
                     /transl_table=12
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase"
                     /protein_id="XP_001525786.2"
                     /db_xref="GeneID:5233623"
                     /db_xref="PFAM:PF03835"
                     /translation="MTTDFKSLSEKLINSYAKLQLSHSIKVANDIKPIQSTANRPVVN
                     AIHSNVNYLLSHKDQKAIDAALDAIDLAKIYENIDKLEQENEKEKDKKKGNEEEKQEE
                     EKQGKQGKENKGATANLKYDDLVVKEILRYFKHDFFEWVNTPKCSCGSDKAIGKGARR
                     MPSTAPNPQKISIIEVYECQKCGKEIVFPRINNPVSLLETKKGRCGEWVNCFLLILEA
                     LIGDGGKDRVRFVWNQEDHVWVEYFSLGLQKWVHLDPCEAAFDEPLLYCENWGKKMSY
                     VLGFNMNSVVDLSKKYITKEKQIPQQSIVDPKLVAKTLKWVNARKLVQKYQNLKDQGF
                     SDSDALKSIYHEVIIPRNREQIALKEGDVKPSKTSSEGGNDVPRGRQTGSAEWTKARG
                     EDGH"
     gene            complement(<101137..>102018)
                     /gene="TRM10"
                     /locus_tag="PVL30_003193"
                     /old_locus_tag="LELG_02345"
                     /db_xref="GeneID:5232959"
     mRNA            complement(<101137..>102018)
                     /gene="TRM10"
                     /locus_tag="PVL30_003193"
                     /old_locus_tag="LELG_02345"
                     /product="tRNA (guanine(9)-N(1))-methyltransferase"
                     /transcript_id="XM_001525737.1"
                     /db_xref="GeneID:5232959"
     CDS             complement(101137..102018)
                     /gene="TRM10"
                     /locus_tag="PVL30_003193"
                     /old_locus_tag="LELG_02345"
                     /note="BUSCO:EOG09263760"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA (guanine(9)-N(1))-methyltransferase"
                     /protein_id="XP_001525787.2"
                     /db_xref="GeneID:5232959"
                     /db_xref="PFAM:PF01746"
                     /translation="MEPQPPQHPKKVKNIPSPEEIERRRQERQNEVIPEGMSRREWKK
                     QRKEQEHEATKEEYKAAEREKRRQQRARRAERMRNDPEYRKLILDRINQEQKDSEVKI
                     VIDCEFDDLMLKKEIISLSNQIKSSYAIMKQSEYNLPIQIASFDKQLKERFDTSLADY
                     KKWQGINFTEKKLSELVTSENKDKFVYLTADTEEEVEELKPDHTYIIGGIVDRNRYKN
                     LCADKAKKMGIRVARLPIGKYIKINSRAVLVTSHVYEICCRWFESRNWGIAFNKVLPP
                     RKIANKYPAPAATEEGS"
     gene            complement(<102433..>104064)
                     /gene="GIT1"
                     /locus_tag="PVL30_003194"
                     /old_locus_tag="LELG_02346"
                     /db_xref="GeneID:5232886"
     mRNA            complement(<102433..>104064)
                     /gene="GIT1"
                     /locus_tag="PVL30_003194"
                     /old_locus_tag="LELG_02346"
                     /product="Plasma membrane permease, mediates uptake of
                     glycerophosphoinositol and glycerophosphocholine"
                     /transcript_id="XM_001528773.2"
                     /db_xref="GeneID:5232886"
     CDS             complement(102433..104064)
                     /gene="GIT1"
                     /locus_tag="PVL30_003194"
                     /old_locus_tag="LELG_02346"
                     /codon_start=1
                     /transl_table=12
                     /product="Plasma membrane permease, mediates uptake of
                     glycerophosphoinositol and glycerophosphocholine"
                     /protein_id="XP_001528823.2"
                     /db_xref="GeneID:5232886"
                     /db_xref="PFAM:PF07690"
                     /translation="MSEKEPITIEQVHTSPDRQSDNIEISSSQTSSDNNNINNNNNNN
                     DPQKHYVYHEEERRHRLDGGVKIRDALMILCAGFALISDGYQNNVMSMLNKVFAIEYP
                     KVYDSNMSTQVSNASLVGTILGQFVIGICADLISRKWAIVIATCFLIFGSMMCAASHG
                     KTVTGMFWMMTIFRGVTGFGIGAEYPSSSVAASEAANESVKKRGMAFILATNLPLSFG
                     GPFASIIFLIVNKITGKHYDGLWRTMFAIGCFWPLSVFYFRMKMATSVLFKKSAIRVH
                     PPYWLALKYYGFRLFGTCVTWFLYDFVTFPNGIFSATIISNVISDNMDLEKIAEWNLL
                     LGAIALPGVFVGAYLVDIIGKKYTMLIGFIGYIIFGLIVGIAYYRVKKITALFIVLFG
                     LMQSCGNAGMGNVLGLVSSESFATPVRGTFYGISALVGKIGAVAGTKAFQRVLTIGGT
                     KESGQRYTFIIAACCGLVGVIITAIFIPHLKVDDLLEEDIKFKNYLRDQGYEGHIGLV
                     EEGKEEDLESDETGTDGGSDVELQEQHYREGKSST"
     gene            <110424..>114497
                     /gene="SKY1_2"
                     /locus_tag="PVL30_003195"
                     /old_locus_tag="LELG_02348"
                     /db_xref="GeneID:5233473"
     mRNA            <110424..>114497
                     /gene="SKY1_2"
                     /locus_tag="PVL30_003195"
                     /old_locus_tag="LELG_02348"
                     /product="serine/threonine protein kinase, CMGC"
                     /transcript_id="XM_001525740.2"
                     /db_xref="GeneID:5233473"
     CDS             110424..114497
                     /gene="SKY1_2"
                     /locus_tag="PVL30_003195"
                     /old_locus_tag="LELG_02348"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine protein kinase, CMGC"
                     /protein_id="XP_001525790.2"
                     /db_xref="GeneID:5233473"
                     /translation="MLLVERINSNSTSTSTGTGTSTTNNNSNNKDKDPSTSTATTGTT
                     SLVERNQLPGTMPSTLQQNSYSHGQEPSSLSRRGSTFNSRVNSTSSFTPNSNNSTSNN
                     DDTIITTAAISGSLDTEKKSRFNLQGLFKKLPVLNTTSANTSTITVNSSSPPPPPQQQ
                     QQLQQQQQPQQQQQQQPQQQTSSSSSSSLPLSFQPPHTTNNTINDTTSFTPISTPTFT
                     QTPPSFIRHNSFPRQVPRSTNIISDINPITIIHSVDEEDESLIHDIDEEDEDECSLAE
                     DHNQQQQQQQQQSHSLSSIDPYSLSANNSLQPIDKANLFSGQPSYFSSHYTTMVNNQE
                     VYTSFTSDCISLQNSEMSTAITELDSDTMIINNSNSNNDNDNMNSYNKQINNIGNGSI
                     SSQEAPIKERKLSNTSSLSLSFPSIKRTISLKSKKSQSSRQQQQQQQQQQSSSLNNDE
                     LSIPTSTLPKANSAKTTASVTTARPNAPKRNLKSLLRIGSFSGNNNIQSTNPHKENPA
                     LAPAPAPSTITATTPTASTAAVVEGLPEDDDIFAQPDDYEDLSETESELNYDPKQEES
                     SHDYRVGGYHPVCRGDIYYSKQLANREYVIVRKLGWGHFSTVWLAKSRITSSVDPTLN
                     ENNDNSGSIDKNEYYVAIKFVKSNRNYKEAAKDEIEILHTLSDPLKYATHLSSKQLQY
                     FQTCKPKQHQGYKHMMRLLDDFEIAGPHGNHICMVFEILGENVLNLIYKYKKFYRNVN
                     QELKKKQESVGEEQTQLSPTSQLQLQSQQQQQQQQSSTPIQVPTSPQQNIKFNKWDAK
                     YLTKKKNTKSKLSLGLTKKAESLESNHTSTPPYPLSSSSAASSTTSSNNSGSGSGSAA
                     GDHLMESLVELESTTTIGSWEDSIDKRIKQMKPSSLVKIIETSKSRGGIPLHLVKKIV
                     KQMLLALDYMHHCGVIHTDLKPENILIDIEDINKVVKSLEEEKQQKIRANSMSRTASL
                     MKRNNSHVTRPSILKRNSTSATIQQQQHHQSQQQQQPPPPQQQQQPQQSQQQKHRRAS
                     SSASSSLISSSQTSNNGFYYRRSKNSIAGKYDSPIRCSKPLLSSSVSQEVFFKDVDFD
                     KCKKASVSRSIISPRFTSLLWDSKKEDKNNTNTGNDHSLDNELNIKIADLGNATYTNQ
                     HFTNQIQTRQYRSPEIILKYKSWGSSTDIWSLGCIIFELITGDFLFDPHEGDGKNMFD
                     KDEDHLAQIVELLGHFPDDEYLVDCKLTGKFFKLAPGYESTSPTNSAESFNSASQSKV
                     IFKNIDNLKIWKLQDVLIEKYKFDRDDPDVKLVCDLILKCLKFNLDERFDAHSLLKHP
                     WFNEKAGADSNTAAVDETVLQSMKNEHDDLPGYTCEE"
     gene            complement(<114827..>115996)
                     /gene="CWC27"
                     /locus_tag="PVL30_003196"
                     /old_locus_tag="LELG_02349"
                     /db_xref="GeneID:5233224"
     mRNA            complement(<114827..>115996)
                     /gene="CWC27"
                     /locus_tag="PVL30_003196"
                     /old_locus_tag="LELG_02349"
                     /product="Peptidyl-prolyl isomerase cwc27"
                     /transcript_id="XM_001525741.2"
                     /db_xref="GeneID:5233224"
     CDS             complement(114827..115996)
                     /gene="CWC27"
                     /locus_tag="PVL30_003196"
                     /old_locus_tag="LELG_02349"
                     /codon_start=1
                     /transl_table=12
                     /product="Peptidyl-prolyl isomerase cwc27"
                     /protein_id="XP_001525791.2"
                     /db_xref="GeneID:5233224"
                     /translation="MSLEPPTTARVTLHTTKGSIKLALFAKELPSTSLSFLQSIYAQD
                     FTDEEFELPQDTSSSEKPIMLNFGHVKTFDPLHEKEPLNGETAQESMIVPKELHPRIK
                     CKRGGYLAISRNQWMISMTELSGVSNVVGKIYNVNDDDDDQDHDHDDKKDSWFVLKSI
                     ADGEKESIVSTKDDGEKVKITKFVYPVKITGGSIDVPFFEMHEVEKRKLEKERLQGLK
                     RKNNGDDKKNEVAKKKSRVVLTYDDVEDDEEDDDDEDEDGGRENLGRLKVKSIYDKPK
                     QTSDKDTNTKDIIGSSDEESSLSSSSDDDDHGEKNVNQNSRQADDKDNDKEGDSSGEG
                     SSEEESDSDSEEEEEKMREINRDPTIDSKYDPYLDLNKAESITYQQLKTHKFNPF"
     gene            <117736..>118788
                     /gene="GOR1"
                     /locus_tag="PVL30_003197"
                     /old_locus_tag="LELG_02350"
                     /db_xref="GeneID:5233183"
     mRNA            <117736..>118788
                     /gene="GOR1"
                     /locus_tag="PVL30_003197"
                     /old_locus_tag="LELG_02350"
                     /product="glyoxylate reductase"
                     /transcript_id="XM_001525742.2"
                     /db_xref="GeneID:5233183"
     CDS             117736..118788
                     /gene="GOR1"
                     /locus_tag="PVL30_003197"
                     /old_locus_tag="LELG_02350"
                     /codon_start=1
                     /transl_table=12
                     /product="glyoxylate reductase"
                     /protein_id="XP_001525792.2"
                     /db_xref="GeneID:5233183"
                     /db_xref="PFAM:PF00389"
                     /db_xref="PFAM:PF02826"
                     /db_xref="PFAM:PF03446"
                     /db_xref="PFAM:PF07991"
                     /translation="MTTASPNSTTKPKVLRLGKIRFGQEKWDEVSKYAEVVDCDSANR
                     EQFLKDLQGKYSDVTNISRTFESVAQTGRFDEEVAAHVPKTLVSVSHTGAGYDQVDVE
                     PFTKRGIQVSNITVPVEAPTADTAVWLAITCLRNYKVASDLVKQGKWPGQAAAGAKLG
                     HSPEGKVVGIMGMGGIGRAIRDRLKPFGFEKIIYYNRSRLDPKLEAGAEYVSKEELFK
                     QSDIIMISIPLNAHTRHSIDKSAIEQMKDGVILVNTARGAVIKESELPELIKSGKIGA
                     LGADVFENEPEIPKELLELPQVVALPHVGTYTSEAIKNMEDWVADNVLSAIKTGKVKS
                     IVPEQKDTKFDVKPLV"
     gene            <120226..>121218
                     /gene="MRS4"
                     /locus_tag="PVL30_003198"
                     /old_locus_tag="LELG_02351"
                     /db_xref="GeneID:5233040"
     mRNA            <120226..>121218
                     /gene="MRS4"
                     /locus_tag="PVL30_003198"
                     /old_locus_tag="LELG_02351"
                     /product="Fe(2+) transporter"
                     /transcript_id="XM_001525743.2"
                     /db_xref="GeneID:5233040"
     CDS             120226..121218
                     /gene="MRS4"
                     /locus_tag="PVL30_003198"
                     /old_locus_tag="LELG_02351"
                     /codon_start=1
                     /transl_table=12
                     /product="Fe(2+) transporter"
                     /protein_id="XP_001525793.1"
                     /db_xref="GeneID:5233040"
                     /db_xref="PFAM:PF00153"
                     /translation="MEHTNHQVQFLPKDPLEIDYEALPEDASLSAHLGAGALAGIMEH
                     TVMFPIDSIKTRMQLNLSSKDISRGLLKSISKISSTEGFYGLWRGVSSVILGAGPAHA
                     IYFSVFESTKTFLCNRLTNSSQFNTKIVTDENHPLIASCAGVAATTASDALMTPFDML
                     KQRMQASAAYPENKLQSVRLLKFAANIYKTEGLSAFYISYPTTLLTNIPFAALNFGFY
                     EYCSSLLNPSHSYNPYLHCVSGGIAGGIAAALTTPFDCIKTVLQTKGMSQNPALREVT
                     GFKSAAAALHKIGGTKAFWRGLKPRVIFNVPSTAISWTAYEMCKELLIRDRRLN"
     gene            <127175..>129028
                     /gene="ARN1"
                     /locus_tag="PVL30_003199"
                     /old_locus_tag="LELG_02353"
                     /db_xref="GeneID:5233299"
     mRNA            <127175..>129028
                     /gene="ARN1"
                     /locus_tag="PVL30_003199"
                     /old_locus_tag="LELG_02353"
                     /product="Siderophore transporter"
                     /transcript_id="XM_001525745.2"
                     /db_xref="GeneID:5233299"
     CDS             127175..129028
                     /gene="ARN1"
                     /locus_tag="PVL30_003199"
                     /old_locus_tag="LELG_02353"
                     /codon_start=1
                     /transl_table=12
                     /product="Siderophore transporter"
                     /protein_id="XP_001525795.1"
                     /db_xref="GeneID:5233299"
                     /db_xref="PFAM:PF06609"
                     /db_xref="PFAM:PF07690"
                     /translation="MSSSLEHKTSSSRSGSVSGSNLDEKAPVYDDKNSHFNDNTTNDV
                     VEQAVEAPKSIGVIKAELLAEQWKHTFWYKLVLLFSAFLVGYAYGLDSQTRYVYTAYA
                     TASWSEHSLLTTVNAITALTAAAAQPVYARLSDVFGRLELFIVAVLFYVVGTIIESQS
                     PTINAYVAGAVLYQIGYSGIIMVLLFILSDFSSLRWRLYFSLCPSFPFIINTWISGNV
                     TEAVGTNWGWGIGMWAFILPLACIPFLCCMIHMRWLAGKTEEWKVFKQRQTKFQELGF
                     VGFIKYLFWRLDVIGLILMVVSLGCLLIPLTLAGGTQEKWKQGNIIAPIVIGAVLIIV
                     FCVWENFAKDPILPLSLMKDRGIWSGAVISFLFDFVYAVEASFLYTVLIVAVNESMKS
                     ATRISSVSSFASVVCGFFFGLFVAYFRHMKPFIIFGCSLWMVAFGLMYNYRSTLSAHA
                     GIIGAMVVMGIGTGFFTYPITVSAQSCVSHEHMAVVTSALYTLYRVGYAVGASVAGAI
                     WSQTLFKKLSEHLPTDLATSVYSDPYTFASTYAWGTDEREGAVKAYGEVQRILMIVCL
                     CFVAPMILSAFFLRDHELTREQSLEQVEEKEKQETLGGFFENFGRTRAERV"
     gene            <130231..>131174
                     /gene="RPS10A"
                     /locus_tag="PVL30_003200"
                     /db_xref="GeneID:85890353"
     mRNA            join(<130231..130282,130873..>131174)
                     /gene="RPS10A"
                     /locus_tag="PVL30_003200"
                     /product="40S ribosomal protein S10-A"
                     /transcript_id="XM_061119452.1"
                     /db_xref="GeneID:85890353"
     CDS             join(130231..130282,130873..131174)
                     /gene="RPS10A"
                     /locus_tag="PVL30_003200"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S10-A"
                     /protein_id="XP_060975435.1"
                     /db_xref="GeneID:85890353"
                     /db_xref="PFAM:PF03501"
                     /translation="MLIPKEDRKKIHQYLFQEGVVVAKKDFDQPKHEEIDTRNLYVIK
                     ALQSLTSKGYVKTQFSWQYYYYTLTDEGLDYLRTELNIPEGILPLTRLKAAPAERQRP
                     GRAGPGGRGGFRRRD"
     gene            <132220..>133662
                     /locus_tag="PVL30_003201"
                     /old_locus_tag="LELG_02354"
                     /db_xref="GeneID:5233633"
     mRNA            <132220..>133662
                     /locus_tag="PVL30_003201"
                     /old_locus_tag="LELG_02354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525746.2"
                     /db_xref="GeneID:5233633"
     CDS             132220..133662
                     /locus_tag="PVL30_003201"
                     /old_locus_tag="LELG_02354"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525796.2"
                     /db_xref="GeneID:5233633"
                     /db_xref="PFAM:PF13202"
                     /translation="MNDLPQMPTPYQQHQQQYPKKHSSSVQQPYSGQKVKYQPPPPPP
                     QQQQQQQQQQQYKAPRTNSSHSVPYQPQQQPQQQQQAYAVPPTPQSQYMYSQQQQQQP
                     QQYAPMPQAPIYHHQQQPQPPMYQHMSSQPQHPQSPLPPQPQQIQQTYASSPQNGAMM
                     YSNPHAAQSVPAPQQHYQLPPQSVSQQQIPQGRHTSSSSQQHFDQNQYIPQSHTSHPV
                     SKKPPPPQQQSSSSQPSQPSQMMMQQTDSPPRMHQHYKQPSNRSKESLSTNNNNNNNN
                     NSTTLTSKQKLEIELRSVFEKVDTNKSGRISAKELSYALLNFDHTRFHESTIKLMLNL
                     FTAQKKSDGSSSSTSSSSYDSSNKSLNFDQFVSLWKYLSAYKKLFIQADADKSGDISF
                     GEFQKILEQIGYKLDIDLVLHLFSKYTAKSDGGLGGGGEIGRLKFDMFIELLIYLRKL
                     TDIFKKYDKDLSGTATIGFSDFLFEISNMS"
     gene            complement(<133860..>140633)
                     /gene="BLM3"
                     /locus_tag="PVL30_003202"
                     /old_locus_tag="LELG_02355"
                     /db_xref="GeneID:5233380"
     mRNA            complement(<133860..>140633)
                     /gene="BLM3"
                     /locus_tag="PVL30_003202"
                     /old_locus_tag="LELG_02355"
                     /product="Proteasome activator BLM10"
                     /transcript_id="XM_001525747.2"
                     /db_xref="GeneID:5233380"
     CDS             complement(133860..140633)
                     /gene="BLM3"
                     /locus_tag="PVL30_003202"
                     /old_locus_tag="LELG_02355"
                     /codon_start=1
                     /transl_table=12
                     /product="Proteasome activator BLM10"
                     /protein_id="XP_001525797.2"
                     /db_xref="GeneID:5233380"
                     /db_xref="PFAM:PF11919"
                     /db_xref="PFAM:PF16507"
                     /db_xref="PFAM:PF16547"
                     /translation="MSHSDSPSKGNNGVGNNNNNNNNNSIFRRSPEETRGEGLKFHVE
                     TQPHTLTSPIPIRTPNASRSNHNNNIQGQFHFDAQFTPLDSDTSRSFTPTTWGHVQRH
                     VTTRRPSYNTIVSTREQYYNLDYPRDRELLAKLQLDPTSRFYARSRPRTLDLPKLLPY
                     ELENPQDSAKFLSHIVSHLYIAIKSLDIQGALSISAKDLAALKDSISDVDLVLETNLF
                     EMDNGQEDDEPMTEEFDSSDEELDHGGEDEVGIDDNSDGDDDDDDDDDDDDDDESTTV
                     QHKKSPKSAAVVSVRTWTHELLIWLKMKYDMPVTLRANLAKVYFALCLCRGQHVHIKT
                     YLRVFEILTKDQEILYEQGLRLPWEGLCKELEHLFPSVDAISVSFEKKDQKQLAKLAS
                     RASYFFDKDCLPKIYSRIVSNFSVSTSASVVSALALMPLNFTQGGADDENDIRHYINS
                     FFYMWLKLNKTKGFEEQVTSRLGIIAMETMKKFDEKVIKDGSTIRNVVKLGNFGLFSK
                     DQMEFTFNELINNLGIMPKKYASRKLKYFHGFASMIVFSINGESAFTERGLIHHLRTL
                     VNAIESYIHPSNSGEWTRPISRLIMALIYQFHKRYNMETQSESGLYNIPENMKITSEV
                     KKKFVSIFLPIVKIGTHSKRGDVASEYLSALQLLAYLEPDYVLENTLLDIYESLEGVI
                     STHRVINALRTMDTLARHLVSTPIFRVHVTRLLSLALPGVDSNDLEKTLQTLEVFSAF
                     STYMPIADLNGEFGDTMLAIEFTSNHVNYLNTKLYGSEQEFEVSPDMESAALKSSTSA
                     FKELIIALAQKLPTLLENLPDPSKSSGLEKSLALSLPKFFFVMFESMSDEIFNIFKNE
                     FLKFSLNNVHHLVASPVAEICGAIIKRDPKCFKANYEILVDKIRDEIDENGAGVARTG
                     SDIVPRDQALLWYLTILNECVGNAGAQLVAMHKELKVFSFYLMDNVKGPCVYSSSFFV
                     NQVLQTVTKIKINECRLISPDYEKRHGLTVDCWGGFWDKKDRFEDLKFDWFISTEREI
                     EFAYEFFNEHVSRCLKNVTNIIESYGANDAGSAAGTAAGTAVSVAASKSSIMILDELR
                     VNLLYLAYSSSGIAYLLDPSFAEDIPNLNHDKESIQQRLQLLKRVKEISGISTQKDIL
                     YDENVTENMKQIMQDLKSEDLIDYMADFSKMGDIVSDQLSNEHSNGEFDKEDVPSTKS
                     TPTEKHSFMHATGKNVSDIDLGGRGTPSVEGVHMSSMNPAITFRERSLYTSNYFFGND
                     AKNKRSKDLYLKIHKTRYLIGRSLHFVAKFLNANFHDNIRIFKNLLFAIGIWISDVGR
                     ERALGSSNAEIDYGYVQYLQIINRVRKPFTRIAIAARLEMYHQTRVALHATARAETNL
                     DRVLIDDVVKIAASNYAEISNSAQRMLLDGMKRLSGSYNHIIKTAFKNLSSALESEQP
                     KEIENALKVFALKRIKYKLHNDYFNLHKFVDLLHRSLKVDDPKVYKLAQALFTSISKG
                     VSLPSKVCIIDEQAIDSIRPPDQCIDLEIKAVQLAKEKKRKIYYDRLERLQHKVLEEQ
                     RHNSHWKVTLSNLELLSNLQSYLELPVRSDILQTLFNESSQEHPIVSRHALVGITRVI
                     TKLRILDRYSYDVKNCYDLDHRSKSEQIISTKPRRNESYYKVWKEEFDTCQEMPHYFI
                     DNKPSKGWLFWGDEMLALSSQPSFQLEMRPNDLESLTKFGERITREWLLKLLKMWVSE
                     AENSNAFQVTDVITIESIILLMSNNLVPNLSYKDLLGLVDEIYVSDEKSAHIVTCEVL
                     AGVLLASKFTSPIYFEDRDEFVGQYLRRVLDSDISPGTSATWSLFSMWVPGHADIRRF
                     YKVMDEIMNFTIDPKSDSAFKDSTRLSYVRAVTSALSWRLADVDKYLDLCLANINHKY
                     NAVRKEIGVFMAILSINYYLDSFADSKVFLKGCNDGINSLLLNASQNERGAISKIPQL
                     FAETERKRNEVMHLTPQEILVSDYINTASTLLYWLKQDLNTNASILLQEYVPQYIVPF
                     LLNLINMKEVCQLGQIDPITAFKKVSQIAYIKEYLESIVEMLESYTKRDLGIVQTIVI
                     GEFTETIYFRNLFKLSKEQRERIINITNSLLYHRHLEVREAESATLSGLIHMLPVEDV
                     EHVVHKFIKSYTSQLDEVRVKYKKKGGIKNLSQEDIVKAHGATLGLGSLVHAFSFASP
                     PPQWVPHILTTLANKSTGLPGIVGKTAKETLGKFRKDRQDTWHVDSKIFNEDQIQDLE
                     GVLWRSYFI"
     gene            <142056..>143888
                     /gene="ARB1"
                     /locus_tag="PVL30_003203"
                     /old_locus_tag="LELG_02356"
                     /db_xref="GeneID:5232938"
     mRNA            <142056..>143888
                     /gene="ARB1"
                     /locus_tag="PVL30_003203"
                     /old_locus_tag="LELG_02356"
                     /product="ABC transporter ATP-binding protein arb1"
                     /transcript_id="XM_001525748.2"
                     /db_xref="GeneID:5232938"
     CDS             142056..143888
                     /gene="ARB1"
                     /locus_tag="PVL30_003203"
                     /old_locus_tag="LELG_02356"
                     /note="BUSCO:EOG092614E6"
                     /codon_start=1
                     /transl_table=12
                     /product="ABC transporter ATP-binding protein arb1"
                     /protein_id="XP_001525798.1"
                     /db_xref="GeneID:5232938"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF12848"
                     /translation="MSAVSASKAKREAKRLEREAKKAADGKSVKKTKKQAEKDAAEEV
                     VEGTAEQIAKLKLQTDEHGLSDRVTTGVLASLETSRDIKISSLSLLFHGKVLIQDSTL
                     ELNYGRRYGLLGENGCGKSTLLKSIAAREFPIPEHIDVYLLNEPAEPTEFSALEYVVR
                     EAEHEMKRLEDLVEDLIVKEGPECPALEGLYEKIDDMDPSTFESRAAVILTGLGFNGV
                     TIKKKTKDMSGGWRMRVALAKALFVKPTLLLLDDPTAHLDLAACVWLEEYLKRFDRTL
                     ILVSHSQDFLNGVCTNMIDMRLKVLTMYGGNYDSYVKTRTELETNQMKQYAKQQEEIA
                     HIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVVPDRVFSFRFPEVEKLPPPV
                     LAFDDMSFSYSGKDEDNLYEHLDIGIDMDSRVALVGPNGVGKSTLLNLFQGKLTPQKG
                     RVIKHTHIKLGVYSQHSADQLDLTKTPLEFVRDKFANISQDYQYWRSQLGRYGLSGEA
                     QTAQMATLSEGQRSRVVFGLLALEAPNLILLDEPTNGLDLSTIDSLADAINAFNGGVV
                     VVSHDFRLLDKVAKDIFVIENKTATRWNGSILDYKKTLADKVVL"
     gene            complement(144299..144371)
                     /locus_tag="PVL30_003204"
                     /old_locus_tag="LELG_06044"
                     /db_xref="GeneID:5232992"
     tRNA            complement(144299..144371)
                     /locus_tag="PVL30_003204"
                     /old_locus_tag="LELG_06044"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:5232992"
     gene            <147718..>152406
                     /locus_tag="PVL30_003205"
                     /old_locus_tag="LELG_02357"
                     /db_xref="GeneID:5233207"
     mRNA            <147718..>152406
                     /locus_tag="PVL30_003205"
                     /old_locus_tag="LELG_02357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525749.2"
                     /db_xref="GeneID:5233207"
     CDS             147718..152406
                     /locus_tag="PVL30_003205"
                     /old_locus_tag="LELG_02357"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525799.2"
                     /db_xref="GeneID:5233207"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MARISHSGRRNHKNNTLEEQPRFGDEFEMPVEAHLAQVAHDQNY
                     QNFYNPYLETHEPPHYYRRAHDDNIYSSTEATPHTQTQTQTQTQTHTHRYQDPYQDPL
                     PQTYSPNRTPRFNAKLYTADPSVEGFETFPSVYKTKDELVKTVDSTEIVSSSSLENQP
                     ILQNEKRLFSWLFSKKVPEIPADEERTDYPWHKANPFLRLGFWWLWPVLKKGYKRTLF
                     PEDLFKLTPELKVEYMYNQWNKHLTSIISKHNASNPKSSDWPKHAIPYALFLTFKWHY
                     LFSCVCLALAFTVIACSPLITRQLIDFVEYRYFQVYTTYNRGIWLTFVAVILIFVNGL
                     LLNHFFHNAMICGAQAKAILTKALLMKSFKLDGKAQYKFPPGRVTSLMSTDLARIDLA
                     IGFQPLVLCFPIPVVISIAILLKNIGVAALSGIGLFLVSLIVCVLLTKKLFTTREKVV
                     CFTDERVSLMREILNNLKIIKFYAWEMAYKAAIAKVRNKEMRHLFTIKVLRNFITAYA
                     LTLPVLTSMVSFITMWATNNMKSPGEVFSSLSLYAILAQAIMLLPIALATGADALIGF
                     QRCNAFLSAEEFHDELAQQLNEKNYYLRDSPANKVTIKVSHADFHWEDNHADDTLLDP
                     ELWDIEEEDIKIMKEGSIYSNQKQQQQQQQQQQQMQTETHSPYGFESDSASCSTITNS
                     NNNQFQGLSNVNLTINRGEFVIITGVIGSGKTSLLHALAGILKITNPSRGQLIVNDKI
                     LLCSSPWIQNATVRENITFGKPFDIAKYKQVLFACALEDDIRMLPAGDRTEIGERGIT
                     LSGGQKARINLARACYADAEILLFDDVISAVDSKVARHIVSHLFKGLLKHKTIVLATH
                     QLGILDFADKVVFIDNGSVYSGLVPQLKHENNNFRKLLDHGEDRAGDAENAASTDNLS
                     EVTNLQRLPPLTDGASASAGAGAGAGFHEGHQNDISGRTTLDEVRATNSISWKIYKKY
                     IELGAGIFGKFAVPLFLLLVTIATFCQVFTNTWLSFWVEKKFPDKSDHFYITIYVVFA
                     FLTVIFTGIEFSMLAYMQDCSANSLNLKAVGKILHAPMSFMDTTPLGRILNRFTKDTD
                     SLDNEIGEQMRLFIFPLALIIGIIILCTCYLPYFAVAVPFLAFGFLFLANFYQGSSRE
                     IKRLEATQRSLVYNNFNETLTGMATIKSFGAEQDFIRKNDYFLDKMNEAYYLSIATQR
                     WLCVHLDIITSCFALIICLLCITEQFSISASSTGLLLNYVMQLVGVLSLTVRSMTSVE
                     NEMNSVERLHEYAFDLPQESAYIIDKAAPPQEWPASGYITFKDVHLRYRSNLPFVLKG
                     LDVNFYPGEKVGICGRTGAGKSSIMSALYRLVEVEQGKIEIDGLDISQMGLFDLRSRL
                     SIIPQDPVLFQGTIRRNLDPFGEYDTYTLWKALAATGLIEESQIPYLSSVSISDNGVS
                     HKSLHKFHLDQLVDDDGLNFSLGEKQLIALARALVRNSKILVLDEATSSVDFATDGRI
                     QELINREFKNCTVLCIAHRLKTILNYDRVIVMDKGAIAEKGDPWKLYNDNGVFRSMCD
                     KANIRAGDFP"
     gene            <154185..>154517
                     /gene="CYC1"
                     /locus_tag="PVL30_003206"
                     /old_locus_tag="LELG_02358"
                     /db_xref="GeneID:5233069"
     mRNA            <154185..>154517
                     /gene="CYC1"
                     /locus_tag="PVL30_003206"
                     /old_locus_tag="LELG_02358"
                     /product="iso-1-cytochrome c"
                     /transcript_id="XM_001525750.1"
                     /db_xref="GeneID:5233069"
     CDS             154185..154517
                     /gene="CYC1"
                     /locus_tag="PVL30_003206"
                     /old_locus_tag="LELG_02358"
                     /codon_start=1
                     /transl_table=12
                     /product="iso-1-cytochrome c"
                     /protein_id="XP_001525800.1"
                     /db_xref="GeneID:5233069"
                     /db_xref="PFAM:PF00034"
                     /db_xref="PFAM:PF13442"
                     /translation="MPAPYEKGSSKKGATLFKTRCLQCHTTEKGGANKVGPNLHGVFG
                     RHSGQAEGYSYTEANKKAGVLWDEQHMSDYLENPKKYIPGTKMAFAGLKKAKDRNDLV
                     TYLKEATS"
     gene            complement(<155251..>158046)
                     /locus_tag="PVL30_003207"
                     /old_locus_tag="LELG_02359"
                     /db_xref="GeneID:5233471"
     mRNA            complement(<155251..>158046)
                     /locus_tag="PVL30_003207"
                     /old_locus_tag="LELG_02359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525751.2"
                     /db_xref="GeneID:5233471"
     CDS             complement(155251..158046)
                     /locus_tag="PVL30_003207"
                     /old_locus_tag="LELG_02359"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525801.2"
                     /db_xref="GeneID:5233471"
                     /translation="MRQTFIKLKPKTSGRSFTKPLDYQASDEIKKSFSRRLRDAVEDD
                     HISPSRSAKGIFTNRDGKFSGNKGKASSSSSYRNLKQNLNRDSEQSSMRNLRRKQGTS
                     QNSGKSKAISETKLKAEEIRSLSQSLKFLQSKYSSIPFLDDSGKIIDLQRLQPYDMKF
                     NNPTSKLIFQNLLRIKELTKKQVPRTLSLTLLGTTSTQLSDPYFITNNASDLLKFDRD
                     PARASYLCRISDKKSSIVGMNTIMEWHFAKKDQKAGIKAFHERRSSGIPCNPYTYLEL
                     FNGVAKTTAWGSAKKEICEKMIEIFKSNRSEFSDAKDNKGFATSIFNACLSILVRNFD
                     DSQAIAWGFFDELFGSNELELEQIYPDSQTFTILLQGVKKYAEHERSQVLADENLSSA
                     VRLAKLLEIEANHVKVATAVFDKVRQAATPPKANLDAKKNQKNIHNWYKSRIEIDFPL
                     FTTFLNSFCSRDAGTGEDLHSGSHYVYAQRALDILRIVSPDVEKMLKYISKDGLSVES
                     RLKAHTDMRVNKALKHGILTSSEADSTSIDNINPSAVIKDSDLSRFNPMVHMIHRGKF
                     NTEAEPLIDLTRSVSGKDSVESMRSINKFMLNQVFETLINLGLFKEFVRAYYYASIEW
                     GGVKLLLPELAEQDILKNFLPNMSVREFKTGRIPSIIDEASFDSFIYKIAEHGRYKGK
                     TSTNVVLQMLRILVTPELTVNGIEPTMDHMNKICSIMVKDLHYYNDTHVKKSYTTRYA
                     FSYRQLTDYLRNLIEFGEIHNMYISKSAKSYTPGYYHAFMEKVTKILQSAHWIDVEDC
                     EKRYHITKLILKANILDYRPQIAALKPETRQRTRSIEKLVGETLSAMKDAGRNFEEDK
                     KLRSVLKSLRAAESVKGDVKSLNKKLYDLISGELKAAPCANVATKKELSGELSEELSG
                     ELSGEHVTTSSTIVKNN"
     gene            <158400..>160253
                     /gene="CWC22"
                     /locus_tag="PVL30_003208"
                     /old_locus_tag="LELG_02360"
                     /db_xref="GeneID:5232948"
     mRNA            <158400..>160253
                     /gene="CWC22"
                     /locus_tag="PVL30_003208"
                     /old_locus_tag="LELG_02360"
                     /product="pre-mRNA-splicing factor cwc22"
                     /transcript_id="XM_001525752.2"
                     /db_xref="GeneID:5232948"
     CDS             158400..160253
                     /gene="CWC22"
                     /locus_tag="PVL30_003208"
                     /old_locus_tag="LELG_02360"
                     /note="BUSCO:EOG09263WM5"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA-splicing factor cwc22"
                     /protein_id="XP_001525802.2"
                     /db_xref="GeneID:5232948"
                     /db_xref="PFAM:PF02847"
                     /translation="MVTSKQQKKPSEIEETTQRKLWGDLKNTITFHVSNVNRSNIKQV
                     VVKLFKCNIDRGRGLFARAVMKAQMENVKDTSSVYASLVAVLNSKLPKIGKLLCSRLL
                     LQFKLAYMKNNWRVCHSSLVFICHLVLQEVMSEIILLQIIQLLLEHHTAGDIELIAEV
                     FKISGSFLNKDSNIATNMILGRLNDLLQEDEGLSHKSRSTINYVLRLGQRQFKGTGIV
                     DNTLDLVEDDDKETHEILIDSKLKSRDHLDLFYVDPDFAKNEADYQRQLVDILDESNE
                     FEEEQEQEQDQGQDQESGEKRHSRQYKSPLELAKDVKQGVKVVDMSQSEILEFQKRVY
                     LTVMSSMSADEAVHKLLRLKKSYSNSQQNHMVNEKFLADMIIKCCSQEKSYSKFFGII
                     GEKLCSRDGQWHNKFVDLFKAYYLEIDKFETNSLRNIGKFFGHLFASDVIALEQAWNE
                     IKITEEDTNPPRRILLKFIFQEMVEEMGIKEMQRRLIFDSHVKRHINGVFPVVGVSWK
                     DADDIRFSINFFTAIGLGVLTEEMREVLNNLPEERGRSMSRNRDGDKNRNSSDGSNGY
                     SRSGSSSYSRSRSNSSTRSFSRSRSGSPTGLNPTNAEKVAESTGDIINKLT"
     gene            complement(<160429..>161589)
                     /locus_tag="PVL30_003209"
                     /old_locus_tag="LELG_02361"
                     /db_xref="GeneID:5232958"
     mRNA            complement(<160429..>161589)
                     /locus_tag="PVL30_003209"
                     /old_locus_tag="LELG_02361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525753.2"
                     /db_xref="GeneID:5232958"
     CDS             complement(160429..161589)
                     /locus_tag="PVL30_003209"
                     /old_locus_tag="LELG_02361"
                     /note="CAZy:GH76"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525803.2"
                     /db_xref="GeneID:5232958"
                     /db_xref="PFAM:PF03663"
                     /translation="MQLSLLIFLLNFLSIASALPTLYKRSFDAESAYQSALNATWSLF
                     WNSQYDAFNLNDPACTSEFSYAAVWDLAVVGKAIVDSGDVAKTEDIINSLYKFQNSAG
                     WFTSSPGGSEIYTDDNAQVVWVFLAAYELTKNQQLLNTAVNLIHLIQTQWSAIGGVTW
                     QKDETYVASISTVEAALAAVKVYEQNGDESLLTFANSSLTWLDEHLTDPTDGFYYDGI
                     NRQTWQLNKGKLTYTVGVAISTYSYLYKFTGDEAYLEKAIAKASATLQSTTFLSPNGA
                     WNNQLCYVHLLFAGFADLITITGITQYTEAVTNQANFIYLYDQLTQGSYGWYGSDLSL
                     YNNYVKSTGDTKSISYSYSADNYCSTNPTQPKRSALDDGSAAQIFYNVARIN"
     gene            complement(<163726..>165504)
                     /locus_tag="PVL30_003210"
                     /old_locus_tag="LELG_02362"
                     /db_xref="GeneID:5233313"
     mRNA            complement(<163726..>165504)
                     /locus_tag="PVL30_003210"
                     /old_locus_tag="LELG_02362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525754.2"
                     /db_xref="GeneID:5233313"
     CDS             complement(163726..165504)
                     /locus_tag="PVL30_003210"
                     /old_locus_tag="LELG_02362"
                     /note="BUSCO:EOG09261I8J; MEROPS:MER0002476"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525804.2"
                     /db_xref="GeneID:5233313"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF02148"
                     /translation="MSSSSTTTSQTATIESTSLKHGTLNGVVSNTKTNCSPHDSHSNG
                     NSSSSSSSSSNNNNHYDHPLHILHSPLVLDNYGSLSSCAHLDKVLQSRAKDTVFETYR
                     QAVLISQPIKDTYTYKARNGGGDVIDRAELQRKQLSALKCTDCGNSQFQEVLICLQCP
                     QVSCSQHSHGHYNESSHMFAIDSKLGLLYCLKCDGYVNSKRLNDIRCEVMGVHSLQSI
                     EEKADDKNDVDLKQEIGKGSEENGVKENRSNQNFINPNMLATMGLKGFVNLGSTCFMS
                     SILQTFIHNPIIRTQFFNNDNHYFNCKLLHDQEVQGSLHEGNACITCSIDKIFKDFFT
                     MQNTEGYGMTYLLATAWYKQKSLAGFQEQDAHEFWQFLLNEFHSDHARISSVEKVCSC
                     ISHICFGFELQSCVRCECGAENITVDPPTFEMSLELTSEKENSNSITVGGCLDSFTRE
                     EILDTKISCKSCLKESGASRTLRLKTTPPVLSIQLKRFNHSISNDKSSKVEAVVDVPL
                     FLDMNKYTINEQADNNSKPILYELFSVVCHLGSVNTGHYIVYTKNSQGRWFKFDDSVI
                     TIEDETSAISAIRSTGYLLYYILHNV"
     gene            complement(<166737..>167513)
                     /gene="PLP2"
                     /locus_tag="PVL30_003211"
                     /old_locus_tag="LELG_02363"
                     /db_xref="GeneID:5233059"
     mRNA            complement(<166737..>167513)
                     /gene="PLP2"
                     /locus_tag="PVL30_003211"
                     /old_locus_tag="LELG_02363"
                     /product="Proteolipid protein 2"
                     /transcript_id="XM_001525755.2"
                     /db_xref="GeneID:5233059"
     CDS             complement(166737..167513)
                     /gene="PLP2"
                     /locus_tag="PVL30_003211"
                     /old_locus_tag="LELG_02363"
                     /note="BUSCO:EOG09264873"
                     /codon_start=1
                     /transl_table=12
                     /product="Proteolipid protein 2"
                     /protein_id="XP_001525805.2"
                     /db_xref="GeneID:5233059"
                     /db_xref="PFAM:PF02114"
                     /translation="MDPNMKIPVEVNPDEDTEWNDILRAHGVIPEKPPSPSAQLEEAL
                     EDAVRKQHENRLENKDLDELDELEDQEDEEFLNFYKQKRLNELKELTAKKKFGSVLPV
                     SKSEYEDEVTKASKDTYVVVHLSLQSSLQSRLLGSLMTQLAIKFPELKFCDIPAQRCI
                     ENYPESNCPTLIVYHNSNVLKQYITLTQLGGNATTLQDLEQVLVNVGAVKDNDQRLVI
                     NNEDEDAQEARKLRFAKKSVRNDDDYNDNDDDDDDDDFYD"
     gene            <167904..>168815
                     /locus_tag="PVL30_003212"
                     /old_locus_tag="LELG_02364"
                     /db_xref="GeneID:5232990"
     mRNA            <167904..>168815
                     /locus_tag="PVL30_003212"
                     /old_locus_tag="LELG_02364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525756.2"
                     /db_xref="GeneID:5232990"
     CDS             167904..168815
                     /locus_tag="PVL30_003212"
                     /old_locus_tag="LELG_02364"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525806.2"
                     /db_xref="GeneID:5232990"
                     /db_xref="PFAM:PF01467"
                     /translation="MQHPVVLLNNPIEIDYSELLINVISLIKGCNQLDILILHQINDA
                     SNLNEVLYKYYTLVRTEVQASSWFDHSFQINIIFNISDDKIRKLAQNWNRAIFAQAEM
                     NVIKAPKSQITALDVNLEHSKFSPPSKTEKKSIGQFKTTAVGGTFDHLHDGHKILLSM
                     ASFLTKSRMIIGITGSELLKNKKFGDALESFSKRQQSVTTFLHMIMGDDHYYEVYEIN
                     DVCGPTGYIEDIDGLVISLETASGGDFVNKYRREQGYKQLDITAIKVIGQSETNNAEN
                     SWKGKISSTDIRAQELEKTKSLEQFSR"
     gene            complement(<169200..>173315)
                     /gene="UBP15"
                     /locus_tag="PVL30_003213"
                     /old_locus_tag="LELG_02365"
                     /db_xref="GeneID:5232993"
     mRNA            complement(<169200..>173315)
                     /gene="UBP15"
                     /locus_tag="PVL30_003213"
                     /old_locus_tag="LELG_02365"
                     /product="ubiquitin-specific protease ubp15"
                     /transcript_id="XM_001525757.2"
                     /db_xref="GeneID:5232993"
     CDS             complement(169200..173315)
                     /gene="UBP15"
                     /locus_tag="PVL30_003213"
                     /old_locus_tag="LELG_02365"
                     /note="BUSCO:EOG092606AJ; MEROPS:MER0002475"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-specific protease ubp15"
                     /protein_id="XP_001525807.2"
                     /db_xref="GeneID:5232993"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF12436"
                     /db_xref="PFAM:PF13423"
                     /db_xref="PFAM:PF14533"
                     /translation="MISDDSHPSTKRRALYDDTVVDIEDDSQEYAAANNEKGELNQDI
                     NTQHKADSPPEYNNDSSSPEVIDITGDVNQEGNIEIDHNDLDSEEEEEVELVDESGED
                     YIDIDQENQLQQQQQQQQSSSIQSSSSIQPQQKAQNKIPMANEFDKLAKYLMKPIPDY
                     PVKEEIHFVWEVTDWASLSKEEKIRSPKFKCGDYEWNILLFPNGNNTNANISAYMEPH
                     PLTNETTADSNLNGKDSDWYVCAQFAIDVWNPEAPESHSPSQSSHRFSKTDADWGFSA
                     LIDKRSLSLKKFANKSFEVPILENNKLNFTGFVRVIDDSSTGVLWHNFNNYDSKTKSG
                     YVGLNNQGATCYLNSLLQSYFTTKIFRKLVYQIPTQQEKNAGVALALQRIFYLLSTSK
                     DPVGTMELTKSFGWDSSDAFTQHDVQELNRILMDKLEHAMKGSAIEKGLNDIFVGKMK
                     SYIKCVNVPYESSRVEDFWDIQLNVKGFRNLEESFKNYIEIEMLEGENKYQAGDDYGY
                     QDAKKGVVFESFPPVLHLQLKRFEYDFMVDDLVKIDDFYEFPDRIDLKPYLDEDLPQD
                     VKNQNWNYKLHGVLVHQGTISNGHYYAMIKPNASGKTWLRFDDDRVWKVTQSQVFQEN
                     FGASDLSKEELSKLTRAEQQEHLIKRVTSAYMLVYYRESELDQIVPIEDDAIEAAIPD
                     HVSNQIKYEMEERERIERERREALFYTNVKIVTTSTINNHLGFDLALDPTVENYYESA
                     LAGTACDAKTLRVRKDIAYADLVSKIAESLGYEDASKIRLVVLSHRENHTNRLDVPVE
                     DDLQKTTIGNVIAKSFNRRHDEHVFFVEELNKDIRNINKLVGETEIIDPTKFDFDKVF
                     YKIQSVGTATSTSEDEMKFQSTVPYSGYSTIFIKYFDPVSQELRCLSYITVRRNDKIE
                     TIVEPVKQLLGFSNDVELEAFEELCPTMIEPIDLDATFDKQELNSGDIITFQVSNVRD
                     IAGDKQFTSAKAYYKFMATRVHIRVKPFNANMEDEDSDYVENDKEDTKLDGETEGDNI
                     NGQENDKVTQREIESAKKLSKSFDLWISKTKSYHDLAEAISKVVGCDPEFLKIFLVGN
                     QGQKYPLKTIHMLSQVFSPKSHVDDIYEFEYEILNIKLKDYESLRPFKVYWLSNLLQF
                     QVFELLVKRSETVRELVSKLLHKVKVSESQLKFLLCWSGVNHSFSEILKFDFPINEIA
                     EHSEIYCGLFPAEVKALCDHDIYKCYIGDGEKTWSDAEKDITNEAEKAEYTQTKTASK
                     SLNLITVFHFHKSSSNHHGIPFMFIVFPGESFKSTRERLRLKLGLGKQAFDKIRFALA
                     DSNNKGQYLDDEDENLVLFDKVSIERSFLALDHPDRNPKRVNPFDKGISIK"
     gene            <176986..>178116
                     /gene="MP65"
                     /locus_tag="PVL30_003214"
                     /old_locus_tag="LELG_02366"
                     /db_xref="GeneID:5233385"
     mRNA            <176986..>178116
                     /gene="MP65"
                     /locus_tag="PVL30_003214"
                     /old_locus_tag="LELG_02366"
                     /product="Cell surface mannoprotein mp65"
                     /transcript_id="XM_001525758.2"
                     /db_xref="GeneID:5233385"
     CDS             176986..178116
                     /gene="MP65"
                     /locus_tag="PVL30_003214"
                     /old_locus_tag="LELG_02366"
                     /codon_start=1
                     /transl_table=12
                     /product="Cell surface mannoprotein mp65"
                     /protein_id="XP_001525808.2"
                     /db_xref="GeneID:5233385"
                     /translation="MLYKTIISTALLAQALAAPAVKHQHNQEKRAVHIVTKTNVVVIT
                     VGAGDSTTTLSQVDLSANTDVSVGGPQTEAPQIVPSSVAEVSTETPSSTSVAASASSS
                     SSSSSSSSSSSTESSTVGAGGAKGVTYSPYSDDGGCKTSSQIASEVAELSGFDIIRLY
                     GVDCDQVAQVLQAKTSSQKIFAGIYDVSQISEGVSAISSAVSSYGSWDDIHTVSVGNE
                     LVNAGTCTPSQIKSYIASARSSLTSAGYSGPVVSVDTFIAVINNPSLCEYSDYIAVNA
                     HAFFDGYYTADQAGAWVLSQIQRVWTACGGEKNVLITETGWPSKGDSNGVAVPSKENQ
                     EAAISSIKSSCGSSAILFTAFNDLWKADGPYNAEKYWGFLSN"
     gene            complement(<178649..>181840)
                     /gene="RAP1"
                     /locus_tag="PVL30_003215"
                     /old_locus_tag="LELG_02367"
                     /db_xref="GeneID:5233546"
     mRNA            complement(<178649..>181840)
                     /gene="RAP1"
                     /locus_tag="PVL30_003215"
                     /old_locus_tag="LELG_02367"
                     /product="DNA-binding transcription factor rap1"
                     /transcript_id="XM_001525759.2"
                     /db_xref="GeneID:5233546"
     CDS             complement(178649..181840)
                     /gene="RAP1"
                     /locus_tag="PVL30_003215"
                     /old_locus_tag="LELG_02367"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription factor rap1"
                     /protein_id="XP_001525809.2"
                     /db_xref="GeneID:5233546"
                     /db_xref="PFAM:PF09197"
                     /db_xref="PFAM:PF11626"
                     /db_xref="PFAM:PF16589"
                     /translation="MNYSYNFDTGFDQTDPDDATAQVAVFAAAAAAGQQTQPFQYPRR
                     HQQERHQGHHQQLFHHQYTKPRNQIFVTRDGKPIAFYLGFNEPNRAKYVTAIIENGGF
                     ITEGGVENVIYLTSHTKDMGGYVRTQFIDDCISAGTLLPSHNYVIPSVPEDSEPMIDV
                     LGLEQHGHQMRHLYPQQQQQQQQQQQQQQQQQQQQQQQQQQHFSHHQMSTQASVQPQL
                     QEQHHQQQLQAKAAKPKKIAHNAAISSHRFTPEKDEYILDQVRKNARFRNSHEFFREL
                     AGHEMLKTHTGNSIRSRYRRHLEPRLQFIYKTNQKGKLMKDPTTNQLIKIGLDELPQT
                     LKNKFTPEDDYYLCQIVTNYNKSVAESKGLPFDPRKKTVPPYSFFNDMYRANHRHTLH
                     SWRDRYRKYITEGTMVEYMEHYEKCRREGKEPRSLMRIPPHILEIEKEKEGEGEGEGE
                     GEKEVGQNEATANSKQKKNDNDNDNDNDNANSKDKDMVENGKEVVERDEDQTEPNITN
                     KVAIKEKRQKKPKQTKGKDKNAVDNDVEFFEAAEAEALAAIAASNARDAKAKEKAKHR
                     ETKNYQSHDEEIEDSQNDDDNDDDQPVSKKRKQEVKLKVDDNSANASKSAAAKTNESN
                     EVKQQQVAGDGEEDYDFGQDFDAALDEEIGELKDSEVGQVSRNTSFADRIEVPKLGDL
                     GDFDFEEEGEEEGEGEDEDEDEDDEQVEQEKNQESPASRNKEQARDDSNKEDKDEHDP
                     QDDEFSDALETTENFSAPADEALQPNNASSSQIHDAERILEATSQTQEFFTFPKSQPP
                     TVPQEEDDEGEEKIEKEEDKENNDSQFDPDFAPPSQSQAPTQDQNQDQKSILTSTQNS
                     AHAQDSQDGDIELKYLARNTLLCDVVKPDKFSKLLEHKNPQLVLTRKLTSTSSAGDSL
                     EDIETVYTKLGQVGLCDNFISHVIYACSAETPVMLNYITAFVKQLLKNKQRAEGIKRG
                     EGGGEGGGEGGEAEEIRKGLVNVYKYLPTGTELHGIWTDEFDSVLGTQQESDLFQYKS
                     GVEIERRFKFLRDCEIVKMEMEMEMESDVLNEE"
     gene            complement(<182932..>183849)
                     /locus_tag="PVL30_003216"
                     /old_locus_tag="LELG_02369"
                     /db_xref="GeneID:5233475"
     mRNA            complement(<182932..>183849)
                     /locus_tag="PVL30_003216"
                     /old_locus_tag="LELG_02369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525761.2"
                     /db_xref="GeneID:5233475"
     CDS             complement(182932..183849)
                     /locus_tag="PVL30_003216"
                     /old_locus_tag="LELG_02369"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525811.2"
                     /db_xref="GeneID:5233475"
                     /translation="MAGTCINTIKLLGFGSLGLLTSSIIYQSIQNIPQLIHQLNSIYQ
                     FNVAQLNQQISKTKAFVFGTRIVNGLLTGFSTLFFSLAFKYSVVDEKHPYLLYAAIGA
                     PLSLIGLYLNAWSYEGKILDKKQAGSTTTTTNLPENAVEKKKSAKFAFVTPTAPSSIS
                     TASEDDDEEEEEEDDDEPVEVVSRVNTVDELGRSYVHLSDESGISTPTSTQPSSPHLK
                     QQDDGNGHADVNDMPKPAKKGNEDQKEKAKEKNDGEIEAEIESTLLKKEIIHDLQQIQ
                     SGYSIASYISGASLVLAAVGLFGDFYFVH"
     gene            complement(<186272..>187309)
                     /gene="OCA1"
                     /locus_tag="PVL30_003217"
                     /old_locus_tag="LELG_02370"
                     /db_xref="GeneID:5232923"
     mRNA            complement(<186272..>187309)
                     /gene="OCA1"
                     /locus_tag="PVL30_003217"
                     /old_locus_tag="LELG_02370"
                     /product="tyrosine-protein phosphatase required for
                     protection against superoxide stress (By similarity)"
                     /transcript_id="XM_001525762.1"
                     /db_xref="GeneID:5232923"
     CDS             complement(186272..187309)
                     /gene="OCA1"
                     /locus_tag="PVL30_003217"
                     /old_locus_tag="LELG_02370"
                     /codon_start=1
                     /transl_table=12
                     /product="tyrosine-protein phosphatase required for
                     protection against superoxide stress (By similarity)"
                     /protein_id="XP_001525812.2"
                     /db_xref="GeneID:5232923"
                     /db_xref="PFAM:PF13350"
                     /translation="MSIEQSVLKSGTGDSFQGIEKKDPNDVVKLEESKLTQSLNASQT
                     KESSSHSQRIQDESLQRQQHIPFEGNNLNLRKITEPPSLRIIPPLNFCPVERQLYRSG
                     QPSMINQSFLNQLNLKTIIWLASEEPNDEFLDYCAAQDIQVEFVAGMSEYAYDDEPIQ
                     DHITNAKLESNTNADPNTIADANVKATTSTDTSTDTSTDTSANINTNTNTNTNTSATN
                     AEGDEIAGTGMAEPPIPQRRFHQRLVSLNPWDSLNEQTITKALELVVDKRNYPVLVCC
                     GMGRHRTGTVIGCLRRLQGWNLASVSEEYRRFTGARGGRILVELLIEGFDIRTVKIDP
                     ELAPDWLKVRS"
     gene            <187771..>188421
                     /gene="OST2"
                     /locus_tag="PVL30_003218"
                     /old_locus_tag="LELG_02371"
                     /db_xref="GeneID:5233167"
     mRNA            <187771..>188421
                     /gene="OST2"
                     /locus_tag="PVL30_003218"
                     /old_locus_tag="LELG_02371"
                     /product="oligosaccharyltransferase complex subunit
                     epsilon"
                     /transcript_id="XM_001525763.2"
                     /db_xref="GeneID:5233167"
     CDS             187771..188421
                     /gene="OST2"
                     /locus_tag="PVL30_003218"
                     /old_locus_tag="LELG_02371"
                     /note="BUSCO:EOG09265JA7"
                     /codon_start=1
                     /transl_table=12
                     /product="oligosaccharyltransferase complex subunit
                     epsilon"
                     /protein_id="XP_001525813.2"
                     /db_xref="GeneID:5233167"
                     /db_xref="PFAM:PF02109"
                     /translation="MAKNNAAIKKATQAVQAVQAKQSKLDSNTTQPSTTSSKATISTS
                     SLAPKEVKATLAQLNQALATTIHDYFHTLTPKLKLIDIFLVFLVVLGVLQFVYVLLIG
                     NFPFNAFLGGFAACVGQFVLLVSLRLQINDGERELKRRVLNTPKVNIGEKTNVIVDEN
                     TRDSEVIGVQVAEIEEEEENDGGAKKVFNTISPERAFGDFIFASLILHFIVIHFIN"
     gene            complement(<188992..>189798)
                     /gene="RAS1"
                     /locus_tag="PVL30_003219"
                     /old_locus_tag="LELG_02372"
                     /db_xref="GeneID:5232981"
     mRNA            complement(<188992..>189798)
                     /gene="RAS1"
                     /locus_tag="PVL30_003219"
                     /old_locus_tag="LELG_02372"
                     /product="Ras GTPase"
                     /transcript_id="XM_001525764.2"
                     /db_xref="GeneID:5232981"
     CDS             complement(188992..189798)
                     /gene="RAS1"
                     /locus_tag="PVL30_003219"
                     /old_locus_tag="LELG_02372"
                     /codon_start=1
                     /transl_table=12
                     /product="Ras GTPase"
                     /protein_id="XP_001525814.2"
                     /db_xref="GeneID:5232981"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF08477"
                     /translation="MLREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQ
                     CTIDGQQVLLDILDTAGQEEYSAMREQYMRTGEGFLLVYSINSRNSLEELQQFYEQIQ
                     RVKDTDRVPVLVVGNKCDLEMERQVSYEEGLALANSFHCPFLETSAKQRINVEEAFFD
                     LVRFTRDMESNLKKEQEAQLNGSNNQSAQKQSTQQIQQQQQQQSQSQSQSQSQSVAGV
                     SGAAGSAGGSSNNIKNKEGASNGAAASRKQQSSTTPASKEKSKSGCCVIV"
     gene            complement(<195569..>196780)
                     /locus_tag="PVL30_003220"
                     /old_locus_tag="LELG_02377"
                     /db_xref="GeneID:5232940"
     mRNA            complement(<195569..>196780)
                     /locus_tag="PVL30_003220"
                     /old_locus_tag="LELG_02377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525769.1"
                     /db_xref="GeneID:5232940"
     CDS             complement(195569..196780)
                     /locus_tag="PVL30_003220"
                     /old_locus_tag="LELG_02377"
                     /note="BUSCO:EOG09264DY4"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525819.2"
                     /db_xref="GeneID:5232940"
                     /db_xref="PFAM:PF05859"
                     /translation="MTSTYQDPRITALITEHLGYAPLKVIDEVINAMNSITIKGIEAF
                     EKFLLDLHSENKIPQSISKDDIYKGTSKLELLLQNNIDVSFDKYELYCLRNIFSIPPD
                     LVQGGWIRLKHLENVDFTNVKNSHIVKWEYDQQIVNIYARIEEELLTRKVIKLQMIKA
                     EKIIENLKYIKKNLLPLTTLTNQQWKLSDSVVDKKIDDKQSELSEGEKETEKDFENEI
                     LEKERLAYEKAAPLRELYNSLQPIEQTLAVLQNELNETIDSVANLSKRLDDDVTKQKI
                     VMRPSSRDKFIENRSRRIMQRLNLVDGLINTTTTTTTTTTNVAGAGAGAGAGNGEKSY
                     GSGSGSRHGIDANTTGSTAKRLVLQNDVGSDMDIDSDIIMEEETTTGGVAKESSDGKA
                     LANLRDIAKAM"
     gene            <197289..>197531
                     /locus_tag="PVL30_003221"
                     /db_xref="GeneID:85890354"
     mRNA            <197289..>197531
                     /locus_tag="PVL30_003221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119453.1"
                     /db_xref="GeneID:85890354"
     CDS             197289..197531
                     /locus_tag="PVL30_003221"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975436.1"
                     /db_xref="GeneID:85890354"
                     /translation="MAGTLHPDRELQRFNTAKEKIGQYFRFKPRSAFFAILTMGIIPV
                     GLTMVAYNYEGVVSRRQVFRTQPVLENSYVPRDKDL"
     gene            complement(<198225..>200603)
                     /locus_tag="PVL30_003222"
                     /old_locus_tag="LELG_02378"
                     /db_xref="GeneID:5233190"
     mRNA            complement(<198225..>200603)
                     /locus_tag="PVL30_003222"
                     /old_locus_tag="LELG_02378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525770.2"
                     /db_xref="GeneID:5233190"
     CDS             complement(198225..200603)
                     /locus_tag="PVL30_003222"
                     /old_locus_tag="LELG_02378"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525820.2"
                     /db_xref="GeneID:5233190"
                     /translation="MNIDFDQLTRNLADTSPVFHQTPSFASNTNQRGSQSHQFTFNPD
                     DFSINDYAINDYSLNESSMLLSSHQQQHSQQQLQLQQPQQLQQPQQQQLSSSAFPPSE
                     LLDFFQEPTSHAIKGAVSSTGQAIKPQPPYLQTPKMTSSPIMSHPMGGSNFSNYNTPA
                     VPQSATFANNSSSQVNLANHFTPVTPTGWNTQTVSYNILNDTNKMMLTTPKSAHTFNH
                     SSPQFTPPSQAHFASMSNMMMDFTSPTIGLGVSNTSNTVSNGFNDDPIPFVPEDPISE
                     VVPVSQRNSDTLLNNDSLQTQSQLQSYQLLQQQQQKQQQQQQQVQQSVQQQKFENYKK
                     ELYEQKRLKSQSESNLPLQYNFVHHVDESQMLIDQPHSMIISNSGVSTESSNISLPSQ
                     SSQPKRKSIAKPLSQLKKAKSTLSLRKHSQKASVPEEEVLHNQELLVPSSKHGDSPTT
                     IEMQSPRSSFEDDFSAYQTHENSITAEELLNSDIFDSYPGSNSNVSTSSVNSKKQEVF
                     YDAKETQSVNSSQQTMEPTSKVNPETPEKLGTITNSGVATGKSLSSVPVSVAHATTVV
                     PSTNTTSKRKKSYTSSSSSSLSSHANISNTPTFIVNSKLQWTENQNAKIKSSLSSQSR
                     KSSGISTGNSSSSSSGATAPGGTGGTGGTSAKSTSSSSSSSATAAHLEMIKRMPVFAL
                     SNHYSFVYENVESIYSDEKEKEKKVGNGQARGQVRDQVKSDDGGNCKSKNDTFFAKKT
                     GGGRNESGREPLFFDERKNKKDKDRVGKAEKSSGPSYNLKSSLVEFQVDLKK"
     gene            <202913..>204214
                     /locus_tag="PVL30_003223"
                     /old_locus_tag="LELG_02379"
                     /db_xref="GeneID:5232903"
     mRNA            <202913..>204214
                     /locus_tag="PVL30_003223"
                     /old_locus_tag="LELG_02379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525771.1"
                     /db_xref="GeneID:5232903"
     CDS             202913..204214
                     /locus_tag="PVL30_003223"
                     /old_locus_tag="LELG_02379"
                     /note="MEROPS:MER0026469"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525821.2"
                     /db_xref="GeneID:5232903"
                     /db_xref="PFAM:PF01546"
                     /db_xref="PFAM:PF04389"
                     /db_xref="PFAM:PF07687"
                     /translation="MNFSSIKIQKGRLINTIHETAKFGAHGVWGTESPTQTGVCRLAL
                     TDLDKQVRDWFVQETTSLGCSIKVDQVGNIFATFPGQNEGLPTAIGSHLDTQPTGGRY
                     DGILGVLSGLEVLRTLKENNIVPKYPITLINWTNEEGARLPMSMVASGVWAEKVSLET
                     CLNLDSLEETPKKFGDELKRIGYAGETLASYKQNPIAAHFELHIEQGPILENENKKIG
                     VVVGGQAFEWNLITVKGRSSHSGTTPMNTRSDAMLTASKIITMAIETAEKYGGLGTVG
                     TLNLQPASVNVIPNEVSFSLDVRHVEDDALESIMNEIKTKAKEIAEQNIGSKFAKPLT
                     VNFENITTSKAIKFNSKNIETVKRAALSLFKEDEVREIVSGAGHDSCFTSTRVPTSMI
                     FIPSKDGLSHTPEEYSTPEEVHNGFEVLLRTVLLYDEQRTE"
     gene            <205061..>206788
                     /locus_tag="PVL30_003224"
                     /old_locus_tag="LELG_02380"
                     /db_xref="GeneID:5233305"
     mRNA            <205061..>206788
                     /locus_tag="PVL30_003224"
                     /old_locus_tag="LELG_02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525772.2"
                     /db_xref="GeneID:5233305"
     CDS             205061..206788
                     /locus_tag="PVL30_003224"
                     /old_locus_tag="LELG_02380"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525822.2"
                     /db_xref="GeneID:5233305"
                     /translation="MRTQPTIKEQLDGFPFFQFTILCIIRLAEPIAFASFLSYIFFMI
                     KSFRIAKTDADVSRYTGYLASAFSISQFLTSVRWGRASDRYGRKPMILLGCLGTAVSM
                     LVFGFSVNFYMALCARAMMGILNGNVSIMRTMAGEIAVEKRHQGIAFSNLSLIWSLGK
                     AGGYFIAGNLVDVDHFRNYKRDNQELTSVSKDVLASTPTLKTTLIPTVVPNSVPTSTQ
                     SSTGLGLFKKFPFAFPNVVIFFIILIHTTFGWLFLEETHEKQRVKRDRGLEIGDRLKK
                     ICGLKVPDRDWKIRKDEASEYLIGNHNDYSDDEYPEEETDDFEMSTLNANTNNNEEER
                     EVEEEEEMEEQNIGESLPTSSLFTWPIIWRIACNFLISFGNIIYTEFLPVFLAKSVDV
                     DSLNPPFHIKGGFGMNSASTGKMLSITGLTSVIAVSLLFPAINQRFTVLEAFRLGLII
                     IPVFYFVLPLTIFTIPQYLGTNYDIATPLLYLNGFMISFVGSITFSQVTLLIHRATPK
                     KHRAVINGYTISCTALAKFVSPLIWGFIMTKMDLKGLGGLSWWLLGFVSLAALGVTFL
                     LSENDDQED"
     gene            <207302..>208936
                     /locus_tag="PVL30_003225"
                     /old_locus_tag="LELG_02381"
                     /db_xref="GeneID:5233003"
     mRNA            <207302..>208936
                     /locus_tag="PVL30_003225"
                     /old_locus_tag="LELG_02381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525773.2"
                     /db_xref="GeneID:5233003"
     CDS             207302..208936
                     /locus_tag="PVL30_003225"
                     /old_locus_tag="LELG_02381"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525823.2"
                     /db_xref="GeneID:5233003"
                     /translation="MHENPSIRDQLSGFPIFQMGIVCILSLSEPIAFASYLSYIYFMI
                     KSFGIVKTDSDVSRYSGYLAAAYSFAQLFSIVQWSKASDKFGRKPVLLLGCIGTALSM
                     ILFGFSSNFYMAFISRMLMGLLNGNVSIMRTVTGEIAVEKRHQGIAFSNLSVIWSLGK
                     AVGYYMAGKLTNVDHFRDYNPDEKANVMGSIGSGGSGNKETHDIPFFVRYPFAFSNIV
                     VSMLILVFALIGCLFLKETNIAFKGRRDRGLELGNKVLNLIRAGHISIDETHESLIAR
                     EHEPVIESGHDLEHEGSQRFVDEYEEFEMTSRNSSFESDEDKQEKQDFVLKWPITVRI
                     LCSCLDSFQYIVYTEFLPVLLASTVDAKSLKFPFHIRGGFGFKTNDIGKLLSMTGVLS
                     VIAAAISFPFINKHMNLLFAFRLGLFILFWLFACLPLIIFTTSEYTGSKLDPSTPLLY
                     LGSTLIAYAASVTSPPIVLSIHRATPKRHRAVVNGYTITGGALAKFISPLLWGQVMTS
                     MDHQGYGGIGWFLAGLSSIVNLSLTFFFKQSDEHED"
     gene            <210274..>211200
                     /locus_tag="PVL30_003226"
                     /old_locus_tag="LELG_02382"
                     /db_xref="GeneID:5233181"
     mRNA            <210274..>211200
                     /locus_tag="PVL30_003226"
                     /old_locus_tag="LELG_02382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525774.1"
                     /db_xref="GeneID:5233181"
     CDS             210274..211200
                     /locus_tag="PVL30_003226"
                     /old_locus_tag="LELG_02382"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525824.2"
                     /db_xref="GeneID:5233181"
                     /translation="MLFVSALISFIFFAFALANQPAINFDVQAVEKRDASAQAVDFLL
                     FDDLQLQRRDYGGISTETYDEIDQYLKQLVAAVGAPNVANSSDLSKRDSNPALTAAFT
                     ALNKSGVGVEIVHGLVTNSLSQPQAITAIEQYIKQNTLPTLLSAADNSGLAVSIVMRF
                     FINYSLVPGLWNIIVALYKNGTIFKRGLLDLIGSVIGGVQQSIWASLINLLSLVANVE
                     TVCESLNNSGFGVSVVDDIVSTSDGQAFAVKAATAIINDSIITLDSLFSALNSTSFLQ
                     NTFTKIISNSTYRKIIFIWAVNFLVSAIKYIF"
     gene            complement(<211520..>212767)
                     /locus_tag="PVL30_003227"
                     /old_locus_tag="LELG_02383"
                     /db_xref="GeneID:5232924"
     mRNA            complement(<211520..>212767)
                     /locus_tag="PVL30_003227"
                     /old_locus_tag="LELG_02383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525775.2"
                     /db_xref="GeneID:5232924"
     CDS             complement(211520..212767)
                     /locus_tag="PVL30_003227"
                     /old_locus_tag="LELG_02383"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525825.2"
                     /db_xref="GeneID:5232924"
                     /db_xref="PFAM:PF03171"
                     /db_xref="PFAM:PF14226"
                     /translation="MPVQSRNYNLRPFKEAPLSTSSLKPIELESIDLSLYKDGPENLA
                     SRKVLAHKIEKSLSTYGFISVINHGFAAEKLELLKSVAQSLLELPLEEQKKYLAGALK
                     SDLEDRTKSIGAERASGFKPKGYWSMRNGVVDSITHFNFNYMNHSRFFDEKENNYPDI
                     VKEYLTEIAEYYRFLHQDTLRKICNLSDIVLELPEGFIYDKFYSVTEGELENSGGGAG
                     RFMLYDAMDSEDQKKVDGTWLRGHSDSGGFTFITSQPILSLQIRDYYTGKWNFVGHTP
                     NGLIVNIGDAMEFITGGFFKSSIHRVVNPPDDQAGFRRLVLIYFCKPKGDAILDPTAL
                     NSSKLQRLGYVKPKEWEIIDFKAWNNEKSRLFGKSKVNDTQSEEPKLVLLYGRLHERW
                     HQAESNFSLEEAEKRFEILKIDV"
     gene            complement(<213541..>215040)
                     /locus_tag="PVL30_003228"
                     /old_locus_tag="LELG_02384"
                     /db_xref="GeneID:5233474"
     mRNA            complement(<213541..>215040)
                     /locus_tag="PVL30_003228"
                     /old_locus_tag="LELG_02384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525776.2"
                     /db_xref="GeneID:5233474"
     CDS             complement(213541..215040)
                     /locus_tag="PVL30_003228"
                     /old_locus_tag="LELG_02384"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525826.1"
                     /db_xref="GeneID:5233474"
                     /db_xref="PFAM:PF00296"
                     /translation="MTVKRQKKERKPIILNAFDMATPGLQSPGLWKHPKDKSRDYNTI
                     EYWTNLAQLLERGKFNALFIADVLGPYDVYNGPRNLTAAAKAGAQWPINEPSAVIPAM
                     AAVTKNLSFAVTASTISEAPYHFARRLATLDHLTKGRVGWNIVSSYLDTASRNLLNGE
                     PLPPHDERYEKAQEYLEVIYQLFLSSWADDAVKLDVKKGVFADPERIREINYDGKHYK
                     VPGPFISEPNPYQRLPVILQAGASTKGLEYAAKNAEAVFINGMTPEGLKTKIDKLNDL
                     IKKNGRNPDDVKKVQLVTVIVAPTHEEAIEKFNDIKQYADAEGAQALFGGWTGINLGE
                     YEWDQKLDEVESNAVKSMAEMWTKPFPGDPPDLEKTRAYIADKVSVGGSGVLFIGTPE
                     EVADEIENWVDISGIDGFNFTYAVTPGTFEDIVDLLVPELQRRGLVWKDYPKEGLSFR
                     ENLYGIDREDATYLKPDHPAYNLRWKKGESREEFEEKLNKALKDNFGIV"
     gene            <218390..>222775
                     /locus_tag="PVL30_003229"
                     /old_locus_tag="LELG_02386"
                     /db_xref="GeneID:5233426"
     mRNA            <218390..>222775
                     /locus_tag="PVL30_003229"
                     /old_locus_tag="LELG_02386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525778.2"
                     /db_xref="GeneID:5233426"
     CDS             218390..222775
                     /locus_tag="PVL30_003229"
                     /old_locus_tag="LELG_02386"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525828.2"
                     /db_xref="GeneID:5233426"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF00664"
                     /translation="MADSSLENQQQLQRQKRLLSIFFSKHVPHVPTEDERKPYPQNSA
                     NFLWRIFFWWLSPVMKTGYTRTLQPEDLFYLTDDIKVQTMADNFYRYMTNDIERAKQK
                     WVAEKCKKRGETLETSSVDPEQDLKDFELSKFLTVWALAKTFKWQYTWACVCLALSNA
                     GQTTMPLLTKKLIRYVELKAMGDETGIGKGLGYSFGTAAIVFIVGVLINHFFYRSMMT
                     GAQAKAVLTKALLDKSFKLSSEAKHKYPASKITSMLGTDLSRIDFALGFQPFLIVFPI
                     PIAIAIAILIVNIGVASLVGVAILFVFMIGIAFSTGALFKYRKKANFFTDTRVNYIKE
                     ALNNLKIIKFYSWEPPYHSNISEVRKKEMKIIYRMQVLRNIVTSFAMSLTLFASMTAF
                     LVLYAIANGRRDPASIFSSLSLYNTLTQQVFLLPMALATGADAFMGISRVGEFMSQSE
                     VHPEENRIEASPETKEEMDKEGVAIDVKHAGFEWEIFDDDDDDEKEKEKKKNHNGEGA
                     DDEKKMKKNTQNKDAKNSAEIETVHESHHDKSSSKEHSSSLDDSSDEEVIFNGLTDIN
                     FQIKKGEFVVITGLIGSGKSSLLAAMSGFMKRSSGSVDVNGSLLLCGYPWVQNNTVKE
                     NIIFGAEYDEERYKKVIYACSLEADLEILPAGDRTEIGERGITLSGGQKARINLARAV
                     YADKDIILMDDVLSAVDARVGKHIMNNCIMDLLKDKTRVLATHQLSLIGSADRVIFLN
                     GNGSIDVGTFAELKDTNPGFGKLMAYNSEHEKEEEEEVEEINEEELEEERRMIERQLT
                     RRTTHTVKTGISETGAGGEAGPEDEEARHREFNLDETVDGKLIDAEERAVNAIGWDVY
                     AKYITLGSGRFTPYLLLPVLLTFMILATFCQIFTNTWLSFWTEYKFDKPDKFYIGIYI
                     MFTFLAFFMLTIEFIILVYITNTASIMLNVLAVKRVLHAPMSFMDTTPMGRILNRFTK
                     DTDVLDNEIGDQLRFFLFTLCNIIGVLILCIVYLPWFAIAIPFLGMLFVSIANYYQAS
                     AREVKRLEAVQRSLVYNNFNETLSGMATIKAYHAVTRFLNKNNYLIDKMNEAYYVTIA
                     NQRWLAIHMDFIAALFALLIALLCVNRVFDIGAASVGLIVSYVFQIAGQLSMLIRTFT
                     QVENEMNSAERLNAYATNLPEEAPYVITENTPPPSWPTKGSIEFEHASLAYRPGLPLV
                     LKDLTFKINPMEKIGICGRTGAGKSSIMTALYRLSELESGKIEIDGIDISTLGLRDLR
                     SKLSIIPQDPVLFRGTIRKNLDPFNEHSDDKLWDALRRTGLIEGVRLEVVKKQIKSHN
                     TEEKIDNSAATTLNKFHLDQTVEDEGSNFSLGERQLIAFARALVRDSKILILDEATSS
                     VDYETDSKIQETIIREFGDCTILCIAHRLKTIINYDRILVLDKGEIKEFDTPWNLFNS
                     NNGIFQQMCQRSNITEQDFSNAQRF"
     gene            <223471..>223872
                     /locus_tag="PVL30_003230"
                     /db_xref="GeneID:85890355"
     mRNA            <223471..>223872
                     /locus_tag="PVL30_003230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119454.1"
                     /db_xref="GeneID:85890355"
     CDS             223471..223872
                     /locus_tag="PVL30_003230"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975437.1"
                     /db_xref="GeneID:85890355"
                     /translation="MSRIIGFIIDVLEAREEVKHTRGRLTSGDKLFYGRRQRREYARS
                     DRHLVDVNRYNERDMCMGTNRGRCGLRGQDSQYHVMQHDSHYLGRPNEVDARYTFRER
                     EQEAPPYRQEGQYYTNEGKQQGQTQDNWNYR"
     gene            <224184..>226480
                     /gene="CMK2"
                     /locus_tag="PVL30_003231"
                     /old_locus_tag="LELG_02387"
                     /db_xref="GeneID:5233174"
     mRNA            join(<224184..224187,225075..>226480)
                     /gene="CMK2"
                     /locus_tag="PVL30_003231"
                     /old_locus_tag="LELG_02387"
                     /product="Calmodulin-dependent protein kinase cmk2"
                     /transcript_id="XM_001525779.2"
                     /db_xref="GeneID:5233174"
     CDS             join(224184..224187,225075..226480)
                     /gene="CMK2"
                     /locus_tag="PVL30_003231"
                     /old_locus_tag="LELG_02387"
                     /codon_start=1
                     /transl_table=12
                     /product="Calmodulin-dependent protein kinase cmk2"
                     /protein_id="XP_001525829.2"
                     /db_xref="GeneID:5233174"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MEHDKSTDATNTTTTTSAAPKPIPPSTRPEAHAQTGHKTVKSFL
                     NKLQGQPDSYTRKQNYTFGKTLGAGSFGIVRYARDNTTGEDVAVKIILKKALKGNEEM
                     ILDEMGMLEELHNPHIVGFRDWFESKDKFYLVTQLATGGELFDRIVQQGRFTEHDASL
                     VVQQMLDALNYLHSKDIVHRDIKPENVLYLTPADDSPIVLADFGIAKRLQSPKEKLTS
                     SAGSFGYAAPEVILGTGHGKPCDIWSLGVVTYTLLCGYSPFRSENVSDFINEVKHNNA
                     VIFHADYWRDVSKDARRFIIKALQYDPERRPTAEQLLNDPWLVSIAEQHKECDLLPSL
                     KANFDAKAKFRQAIEVVKLHNRIKKLKEMQTENDDDPSEIDLFNEKGNISNKKGDDEK
                     DAAAASALSNWKKFNDSLPRAGDTTISNASLTPSKPQSQSSNKTVAAGNAFAQLVQAA
                     TQNKERVMTFKEEKEKEEQ"
     gene            <227135..>229603
                     /gene="SET2"
                     /locus_tag="PVL30_003232"
                     /old_locus_tag="LELG_02388"
                     /db_xref="GeneID:5232908"
     mRNA            <227135..>229603
                     /gene="SET2"
                     /locus_tag="PVL30_003232"
                     /old_locus_tag="LELG_02388"
                     /product="histone methyltransferase set2"
                     /transcript_id="XM_001525780.1"
                     /db_xref="GeneID:5232908"
     CDS             227135..229603
                     /gene="SET2"
                     /locus_tag="PVL30_003232"
                     /old_locus_tag="LELG_02388"
                     /note="BUSCO:EOG09261B14"
                     /codon_start=1
                     /transl_table=12
                     /product="histone methyltransferase set2"
                     /protein_id="XP_001525830.2"
                     /db_xref="GeneID:5232908"
                     /db_xref="PFAM:PF00397"
                     /db_xref="PFAM:PF00856"
                     /db_xref="PFAM:PF08236"
                     /db_xref="PFAM:PF17907"
                     /translation="MTEVLPRNGHQRQLFLDAEDKTAEALTKYQNLQQCTYMNKGIGC
                     PSNSKRGREYMTCDCEEDWDSSTEQNMACGEDSNCINRITSVECINRHCSCGENCQNQ
                     RFQKKQYADVSVFQTELKGYGLRANTQLREGDFIYEYIGEVIDEPTFRQKMIEYDLKQ
                     YKHFYFMMLKNDAFIDATEKGSLARFVNHSCSPNAFVDKWVVADRLRMGIFAKRDIMA
                     GEEITFDYNVDRYGAQSQPCYCGEPNCLKFMGGKTQTDAALLLPEGVSEALGVNSRIE
                     KAWLKENKHLRSEQQADDATINEMFVKSLQVEPMEDLDVSKVIGALMKAQQQSLIKKL
                     VERMHLTTDEYVNKLLVKFHGYKTLSSVLQEVATSAGDADENAKDDGDDELVIWILEV
                     LARWPAITKNKISSSQIEDVVKEVKERSKNEEIVVLCEKLLQQWSQLEMAYRIPKIKN
                     PVVTSSGFDRKSKSPTKETLDESTAEKSNGRPPAPSYRLPANWETTFDESSGKWYFYN
                     KITRETDWNPPKGSVPVGPARVGSMSGTSRGARSHEGYPKGPSSYASHPYDSNHGHNH
                     ATGRNHNNSHNHNYNSSFQETRGPSFKHKELEITRREEERIQKEREAKAQELAAKERQ
                     VMEMIEQAKMVSQTVTPEPEKKSRHKDKRGQSSSRSDYKPKEHKSKEHKSKENSIESQ
                     WKRVLAKHIPNLIKKHQAEIGKDNVKGCAKEIVNNLARREAQKENAKSPPEELEKHKI
                     KKIKAFTDSFMDKFLIKYRRKHQSRKRKLDQDGNGEIEGVDDIMGDANELESPVANVT
                     GDGSGEVDTSKEEAEDNDVKRVKV"
     gene            complement(<230140..>231306)
                     /gene="GPD1_1"
                     /locus_tag="PVL30_003233"
                     /old_locus_tag="LELG_02389"
                     /db_xref="GeneID:5233199"
     mRNA            complement(<230140..>231306)
                     /gene="GPD1_1"
                     /locus_tag="PVL30_003233"
                     /old_locus_tag="LELG_02389"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_001525781.2"
                     /db_xref="GeneID:5233199"
     CDS             complement(230140..231306)
                     /gene="GPD1_1"
                     /locus_tag="PVL30_003233"
                     /old_locus_tag="LELG_02389"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_001525831.1"
                     /db_xref="GeneID:5233199"
                     /db_xref="PFAM:PF01210"
                     /db_xref="PFAM:PF07479"
                     /translation="MSGAQSRLTQLSNILTPTKSPNPKNSLSPDHPFRICVIGSGNWG
                     TTIAKVVAENALARPHLFAHHVRMWVFEEKIDGKPLTEIINQQHVNIKYLPGVKLPTN
                     LVAEPSLLKTVEGADLIVFNMPHQFLPKILKQLKGHVPPTARAISCLKGLEVSKEGCK
                     LLSTYITEELGITCGALSGANLAPEVARCKWSETTVAYKLPSDYRGAGKDIDQYILKA
                     AFHRPYFHVNVIEDVAGVCIGGALKNIVALAVGFVEGLGWGDNAKAAIMRVGLLETIK
                     FSEMFFPESLASTFTAESAGVADLITTCSGGRNVRVGRYMAETGASAEQAEKKLLNGQ
                     SSQGIVTAKEVHELLTNVEKLDEFPLFEATYQIIYGSESIENLPNLLNRDAHFS"
     gene            complement(<233904..>235967)
                     /gene="MET32"
                     /locus_tag="PVL30_003234"
                     /old_locus_tag="LELG_02390"
                     /db_xref="GeneID:5233067"
     mRNA            complement(<233904..>235967)
                     /gene="MET32"
                     /locus_tag="PVL30_003234"
                     /old_locus_tag="LELG_02390"
                     /product="transcriptional regulator of sulfur amino acid
                     metabolism"
                     /transcript_id="XM_001525782.2"
                     /db_xref="GeneID:5233067"
     CDS             complement(233904..235967)
                     /gene="MET32"
                     /locus_tag="PVL30_003234"
                     /old_locus_tag="LELG_02390"
                     /codon_start=1
                     /transl_table=12
                     /product="transcriptional regulator of sulfur amino acid
                     metabolism"
                     /protein_id="XP_001525832.2"
                     /db_xref="GeneID:5233067"
                     /db_xref="PFAM:PF00096"
                     /translation="MSQSYKEILDSFDHNHQSHIASDRNTNFRQPDTRRKPLSISQIT
                     ASSGSNSNSNSNLALGTQSKPISPVILPSQDHFSSNLEHFQHHQQSKQKGQGLEHTEH
                     SPSHFEIQLAKQRSREEQVQQQQQQQQRLGSPYHQQSHQVEHRQRTPQFLNRSYSQQN
                     ILSRQTPPPQQQPPPPQQQHSNREINRAMSFTMFSPNPASPLYPSTSANSIKPSNERS
                     NSHHNVKNIKSNKSSSPPAKKFKHDSHHNHHNHHPHNNNELFFGSSSLHQQGTSPIPT
                     SQPIVSSTRTTLRRERTPENENEDQRFLRLARDALVATAQGINEQNRGIVDPTISDLL
                     TRLQYASSPHGNPISNSKHLEANENGQLNVQGFYQNFPNLSNNIFTGSPHGGDGGVGL
                     GVGAGVGAGVDTTPGGTKADEYKASEQKDETIKSAPLLNSRHHPAGNEQGWNFLIGEA
                     LHLKADSERNPMAQLENTSVDFTAAKANNARQSVSTSRKKFKGEGVRKFPCDKCSMSF
                     RRSSDLKRHEKQHLSIPPNICEFCGKGFARKDALKRHVGTLTCKRNANKKLYIENLEH
                     LNGRGGVGGIGAKSGDIDELSEDEVEEDEEEDGEEAEEEEDEVDGGENGNHEGIGRKT
                     VNEYGEIGKRDDNEHDRSGGGISKNSTKKNKKSNEEQHEIEDDDEEEIQRKFPTYGYQ
                     KENWQ"
     gene            <238782..>239819
                     /locus_tag="PVL30_003235"
                     /old_locus_tag="LELG_02391"
                     /db_xref="GeneID:5233395"
     mRNA            <238782..>239819
                     /locus_tag="PVL30_003235"
                     /old_locus_tag="LELG_02391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525783.2"
                     /db_xref="GeneID:5233395"
     CDS             238782..239819
                     /locus_tag="PVL30_003235"
                     /old_locus_tag="LELG_02391"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525833.2"
                     /db_xref="GeneID:5233395"
                     /db_xref="PFAM:PF04193"
                     /translation="MFSLLLQAAGTSAVTTSLRTQISGVMGSTSLACWIVLLMPQLIE
                     QWRLKSAEGIAIGFISIWFLGDLFNLIGAVWAGLLPEVIFLAIWFCIADALMISSYFY
                     YTRIYRKKTSHHNHHHHHHHQQQYHDNSNSNESNSHENYHQHEQGPNHHHALNEDGPG
                     ELERDFIESSEHTPLVRKRSRRNSTLTDIAMEPQYHSVFVKYILPIIFVIGAGVVGFL
                     MSGKEAIPDNPSPPNPNPHDPPQDVIAFGPQVMGYCSAFLYLGARIPQIIQNYRKKSV
                     YGLSLLFFLFSTLGNLTYAGQILFYRSDWKYVVLNMSWLLGSLGTIFEDCLIFMQFYM
                     YRDNSVEDDFI"
     gene            complement(<240631..>242040)
                     /locus_tag="PVL30_003236"
                     /old_locus_tag="LELG_02392"
                     /db_xref="GeneID:5233194"
     mRNA            complement(<240631..>242040)
                     /locus_tag="PVL30_003236"
                     /old_locus_tag="LELG_02392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525784.2"
                     /db_xref="GeneID:5233194"
     CDS             complement(240631..242040)
                     /locus_tag="PVL30_003236"
                     /old_locus_tag="LELG_02392"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525834.2"
                     /db_xref="GeneID:5233194"
                     /db_xref="PFAM:PF04433"
                     /translation="MISDTSNHQKRLEEPQLQSQLQPQLQPQPKPVQPYPHQYQYMHH
                     NLSDSIIANCPTPSIADDQLLDKNNFQTLQSMRKSNSSPNNYFSSVTTVSAKNASISA
                     TTATAAVPAGTAGTPRVPGMMAASKTSSFESQLPSQQPLSPPLSPYQRNAELHTLGGN
                     IHHQSEILKSHQVLQSPLPTTTITTETTASSPPPPSKPFLDSSKNYKLENFRDYKLTI
                     SVKPSKSYYAHQFEFLDKYSSIASAEHKTNNAASLHMPVRKYKKRSYLGNYDSNDESY
                     ESGATAGATAGVRTRRLAKTKEIFDNSDTDVATPVKKRKRVATPSNFGHTPSHSSTPS
                     SPSMSIAMQQQLLIDESIPDFSPDAQATLPNNAKCLKIEWKGQPMDLTNDPNLTKYKL
                     HPAEIHLASILRLPVAVYMDSKRRFFFEKVQKIKAGKMFRRTDAQKACRIDVNKASRL
                     FAAFEKVGWLNDKLFEKYL"
     gene            <245327..>246835
                     /gene="dus2"
                     /locus_tag="PVL30_003237"
                     /old_locus_tag="LELG_02393"
                     /db_xref="GeneID:5233103"
     mRNA            <245327..>246835
                     /gene="dus2"
                     /locus_tag="PVL30_003237"
                     /old_locus_tag="LELG_02393"
                     /product="tRNA-dihydrouridine synthase 2"
                     /transcript_id="XM_001525785.2"
                     /db_xref="GeneID:5233103"
     CDS             245327..246835
                     /gene="dus2"
                     /locus_tag="PVL30_003237"
                     /old_locus_tag="LELG_02393"
                     /note="BUSCO:EOG092628FW"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA-dihydrouridine synthase 2"
                     /protein_id="XP_001525835.2"
                     /db_xref="GeneID:5233103"
                     /db_xref="PFAM:PF01207"
                     /translation="MALTYTNKVCLAPMVRSGELPIRLLALRYGCDLVWSPEYIDRKI
                     IQTQRRVNAELNTIDYIIPNNKDPSKMKHNQDNVVFRKHPEETGKLIFQLGTSTPELA
                     VEAASRVIEDVDGIDLNCGCPKSFSTHGGMGAELLKTPDILCSILRALVEKVGNPNKK
                     PISCKIRLLPNFEASKLLIEQICQTGIRNLTIHCRTPIMRNRQDPFWNYLPKLIPIIE
                     SHGISVILNGNFQGRGDLTSLQEALGNPNLSIMIAEGAEANPSIFINTNTNTNNSNTH
                     SVANTPSSPKTQAEIINEVVELGKKYYLYSGTKFMVSNMTPGKSIYFQKFARSKSFEQ
                     MEEVIKEMNNEGGCEDESKNSREASDFSARSNTSTTTTTSIDKIYKIMTKDCQKPRFW
                     DAEGYQNYMAQRQNKMQRYFKNWNEEEMLKDLNDTPTPRTNETFNSGNKRQGKSKNSN
                     NNNNNNNNNNNNKTKGDKETEKALKRHSQQEEIENKVKVQKLDGDAIHAQMV"
     gene            complement(<247337..>248017)
                     /gene="TIM23"
                     /locus_tag="PVL30_003238"
                     /old_locus_tag="LELG_02394"
                     /db_xref="GeneID:5233110"
     mRNA            complement(<247337..>248017)
                     /gene="TIM23"
                     /locus_tag="PVL30_003238"
                     /old_locus_tag="LELG_02394"
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim23"
                     /transcript_id="XM_001525786.1"
                     /db_xref="GeneID:5233110"
     CDS             complement(247337..248017)
                     /gene="TIM23"
                     /locus_tag="PVL30_003238"
                     /old_locus_tag="LELG_02394"
                     /note="BUSCO:EOG09264NC7"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim23"
                     /protein_id="XP_001525836.1"
                     /db_xref="GeneID:5233110"
                     /db_xref="PFAM:PF02466"
                     /translation="MSWIFGKPTQSQDDQSNDQLKQRLGFDPREVSDVNTIISSPSSE
                     TASSLNSSLLLHPLAGLEKGIEYLDLEEEKLNTVEGSKGLIPSRSWTDDLCYGTGAVY
                     LLGLGIGGLFGLQHGLSTLPQDAPGKVKLNHILNNITKRGPFLGNSAGVLALTYNLID
                     STIDAVREKHEDVNSVAAGALAGALFRSSRGLKPMAYSSVMMAGAAGVWCALKRSIHE
                     DNQVVLKE"
     gene            <249207..>250010
                     /locus_tag="PVL30_003239"
                     /old_locus_tag="LELG_02395"
                     /db_xref="GeneID:5233297"
     mRNA            <249207..>250010
                     /locus_tag="PVL30_003239"
                     /old_locus_tag="LELG_02395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525787.2"
                     /db_xref="GeneID:5233297"
     CDS             249207..250010
                     /locus_tag="PVL30_003239"
                     /old_locus_tag="LELG_02395"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525837.2"
                     /db_xref="GeneID:5233297"
                     /db_xref="PFAM:PF03162"
                     /translation="MTAVLDPNADSTLPTHDLPNTNQNKVISPSSSTSTSITPTIEPQ
                     IPLNLVPPLNFSLVEDGIYRCGFPMPINYPFLQQLNLKTIIYLGDLGHEPTEPKKEKD
                     KRKGNEKEEPKEKEKEKEKEKEKEKDKKKKKKDKDGSVEILNQYVDWIKDQGSITFHN
                     LLVESSKEPFNKMEEHEQTLRSLTTALTLILDRSNYPILIHSNKGKHRTGLLVGLMRK
                     LLQGWCLSGIFEEYEKFALGKFEYDLELIEIWQPELWVNDDNKPNFVRI"
     gene            complement(<250501..>251268)
                     /gene="GLO2"
                     /locus_tag="PVL30_003240"
                     /old_locus_tag="LELG_02396"
                     /db_xref="GeneID:5233117"
     mRNA            complement(<250501..>251268)
                     /gene="GLO2"
                     /locus_tag="PVL30_003240"
                     /old_locus_tag="LELG_02396"
                     /product="Cytoplasmic glyoxalase II"
                     /transcript_id="XM_001525788.2"
                     /db_xref="GeneID:5233117"
     CDS             complement(250501..251268)
                     /gene="GLO2"
                     /locus_tag="PVL30_003240"
                     /old_locus_tag="LELG_02396"
                     /codon_start=1
                     /transl_table=12
                     /product="Cytoplasmic glyoxalase II"
                     /protein_id="XP_001525838.2"
                     /db_xref="GeneID:5233117"
                     /db_xref="PFAM:PF00753"
                     /db_xref="PFAM:PF16123"
                     /translation="MHILPIPMRWGQGDNYAYLLVDDRSKNAWLIDPAVPSEVNEFIK
                     EKKPKYELKAIVNTHHHYDHSDGNKEFHRKYPDLPIIAGKDSPLVTYTPSHEEVIDLG
                     DDLSVTALHTPCHTQDSICYYVKDAKTGEKAVFTGDTLFISGCGRFFEGTGAEMNVAL
                     NKILAKLPKDTKVYPGHEYTKSNVKFSKTILDNEAIEALDEYTQKHEHTTGQFTIGDE
                     LNFNPFMRLSDPQVQEKTGLTQADDVMTKLREMKNNS"
     gene            complement(<251918..>253189)
                     /gene="SGT1"
                     /locus_tag="PVL30_003241"
                     /old_locus_tag="LELG_02397"
                     /db_xref="GeneID:5233422"
     mRNA            complement(<251918..>253189)
                     /gene="SGT1"
                     /locus_tag="PVL30_003241"
                     /old_locus_tag="LELG_02397"
                     /product="Cochaperone protein"
                     /transcript_id="XM_001525789.2"
                     /db_xref="GeneID:5233422"
     CDS             complement(251918..253189)
                     /gene="SGT1"
                     /locus_tag="PVL30_003241"
                     /old_locus_tag="LELG_02397"
                     /note="BUSCO:EOG09264LH2"
                     /codon_start=1
                     /transl_table=12
                     /product="Cochaperone protein"
                     /protein_id="XP_001525839.2"
                     /db_xref="GeneID:5233422"
                     /db_xref="PFAM:PF04969"
                     /db_xref="PFAM:PF05002"
                     /translation="MAVEQAIKHGDEAVQAKDFLGAIQFYTSALKENPQAFQAYLKRA
                     IAYSKLKNLDHAKKDISTAFTIANDRGKRSEIGLCYFRLAIIYYQEKKLKLALSQFSK
                     ALEYDCKEATLQMWKDKCEYDLKNHPEWNVDNDDDDDDDDKEEEKKEEEEKEREGERE
                     AAEVVGGERSTSNLDSSGDGKGGSELKSEIVEKTETTKASATEANASKPATQSNVDEI
                     NRIAPLSVKIREDWYQSNDDVIITIYAKNIKEDKLKVHFESKSVSISFPSANGSEYNY
                     NLDPLYSEIRVEESRFKIYSTKLEISLRKSIAGKWPSLEKEETLTNNGNSNNKGRQEE
                     LHAAYPSSSRKKIDWSNFKVEDETENEGGEPNQFFQQIFKDMDEDSRRAMMKSYVQSN
                     GTVLTTNWEEARDKEFETSPPEGMVAKKWGA"
     gene            complement(<253671..>256298)
                     /locus_tag="PVL30_003242"
                     /old_locus_tag="LELG_02398"
                     /db_xref="GeneID:5233370"
     mRNA            complement(<253671..>256298)
                     /locus_tag="PVL30_003242"
                     /old_locus_tag="LELG_02398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525790.2"
                     /db_xref="GeneID:5233370"
     CDS             complement(253671..256298)
                     /locus_tag="PVL30_003242"
                     /old_locus_tag="LELG_02398"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525840.2"
                     /db_xref="GeneID:5233370"
                     /translation="MISRLQGSLGPILRGQIYSTQIVAHNFYSRRNKSWKVIIEEPKQ
                     YKNAELERHHAKISDFLHDSQLPLKRKRKLIISTLQEVIALPSDKEQVELINFVLREF
                     KNLQRKHNSSTTIPIDILSHTFRRLYPDIEKNHSEIYDELVTELSRHYNKLSNETLIL
                     LIDLLSQRNIDTEYIFQSLGTRLNENFTREYFSMMERRQKLKLNVFEVMIKFGIRDSY
                     ITALNNYIEKLFEDETPEVHCYKDLERHLDRIHMLISNVIDTVDFEKISIRSLLTLLR
                     LNDELSQVNNFKGSSKRTYTLLDSLYQRFDNLQQVLQKPNNSIDATLLETLLYKAREC
                     NKLLFFKVLDILKHTKSQSNSYLIEEATILNLINGESKNENHRDCEIDSEDVSQISYE
                     LYQKLESCSIETFNKMVPIIAKISPQTVSSLLKLYNSRGIAPSAEFYKALLDNAINRD
                     DHKAALKIFEDAKLDVDWLEAANDPSVAKTLNELIQCVMEALPINESFRIFRTVKTAL
                     PSQISADTINAIAVKLLESNYVGDCMTLMKRELPEIEDEKLRLPIDKPYGYKYMNLFN
                     TVHEYVISNKSDKTVNNNWFLYKDMYKYFHVPVDRILPTMKFFCDNNRWHGALLIFNK
                     MVEQSQIHGKHSFEPPTKEIYTYLLEEFGNSLYEEGVVEVHEWLKMDTNIQEQGLELS
                     NIIMNAYCNLQDTPKVRDLFLSTSVNQGVNEESAVIMLKAYTYNDLNYVDKFWNNLST
                     FGLVPEYSLFRQYLIAQAYHGKVDKSFALLEEAEDYDVEVNEDLLLSMHNYCYMEEPQ
                     AEIKRLAAVQYPQIWQNVEQSGLLSQTKGYRPTESFLIDGSTTNERRLPLAEEARHFT
                     PEQAAADPVLPSESRQKIH"
     gene            complement(<256803..>258029)
                     /gene="TAZ1"
                     /locus_tag="PVL30_003243"
                     /old_locus_tag="LELG_02399"
                     /db_xref="GeneID:5233340"
     mRNA            complement(<256803..>258029)
                     /gene="TAZ1"
                     /locus_tag="PVL30_003243"
                     /old_locus_tag="LELG_02399"
                     /product="Lyso-phosphatidylcholine acyltransferase"
                     /transcript_id="XM_001525791.2"
                     /db_xref="GeneID:5233340"
     CDS             complement(256803..258029)
                     /gene="TAZ1"
                     /locus_tag="PVL30_003243"
                     /old_locus_tag="LELG_02399"
                     /codon_start=1
                     /transl_table=12
                     /product="Lyso-phosphatidylcholine acyltransferase"
                     /protein_id="XP_001525841.2"
                     /db_xref="GeneID:5233340"
                     /db_xref="PFAM:PF01553"
                     /translation="MSFPDVLRRGDEFLSEYPRTNPLWNYASHATCLFMITGSKIILN
                     TLYKPFVHNIEKLDMALAKAREENRGLLTVMNHMSVVDDPAFYAALPWRFHFDIDTIR
                     WGFGAHNICFSNAIQSWFFNLGKILGTKRFGEGPFQGSLDAAIRILSPDDTLDLEFTP
                     GVKDVAKPNLLQTVNNYHNKSNTEMVKFIKPTPEGTNVLMSKNPFIRSKTSWFHVFPE
                     GFVLQLQEPHSNSMRYFKWGVSRLILESTRAPVVVPIFTYGFEKVAPEDSAEEGIKRW
                     LPANVGAEIHLTIGDMICDTKIEQYRQDWRKLVSKYIDKYHPTDLSEELMNGKKAQQL
                     RSSLAAFLRDSVLQIRNSIPLFQPEDPRFKDPKFWKIYTNTEGMSDEDVKFIGKNWAI
                     KRLQSHLPDFDPKEKK"
     gene            complement(<258654..>259031)
                     /locus_tag="PVL30_003244"
                     /db_xref="GeneID:85890356"
     mRNA            complement(<258654..>259031)
                     /locus_tag="PVL30_003244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119455.1"
                     /db_xref="GeneID:85890356"
     CDS             complement(258654..259031)
                     /locus_tag="PVL30_003244"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975438.1"
                     /db_xref="GeneID:85890356"
                     /translation="MLMRMTSCFDNKFNTKEKEWMVDQVRERLKRDVKFQHLQACITT
                     KLDKKHKVSNLSSKSEANSCNNVKETRFDNNDFIDTSSVSGQSAYLSVANFDELIHSL
                     LETVDEKPDKDVPTLEYKHILLN"
     gene            <259324..>259935
                     /locus_tag="PVL30_003245"
                     /old_locus_tag="LELG_02400"
                     /db_xref="GeneID:5233300"
     mRNA            <259324..>259935
                     /locus_tag="PVL30_003245"
                     /old_locus_tag="LELG_02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525792.1"
                     /db_xref="GeneID:5233300"
     CDS             259324..259935
                     /locus_tag="PVL30_003245"
                     /old_locus_tag="LELG_02400"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525842.2"
                     /db_xref="GeneID:5233300"
                     /translation="MILKEFPTKDSTTVHHLPITRLMLQTSTAVNENHIRKLLELQDN
                     ECIDSIEEKKPGKGLSDMIYQRLINVVAAIAEELYSTHKMYDVKQYPLTSIYELNIYV
                     ADKFPFLFYKPVYPSLCEQRIEKIKKDDINAEEEEEDDDIDKESVLFKKNTSSCNSNC
                     TQCCLIKRVPKFIEFWPITLLLKDAYITVLNNKLKDVDCRVRI"
     gene            <260312..>261269
                     /locus_tag="PVL30_003246"
                     /old_locus_tag="LELG_02401"
                     /db_xref="GeneID:5233609"
     mRNA            join(<260312..261001,261138..>261269)
                     /locus_tag="PVL30_003246"
                     /old_locus_tag="LELG_02401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119456.1"
                     /db_xref="GeneID:5233609"
     CDS             join(260312..261001,261138..261269)
                     /locus_tag="PVL30_003246"
                     /old_locus_tag="LELG_02401"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975439.1"
                     /db_xref="GeneID:5233609"
                     /translation="MNRRTFIKSEHFNLGEPLPLTYATTNHQNKPQQSQYPLKQQQQQ
                     KQTPLQPSPRQQSNRFGVQDTLFTNISVPKNRSQTPYIANNTNLSRNSSLVRRKSLSS
                     RHSSSNGGTLNTINSGYIREKIEQLTHQINELETEQVNLVVLDAKLDEVIELVKQFNT
                     TRTLEDVKNELEHEQEGIDIDKRIDRKDENVVEGEGLIEKPNKNIEEMTNDAKEIEEM
                     LNELEQKRKNRKKILSIDIAITFVDIWIMAYLQLLTPSSQATKKTLFLEAVLKMK"
     gene            complement(<261446..>262012)
                     /gene="TIM22"
                     /locus_tag="PVL30_003247"
                     /old_locus_tag="LELG_02402"
                     /db_xref="GeneID:5233148"
     mRNA            complement(<261446..>262012)
                     /gene="TIM22"
                     /locus_tag="PVL30_003247"
                     /old_locus_tag="LELG_02402"
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim22"
                     /transcript_id="XM_001525794.2"
                     /db_xref="GeneID:5233148"
     CDS             complement(261446..262012)
                     /gene="TIM22"
                     /locus_tag="PVL30_003247"
                     /old_locus_tag="LELG_02402"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial import inner membrane translocase
                     subunit tim22"
                     /protein_id="XP_001525844.2"
                     /db_xref="GeneID:5233148"
                     /db_xref="PFAM:PF02466"
                     /translation="MNSNNGLWGVYQGPQPPPKALSEMTQEEQAEAGAQQFISFMQSC
                     PGKTAMAGVSGFALGGFFGLFMASMAYDVPVGTDSVKHISELPFKQQMKLQFGDMAKR
                     SYSSAKNFGYIGLVYSGVECAIESFRAKHDLYNGVSAGCITGAGLAIKAGPQAAFVGC
                     AGFAAFSLAIDTYLNSDSTYPPKNDYDT"
     gene            <263301..>264383
                     /gene="MAG1"
                     /locus_tag="PVL30_003248"
                     /old_locus_tag="LELG_02403"
                     /db_xref="GeneID:5233051"
     mRNA            <263301..>264383
                     /gene="MAG1"
                     /locus_tag="PVL30_003248"
                     /old_locus_tag="LELG_02403"
                     /product="3-methyladenine DNA glycosylase"
                     /transcript_id="XM_001525795.2"
                     /db_xref="GeneID:5233051"
     CDS             263301..264383
                     /gene="MAG1"
                     /locus_tag="PVL30_003248"
                     /old_locus_tag="LELG_02403"
                     /note="BUSCO:EOG09264X9R"
                     /codon_start=1
                     /transl_table=12
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="XP_001525845.2"
                     /db_xref="GeneID:5233051"
                     /db_xref="PFAM:PF00730"
                     /translation="MGAITRSNKSGAKTAENTSQVYLLASDIPNDIKISSTDSKVTKP
                     KSKSNPKPSKASSSSSSSSPKKVLPKSKKSIEEFMDRENIPSDLALPQKFIDYHTPSF
                     IDGLKFCISQDPTLYPVVVCQNFEGFGSKDFDKKLQQADDDRIHFIWYSLIRSVIAQQ
                     VSGAAAKSIENKFKNLFNEGEVPTAKLTREMSSEQLKSAGISGPKVKYVEHISQVFTD
                     PSSKLCDLSFYANATVEEVYEEVCKLKGIGIWSAKMFALFTLEEMDVFAEDDLGVARG
                     MAKYLQQRPEMLSQVKSAAKGDEDKQKRLKKRSKFFNKDNSKRTWNPVHDVYVLDIAE
                     KFKPYRSAFMMILWRLSSTNIDVLEI"
     gene            complement(<264466..>265419)
                     /locus_tag="PVL30_003249"
                     /old_locus_tag="LELG_02404"
                     /db_xref="GeneID:5233552"
     mRNA            complement(<264466..>265419)
                     /locus_tag="PVL30_003249"
                     /old_locus_tag="LELG_02404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525796.2"
                     /db_xref="GeneID:5233552"
     CDS             complement(264466..265419)
                     /locus_tag="PVL30_003249"
                     /old_locus_tag="LELG_02404"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525846.2"
                     /db_xref="GeneID:5233552"
                     /translation="MFHFLQFAAGSNIIVNDKPLAGLPRTFAKYKFSRFTPYLYHSVE
                     TSVSNSNQNDKRNIQISNNYGNKVADKLSQARKESREELLSLNLCRPANQKGFEKENE
                     KTLQKEEEKDSSQFSNKYNFENEICRSVLPTPTNKHQKSHLKIAQITNFDTEATDVSL
                     SMTLHTFAISTGTSESSYSNKKLHHDISSVSNDLTKTPNLIVENKKKVPTLYSTHEEK
                     PTKFSECFLYPFAQTQTSKESLKGISVSSLGKDLDYGEREIEQELSRSKQLQAQRRAR
                     IIEIGGEGGSGLANSMARLRVNSIFMMLILVLVVLINTNVV"
     gene            <269057..>274408
                     /locus_tag="PVL30_003250"
                     /old_locus_tag="LELG_02406"
                     /db_xref="GeneID:5233581"
     mRNA            <269057..>274408
                     /locus_tag="PVL30_003250"
                     /old_locus_tag="LELG_02406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525798.2"
                     /db_xref="GeneID:5233581"
     CDS             269057..274408
                     /locus_tag="PVL30_003250"
                     /old_locus_tag="LELG_02406"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525848.2"
                     /db_xref="GeneID:5233581"
                     /translation="MISTGANTTSRRNSITSLSSLNTNNTTQSSFHNRSLTRDLSTDN
                     LLTVDSRFVRQPAKKKRLPPPPLASPLSSTFSSATAPAPAPAPTAISSPMVNGNYNAN
                     GMRSPPMANDMSFRANSMNSAVSAISANNYNHNHNKNKNKNMSKSKNLTNAAPAPALA
                     AAPAAAPTTAPNNNSFYSREGVYYFPNGEVFRPRTAPAKRNRPGKVSKDSSSSSSPSP
                     NPNAMRSPPPINTSSFTAYSPNSATSIGPNPGTITHLPSPSPTPTPSSATSATSARSI
                     HSHQYYPQQPQIRPNGSFTNIPKSVSLQNVKLQSKQNLSRSLRDNKHGDIITNIVIDD
                     PAKLPYDCYKNSNSNSSTSSFKNTGKLQCQNTTRTEQSFCNASSSMSSSESQSSHFEN
                     SINRTESNTPSTSISEDQLHQIQQQKEQEQREDEEGEQKMRIKNAKQQQNHHHQQIGN
                     ASHEVGKHATQNNNMQDQYIDSFQNSVSHPVSQIEKDSSITEKDATRFVNPETHQSAV
                     PNHASTANDQMHESNLRQISGANVEDFNTHVKIPVSSGNDYSRNYNTSTNNEMCNMHK
                     TNTATSKADSQSAGRLVESSSETTLQLNQYEQSGQSKTNGNQLEKKEEEEEEEKKEEE
                     EPLRNQNNKLADNAVLIPDEKTFHNENSLDSSISGESTIQSNTLASQSRDDLKDLGAP
                     NRFQSSASSIAPVNGAYYKSTNSSEADIFKTPVQTPEMEPSNQFETISVGIAKEKPKS
                     PITPVDQITPSTLAQGFSSNNSSETNLNLGARNSNTSRQTTPKNASVNASANVSTSTS
                     VEQFQFKPPQMHSQSSLASQANNQMQQHQQQQQPRNSPDNINKRKSQASLPEPNIDNE
                     SFVDQYLYNSPPESVSYQLNELIMTHNEPTPTQQKSSETTPVSTPQLLRHSNQESNIT
                     EQVVHANDDRLLEFLPSPTRSTPQTPRSSRYFDIDSNTIDKFVNDTQAEVPPRGDVKV
                     VTNKQKRNFHHHRQGSSVTSAGEISNSLRKSLENNSNNENSNHSSTNEAVTSTPVQDH
                     NSSKDEDLSILPPPPPIEKSPNMRVKGRSKKSKKEGTFNGNGSVSDLSIATSSIGVPT
                     SVSTPTHDVGVANVGNRNKDTSNTNANANTNTNTNFISSTPRPAPPRPTGSFANAATD
                     VENCSRKENFAQQTFKSLLLDDNDANTKTGHVAHSVPNKQLNKMPSLPNIKTRLAKKQ
                     PPPSNLSSQPSSTPPQPAHPPQAVPQQRSASQSPKKNSTLRQASASTANSAPPSAPQF
                     QQSSTRKTSSGNSNFISFFKKFAPVKDKSHMEKSSSTSSFNSSNSYMSNKSNKSQSQT
                     STTGSKFGILGRFIRGGDHSNSNLSNNQNQEQQNRMSVISDVAPSLKLGTLPDFDFEP
                     EEDAGFLDDMMLTFDEKFESELIASQPRKDLVNLTTSSTSDPFMKDDELTRAQIVDQQ
                     LMDEEDDSGGANSDDSTDHTKNVNANEGTGTMGSYYMDENIEYLRNNYVWPTLDDVTE
                     EKEPVNREHEATQTDDKIESQNEIRDGNVAGTTPPTTVDTSTRTSDDNDISTVKSPAQ
                     QLEDQDADSFKEGDETFISLDYQNNESNERGLTSPIADTVLSSSSTSALPIPSAPRTI
                     VIENDELEYIVNNLSDEEKRNLPPHLKYIKQFVDFRSITVEFNKFQDLENAPLPTSTD
                     ARNKSTSSILRRRKTLGRQGSIIGLGRSKLNGSGNNSNKTKSKKRSSGASVSFTDRIV
                     INETFSGDVYKRYNKSVTQYSLSDPREINRIKNEVNWYKCNEMLVHELSQDNTHFFY"
     gene            complement(<274805..>275245)
                     /locus_tag="PVL30_003251"
                     /old_locus_tag="LELG_02407"
                     /db_xref="GeneID:5233508"
     mRNA            complement(<274805..>275245)
                     /locus_tag="PVL30_003251"
                     /old_locus_tag="LELG_02407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525799.2"
                     /db_xref="GeneID:5233508"
     CDS             complement(274805..275245)
                     /locus_tag="PVL30_003251"
                     /old_locus_tag="LELG_02407"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525849.2"
                     /db_xref="GeneID:5233508"
                     /db_xref="PFAM:PF00576"
                     /translation="MSPQATRDPITCHILDTHRGRPASSVLVQLYNISPVTPDTFSST
                     PFAQAKTDADGRITKWNFDPDVDAKSTGVEDNKWVRVVPGDYKIKFLTGKYFAEGAGN
                     DNGDGKGRSFFPYVEVVFTVDDVNGHYHIPLLLSNYSYTTYRGS"
     gene            <276389..>277792
                     /gene="RRP8"
                     /locus_tag="PVL30_003252"
                     /old_locus_tag="LELG_02408"
                     /db_xref="GeneID:5233186"
     mRNA            <276389..>277792
                     /gene="RRP8"
                     /locus_tag="PVL30_003252"
                     /old_locus_tag="LELG_02408"
                     /product="25S rRNA (adenine645-N1)-methyltransferase"
                     /transcript_id="XM_001525800.2"
                     /db_xref="GeneID:5233186"
     CDS             276389..277792
                     /gene="RRP8"
                     /locus_tag="PVL30_003252"
                     /old_locus_tag="LELG_02408"
                     /note="BUSCO:EOG09263YBT"
                     /codon_start=1
                     /transl_table=12
                     /product="25S rRNA (adenine645-N1)-methyltransferase"
                     /protein_id="XP_001525850.2"
                     /db_xref="GeneID:5233186"
                     /db_xref="PFAM:PF05148"
                     /db_xref="PFAM:PF08241"
                     /translation="MLFEAKGWNLKNSDKIALGGAAKKKKKNTNNSNKNNSSNGKKGN
                     FTGSSITKEDVERVINPTTFDETSNKNEKSKKNEKRNEKNKSEQEQNSGNIESAKSKR
                     RENDKLDKIGKNGEASNVKSDKKRQSRDDDNDSSTKVKRSKAIQKSVNTSTTLSTTPA
                     NDSVAAPMPIPVTSQTKLTPLQQKMMSKLSGSRFRWINEQLYTITSEEALKLIKEQPS
                     LFDEYHQGFRSQVSSWPENPVDVFVNQFKQRLTTRNINAPGGLPGNQDKRIVVADMGC
                     GEAQFSADIGQFVKQLQKKGKKYRNLNVDVHSYDLKKYNERITVADIKNVPLASGSAS
                     IVIFCLALMGTNFLDFIKEAYRILQPRGELWIAEIKSRFTDGGPERAENVGSEFVEAL
                     KLNGFFHKSTDNSNKMFTRFEFFKPPQDIIDERRAKLERKRKFIEEESEKEKLESKRE
                     KRPEGEWLLKPCIYKRR"
     gene            <279729..>282257
                     /gene="DSE1"
                     /locus_tag="PVL30_003253"
                     /old_locus_tag="LELG_02409"
                     /db_xref="GeneID:5232911"
     mRNA            <279729..>282257
                     /gene="DSE1"
                     /locus_tag="PVL30_003253"
                     /old_locus_tag="LELG_02409"
                     /product="daughter-specific expression- protein"
                     /transcript_id="XM_001525801.2"
                     /db_xref="GeneID:5232911"
     CDS             279729..282257
                     /gene="DSE1"
                     /locus_tag="PVL30_003253"
                     /old_locus_tag="LELG_02409"
                     /codon_start=1
                     /transl_table=12
                     /product="daughter-specific expression- protein"
                     /protein_id="XP_001525851.2"
                     /db_xref="GeneID:5232911"
                     /translation="MTDFYEPTLLFRQNAIRHSGTKRFNPSLSPISSVESLMSTLDHS
                     ENSMSSVENTSPSSSFYKHSGNSASSRSSWLLNLNNPKDTEALNKICAINRTNIKSNY
                     WKIPDDDMNLTSMCIKSSSHGNAGIDTLASANENTLLAISSGNRENNLFIYELNVTSN
                     HLIHHSTISLPNINTMKWVNTSNSNSNLNDNNTPEMEKNYIVTGNNKGYAHLVLLPEI
                     TTHEPNPDEELASAEICKRFNHRKYIKRRSQNTSQDDDYYVGLNSPITNLDLFNSNKE
                     MVSIYNDYLFHWDMQNAESQQRPTPLSYTKISGICDFDTLQNNNTTLSICGKFGLSLF
                     DTRTAKFSIPMSPVSLSGTATATATATAKNIKNYRQLSANIIKWNPLNTNILAAGHGD
                     GVVRLWDIRKQDYFATLNCHSTNASNTGFSSRFGNVLKVTSLEWSQGDLITGGQNGDI
                     IHWDLTSDINLDQVGHLNCGLRQGWDSVKRGNVSSNPSAEASVDVNQRQCGTILPASN
                     SNIASMCSLAVGDKDGEEDVKILSIDGSSFLGVHSRVKEAVKLDIDDSKMYYTQQDLD
                     SLLREIEAANDKLDINLSSNSDSEIRSSSASSSFVSLSDSEKPLVISRKPSMNKPLVS
                     SEANTRIFSINSTSGSGSETEVEEVFDYKDSGNYGKEEEEEQEEEQEVADEFKYPPDI
                     STPSPKFNHDSIEVMSLDDFDFSSLSFDSPGNDFSGSGLGSCFDANAGSGSDVSTRGS
                     PNNNYASPLGSVDTLSTMATVVEHIPHEHKSDKSDNSHNSHKRGVYGLCQGQDHSGAD
                     KNDDTILDVSIGIRRTSSGSHFRKSSYMDVFSSLDHFDFSHQLS"
     gene            <283670..>286147
                     /gene="RSP5"
                     /locus_tag="PVL30_003254"
                     /old_locus_tag="LELG_02410"
                     /db_xref="GeneID:5233303"
     mRNA            <283670..>286147
                     /gene="RSP5"
                     /locus_tag="PVL30_003254"
                     /old_locus_tag="LELG_02410"
                     /product="NEDD4 E3 ubiquitin-protein ligase"
                     /transcript_id="XM_001525802.2"
                     /db_xref="GeneID:5233303"
     CDS             283670..286147
                     /gene="RSP5"
                     /locus_tag="PVL30_003254"
                     /old_locus_tag="LELG_02410"
                     /codon_start=1
                     /transl_table=12
                     /product="NEDD4 E3 ubiquitin-protein ligase"
                     /protein_id="XP_001525852.2"
                     /db_xref="GeneID:5233303"
                     /db_xref="PFAM:PF00168"
                     /db_xref="PFAM:PF00397"
                     /db_xref="PFAM:PF00632"
                     /translation="MTRNTSTISVKVVAAESLYKRDVFRQPDPFAVITVDGSQTKTTK
                     TAKKTLNPYWNETFNFQALEDSILVIQVFDQKKFKKKDQGFLGVVNIRIGDVINFGLN
                     SSEETITRDLKKSMENVAISGKIIVVISHNSGSGSNSGNGNGHSSSRAASSSTASHSA
                     SNGRRSLPPASSTTTSTSSTVAVGGGGGGASTATNGTASATGTGTSNGHAHGSAPSAA
                     DPGSTATAAAHRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNSRTTTWQRPALDQS
                     ETERGQQRQDTTEAERRQHRGRTLPGEQPSTPGGSSVTSGNVTVNATGANSPVNPAAA
                     VSMAASGATTSGLGELPSGWEQRFTNEGRPYFVDHNTRTTTWVDPRRQQYIRTFGPNT
                     TIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRD
                     FRRKVIYFRSQPALRILPGQCHIKVRRDHIFEDSYQEIMRQTPEDLKKRLMIKFDGEE
                     GLDYGGVSREFFFLLSHDMFNPFYCLFEYSSHDNYTLQINPNSGINPEHLNYFKFIGR
                     VVGLGVFHRRFLDAFFVGALYKMMLHKKPMLQDMEGVDAEFYRSLKWILDNDITDILD
                     LTFSTEEEKFGERVEVDLKPNGKDIEVTEDNKQEYVELITEWRISKRVEEQFRAFIDG
                     FNELIPQDLVNVFDERELELLIGGLAEIDVEDWKKHTDYRGYQESDQVIQWFWKCINE
                     WDSEQKARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEPNQLPKSHTCFNRVD
                     LPPYADYASLKQKLSLAVEETVGFGQE"
     gene            <287454..>288272
                     /locus_tag="PVL30_003255"
                     /old_locus_tag="LELG_02411"
                     /db_xref="GeneID:5233250"
     mRNA            <287454..>288272
                     /locus_tag="PVL30_003255"
                     /old_locus_tag="LELG_02411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525803.2"
                     /db_xref="GeneID:5233250"
     CDS             287454..288272
                     /locus_tag="PVL30_003255"
                     /old_locus_tag="LELG_02411"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525853.2"
                     /db_xref="GeneID:5233250"
                     /db_xref="PFAM:PF03061"
                     /translation="MTREFSPILVASDASNESEEGKNSATVSNTSTQTSSVQKAINTI
                     DEDHSPIHDMLELQLASFPLYKTHQDEHKLFSAENPEVNNIKERLFPHLTGLTLFGKD
                     KIEYRSPTLYFISDEYLTNPPNEIQGAPSTIESNGSTPESTSSRPQSNFSITYLHLGD
                     QLSGHRGIIHGGLLATLLDEITCRLAFLSFPSRRGVTANLNINYKKPTLVNNWICIKC
                     QVVKKQGRKCWVKGEVFGVDEKTKELNEEDIRCWCEILIVEPRWVEELKNGEGN"
     gene            complement(<289409..>291514)
                     /locus_tag="PVL30_003256"
                     /old_locus_tag="LELG_02412"
                     /db_xref="GeneID:5233423"
     mRNA            complement(<289409..>291514)
                     /locus_tag="PVL30_003256"
                     /old_locus_tag="LELG_02412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525804.2"
                     /db_xref="GeneID:5233423"
     CDS             complement(289409..291514)
                     /locus_tag="PVL30_003256"
                     /old_locus_tag="LELG_02412"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525854.2"
                     /db_xref="GeneID:5233423"
                     /db_xref="PFAM:PF13537"
                     /translation="MCGILLRVSKEPIKKPLCIPQPIQTSQGSSDLSSEIWDTTDPDV
                     IKTFLQQGEKLRPLSPQQVRKLNSLDELRDLTKQLAKVKNNVKLSQEVKEDQVRNIQD
                     QIDDISREDEDNYDDKNHHHTDVNKHGSKNKEEKEDREDKEMESLIYKTSNRGPNYLN
                     YTQFKIDDNYYFQSFSAILSLRQPFTKQPIFKDEFVLQFNGELYNSECLETNDTQYII
                     DLLHSKIKSNKDRKSAILNTLKELSGEWAIILVDLRECRVYFGRDPIGKRSLCYKVSY
                     DSNRIKEGQQQQQQQQQQQQQQEEENEKEGIEIIISSNSGIGFLECKNEIYEYSLAHN
                     SKGLISHKLKEVARPTFELPDERVVLAELKKQLRAATKIRQDSIHPLTHLPNESALAV
                     LFSGGLDCTIVARLICELINNSNGHTSLDLLTVGFENPRTLQAADSGPDRKLAIKSWF
                     HLCHMFPKLKINLVEINVDYQSWLSHKSRVKELMYPCNTEMDLSIAIAFYFASSILPD
                     LTSAKCLANDNVSWEEFVNNQEKYTIKQEKYLSSAKVMFSGLGADELFAGYSRHEGIF
                     NNINVDNISGDESNYIELAESLNYDIEIIHQRNLGRDDRVMSCWGKELRYPYLDEDFI
                     SWVISTIPPNMKFKYSFAKDKKGKNRLVPIRKYILRKLAEELGMSWVSQELKRAIQFG
                     AKSAKLEIGQSKSKGTDSL"
     gene            complement(<291982..>293244)
                     /locus_tag="PVL30_003257"
                     /old_locus_tag="LELG_02413"
                     /db_xref="GeneID:5233237"
     mRNA            complement(<291982..>293244)
                     /locus_tag="PVL30_003257"
                     /old_locus_tag="LELG_02413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525805.2"
                     /db_xref="GeneID:5233237"
     CDS             complement(291982..293244)
                     /locus_tag="PVL30_003257"
                     /old_locus_tag="LELG_02413"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525855.2"
                     /db_xref="GeneID:5233237"
                     /translation="MVLPSSTQPHVSNDPNIKETKTTSNKSEIHLAKGEHRFKSWLKK
                     GVVERPVNNLPSTEPNPDPAKEDVTDKSMRIKEEREAKDENDERERQMDKTDSKAQIA
                     PLNVKKRSNWFRKSRSSTNVPSDSNTLPLTSTSNPTFEKEKDSIVERTTLQTVPRSRS
                     WFSNTWNKSTTILTQVNSSSSEDSEPVELLSTESANNLSSIDTLIKRLEEDENIPIVI
                     GNYFGEPIFKKNIFESTIFQAQLGKFYSFDKFDEAAYFSWNIWNIDECGKKKITRFIE
                     CKSDFVDFFRHFNYEKVFIMRTSLVPNYNSFHNGYLVKLKLLHGRTITNAELGLYLFM
                     KCCKNSILNNVPHIALNINVCGYTYTRRKSMTSITLWIHPILSMSFDITNQVKLLIQS
                     LNFGIKLNKITLVDINNNSKTLINPKVD"
     gene            <294043..>294810
                     /locus_tag="PVL30_003258"
                     /old_locus_tag="LELG_02414"
                     /db_xref="GeneID:5233578"
     mRNA            <294043..>294810
                     /locus_tag="PVL30_003258"
                     /old_locus_tag="LELG_02414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525806.2"
                     /db_xref="GeneID:5233578"
     CDS             294043..294810
                     /locus_tag="PVL30_003258"
                     /old_locus_tag="LELG_02414"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525856.2"
                     /db_xref="GeneID:5233578"
                     /db_xref="PFAM:PF01713"
                     /db_xref="PFAM:PF08590"
                     /translation="MTDVLDRGVKLSNDNERDYNHATDSEYKRLRAKADEYYKKRNAL
                     SQQSQAAYKQKDGQRAHELSEESKKALAQAEQYSQQAAEYVFRENNADSAADEIDLHG
                     LYVKEAEWILKVRLKQAISTNQSHLKVIVGKGLHSQNGIAKLKPAVDQLCDETRLKHY
                     IDPKNSGVMIIELNGEDASNIPTGWGSGTITQPQQAYHGNNQPHYQQQHQQQQQQQQS
                     QYQQQHHQNQNQNQNFKTGNQLLDLLLKGLCMCINSK"
     gene            complement(<295017..>295661)
                     /gene="YPT7"
                     /locus_tag="PVL30_003259"
                     /old_locus_tag="LELG_02415"
                     /db_xref="GeneID:5233448"
     mRNA            complement(<295017..>295661)
                     /gene="YPT7"
                     /locus_tag="PVL30_003259"
                     /old_locus_tag="LELG_02415"
                     /product="Rab GTPase ypt7"
                     /transcript_id="XM_001525807.1"
                     /db_xref="GeneID:5233448"
     CDS             complement(295017..295661)
                     /gene="YPT7"
                     /locus_tag="PVL30_003259"
                     /old_locus_tag="LELG_02415"
                     /codon_start=1
                     /transl_table=12
                     /product="Rab GTPase ypt7"
                     /protein_id="XP_001525857.2"
                     /db_xref="GeneID:5233448"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /translation="MSSRKKTLLKVIILGDSGVGKTSLMQQFVNNKFSQQYKATIGAD
                     FLTKEIPIDNNKSVTLQIWDTAGQERFQSLGVAFYRGADCCVLCFDVTNEKSLNNLTS
                     WKDEFLVQSNVSNPQDFPFIIIGNKIDVDDSKKIPSLQKKLHNITHNQLGGLNYPVFE
                     TSAKDSVNVEAAFEVVAKMALQQEELNAANADLNDNYNDAINIHLESESSTCGC"
     gene            <296350..>296871
                     /locus_tag="PVL30_003260"
                     /old_locus_tag="LELG_02416"
                     /db_xref="GeneID:5233381"
     mRNA            <296350..>296871
                     /locus_tag="PVL30_003260"
                     /old_locus_tag="LELG_02416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525808.2"
                     /db_xref="GeneID:5233381"
     CDS             296350..296871
                     /locus_tag="PVL30_003260"
                     /old_locus_tag="LELG_02416"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525858.2"
                     /db_xref="GeneID:5233381"
                     /translation="MSNLTSAIQLTKESKYKLNNGLYIPVAGFGTYLIDNKKTSDLVY
                     QALKDGYRHIDTAIVYKNQGEAAQGVAKFLKDYPDVKREDIWFTTKIGNNNQGYEETK
                     KAVELISQEVKQYIDYVDLILIHSPKTSKEKRLGTYKALQEFVANPNNDTLNVHSIGV
                     SNYGVDHLEELFN"
     gene            <296873..>297315
                     /locus_tag="PVL30_003261"
                     /db_xref="GeneID:85890357"
     mRNA            join(<296873..296903,296936..>297315)
                     /locus_tag="PVL30_003261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119457.1"
                     /db_xref="GeneID:85890357"
     CDS             join(296873..296903,296936..297315)
                     /locus_tag="PVL30_003261"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975440.1"
                     /db_xref="GeneID:85890357"
                     /translation="MVYWSIQSLIKLRKYLYEHDILVEAYSPLTQGQKLKDPWLLDLA
                     KKYNISPIELLLKWSYLQGFIVLVKTENPKRIKENLDILPEAVKENDGLEETVRLGKI
                     DLDVDLLEALNKPDSKEVLTWGGVDPTLYKDGDA"
     gene            <298191..>299624
                     /gene="SUB8_1"
                     /locus_tag="PVL30_003262"
                     /old_locus_tag="LELG_02417"
                     /db_xref="GeneID:5233610"
     mRNA            <298191..>299624
                     /gene="SUB8_1"
                     /locus_tag="PVL30_003262"
                     /old_locus_tag="LELG_02417"
                     /product="serine protease"
                     /transcript_id="XM_001525809.2"
                     /db_xref="GeneID:5233610"
     CDS             298191..299624
                     /gene="SUB8_1"
                     /locus_tag="PVL30_003262"
                     /old_locus_tag="LELG_02417"
                     /note="MEROPS:MER0000356"
                     /codon_start=1
                     /transl_table=12
                     /product="serine protease"
                     /protein_id="XP_001525859.2"
                     /db_xref="GeneID:5233610"
                     /db_xref="PFAM:PF00082"
                     /db_xref="PFAM:PF05922"
                     /translation="MLPTSAVYTTFLLFATASHALLLPGFDSLFSLINYLPFQSNNKQ
                     TYLKQDEVNYEEYKAKLISNKFKKIVPDHYIVVLKDGLSKSTLMQHTNWVSNEYATMM
                     TAATESAGVFSNSKPQLMKALEFFQVDNFISGYMGYFTKDMIQRVMQNPDVDFVEEDS
                     IFKVNEFDVQKNAPWGISRISRRENLTGGGGADSDSKYLFDNEGGKGVVAYVVDTGIM
                     VEHEDFEGRAVWGEAVAFPKIKKDGNGHGTHCAGIIGSKTYGIAKSVDLVAVGVMNLL
                     GAGSTSDILKGIEYVVNQHQNDVRTKKKGFKGSVINMSLGGGASDALDLAVNAAVRAG
                     VHVAVAAGNDNADACDYSPAKADGPITVGASSIVDARASFSNWGTCVDIIAPGENIDS
                     TYIWSDHTAMSGTSMAAPHVAGLLSYYLSLQPEQTSEYYTLVEPADLKKRLLKYGTKG
                     VLTDVQGSPNILAYNGAGGNLTEFWSN"
     gene            complement(<300069..>300794)
                     /gene="ATP23"
                     /locus_tag="PVL30_003263"
                     /old_locus_tag="LELG_02418"
                     /db_xref="GeneID:5233285"
     mRNA            complement(<300069..>300794)
                     /gene="ATP23"
                     /locus_tag="PVL30_003263"
                     /old_locus_tag="LELG_02418"
                     /product="Mitochondrial inner membrane protease atp23"
                     /transcript_id="XM_001525810.2"
                     /db_xref="GeneID:5233285"
     CDS             complement(300069..300794)
                     /gene="ATP23"
                     /locus_tag="PVL30_003263"
                     /old_locus_tag="LELG_02418"
                     /note="BUSCO:EOG09264RBX; MEROPS:MER0127117"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial inner membrane protease atp23"
                     /protein_id="XP_001525860.2"
                     /db_xref="GeneID:5233285"
                     /db_xref="PFAM:PF09768"
                     /translation="MSSSTQPAQTSASPSKITLSADSQLNGFEWWRRSLQYQTGLGLT
                     PSEKAQYEYDYFHRNLDEKCDTCKDHLKWVLAYSPSVRFMMDHIQKLNKSNEPVPRNK
                     IVCQTCDFTKGGGFDPNHGIVLCSNYIRSKWQLEDILAHELVHVYDYMKFNVNMSDLR
                     QHACTEIRASMLSGECRVWNEMKKTGMGNFGKKFQECIRRRAVLSVEANPVCKSREEA
                     EKAVDVVWKSCFNDTRPFERVYR"
     gene            <301959..>302852
                     /gene="SPE3"
                     /locus_tag="PVL30_003264"
                     /old_locus_tag="LELG_02419"
                     /db_xref="GeneID:5233225"
     mRNA            <301959..>302852
                     /gene="SPE3"
                     /locus_tag="PVL30_003264"
                     /old_locus_tag="LELG_02419"
                     /product="putrescine aminopropyltransferase"
                     /transcript_id="XM_001525811.2"
                     /db_xref="GeneID:5233225"
     CDS             301959..302852
                     /gene="SPE3"
                     /locus_tag="PVL30_003264"
                     /old_locus_tag="LELG_02419"
                     /codon_start=1
                     /transl_table=12
                     /product="putrescine aminopropyltransferase"
                     /protein_id="XP_001525861.1"
                     /db_xref="GeneID:5233225"
                     /db_xref="PFAM:PF01564"
                     /db_xref="PFAM:PF17284"
                     /translation="MAQELSHPSIQDGWFAEKSATMWPGQAMSLEVDKVLHVEKSKYQ
                     DVLVFKSKTYGNVLVLDNCIQVTERDEFSYQEMITHLAMNSHPNPKKALVIGGGDGGV
                     LREILKHSSIEEAWLCDIDETVIEVSKKYLPDMAVSYQDPRTKVHIGDGFKFLEEYKN
                     QFDVIITDSSDPEGPAESLFQKPYFELLKNALTEKGVITTQAENMWIHMDIISKLKKD
                     CSDIFPVVEYAYTMIPTYPSGSIGFMVCSKDANANVKKPLRFEWDDEFVAKNLKYYNK
                     QIHEAAFVLPNWADQKLNKNL"
     gene            <303712..>304779
                     /gene="AAH1"
                     /locus_tag="PVL30_003265"
                     /old_locus_tag="LELG_02420"
                     /db_xref="GeneID:5233409"
     mRNA            <303712..>304779
                     /gene="AAH1"
                     /locus_tag="PVL30_003265"
                     /old_locus_tag="LELG_02420"
                     /product="adenine deaminase"
                     /transcript_id="XM_001525812.2"
                     /db_xref="GeneID:5233409"
     CDS             303712..304779
                     /gene="AAH1"
                     /locus_tag="PVL30_003265"
                     /old_locus_tag="LELG_02420"
                     /codon_start=1
                     /transl_table=12
                     /product="adenine deaminase"
                     /protein_id="XP_001525862.2"
                     /db_xref="GeneID:5233409"
                     /db_xref="PFAM:PF00962"
                     /translation="MTRFDCNEHMTSFLRELPKCEHHVHLEGTLEPDLLFKLAKRNKI
                     TLPDSFPKSVEDCITRYNNFADLQDFLDHYYIGMSVLITEDDFYDLAMAYFEKAHSDG
                     CLHSEVFFDPQGHLERGIDMDAVVHGFNRACKYATEKFGTTNKLIMCLLRHLPSEDGL
                     KTIELASKHYEKGTIHGLGLDSSEKPFPPELFAECYKTLKEKFPDVGLTAHAGEEGDY
                     TYINGALNSLNTTRIDHGVNAQQNEALMKHLSENQIMLSLCPLSNVKLQVVKDVAELP
                     IDLYFEQNIPFSLNSDDPAYFGGYILDNYIAVHTRFGFGLEQWRQISLNGINGSWCTE
                     QRKNELKKLVDDVCDKYRPLL"
     gene            complement(<305421..>306740)
                     /locus_tag="PVL30_003266"
                     /old_locus_tag="LELG_02421"
                     /db_xref="GeneID:5233417"
     mRNA            complement(<305421..>306740)
                     /locus_tag="PVL30_003266"
                     /old_locus_tag="LELG_02421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525813.2"
                     /db_xref="GeneID:5233417"
     CDS             complement(305421..306740)
                     /locus_tag="PVL30_003266"
                     /old_locus_tag="LELG_02421"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525863.2"
                     /db_xref="GeneID:5233417"
                     /translation="MKMEHHILKYSMEVSMFIEDDAFLQSQNITFFNYRSKNIHEIAN
                     LVSLIAKYRNQITQLKSYEHIFRVFETIHILVAAQFTEMKLLAKTKEISNGDSLVARS
                     LLNVFILHHSIDLTVEKIIQQYYKLREIKHYLTKDTVDRSFENFSNFCFPQAKDSIEY
                     YKRIITKCSKQYSPNEEAQLFGLYLLKSTIHINIDQPKYESMKNSILQKILDNEEDTS
                     SGSFTEQELVSIDLMEYLTAHIDFFPRVLLIFDKFQSVTCKCLQLHRRRLSGQNNENR
                     NFSNNGTFVTTSDRYSLSKKLTPAINRAIDKYVKGGTIGLAKTECCRYTFRLLLFCGG
                     QIAFEFKTIEANLISTTSSYEEKSFLSDILNTFQTYAESLSGFLTFLSEPLKGKGNAI
                     AIMGTHRDEFEKLDELLKQSFLYVLECETSLDLEEEMISLKTSRLSR"
     gene            <309532..>310554
                     /locus_tag="PVL30_003267"
                     /old_locus_tag="LELG_02422"
                     /db_xref="GeneID:5233156"
     mRNA            <309532..>310554
                     /locus_tag="PVL30_003267"
                     /old_locus_tag="LELG_02422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525814.2"
                     /db_xref="GeneID:5233156"
     CDS             309532..310554
                     /locus_tag="PVL30_003267"
                     /old_locus_tag="LELG_02422"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525864.2"
                     /db_xref="GeneID:5233156"
                     /db_xref="PFAM:PF13928"
                     /translation="MKLSTFTNAAVVAILASNNVVEAGKIIPSIKSKIKSKLLPQQPE
                     ETSECPDFEETSLESVITTTIVETSEDCTTTEVETSEECTFESTEKSSEEHTWKPTWK
                     PTWTPSWITKPTHKPKESTSTITEVETTVITVISCEEESCASIVKTTGVTTVTEEHTV
                     YTTFCPIPETKPVPEEETTTIRSEITVSTTICPPTETPEVSEVPIVPETSEVPIVPET
                     SEVPKVPEVSEVPKVPETSEVPKVSKPSTEVAPPTIEKPKISAPTSETLPRVSITVPV
                     SVSKPPPEASKPTPEASKPATKAPAPSAPIPASNITRPTSIYEGAGSFVNPASALVVA
                     ALIYFM"
     gene            <312589..>314325
                     /gene="LEU4_3"
                     /locus_tag="PVL30_003268"
                     /old_locus_tag="LELG_02424"
                     /db_xref="GeneID:5232999"
     mRNA            <312589..>314325
                     /gene="LEU4_3"
                     /locus_tag="PVL30_003268"
                     /old_locus_tag="LELG_02424"
                     /product="2-isopropylmalate synthase
                     (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase)"
                     /transcript_id="XM_001525816.2"
                     /db_xref="GeneID:5232999"
     CDS             312589..314325
                     /gene="LEU4_3"
                     /locus_tag="PVL30_003268"
                     /old_locus_tag="LELG_02424"
                     /codon_start=1
                     /transl_table=12
                     /product="2-isopropylmalate synthase
                     (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase)"
                     /protein_id="XP_001525866.2"
                     /db_xref="GeneID:5232999"
                     /db_xref="PFAM:PF00682"
                     /db_xref="PFAM:PF08502"
                     /translation="MPMLENPSVKYKKFPPVNLPNRQWPSRTLDKAPRWLSTDLRDGN
                     QSLPDPMSISEKKEYFKKLVDIGFKEIEVSFPSASQIDFDFTRFAVETAPADVSIQVL
                     SPCREELIKRTVESLKGAKKATVHIYLATSDCFRNVVFGLSKEESKALAVKCAKLVRQ
                     LTKDDPSTAGTDWDFEFSPETFSDTDLDYAVEVCEAVKQVWEPSKEKPIIFNLPATVE
                     MATPNVYADQIEYFSTHISNRETVCISLHPHNDRGCSVAAAELGQLAGADRVEGCLFG
                     NGERTGNVDLVTLALNLYTQGVPPHLDFSDITSVIDVVERCNKIPVHARAPYGGSLVV
                     CAFSGSHQDAIKKGFADYENKKKKQSTDGKSVHWQLPYLPLDPADIGRTYEAIIRVNS
                     QSGKGGSAWVILRNLELDLPRGLQIAFSKIVQQRAEVKGQELTNEELCDLFKQEYFID
                     YDEDSTESPDQVFKLVDYSISSPSKGIKEIEAELSVNGKSVKIKGQGNGQLSAFNDAI
                     AKHLNVDIDVKHYHEHSLGDDSQARAATYIEVLVNKKTTRWGVGINTDVSQASFLSLI
                     SILNGLKRSKDI"
     gene            complement(<314662..>316374)
                     /locus_tag="PVL30_003269"
                     /old_locus_tag="LELG_02425"
                     /db_xref="GeneID:5232885"
     mRNA            complement(<314662..>316374)
                     /locus_tag="PVL30_003269"
                     /old_locus_tag="LELG_02425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525817.2"
                     /db_xref="GeneID:5232885"
     CDS             complement(314662..316374)
                     /locus_tag="PVL30_003269"
                     /old_locus_tag="LELG_02425"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525867.2"
                     /db_xref="GeneID:5232885"
                     /db_xref="PFAM:PF13928"
                     /translation="MRLSSVIASSVALLASTAAAKDVACLVDGQTVAVVDLDTGVCPF
                     TIPSQFPAPIFDFTSTSDYDILFYYSLLNDARYFTDIVNAGNIISIPAVALYGQSGAP
                     LYQVHVNEEPASNSTAAIKKRLMMLRGLDISNNKNQDKAKRDAASDFAESLKTLDGTF
                     LENSVFEVVDINPSSGASSIPSTESSGAAATETEDESSAPLTIHSTTVSTETVDCSTS
                     TFTTTDAEGNPSTGTTTVSQSTGAGAGAGEGKTVTEDLTTVVTITSCHDDLCHLTTVP
                     GTQTVTTATVHGVETIYTTYCPLSDVETVESTKVITITSCHDNACHTSAVEATPAWTT
                     ETVGGTVTEYITYCPLTAGGKTVPAPAPTTVTKTLTGGEAGEGPVTVTIIEGGEAVTQ
                     GQVGTHVVPTGTTTWTEGASVYTSTVYETVEYTYGTQSTGAAAAATTTEGAAGKAGET
                     TTATTTEGAAGKAGETTTATTTEGAAGKAGETTVAAESQAAAAGTTTTGAAAPAGAAS
                     GAASGAAGASGETTVAVISTVAAESSSPSGAASTAINTYEGAASTTKATFFALAVAFV
                     AAHL"
     gene            <326746..>328890
                     /locus_tag="PVL30_003270"
                     /old_locus_tag="LELG_02426"
                     /db_xref="GeneID:5233046"
     mRNA            <326746..>328890
                     /locus_tag="PVL30_003270"
                     /old_locus_tag="LELG_02426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525818.1"
                     /db_xref="GeneID:5233046"
     CDS             326746..328890
                     /locus_tag="PVL30_003270"
                     /old_locus_tag="LELG_02426"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525868.2"
                     /db_xref="GeneID:5233046"
                     /db_xref="PFAM:PF13928"
                     /translation="MKLLHAIIAAICISTSTATTLSSDTAATPEIVYVTMKNVMTEVV
                     TETECNKSDCTKSTAVPSATNESPSVVYVTMKNVMTEVVTETECNKSDCTKSTTVPSA
                     TNESPSVVYVTMKNVMTEVITETECNKSDCTKASSSAEGNVDAEITGSDVRSILSTSI
                     TSDAAATTDPQVVYVTMKNVKTEVITETECNKGTCTRITDTTKEAIQSSATDAYPQIV
                     YVTMKNITTAVITEVVCNKSTCTLVTSESILPSSTKSVPSIVYVTMKNIKTEVITETV
                     CNKSTCTKVTQTTGVSTVTDNSSTYTTYVPLTTSVLSTSVKSSSTVAKSTTSKTPTSP
                     SSSLFTTVAALESTSTVKLTTEKSTSVLSTSITSDASASQTTNLSTSILKSVDTNPPY
                     VISSVPSSTSSVEASTEYSSYPTSIKSNPFTTVVDEAVVKEIETTIITITSCSENSCS
                     KTIQTTGLTTVTVGSIIYTTYCPLTTEAPEKTTTATAAAAPSSNSSSTTTTTTKTSSS
                     SASLSKVTTTVSTIKGSSLPAKSSTTSISSSKSSSANNVSRTTSIMSTSVTPIATSMT
                     TQYVGKKSSKEDTTTTTSTIDITIFVTSSCSEEHCLPMTLSSVVEVLTKGDSTIISYA
                     PIPTAEPVRSVANQVVNEQVQSQSNLNPVVAPSNQVIDLVQQQPSVAEQAVSQSTTTV
                     GTTPQEVSEYTGSAIKFSPSYAFVFVAAIAYL"
     gene            <329689..>330771
                     /gene="GTR1"
                     /locus_tag="PVL30_003271"
                     /old_locus_tag="LELG_02427"
                     /db_xref="GeneID:5233026"
     mRNA            <329689..>330771
                     /gene="GTR1"
                     /locus_tag="PVL30_003271"
                     /old_locus_tag="LELG_02427"
                     /product="GTP-binding protein gtr1"
                     /transcript_id="XM_001525819.1"
                     /db_xref="GeneID:5233026"
     CDS             329689..330771
                     /gene="GTR1"
                     /locus_tag="PVL30_003271"
                     /old_locus_tag="LELG_02427"
                     /note="BUSCO:EOG09264IV9"
                     /codon_start=1
                     /transl_table=12
                     /product="GTP-binding protein gtr1"
                     /protein_id="XP_001525869.2"
                     /db_xref="GeneID:5233026"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /translation="MSNASRKKLLLMGHSGSGKSSMRSIIFSNYSAFDTRRLGATMDV
                     ELSHLRFLGNLSLTLWDCGGQDVFMENYFSSQKDHIFKMVQVLIHVFDVESKSINKDI
                     EIFVKSLTNLQKYSPDAKVFVLLHKMDLVQIDKRQELFAIMMDKLQKISNPYQFKLTG
                     FPTSIWDESLYKAWSQIVCSLIPNINLFNSNLIKFNEILDAEEIILFEKTTFLVISST
                     ASIKQQEQLQLQSNQQQSNQGDRKTVGDSSRQSLLRETSTQNDVANEELDPKRFEKIS
                     NIIKTYKQSISKLRTNFTNLIIRGSNGTTFYLDILTENMFIMIVLKNQNEVSANGIKT
                     NQNEELLVLDNIKAARKWFEKIENSK"
     gene            <331354..>332703
                     /gene="ERG9"
                     /locus_tag="PVL30_003272"
                     /old_locus_tag="LELG_02428"
                     /db_xref="GeneID:5233446"
     mRNA            <331354..>332703
                     /gene="ERG9"
                     /locus_tag="PVL30_003272"
                     /old_locus_tag="LELG_02428"
                     /product="bifunctional farnesyl-diphosphate
                     farnesyltransferase/squalene synthase"
                     /transcript_id="XM_001525820.2"
                     /db_xref="GeneID:5233446"
     CDS             331354..332703
                     /gene="ERG9"
                     /locus_tag="PVL30_003272"
                     /old_locus_tag="LELG_02428"
                     /note="BUSCO:EOG09262HA6"
                     /codon_start=1
                     /transl_table=12
                     /product="bifunctional farnesyl-diphosphate
                     farnesyltransferase/squalene synthase"
                     /protein_id="XP_001525870.2"
                     /db_xref="GeneID:5233446"
                     /db_xref="PFAM:PF00494"
                     /translation="MGKVVQLLTHPTELLAAIKFFGFRQSLHSSTSSQANSDELKRCY
                     ELLHLTSRSFAAVIEELHPELRDAIMIFYLVLRALDTVEDDMTIDPETKIPLLRHFDE
                     KLDTKNWTFNGSGPNEKDRAVLVEFDVILKIYHELKPQYQEIIKDITYKMGNGMADYI
                     LDENFNLNGVGSVEDYDLYCHYVAGLVGEGLTKLMVLAKFSDKSLAEDKFVKSNSMGL
                     FLQKTNIIRDYHEDLQDGRSFWPKDIWSKYTDSLPSFHKDASHEDKGLACINELVLNA
                     LGHVKHVLEFLSLVKDPSTFSFCAIPQVMAIATLAEVYNNPKVLHGVVKIRKGTTCKL
                     ILESRTFPGVVRIFRKYIQVINHKSSVRDPNYLKIGIKCGEIEQFCESLYPSLHALPK
                     GAKLPEGRLTKALKSRKEIDESVQKIIDQENFNANFVFGFVAVLFIGLILFITGYKL"
     gene            <333383..>334476
                     /locus_tag="PVL30_003273"
                     /old_locus_tag="LELG_02429"
                     /db_xref="GeneID:5232951"
     mRNA            join(<333383..334296,334353..>334476)
                     /locus_tag="PVL30_003273"
                     /old_locus_tag="LELG_02429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119458.1"
                     /db_xref="GeneID:5232951"
     CDS             join(333383..334296,334353..334476)
                     /locus_tag="PVL30_003273"
                     /old_locus_tag="LELG_02429"
                     /note="MEROPS:MER0902165"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975441.1"
                     /db_xref="GeneID:5232951"
                     /db_xref="PFAM:PF04424"
                     /translation="MSPLGSSQTINGSIKFPIKLINWTPHYAINESISTPILLQDQNG
                     PCPLIALVNTLLLQNDFNDLLASQIRQGKRKISEPAGAFVVNNLKHELRKKYESTGNI
                     SLVDVLSLLGDLLLTLVENGSTDLDSGVVDELLAQLPKLHTGLNVDPNLLTGGFAPSL
                     ATELFDAFGLDFRHGWVVETSDNVGTSGQMVQKVEQNSCSDNDNSENSENPEDSGLLN
                     IVRQLETYDRVQDYLLSDQENVGYLENKQLLTTWLNENQTQLTRQGLFNLNSVMEEGK
                     FVIFFRNNHFNTLFRKGDEEFYLLVTDSSLWAGRSCFTGDFSPILDIEQDLPRGDNVD
                     DRGEYYISGTR"
     gene            complement(<334895..>336370)
                     /locus_tag="PVL30_003274"
                     /old_locus_tag="LELG_02430"
                     /db_xref="GeneID:5233234"
     mRNA            complement(<334895..>336370)
                     /locus_tag="PVL30_003274"
                     /old_locus_tag="LELG_02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525822.1"
                     /db_xref="GeneID:5233234"
     CDS             complement(334895..336370)
                     /locus_tag="PVL30_003274"
                     /old_locus_tag="LELG_02430"
                     /note="BUSCO:EOG09264331"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525872.2"
                     /db_xref="GeneID:5233234"
                     /db_xref="PFAM:PF03985"
                     /translation="MSHKPVRQDYIAKIRYTNNLPPPPLNPKYIEYNTTNPISPKVEA
                     EQLLSSLFRKENFQNLLGRIDDFSGLELNLLNNAGFFAGDSTVVGQLSKNGQPVHLHP
                     KDRALLRDAGIGKINKSEPGVSFLRRTEYISERSLPKAAHSVTAHTEEVKVNEKLKNN
                     ESHSLDADAQLNAVEETFTAANSTLSDVSSLKHPRKRHLKAVDAWPLLPDTQMMDNVL
                     MNLRFLGSASIDRELKDLKRKRGTAFNEKFERQKQESSIFKPINSEDGEWMSMFEVND
                     ISQAEQVHQKLNSTAPEQPINLLDLDDESASNYNFKFVHNYDMQYQEYPEVNQELAIK
                     FIPDDEHKDTKAPTKKRKVAYYLPVTGKIELRKHRLSTNSEINKFVKERTYDEVAFKL
                     REPSTNELKEMDRARSEFDPMEYEGDDDDEEEEDDDDEEELEDGEDYEEREEQEESES
                     RQGRSNGNAESGADQESVDGKVKHDREDAENEEGESHNEDF"
     gene            complement(<336920..>337525)
                     /gene="PST2_3"
                     /locus_tag="PVL30_003275"
                     /old_locus_tag="LELG_02431"
                     /db_xref="GeneID:5233176"
     mRNA            complement(<336920..>337525)
                     /gene="PST2_3"
                     /locus_tag="PVL30_003275"
                     /old_locus_tag="LELG_02431"
                     /product="flavodoxin-like fold protein"
                     /transcript_id="XM_001525823.2"
                     /db_xref="GeneID:5233176"
     CDS             complement(336920..337525)
                     /gene="PST2_3"
                     /locus_tag="PVL30_003275"
                     /old_locus_tag="LELG_02431"
                     /note="CAZy:AA6"
                     /codon_start=1
                     /transl_table=12
                     /product="flavodoxin-like fold protein"
                     /protein_id="XP_001525873.2"
                     /db_xref="GeneID:5233176"
                     /db_xref="PFAM:PF03358"
                     /translation="MSKPKVAIVLYSLYHHVYTLAESAKVGVERAGVKADLFQVKETL
                     SPEILKLVHAKPKLDLPEATNDTLTNYDAFLFGIPTRYGNMPAQWKSFWDGTGGLWAK
                     GALRGKHAGVFVSTGTQGGGQETTVINTLSTLAHHGIIYVPFGYGHEGQSNLTEIHGG
                     SPWGAGTFAAPDGSRQVTDLEKAIAEQQGHDFVEMITKWKQ"
     gene            <339996..>342167
                     /gene="ARE2"
                     /locus_tag="PVL30_003276"
                     /old_locus_tag="LELG_02432"
                     /db_xref="GeneID:5233427"
     mRNA            <339996..>342167
                     /gene="ARE2"
                     /locus_tag="PVL30_003276"
                     /old_locus_tag="LELG_02432"
                     /product="Sterol O-acyltransferase 2 (Sterol-ester
                     synthase 2)"
                     /transcript_id="XM_001525824.2"
                     /db_xref="GeneID:5233427"
     CDS             339996..342167
                     /gene="ARE2"
                     /locus_tag="PVL30_003276"
                     /old_locus_tag="LELG_02432"
                     /codon_start=1
                     /transl_table=12
                     /product="Sterol O-acyltransferase 2 (Sterol-ester
                     synthase 2)"
                     /protein_id="XP_001525874.2"
                     /db_xref="GeneID:5233427"
                     /db_xref="PFAM:PF03062"
                     /translation="MRTSTADKLDSISDNIDRRNLLDINNDYTTGSSSETDESDTSKF
                     QRTPSDLSDLRAPPHLAKRNGSYFLNKNDSELASIPSTTPSALSSTTSVNNASPPPSP
                     LRYENQRDNSQVRNRIKKQEHEHEHEHEHEHEHKQERQKKRPFTSGTGLHTSESDITL
                     DGLVKYVSNQDKARLNKRHQELNNNDNNNNNINTTTTTTDENDKTTQSSNNDNNSKNK
                     NKNKNNTGAHHGHKRKDSNSKYRLRFGDLTFGTSSTTILDSQEFINSQFFGMYVLFWL
                     ATAFIMLNNFVHIYFENATPIWNWTVVRIIRQDLFKVAFTDLAMYLGTYMSYLLQVSV
                     KHRIFSWRRVGWIVESVYEAAYFFTFLWFSHYMQFPWIARVFLVLHSLVFVMKMHSFA
                     FYNGYLWGIYTEGLFSESYLHRLLNDEVDLPKGFELDHTLKILEGSIEFAKYELEYQS
                     KATSDKPDNDKHKCDGARLDISIEELQRTNCILFPQNINLKNYFEYSMFPTLVYTISY
                     PRTNTIRWSYVFFKTFAVFGLYFLMITIAENSLLPIVGRCFLAKKLPLQERVPQYFFI
                     LLDMIPPFLMEYLFTFILIWDSVLNALAELTMFADRDFYGPWWSCTDFSDFARLWNKP
                     VHNFLLRHVYHSSISAFKVNKIQAAMITFIISSIVHELVMYVIFGIFRGYLLLFQMSQ
                     IPLIMLSRSRFLRGRKILGNIICWFGFISGPSIIFCLYLVF"
     gene            <343977..>345611
                     /locus_tag="PVL30_003277"
                     /old_locus_tag="LELG_02433"
                     /db_xref="GeneID:5233480"
     mRNA            <343977..>345611
                     /locus_tag="PVL30_003277"
                     /old_locus_tag="LELG_02433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525825.2"
                     /db_xref="GeneID:5233480"
     CDS             343977..345611
                     /locus_tag="PVL30_003277"
                     /old_locus_tag="LELG_02433"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525875.2"
                     /db_xref="GeneID:5233480"
                     /db_xref="PFAM:PF11309"
                     /translation="MTEQYYYTASTGLLHLIYNIQNGAAPGTGVKKLATFANNLLGEE
                     IPPAVINNAVGLLNNLYGSYPNHSDYVPSIVFAALFAVIMFIHLGVFLMDQYRGHYFY
                     LSLIWIFYCAMKIIGFALRAKWSTNILLVDLGLTSEIFLIVPAMIIVSANLILAQRLF
                     TWRHPVGGSRRLFWNFMFTIYIIVGIIIAVTVLASAVPYLYFISWQSYRSWIKTVQFT
                     AVLICLYCLTSMSLIGLSFWLPTQKDVMRYTYQPWWIESFSPLYFPKKGAAQKAAATF
                     MKRNSNHRHATRVIAATHHHFHNVKGLTNQRGDLKHNVSMGLLILTTVLVLIESIGRA
                     IVVFQARENKYTSPAGNRWFMYVCWGVFEIIINICYIVGRVDLRFYKPDRLPKEVRSI
                     ITANQTYYPSSDEEEDGFHRDRPETYGKIRGISEHGYKNSPSHAYKNGMEQPENAYAP
                     YGYDKGSVFVGGNFNEEEEEEDDEDDDEFDDIKSNEWDFTVPKAEKLSSSSEEYPSDT
                     KKNQLPYPVDDKKQNSRFDNFDHDFDNDDRDSEFNF"
     gene            <347771..>349354
                     /locus_tag="PVL30_003278"
                     /old_locus_tag="LELG_02434"
                     /db_xref="GeneID:5233310"
     mRNA            <347771..>349354
                     /locus_tag="PVL30_003278"
                     /old_locus_tag="LELG_02434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525826.2"
                     /db_xref="GeneID:5233310"
     CDS             347771..349354
                     /locus_tag="PVL30_003278"
                     /old_locus_tag="LELG_02434"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525876.2"
                     /db_xref="GeneID:5233310"
                     /db_xref="PFAM:PF11309"
                     /translation="MGDNQYYYTATNGLLNLVMAVNNGAATGTGIKKLVDFAHNLQGP
                     IIPTPIVNYCLSTQVNIFGGYPGHDDLAPSIVFAVLFGVIGLVHLIIFIIDQYRGHYF
                     YISAIWVLYSIFKILGFALRAQWSKDITRVQIGLVSEVFLIVPAVVIVSANLILAQRL
                     FTWRHPVGGSRRLFWSFMITTYIFVLILIAVTIVASFVPYLHFLSWGSYRSWIKTVQF
                     TSILVIAYSLTSVTLIALSFWLPTKKDELRYTYQPWWIESFGTFYFPQKGAAQKAEAT
                     FMKRNSNHRHATRVIAATHHHFHSVKGLSNSRGNLTHNVSMGLLIITTVLIFIGDIGR
                     AIVVFQARQNRYASHAANKWFMYVCWGVFEVIINLLYIIGRVDLRFYRPDRLPKTVRN
                     IVTAEQTYYPSSDEEEDGFHRDRPETFGKLRGRAEHGYKNSASRQEPASQYYPSDMAY
                     GQHNEGEESAFEDDSEEFDDDIDSDEWDFTVPKQEKISTSSDEVQPHTGTGAGAGTWA
                     PYPAKDPRFDDDNESEFNF"
     gene            <349858..>350565
                     /locus_tag="PVL30_003279"
                     /old_locus_tag="LELG_02435"
                     /db_xref="GeneID:5233280"
     mRNA            <349858..>350565
                     /locus_tag="PVL30_003279"
                     /old_locus_tag="LELG_02435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525827.1"
                     /db_xref="GeneID:5233280"
     CDS             349858..350565
                     /locus_tag="PVL30_003279"
                     /old_locus_tag="LELG_02435"
                     /note="BUSCO:EOG09265313"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525877.1"
                     /db_xref="GeneID:5233280"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF12796"
                     /db_xref="PFAM:PF13606"
                     /db_xref="PFAM:PF13637"
                     /db_xref="PFAM:PF13857"
                     /translation="MTSNIWIAAADNQIDIVTKLVEKDGLSPNVKDPNGYTALHAAAS
                     YGHLDLLQYLVNKGGDINIQDNEGDTPLHHVEDLNVAKSLVTKFKADYKIKNNDGQTA
                     AQFIEEEDEFPDVASYLKSLVHGDNADEGDVDRANEVTKANEFIESLPEPGNIDGHEI
                     KYSLETDQQLNGDEELTPEQLDERRKKIEAILNSENPEEGLRELVKNAVHEGLMQYKD
                     GGEANEQDLEPSTKKRR"
     gene            <351075..>352322
                     /locus_tag="PVL30_003280"
                     /old_locus_tag="LELG_02436"
                     /db_xref="GeneID:5233603"
     mRNA            join(<351075..351124,351269..>352322)
                     /locus_tag="PVL30_003280"
                     /old_locus_tag="LELG_02436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525828.2"
                     /db_xref="GeneID:5233603"
     CDS             join(351075..351124,351269..352322)
                     /locus_tag="PVL30_003280"
                     /old_locus_tag="LELG_02436"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525878.2"
                     /db_xref="GeneID:5233603"
                     /db_xref="PFAM:PF07946"
                     /translation="MLFEFLSKYYPVGVKEQAKGLTLEELNAMTLFERVKLRDWRLEL
                     FTLGFIVIFIVLFKAGDFYNQSKVTTFLKSVQPTFAKQFFQFGVTPDKLYVKDSSENF
                     SSYATGRLNIAKVDLKFTLAPRQNLFLWIMEHGFSIFTESVPTPQDKVEIVITPSGKY
                     DNFIASIVSKLGMNDARKLNYFLSLCKTTDSPNLPQSFVYMSEANEFQDKITTTDLRQ
                     ALTLQSASYVKVIAFTDQAVVKPETLHEFIPQRRVIIELSLTTNKEALKVINNVLDAV
                     FNVVDKLSDQAITFKPETIKKVVKTREFEIEKLKKIEQELQNEKLAEEQARLKREERE
                     RMRNMSREEQLRAEQKAQEKRQKKLQKKQRIKM"
     gene            complement(<352625..>353839)
                     /locus_tag="PVL30_003281"
                     /old_locus_tag="LELG_02437"
                     /db_xref="GeneID:5233329"
     mRNA            complement(<352625..>353839)
                     /locus_tag="PVL30_003281"
                     /old_locus_tag="LELG_02437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525829.1"
                     /db_xref="GeneID:5233329"
     CDS             complement(352625..353839)
                     /locus_tag="PVL30_003281"
                     /old_locus_tag="LELG_02437"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525879.2"
                     /db_xref="GeneID:5233329"
                     /db_xref="PFAM:PF10494"
                     /translation="MPLQYSAARTSIASKRSPTKSPIKKFQREAKKLLPSQRLYQQNR
                     LAKSSVPSLSPSPSSLESHASQSSQSPQSPQSPSRSRKPIEKLVVSDYNVELDYQLSK
                     DDDIKIAIDIINSNRWSESTELHDKQKLRHLEGNTTEEVIFQIKGLSLTSKAELVKFR
                     SSFPSGIVTINQLYSIFSAQGNTFVDKQVELNVRQGLLRKFVLNNASPVISRSINRLQ
                     MRKVTYGYENVELLVKTEDYYKNLINIVESTDKENEKLRLTMSKFLNLAKSSPSQMFI
                     STSSFDDYEVSMLIQMGYLTLTTNFSSSEEAQLEISYPGCGRFLRLINEGRMWLVGTL
                     NRNTHKEMLEDELFRKWMGVSLEGDLKLNNFKKPFYGYDLHWVLADAFGGGIVEVFNT
                     PVGRGWRLTGKI"
     gene            complement(<354519..>355274)
                     /locus_tag="PVL30_003282"
                     /old_locus_tag="LELG_02438"
                     /db_xref="GeneID:5233243"
     mRNA            complement(<354519..>355274)
                     /locus_tag="PVL30_003282"
                     /old_locus_tag="LELG_02438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525830.1"
                     /db_xref="GeneID:5233243"
     CDS             complement(354519..355274)
                     /locus_tag="PVL30_003282"
                     /old_locus_tag="LELG_02438"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525880.2"
                     /db_xref="GeneID:5233243"
                     /db_xref="PFAM:PF01281"
                     /translation="MSFISIRGFMSSSRCCKRSPNVLRSVNTRVPVQLLQDVEDVGVR
                     GQIVRVKPGFMRNFLHVDNKACYITENSPPRIPIVDINELREQRRLRQKELAKQRKKE
                     EQLQDATKSVVNEEVVDDAEGVLSQDELSQFFSGLTKTSKTSAEIFSSDIEITDNEAE
                     LFTLKSDNMGEKIPKVVNMYTSKYTLPLDGTVVAKHLTEIGGEEVSPLSVKLSYEDTP
                     EEVLSAITQAGRYLVTLETGKDGRKISRVLEVE"
     gene            <355788..>357119
                     /gene="BCD1"
                     /locus_tag="PVL30_003283"
                     /old_locus_tag="LELG_02439"
                     /db_xref="GeneID:5233390"
     mRNA            <355788..>357119
                     /gene="BCD1"
                     /locus_tag="PVL30_003283"
                     /old_locus_tag="LELG_02439"
                     /product="Box C/D snoRNA accumulation"
                     /transcript_id="XM_001525831.1"
                     /db_xref="GeneID:5233390"
     CDS             355788..357119
                     /gene="BCD1"
                     /locus_tag="PVL30_003283"
                     /old_locus_tag="LELG_02439"
                     /codon_start=1
                     /transl_table=12
                     /product="Box C/D snoRNA accumulation"
                     /protein_id="XP_001525881.2"
                     /db_xref="GeneID:5233390"
                     /db_xref="PFAM:PF04438"
                     /translation="MEESLELCSICSSNRAKYTCPACAYKTCSLFCYKTHQREQSCTG
                     KVDVTRFVTRDELSQTPVHLNRDYNYLQNVDRKISLSKEDIKSNARNILKRSRNEVMQ
                     DRRQKRVKRNDGGVNGGIGGNVNNFNGSNSGNNGKNSDNGEDRRRITMLEVFPQNPSI
                     VIKRQNTMVVQLPSGMQRAVSNKTGYDKKSNTFVWTVEWILLDNDQGKQLDSYTSFRL
                     KESGVLKEIVPQVLLSRNGFDALPFSSCPGSSADADADARSPQLYFFLRNVANKPINS
                     LIQLSSNAILSDALKDKIVLEYPTIYITTNVKSVQNRIVSEIQGYGLRGDSDQSSSDS
                     DSDTGSEVSSSSGTGSDSDSDSELDSDADADADADSDTDSRDASESEDSGPEEASSKK
                     LEIEVGDDFEEQKYDNIEKKDLVTSLVEVGDVCTVGDVAGESSLDYLNGVD"
     gene            <357407..>358086
                     /gene="sap49"
                     /locus_tag="PVL30_003284"
                     /old_locus_tag="LELG_02440"
                     /db_xref="GeneID:5233293"
     mRNA            join(<357407..357413,357440..>358086)
                     /gene="sap49"
                     /locus_tag="PVL30_003284"
                     /old_locus_tag="LELG_02440"
                     /product="Spliceosome-associated protein 49"
                     /transcript_id="XM_061119459.1"
                     /db_xref="GeneID:5233293"
     CDS             join(357407..357413,357440..358086)
                     /gene="sap49"
                     /locus_tag="PVL30_003284"
                     /old_locus_tag="LELG_02440"
                     /codon_start=1
                     /transl_table=12
                     /product="Spliceosome-associated protein 49"
                     /protein_id="XP_060975442.1"
                     /db_xref="GeneID:5233293"
                     /db_xref="PFAM:PF00076"
                     /translation="MPQCSELLMYELFSQFGPIRNINMPKDRVSKMHQGYGFVEFKDA
                     RDAKYTEDILRGVRLYGKLLKLKKLDSKPSTQYQSERSVGTYVTPKSDLSNDRYVDVG
                     AKLYISNLNPLIDEKFLLQTFSNFGTVIKQPVIRRDLEGKSMGSGFITFADFETSDEV
                     IEKMNNTILMNSKISLAYAFKEGATKGGKKIRHGDKAERILAESAKKNGFSRSKKSR"
     gene            <358599..>363901
                     /locus_tag="PVL30_003285"
                     /old_locus_tag="LELG_02441"
                     /db_xref="GeneID:5233145"
     mRNA            join(<358599..358606,359008..>363901)
                     /locus_tag="PVL30_003285"
                     /old_locus_tag="LELG_02441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525833.2"
                     /db_xref="GeneID:5233145"
     CDS             join(358599..358606,359008..363901)
                     /locus_tag="PVL30_003285"
                     /old_locus_tag="LELG_02441"
                     /note="BUSCO:EOG09260OE9"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525883.2"
                     /db_xref="GeneID:5233145"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF13920"
                     /translation="MLNRGYVKCKVGKNGNTSLTWSKQKGSKQFTILEIGDIENEQTK
                     SELTLLAKASKDNNCLMDFITISGKRQRDGGDFTIEIEYALDYVFTFANVAEDISNEL
                     VNYIFKGSANLNMEQEVSVEFFYKCILEHTGKLPLCHEQFDLPDLKTKLLNFQRKTVQ
                     WMLTKESALYDLDTGRCEQIIGISASSLNEDKNVIDMMNKIWYGWREIEFNGQQLCFN
                     ILTSHLSTIEHLRSYLLEYLKETDKNLYPTILPAKGLLCEEMGLGKTVESTALILLNP
                     RPAEDIGKRISRPSYIMGDHKSMYKAKTTLIIAPNSIIQQWQDEITRLAPSLTVTEYK
                     GIKSYKSMKNKPAIIAEYLGKFDVVFTSYTVLGNELNYANFSKLTRKTRAAKKEMEQF
                     FNEESVQEVSSSSSSSSSPLPSSRASSAFPGKNLNQHTEEKKVDEEKEKQEKQETQET
                     QERDLINSASLEFFHIPDISTKTIQPNSKMSDASSETFYEEALQREVALALEHNKIPD
                     WYHKIDYACPLMLMQFWRVLLDEVQMVSSSSSKCFKSAELIPRFHSWGVSGTPIKRDL
                     DDLQSYLKFLHFYPFDSIHGKKAWKSLISDSHKFQKFWSEMSLRHTKAMVEHDIRLPP
                     QNRIRMTIPFNPVEQNNYDTRFAECLQDIGLDSEGNPTQNDWEMSTDRIQKMKTWLRN
                     LRQLCCSPQFSSLNINRFNSKAAAMGFQQLYFVDTSKSLDDLLDQMLDKVYFEIAEKE
                     KRKLELVIQSAEFLEFIYQPKHATKFLKEGIIETRKIIHRLRLLLQKSIEDYRKDRNK
                     DAKDKLSKQPKYDNNGDANGDETQNIMEVDDAYNNIDHDDNIGTSQESNSYNGENKLE
                     HRVSNLRIRLKNWHLLLHKLYFLYASANFQLYDPEFQSLIAKYQIDCNFDTLYKILDG
                     CLGIDRADELAGIMSSMPKSYFFSVEDFVELPSPQKTETEFYKKAEDIRDEYLKPSLK
                     YLQKVVHDKIQNRGLFCSWKSTFHDDGTKLIPKNSKKLFNVLPLICLESDKVDDFGHS
                     KCNLFLEKSAKLITALNVNAHEVNPKIHRLVELLIESVVPKEVEMIEYNKESHEHQQN
                     GVDEKENGKVDVNGPGNETTENIYDWGLQKQQQIEDLLSDLGKLISERKLLLLGNTGV
                     YNSSLSSRAEDLNFTNMMVELGSIEYSINEPMSSKSSKISSPAIVQFSNLAKKLRNIF
                     ENQKTVSNMITREVNLNFNAIFNARVEYFKQLQQISDSVLPPTFIGFDREKLKKIDVE
                     LKFTRLEKSFVEQNRLIENSTGRLRYLSELVKESSSNNADDFDGAMMCIICRCEITSG
                     SLTKCGHKFCKECLQHWMRNSQFCPMCKDRIQAGSVYNFNRFAQNLKAAEETTSSSSV
                     DSFGVNMNSIYKPVDQSVVDEIQDIKLWSNYSSKVDMIVKQALYLRTKDRDVQIVVFS
                     QWRKMLSILAVALNASGVTCATLGTKQLKRPRGGQGAMHSASTRTDPVELFKNPANKI
                     TCFLLDANAQASGLTLTNATHIFLCEPLINTSLELQAISRVHRIGQTRPTTVWMFTIA
                     NTVEESVVLTATRKRLNLIKETSQDNGTIVVNEHAMSIADSLTLNKSNGQKSLLEKRN
                     AEGENVNSSDLWDAFFSSNLNKC"
     gene            complement(<364105..>364893)
                     /gene="ssb2"
                     /locus_tag="PVL30_003286"
                     /old_locus_tag="LELG_02443"
                     /db_xref="GeneID:5233307"
     mRNA            complement(<364105..>364893)
                     /gene="ssb2"
                     /locus_tag="PVL30_003286"
                     /old_locus_tag="LELG_02443"
                     /product="Replication factor A protein 2"
                     /transcript_id="XM_001525835.2"
                     /db_xref="GeneID:5233307"
     CDS             complement(364105..364893)
                     /gene="ssb2"
                     /locus_tag="PVL30_003286"
                     /old_locus_tag="LELG_02443"
                     /codon_start=1
                     /transl_table=12
                     /product="Replication factor A protein 2"
                     /protein_id="XP_001525885.2"
                     /db_xref="GeneID:5233307"
                     /translation="MSEYGNFGNYGGNYGDGGFTNTGYSQGGFSNENGSQSGGTKTQG
                     RSSLTPVTIKQILEATQATPDGDFSVHNVTLSMISFVGVVRKVDGQGMSVIITVEDGT
                     GSIDVRKWVDESTTSLAVETEKYSAFKNKYVFVGGSLKLHMNKKSIQNAAIALIEDSN
                     QIIYHHLSAIDHHLKSQGLPKSSGANTDGDLFVKDEDSNESLMNRVLKFITEESKTMQ
                     DGVPINYIAEKLGISKDEGLRQCNELIENGRIYLGFNDGGYIAV"
     gene            <365543..>368176
                     /locus_tag="PVL30_003287"
                     /old_locus_tag="LELG_02444"
                     /db_xref="GeneID:5233626"
     mRNA            <365543..>368176
                     /locus_tag="PVL30_003287"
                     /old_locus_tag="LELG_02444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525836.1"
                     /db_xref="GeneID:5233626"
     CDS             365543..368176
                     /locus_tag="PVL30_003287"
                     /old_locus_tag="LELG_02444"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525886.2"
                     /db_xref="GeneID:5233626"
                     /translation="MEIDPEFENDFTSLHQLESNKTIETSYDGGLRSPQDSNIAHLAV
                     RRAEQGRPTQLSSFNVNVNMKANSDIYAQNTGSGNSEDNSISSQHTAAPEFKVKLVEY
                     DPNSKPERLGRPRKHITKPSSPPETSSAQNHNEALISKFRFDNQPLEGPGSRGGKTII
                     RVPKGKLTSSARKRKHQSTLNFSPIQHPKLNETKKDEETANPENFKESKVTKETDESG
                     EIEKSKEAKEAKETGNLEALQKSSPTQHKVNSLCTASVKENQETKQETIESLLHSSRQ
                     PALGVSKSLKKVSAMSSPSSSPSLSPSLSTPSSILSTTLSGNHRKPLASTKRNPKLLP
                     SPLVPVNLISDSYASDNLQIPENLDHLALGFPLRNSSFGRYVVFLITYLTKFGDIVGF
                     PYKFGPKDFEIGLGLNFEVGLETEPGSNTDNITDATNPETNMDSRSRSRSSSSSSSQV
                     VVTAPPRVSKEMNDLFKKLLGLILNRKKHIQSHTKAIQELKPQTNKLGMPLEWKQYNS
                     FDRPEYIVGSPVDPNHAEILINEYPIESEYVNTFNPFYDSDFENLGLDGLANPKDRLV
                     MLHTLAMWSLNTSEVLKSYMTQNIQAQDMPGEKETYYGARAVLNGFNNCEHMKLRTVQ
                     RLSKMKSSQEDLKYVDPTSDPRNHSMNIRLVENIAGDLGFRGGIFYLCRSADEDAGGL
                     SSVQKMSNVWKDSKTTLLGTCSDFKLYVHDIAQTLADSMPMSDVQVDENDNEKKVASN
                     YTIDLDKNWYEVASNCTELQDFINYLDEKLSNELQTLKRTLFYKSVENLHNYLSGIFN
                     LLQRHEEIASSARIKRRKVVDYSNNGAGNVFESAHEWFEDENKGEHDELDEQEYVDDE
                     LENDDALVEDANDEDDKDYLD"
     gene            complement(<368189..>369646)
                     /gene="ssr3"
                     /locus_tag="PVL30_003288"
                     /old_locus_tag="LELG_02445"
                     /db_xref="GeneID:5233604"
     mRNA            complement(<368189..>369646)
                     /gene="ssr3"
                     /locus_tag="PVL30_003288"
                     /old_locus_tag="LELG_02445"
                     /product="SWI/SNF and RSC complex subunit Ssr3"
                     /transcript_id="XM_001525837.2"
                     /db_xref="GeneID:5233604"
     CDS             complement(368189..369646)
                     /gene="ssr3"
                     /locus_tag="PVL30_003288"
                     /old_locus_tag="LELG_02445"
                     /note="BUSCO:EOG09262IY3"
                     /codon_start=1
                     /transl_table=12
                     /product="SWI/SNF and RSC complex subunit Ssr3"
                     /protein_id="XP_001525887.2"
                     /db_xref="GeneID:5233604"
                     /translation="MSQRNGLPTVSYSPTDITIPQSIYDKIPNLEDYKNLKEAERKID
                     LLIARKALDFQAIQQKTIHPFEYKSNTGLLRVFVYNTCENQPWQKQLQQQQQQQQQQQ
                     QQTEYVPDPNAEPTWTLRVEGKFIGDNKVEATESSRLKFSTFLSAASIDLLPNEHYPN
                     LEESQQNIIEWRDDGSNNAMRNPSIDTSFDGLDVKRNGLHNIKVKIALLLKSYSSKLQ
                     LSDEMAQFIGKTECTQQEAMYTIWIYVLWNKLLKNTEEYMHVPAVENHSMSSSDKSGA
                     GAGVGAGVGVGVGVGAGAGVAGTGSGDINNDFSLTVADDTLFELLKVREFTFKDLYRL
                     IQPHFKPREPVMIEYEVDTRTSNTLGNLIVDIPVELPINLSQAQKELLELNKSAFETL
                     SQHDAMIEKLNQKISLAIIALRNANSREIFFSELSKDPVGFIQKWLETQSETLKALKS
                     DEGYDEEVVRRAQYFIDNEDMIKEKIDLLFGASKF"
     gene            <370261..>371970
                     /gene="OLE2"
                     /locus_tag="PVL30_003289"
                     /old_locus_tag="LELG_02446"
                     /db_xref="GeneID:5233634"
     mRNA            <370261..>371970
                     /gene="OLE2"
                     /locus_tag="PVL30_003289"
                     /old_locus_tag="LELG_02446"
                     /product="stearoyl-CoA desaturase"
                     /transcript_id="XM_001525838.2"
                     /db_xref="GeneID:5233634"
     CDS             370261..371970
                     /gene="OLE2"
                     /locus_tag="PVL30_003289"
                     /old_locus_tag="LELG_02446"
                     /codon_start=1
                     /transl_table=12
                     /product="stearoyl-CoA desaturase"
                     /protein_id="XP_001525888.2"
                     /db_xref="GeneID:5233634"
                     /db_xref="PFAM:PF00173"
                     /db_xref="PFAM:PF00487"
                     /translation="MNGTANTIKNEADERMPNHGQDKGQSQSQDQGQGKGQSQGQSQG
                     QKTMKIQRRKVASSSHQSSSPHNLLNQAQKLKKTRIHEIKKKRRDFVRRINYVHLLTV
                     VILPFLALSYILYSGESILPANQKTMYFTIIYYNITMLAFTSGYHKYFAHNSFKVKFG
                     ALKYFFAVFGSSCGLGSIRWWASLHRAHHRFTEDTERDPYSIKRGFIFSHYGWLLKKP
                     KVTTFYDNFISQEFPLSDQRTDEELKHLEYTLQNEVAEMGNNDHDTSDEVSREDYDES
                     TQSLLAWQQRTYPIWFLTTTLLIPIIITKFLCHDSMVHGLLYPGILRMFLCQQSLLST
                     ESICHLKRIQVTIPTQPFNDKNSSQNCLNPLVALLTYGQSQQNFHHEFPHDYRCDNGF
                     FTYDPTKWFIWTMEKLGIVHELCRTPDNLVVHLNLQQQQRVINRTKSQLNWGTPISKL
                     PLISPKDFKNIIASSSNKDRIYIVIQSIIHDITPFMDQHPGGVPLLKASHGKDATKAF
                     YGGVYGHSTAAINLLATMRIGILNNGNDEEVWKRVVKEEGEVEDESGSRTGQAQYRTA
                     EAA"
     gene            <372484..>373065
                     /locus_tag="PVL30_003290"
                     /old_locus_tag="LELG_02447"
                     /db_xref="GeneID:5233416"
     mRNA            <372484..>373065
                     /locus_tag="PVL30_003290"
                     /old_locus_tag="LELG_02447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525839.2"
                     /db_xref="GeneID:5233416"
     CDS             372484..373065
                     /locus_tag="PVL30_003290"
                     /old_locus_tag="LELG_02447"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525889.2"
                     /db_xref="GeneID:5233416"
                     /db_xref="PFAM:PF00571"
                     /translation="MTTTPILFHTQDYRGATIEDLNIPQALSVNPSTSIYGAIELGFE
                     NEFTYLPVIHELNKRLLGVINLEQFKQGTAQINHAKQEPTVFDYMIWFNQNTKRKYET
                     EIRNNKNIQNGTGEGKGKGKILETTSPKTKILKPKGKRYSVLTPFSPLEDLAGFFNRG
                     NYFAIVTNDSGNFVYGVVTPQDLMKYEQSRPKL"
     gene            complement(<373729..>374748)
                     /gene="ZTA1"
                     /locus_tag="PVL30_003291"
                     /old_locus_tag="LELG_02448"
                     /db_xref="GeneID:5233537"
     mRNA            complement(<373729..>374748)
                     /gene="ZTA1"
                     /locus_tag="PVL30_003291"
                     /old_locus_tag="LELG_02448"
                     /product="NADPH:quinone reductase"
                     /transcript_id="XM_001525840.2"
                     /db_xref="GeneID:5233537"
     CDS             complement(373729..374748)
                     /gene="ZTA1"
                     /locus_tag="PVL30_003291"
                     /old_locus_tag="LELG_02448"
                     /codon_start=1
                     /transl_table=12
                     /product="NADPH:quinone reductase"
                     /protein_id="XP_001525890.2"
                     /db_xref="GeneID:5233537"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF13602"
                     /translation="MSAQTIPKTQKVSLFNEQGDTSKIQYVEDFSTPQISSPTDVIVK
                     NYYAGVNFIEAYFRKGIYPVSSTPYVFGREASGAVVAVGSDVKELSIGDKIAYLSPNT
                     FAQYTKVSASNLKFVKLPSSSNDEDLKIYGSLFLQGLTALTFVNEAYNVKSDDFVLVW
                     AAAGGVGRLIVQLAAQRGAHVIAVASTDEKLQIAKSLGAEYLVNSSSDDVAKRVEEIT
                     KGKGVAVSFDSVGKDTFETSLSALARKGHFVSYGNSSGTVTPFPLSRLSPKNIQLARP
                     QLFGYITEKQEWDHYAEELKKLYQSGELKFEVSKVYELKDYQQAAEDLEGRKTTGKLT
                     LKIPE"
     gene            complement(<375625..>377571)
                     /gene="srk1"
                     /locus_tag="PVL30_003292"
                     /old_locus_tag="LELG_02449"
                     /db_xref="GeneID:5233195"
     mRNA            complement(<375625..>377571)
                     /gene="srk1"
                     /locus_tag="PVL30_003292"
                     /old_locus_tag="LELG_02449"
                     /product="MAPK-activated protein kinase Srk1"
                     /transcript_id="XM_001525841.2"
                     /db_xref="GeneID:5233195"
     CDS             complement(375625..377571)
                     /gene="srk1"
                     /locus_tag="PVL30_003292"
                     /old_locus_tag="LELG_02449"
                     /codon_start=1
                     /transl_table=12
                     /product="MAPK-activated protein kinase Srk1"
                     /protein_id="XP_001525891.2"
                     /db_xref="GeneID:5233195"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MFENLKAFIRHGKQANDMKKKGLPTTATSPYDSNNNIGQYQSTG
                     TYSTLENPFGSEYQVIDSYNPSDKQYQQYQQQYEQQLQQQEQQQEQQEQKDQQFAQQM
                     GQTSLDQQQQQQQQNGLYSNYGAGYSDITLNDPSSQQQQQQQQQQQQDLHNKVATQMV
                     EEENLQKSKSKKYPNLERYQVLEQMGEGAFSVVYKAIHLPTGKEVAIKILRKFQMDQQ
                     QKQSVLKEVTIMRQLKHPNIVRFIEFIDSPIYYYIVQELASGGEIFTSIVKYTYLSED
                     LSRWIITQVAQAIRYLHEEVGIVHRDIKPENLLFEPIEFKPSVNPVAKLRKSDDPNTK
                     ADEGDFTDGVGGGGIGVVKLADFGLSKQIWEHNTKTPCGTVGYTAPEIVRDERYSKEV
                     DMWAMGCVLYTLLCGFPPFYDEKIETLTEKVAKGQFTFLQPWWDEISDGAKNCVSNLL
                     TVDPKKRYTIDDLLQDSWIKQQPKSASSSSTAFNAPVESSAGAHPIQSHNQDPSAGKK
                     YSKKFKAQNPTHHDLYSPAAIALRDAFDISTAVHRMEEEAALSNKNGGIEDLIEEEEE
                     EEEEDVSHSGRVLQHHKRSPESQRIRERNHQQGGSSRIPRSNGNSTNARSHIKMNQNA
                     FDLNLGGASILERRKNKFIPIQSS"
     gene            <381700..>382455
                     /locus_tag="PVL30_003293"
                     /old_locus_tag="LELG_02451"
                     /db_xref="GeneID:5233383"
     mRNA            <381700..>382455
                     /locus_tag="PVL30_003293"
                     /old_locus_tag="LELG_02451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525843.1"
                     /db_xref="GeneID:5233383"
     CDS             381700..382455
                     /locus_tag="PVL30_003293"
                     /old_locus_tag="LELG_02451"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525893.1"
                     /db_xref="GeneID:5233383"
                     /db_xref="PFAM:PF12710"
                     /translation="MSVKNPPAIVFSDFDGTITLQDSNDYLTDNLGMGGTRRKNIGQD
                     ILDGKTSFRDGFREELNSVTTPFDECIEILLANIKLDPGFIKFFEYCQAEGIPIVVVS
                     SGMTPIISALLAKLVGPDAASKIQILSNDVRLSDNGKNWEILFKHPDSPFGHDKAQSI
                     KEYLTNHGYADLKEDSEGLVVPQLFYAGDGVSDLSAAKETDLLFAKHGNDLITYCKRE
                     NIPYTEFNSFDDILSKLQKIVGGEPIKTFVENP"
     gene            <384054..>385943
                     /gene="SMF1_2"
                     /locus_tag="PVL30_003294"
                     /old_locus_tag="LELG_02452"
                     /db_xref="GeneID:5233351"
     mRNA            <384054..>385943
                     /gene="SMF1_2"
                     /locus_tag="PVL30_003294"
                     /old_locus_tag="LELG_02452"
                     /product="Manganese transporter smf1"
                     /transcript_id="XM_001525844.2"
                     /db_xref="GeneID:5233351"
     CDS             384054..385943
                     /gene="SMF1_2"
                     /locus_tag="PVL30_003294"
                     /old_locus_tag="LELG_02452"
                     /codon_start=1
                     /transl_table=12
                     /product="Manganese transporter smf1"
                     /protein_id="XP_001525894.2"
                     /db_xref="GeneID:5233351"
                     /db_xref="PFAM:PF01566"
                     /translation="MKSIDIADQTTSHRAESILSATSGRDMPAISRVSTKRTSQHATL
                     ASPFTNTYTNSEIHSSTTNNTTGTFHSKFGSYASKTKSILKKYSKFIGPGLVVSVSYL
                     DPGNYQTAITAGSSNKYSLLFIIFLSNVIAIFLQSLCIKLGSVTGYDLARCCREYLPK
                     KLNYVLWILAECAIIATDVAEVIGSAIALNILIKVPLPAGVCITIVDVLFVMMTYRAD
                     TSSMRFVKIFEYTIGTLVMVVVICFAIQLSQIHADAKEIFRGFVPSKQMFDGNGMTVA
                     TSIVGATVMIHSLFLGSGLVQPRLREFDVKNGYVKLEEITSQDVEEKEKDKTSECNER
                     TTSHNDDDNDCGDTSDVSGFSSSPVGVAVAASNIVSEKASNHKVSTYEKEASYFYNEY
                     KPSYQSIKYSLKYSIIELTITLFTIALFVNAAILIVAGATLYGTQEAMDADLYTIHDL
                     ISKSIAPAMGTIFMVALLFSGQSAGIVCTIAGQVVSEGHINWTLRPWLRRLITRGISI
                     VPCLIISLCIGRNGMGIALNISQVIISILLPPLTAPLIYFTCSKKIMRVKLGSSDQDE
                     SGVEVSDDDDNIEGGGEDHNNDARYKIMTNNWITSIIAVVIWIFVSVLNVYAIYEMAK
                     NGVSG"
     gene            complement(<386547..>389684)
                     /gene="AFT1"
                     /locus_tag="PVL30_003295"
                     /old_locus_tag="LELG_02453"
                     /db_xref="GeneID:5233028"
     mRNA            complement(<386547..>389684)
                     /gene="AFT1"
                     /locus_tag="PVL30_003295"
                     /old_locus_tag="LELG_02453"
                     /product="DNA-binding transcription factor aft1"
                     /transcript_id="XM_001525845.2"
                     /db_xref="GeneID:5233028"
     CDS             complement(386547..389684)
                     /gene="AFT1"
                     /locus_tag="PVL30_003295"
                     /old_locus_tag="LELG_02453"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription factor aft1"
                     /protein_id="XP_001525895.2"
                     /db_xref="GeneID:5233028"
                     /db_xref="PFAM:PF08731"
                     /translation="MEGKVRYRVPLDAAQFNKQKFTSRDDIKPWLYKQLENTGIDVVI
                     ERSDKSKMIFRCKNKEKKKKKKKQQQQQQQQKKDDTSNNKNLAEGKDNNFSRTPIRRQ
                     TTCPFKIRANYSVRNKVWGISLVCDLHDHVVEQPSNATTAGAITTTTTTPKPPHSTND
                     KGAQNPLDLLPQPNLNGGKYFQNDSSKNDSNSDSLFSGKEDSSSDNQSSMNSNFSNKS
                     GGNTSNNSPPTSINSGESSNNDDSSSSSKSSSASGNRKRARKKKNGLTPGLKKRKIKK
                     EDYLDKGRLPIAEEIALSQGANTSLSQKTNLNHDQRQKSVKEQAQSSGEQRGQDQTLP
                     PNFRYMDPPFPSNGHPMQSTQPMQPMQPMQPMQPMQPNYPVHFAQFNTNNPPVSHLTP
                     IQPRSQKVPPLPTPKLRHLQRNQQNLSKSSEQQAYLPSENPAQNKQPQKSEHVEKTTK
                     SPKGLYNSQAHSVHALQTLQDMVRAKIKHIVLDDPKITDHQKTSMMDSFISQLLLEYR
                     TYFSPQFLSSLKENLFDQNTLSGSNTMGAPQTEHMPSIATHTLLPDKNVPINRPSSAS
                     SKTNILQPGSTASIPLSPLLNGNGNGNGNEIGNGNGNISLDNSTQLLRPSNNIGTSNA
                     YGNAWEAASHSSKPFKSGQNTSMTSGNMNLNSSVNMSNTPFPLQSDPRALNNPLPPLN
                     SLHSNTKLTNTLAKRQITPPDFPSLHKGHTGLSNYPLNPTRPINQRANNNNCSNFADS
                     GNDSSTNAKSQLNHNSIINNNNNNNNNNNTNSLPPPSQPLLLPDGALIKTDSSTNSDV
                     SSKEGNSSGSSVNQETKFGATTKAGTSGPVFPSLNPISSTPNPTQILRHNNISVNPNS
                     LPNSNSSSSNSIGVYQSGNYNNNGKFVGSIPVGDTAFAQHQQHQQQQQQQQQQQQQQH
                     FNPALLYSSNMQTPQNSGMTGNLNAVTYNENGNQNAMLNSFGANGSLGGFSNSNECLN
                     GNGGGSGNGSLNNFGVISGIGSIGGMSNIGVGGVGGSVPGRNSSSNTNSGFVYQERDS
                     GSNLLNNMPSFDPTW"
     gene            complement(<392061..>392399)
                     /gene="RPB9"
                     /locus_tag="PVL30_003296"
                     /old_locus_tag="LELG_02454"
                     /db_xref="GeneID:5233499"
     mRNA            complement(<392061..>392399)
                     /gene="RPB9"
                     /locus_tag="PVL30_003296"
                     /old_locus_tag="LELG_02454"
                     /product="DNA-directed RNA polymerase II core subunit
                     rpb9"
                     /transcript_id="XM_001525846.2"
                     /db_xref="GeneID:5233499"
     CDS             complement(392061..392399)
                     /gene="RPB9"
                     /locus_tag="PVL30_003296"
                     /old_locus_tag="LELG_02454"
                     /note="BUSCO:EOG092654O3"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase II core subunit
                     rpb9"
                     /protein_id="XP_001525896.1"
                     /db_xref="GeneID:5233499"
                     /db_xref="PFAM:PF01096"
                     /db_xref="PFAM:PF02150"
                     /translation="MASFRFCAECNNMLYPKEDKDGQRLLYGCRNCGYNEIADDSKVY
                     RHELMTNIGATAGVVEDIGNDPTLPRSNKECPQCYNRDCVFFQSQQRRKDTSMILFFV
                     CLDCKHVFQA"
     gene            <392844..>393395
                     /gene="MNP1"
                     /locus_tag="PVL30_003297"
                     /old_locus_tag="LELG_02455"
                     /db_xref="GeneID:5233339"
     mRNA            <392844..>393395
                     /gene="MNP1"
                     /locus_tag="PVL30_003297"
                     /old_locus_tag="LELG_02455"
                     /product="54S ribosomal protein L12, mitochondrial"
                     /transcript_id="XM_001525847.2"
                     /db_xref="GeneID:5233339"
     CDS             392844..393395
                     /gene="MNP1"
                     /locus_tag="PVL30_003297"
                     /old_locus_tag="LELG_02455"
                     /note="BUSCO:EOG09265HPJ"
                     /codon_start=1
                     /transl_table=12
                     /product="54S ribosomal protein L12, mitochondrial"
                     /protein_id="XP_001525897.2"
                     /db_xref="GeneID:5233339"
                     /db_xref="PFAM:PF00542"
                     /db_xref="PFAM:PF16320"
                     /translation="MSVIRQVTKINARFASAQFRRSVPALISQSVRFNSTTAAAPAAE
                     SAPVDPKISQIVDQISVLTLFETSQLVSELKSRLNISDIALPAAGAAAPSGASAAPAE
                     EEEAKVPVEEKTIFTIKLESFDAKSKPKIIKEVKGLLGLSLVESKKFVESAPKVLKEN
                     VAKEDADKIKATLEGLGAKVTLE"
     gene            complement(<393831..>395303)
                     /gene="TPK2_3"
                     /locus_tag="PVL30_003298"
                     /old_locus_tag="LELG_02456"
                     /db_xref="GeneID:5233358"
     mRNA            complement(<393831..>395303)
                     /gene="TPK2_3"
                     /locus_tag="PVL30_003298"
                     /old_locus_tag="LELG_02456"
                     /product="cAMP-dependent protein kinase catalytic subunit"
                     /transcript_id="XM_001525848.2"
                     /db_xref="GeneID:5233358"
     CDS             complement(393831..395303)
                     /gene="TPK2_3"
                     /locus_tag="PVL30_003298"
                     /old_locus_tag="LELG_02456"
                     /codon_start=1
                     /transl_table=12
                     /product="cAMP-dependent protein kinase catalytic subunit"
                     /protein_id="XP_001525898.2"
                     /db_xref="GeneID:5233358"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MTNLLKKLHIHKFDNNQHSEKQQSTPILEQKYSDNNNDNDNDND
                     NDNDNDNDNDNDHDNDNDNDHDNNYNMSQQQFSQSSHVPGQAIAHPGTPQSASNPQNV
                     TATTTANVTQAQANLHAQQQAQLQEQQRQQQFAQQQQQQQQQQQQQQQQTTAADAAIQ
                     KSLLPTRSTVSKGKYSLQDFSIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVK
                     MKQVEHTNDERKMLKLIEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFP
                     NPVAKFYAAEVVLALDYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKEVTTVTWT
                     LCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILAGKI
                     HYPSFFNPNEIDLLSKLITADLTRRLGNLMNGPADIRNHPWFQEVVWEKLLAKDIETP
                     YEPPITAGVGDSSLFDHYPEAQLDYGAQGEDPYAQYFQDF"
     gene            <396775..>397734
                     /locus_tag="PVL30_003299"
                     /old_locus_tag="LELG_02457"
                     /db_xref="GeneID:5233269"
     mRNA            <396775..>397734
                     /locus_tag="PVL30_003299"
                     /old_locus_tag="LELG_02457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525849.1"
                     /db_xref="GeneID:5233269"
     CDS             396775..397734
                     /locus_tag="PVL30_003299"
                     /old_locus_tag="LELG_02457"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525899.1"
                     /db_xref="GeneID:5233269"
                     /db_xref="PFAM:PF09754"
                     /translation="MASSLQYYIPTLQPQPDLSKSKLIIPTISIGNIPQLTIDLLIHT
                     YNFNKIGILNDTFLYPFASPIDYSPQHSEPKEGISHAIEIYHNNELNLVVVQQRSPII
                     PSYTSLFVQNVINPFIKHSGIQKVVLLNSQDLGLVKGLPHQGGSHGFNNETELENGHV
                     EVFSLADLMNCKFEELKLSSASITETESETRNNTSNDANIDDDESFAFVKSIFQAFDV
                     PTKTLESKAASNNSSNSTNSISSSKVTNHESTLKGLDLTVLVSYAYESDNFHDAETMM
                     QQLKEELNLLPKFKDFPLIKPVSWRGAYGDRAVPNAMEGGIFG"
     gene            complement(<397950..>401429)
                     /locus_tag="PVL30_003300"
                     /old_locus_tag="LELG_02459"
                     /db_xref="GeneID:5233153"
     mRNA            complement(<397950..>401429)
                     /locus_tag="PVL30_003300"
                     /old_locus_tag="LELG_02459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525851.2"
                     /db_xref="GeneID:5233153"
     CDS             complement(397950..401429)
                     /locus_tag="PVL30_003300"
                     /old_locus_tag="LELG_02459"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525901.2"
                     /db_xref="GeneID:5233153"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MNYSKTEEQPHAKRKRISQACDFCRSKKAKCDGLTPSCTNCAIS
                     EEECKYTQSSKRRGLPTGYTHDLEKRILILQGLLGKLLEIDDNTKDNIAKCVTDTKEF
                     VGELSLLNTNWSRSPSSKLVKLVMEEMSPVFQGVKTSNLVKATSTNANSATEGGRNSL
                     SQVSNSLSPSTSSESRPNNTNNNNNNDNNNNNNNNNNNSNNNNNNNNNNNNNNNNNNS
                     NPTQSKIKIEPSSNNNQPNQVPSVVIPPLPNPFPVMSQQYPFNSMVGTPSTMYPEPIN
                     FVNDPSFFLSYDIFQFLSDEIESAGNANILEPVALQYHGLSSIISGFTNKAIQQNYNQ
                     KGSRKKNPFRVGSIFNVSSFAINASLSDKIQLPPELFQLPANVHQLVSNYFQIFHIMI
                     PMLDKLVVNRQLHQLRTLYGDDQRQNVDCNLIALLWAVIALGEYSTNITGDLRTSMKY
                     AKVAIMALENSLTSTIETMQAMLLLGLYYYQAGQWDFSWVLISSSSRMAIDVRLMRTA
                     SDEEDNKFNPKFNNNNNNINSPSSNLKDTTSSSNIASSTWNSISRERTWATVYVLNTF
                     LSARMGRSPVVRAGDWPVPQIRNEGWEEWDPWSCYYAPETIKLDHGCFLSSFNEFLKV
                     MMILNMAITSTLDTSKGMIEDHEGEVKPDLKIDYDDRRNSNNMTMQDFQNSITEWRNG
                     LPEFAKLQKDNNSPNILALYGVEQLVWCVLSVRLSSINGGNNEMQQKVIKARNYYYTK
                     AVVELKKLFTTEVLELFRCYPFVDYVFTMMLNFPRMLDFTTEQEKIVFCKDVRLMMKK
                     AAETSAPMSISCEISSKMNTESQPQSPIEATPRAQESSNIANLLNSPGTKASALQPPL
                     INSSHNLSPQPSPPSKFHREIEAKGQVQLRDRQSNNEIDYIQQSKTLLDGVNALSPPT
                     NNRYREKFKRKASNSPTASIPSISQPPSNQNYNISHTGHSNNHNPQFIRNQSSTISST
                     STSNLPLMPSQIHHVSQIPQISQVPQSSNPLVRGSFPFYRSMGNTEQPQTQPQAQVQA
                     QPQAQTQTQTQNPPVSMMSPSGGGAYYAPHQSIGASPLQHPHSHPYPPHFGQALFTPQ
                     LVQQVYPIQSQQPPPPPTQQQIGLPHLSQQQQQQHQQQQHGQVNGENTHQSQTFVQPQ
                     PQPGVHHSPQSRQ"
     gene            complement(<404318..>405922)
                     /locus_tag="PVL30_003301"
                     /old_locus_tag="LELG_02460"
                     /db_xref="GeneID:5233365"
     mRNA            complement(<404318..>405922)
                     /locus_tag="PVL30_003301"
                     /old_locus_tag="LELG_02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525852.2"
                     /db_xref="GeneID:5233365"
     CDS             complement(404318..405922)
                     /locus_tag="PVL30_003301"
                     /old_locus_tag="LELG_02460"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525902.2"
                     /db_xref="GeneID:5233365"
                     /db_xref="PFAM:PF01144"
                     /translation="MMRSVLKLSRFSDIAYISRRYASSSIASTPKSKVVKTTDEALDG
                     VGSNITLLSGGFGLSGVPDTLINAMVNKPGINNITAVSNNAGLEGRGLSQLLVTGQIT
                     KMISSYIGSNRTFEKLYLTGQIDLELTPQGNLAERVRAGSAGIPAYYSPVGVGTWLEE
                     GKLPVRYDSNGEKVLKSSEPRETREFDGKKFLLEKAIFGDVAVVKAYKADTLGNCWFR
                     GSANNFNSIMGKNAKLTIVEAENIVEPGEIPPEDVHLPAIYVDRIIQSTTPKDIEICK
                     FSENVEINDGKEEGSAAATAAAAATVTAETASIENPQSASELKRAKIVRRAAQEFKDG
                     SFANLGIGMPTLAPNYLPQGIHVVLQSENGVLGLGPYPKRGEEDADLINAGKETITLN
                     PGASLFGSEESFAMIRSGKIDLTILGGLQVAANGDLANWGLPGRVKGMGGAMDLVSNP
                     DNTRVVVVMEHVDKKNRPKILETCQFPLTGQKCVSRIITDLAVFDIVDEKLVLIEIDP
                     DTTLEEVKAKTGANFTVSPELKKISI"
     gene            complement(<407009..>408019)
                     /locus_tag="PVL30_003302"
                     /old_locus_tag="LELG_02461"
                     /db_xref="GeneID:5233457"
     mRNA            complement(<407009..>408019)
                     /locus_tag="PVL30_003302"
                     /old_locus_tag="LELG_02461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525853.2"
                     /db_xref="GeneID:5233457"
     CDS             complement(407009..408019)
                     /locus_tag="PVL30_003302"
                     /old_locus_tag="LELG_02461"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525903.2"
                     /db_xref="GeneID:5233457"
                     /db_xref="PFAM:PF00775"
                     /db_xref="PFAM:PF04444"
                     /translation="MPSTLPKANISNGPQVSDMNDDTITQNTQIVNSQHSDMRLMFLL
                     SKAVQHLHDFARETRLTTDEWMAAIEFFTAVGKMCSDIRQEFILLSDTMGLSVLVDSL
                     SHPKPETATIGTLLGPFHTHDAEEKHEGESICSDGKGEPLVIEGLLTDTEGNPLANGS
                     IDIWHCDSNGLYDTQYENRENPDMRGITKTNEDGTFVIKCTRPVPYPIPHDGPVGKLL
                     QKLNRHPYRPAHLHFMIGKPGYDELITALYEKGDKYEKSDAVFGVKTPLLYTLTKLGE
                     EKAKKYDMKPDDWYLQWHFKIVSEADARKVKLEKTKEALGKLPSNVVLNQEGLPEFAP
                     LD"
     gene            <410361..>411230
                     /locus_tag="PVL30_003303"
                     /old_locus_tag="LELG_02462"
                     /db_xref="GeneID:5233057"
     mRNA            <410361..>411230
                     /locus_tag="PVL30_003303"
                     /old_locus_tag="LELG_02462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525854.2"
                     /db_xref="GeneID:5233057"
     CDS             410361..411230
                     /locus_tag="PVL30_003303"
                     /old_locus_tag="LELG_02462"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525904.2"
                     /db_xref="GeneID:5233057"
                     /db_xref="PFAM:PF01613"
                     /translation="MTQTEEPKRFGLESQVKRNPHADFGKVESSRPKFDSSIEWAYTQ
                     IPEKDWVAGSGANDNEWKSHKKIEIDPFGEGRNPVDNYKTLISAVVPRPIGFVSTISS
                     DGVRNLAPFSYFTLVNHDPPIFTIGFSGGRGNPKDTCKNILDTEECTINIISEWFVEA
                     ANYCAINSPIDVDEWKLSGLTPLESTKVKPQHVAESAFSVEGKLIASHEWKSKSDPTR
                     ATGTLCIIEGVNFHVREDVINKELNNIDISKLKPVSRLGGITYARTVHGYEKPRPDFD
                     KEVAKDEVKQLLE"
     gene            <412080..>413036
                     /gene="LIA1"
                     /locus_tag="PVL30_003304"
                     /old_locus_tag="LELG_02463"
                     /db_xref="GeneID:5233428"
     mRNA            <412080..>413036
                     /gene="LIA1"
                     /locus_tag="PVL30_003304"
                     /old_locus_tag="LELG_02463"
                     /product="deoxyhypusine hydroxylase"
                     /transcript_id="XM_001525855.2"
                     /db_xref="GeneID:5233428"
     CDS             412080..413036
                     /gene="LIA1"
                     /locus_tag="PVL30_003304"
                     /old_locus_tag="LELG_02463"
                     /note="BUSCO:EOG09263JZO"
                     /codon_start=1
                     /transl_table=12
                     /product="deoxyhypusine hydroxylase"
                     /protein_id="XP_001525905.2"
                     /db_xref="GeneID:5233428"
                     /db_xref="PFAM:PF03130"
                     /db_xref="PFAM:PF13646"
                     /translation="MSSEDQIENSSLEELRDILINKSGSVPLAHRFRALFSLKSIGSD
                     NSNPEQAHKAIEYIAESFRDNSELLKHEVAYVLGQTHDLHAASYLRDVLTDDNQQVMV
                     RHEAAEALGALGDKDSLDLLQKYFVNDPSLEIRQTCELAIERIKWENSESAKKENLEK
                     SLYESIDPAPPLATDATNSSKIDKLQSILNDQEKPLFERYRAMFRLRDIGTDEACLAL
                     ATGFDDPSALFKHEVAYVFGQLCNPVTVPSLIKILKDESEAGMVRHEAAEALGSIATD
                     ECLPVLRSFLNDKEQVVRDSAIVALDMYEYENSGQLEYATVQ"
     gene            complement(<413344..>413715)
                     /gene="RPA12"
                     /locus_tag="PVL30_003305"
                     /old_locus_tag="LELG_02464"
                     /db_xref="GeneID:5233288"
     mRNA            complement(<413344..>413715)
                     /gene="RPA12"
                     /locus_tag="PVL30_003305"
                     /old_locus_tag="LELG_02464"
                     /product="DNA-directed RNA polymerase I core subunit
                     rpa12"
                     /transcript_id="XM_001525856.2"
                     /db_xref="GeneID:5233288"
     CDS             complement(413344..413715)
                     /gene="RPA12"
                     /locus_tag="PVL30_003305"
                     /old_locus_tag="LELG_02464"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase I core subunit
                     rpa12"
                     /protein_id="XP_001525906.2"
                     /db_xref="GeneID:5233288"
                     /db_xref="PFAM:PF01096"
                     /translation="MSVVGSLIFCSYCGDLLDSHSASSDIQCNICSASYPKSQFANLK
                     VVTKSADDAFPSKLKSARSVVKTSLKKDELDEGATIKEKCPKCGNEEMQYHTLQLRSA
                     DEGATVFYTCTECGYRFRTNN"
     gene            <414543..>416189
                     /gene="CCT5"
                     /locus_tag="PVL30_003306"
                     /old_locus_tag="LELG_02465"
                     /db_xref="GeneID:5233002"
     mRNA            <414543..>416189
                     /gene="CCT5"
                     /locus_tag="PVL30_003306"
                     /old_locus_tag="LELG_02465"
                     /product="T-complex protein 1 subunit epsilon"
                     /transcript_id="XM_001525857.2"
                     /db_xref="GeneID:5233002"
     CDS             414543..416189
                     /gene="CCT5"
                     /locus_tag="PVL30_003306"
                     /old_locus_tag="LELG_02465"
                     /note="BUSCO:EOG09261HM3"
                     /codon_start=1
                     /transl_table=12
                     /product="T-complex protein 1 subunit epsilon"
                     /protein_id="XP_001525907.2"
                     /db_xref="GeneID:5233002"
                     /db_xref="PFAM:PF00118"
                     /translation="MAGAPQGMPDLSNAIVAQDEMGRPFIIVRDQGKKQRKHGVEATK
                     SHILAARSVASIVKTSLGPRGLDKILISPDGDITITNDGATILSQMDLENQIAKLLVE
                     LSKSQDDEIGDGTTGVVVLASALLDQALELIDKGIHPIKIANGFDEACKVAVEQLEKV
                     ADEMTIDDKSTLLKAAKTSLGSKIVSKAHDHFAQMAVDAVTEVADFKRKDVDFELIKM
                     EKKVGGSIEDSKLINGVLLEKDWSHPQMPKEVRDCKIAILTCPFEPPKPKTKHKLDIS
                     NVEEFKLLQEYEQKKFQEMIDHVKASGANVVACQWGFDDEANHLLLANGLNAIRWIGG
                     SELELLAIATNGRIVPRFEDLSADKLGKAGVIKELEFGTTKDRMLVIEECSNTKAVTC
                     FIRGSNEMIVAEGVRALHDSLCVVRNLIRDNRVVYGGGAAELTCSLAVSDAADRQVGI
                     DQYAFRAFAAALDTIPLTLAENSGLDPIETLSSLKAKQVREQNSHLGVDCLGKGTNDM
                     KSLFVIDPLIGKKQQLYLATQLTRMILKINDVIISGADDY"
     gene            <416766..>418034
                     /gene="ARP3"
                     /locus_tag="PVL30_003307"
                     /old_locus_tag="LELG_02466"
                     /db_xref="GeneID:5233206"
     mRNA            <416766..>418034
                     /gene="ARP3"
                     /locus_tag="PVL30_003307"
                     /old_locus_tag="LELG_02466"
                     /product="Arp2/3 complex subunit, actin nucleation center"
                     /transcript_id="XM_001525858.2"
                     /db_xref="GeneID:5233206"
     CDS             416766..418034
                     /gene="ARP3"
                     /locus_tag="PVL30_003307"
                     /old_locus_tag="LELG_02466"
                     /codon_start=1
                     /transl_table=12
                     /product="Arp2/3 complex subunit, actin nucleation center"
                     /protein_id="XP_001525908.1"
                     /db_xref="GeneID:5233206"
                     /db_xref="PFAM:PF00022"
                     /translation="MSMGTPAVVMDNGTGLTKLGFAGNDSPSFVFPTAIATSSASSKA
                     GKTGAGSRSSNLSSKRGLDDLDFFIGDEALEAASGPQYGLHYPIKHGQIEDWDKMERF
                     WESSIFRYLRCEPEDHYFLLTEPPLNPPENRESTAEIMFESFNCAGLYIAVQAVLALA
                     ASWTSPKVQDRSLSGTVIDSGDGVTHVIPVAEGYVIGAAIKNIPLAGRDITLFIQQLL
                     RDRGEPDTSLQTAERIKQQFCYVCPDIVQEFTRFDQYPQEKFAQYIVEYTEKNRNKVV
                     DVGYERFLAPEIFFNPEICSSDFLTPLPIVVDQVIQASPIDVRKKLYKNIVLSGGSTM
                     FKDFGKRLQRDLKVITKERVAISEKLSGVQSSGVDVQVISHKKQRNAVWFGGSLLAQT
                     SEFKSFCYTKSDYDEYGPSIVRNFSLFSVP"
     gene            <418453..>426219
                     /gene="TOR1"
                     /locus_tag="PVL30_003308"
                     /old_locus_tag="LELG_02467"
                     /db_xref="GeneID:5233456"
     mRNA            <418453..>426219
                     /gene="TOR1"
                     /locus_tag="PVL30_003308"
                     /old_locus_tag="LELG_02467"
                     /product="phosphatidylinositol kinase- protein kinase
                     tor1"
                     /transcript_id="XM_001525859.2"
                     /db_xref="GeneID:5233456"
     CDS             418453..426219
                     /gene="TOR1"
                     /locus_tag="PVL30_003308"
                     /old_locus_tag="LELG_02467"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol kinase- protein kinase
                     tor1"
                     /protein_id="XP_001525909.2"
                     /db_xref="GeneID:5233456"
                     /db_xref="PFAM:PF00454"
                     /db_xref="PFAM:PF02259"
                     /db_xref="PFAM:PF02260"
                     /db_xref="PFAM:PF08771"
                     /db_xref="PFAM:PF11865"
                     /translation="MAVTSSQGQQLHMQSTQQHQYQHEHLPSSSLPSQQQQQQQLSQQ
                     QSQQQQQQSSSSSQQQSSSSQQLQVIDGMALNGIFKGLTSNSKESRKKYAQELHNYLT
                     SISRDLSTEQFHRYNNDINKIIFDLLHRESSSEILGGIAALNALIEFDSGLGNENASK
                     TARFSNYLGSLILSNDITIMRQATKTLGRLATLGGNLTSDFVDYEAKRAIEWLQNDSK
                     AHENRRHAAILILTALADFAPLLLLPLINQILENLWQPLRDNKLLIRKDAAVALSRCM
                     EILNGRDPNLRQHWVRKLIELASKILNPHDKGDNSNYYNSNNNMSNNNGPDDSKLILA
                     STQSGGNIHGSLLVYEVVLKFYKDPFVASRFGSMYENSILYKNHKESVIRQELTNIFS
                     LLCKVDTDLFVERYLHRTFYYYLSQLKKYRGSHTESATADKCAIFYSIGKIAIEVGNQ
                     TATYLDAILDNIREGLAYTSSGGVQSILTNAGNQSDNATIIQANITAISSSSKTHITK
                     RGLEPAIFDCIGKLSIAVGPALTKHLQRDILDLMFANCSLSVHLQDVLQILCKNIPSL
                     SPLINEKLLHLLSLALAGKGFQPPGSPYGITKINRKLARDCRLIMISRDTGLGISSIR
                     DDHELYEHQDSQIIVQALEMLTAFPFENYQLNEFVRYCTITYLESNDPQVRLTATRTS
                     CEIFVKDPICQQVSINALNAVHDVLCKLLAISITDPVPEIRITGLKSLAAAGSFDPQL
                     SQAENVKLLFIALNDEVFEVKKVAMKILGRLSSINPAYIVPSLRKTLIQLLSKLDYSV
                     SSRSKEESAVLLSILISNSKELTRPYVKPIMASLLPKAKDASSSVASSAIKCLGELAV
                     VGGEDLKPFQSELMPLILDTFQDQSSFYKRDAALKTLGQFSSSSGYVIQPLLDYPQLL
                     GMLVAILKSDNSVSIRRETVRLLGILGALDPYKHREVEETSKNIPVEQNAPPIDVALL
                     MQGLSPSNEEYYPTVAITNLMKILKDPSLNLLHTKVIQAIMYIFQTLGLRCVTFLPQI
                     IPGLISVMHSSSHNMLKFYFQQLGDIILIVKQHIRPYLDDVLKAVKQYFVFNTSMNLQ
                     VTIILVIQSISKALDGEFKAYLPEILDLLLGVLEEDNSNDKISSFQVLKSFVIFGNNI
                     VEFVDIIVPTIVRMFESGPLELRIAAIETIGRLSRKVSLNDMASRIIHPILRILNSGS
                     IELREPCINTLNQMLLHLGAEFVVFIPVIKKTMVSQRINSPKFESLVNKLLSGDPLPH
                     SMEIYKEYDNNSNEPESDSSSKKLPVNQNALRIAWDASQRITKEDWQEWIDGLSKEML
                     LQSPSHAIRACASLAADYYPLAKDLFNASFASCWNELYSQHKEELVQAFCIALSSPTN
                     PPEIHQTLLNLAEFMEHDDKSLPIAISTLGQYAQQCHAFAKALHYKELEFYEEPTTPT
                     IESLISINNQLQQSDAAIGILKHAQLHHDLQLKETWYEKLHRWDDALEAYNERARVEP
                     DNMEVTLGKMRCFHALGEWEQLSELARSKWESTSNDMRRSIAPLAAAAAWGLGQWDRM
                     DDCIKVMKTASPDKAFFDAILNLHRNNFDEASNQISKARDLLVTEITALVSESYNRAY
                     GVVVRVQMLAELEEIIKYKCLPQGSEKRAVMRKTWNTRLLGCQRNVDIWQRMLKVRTL
                     VIKPKQDMDMWIKFANLCRKSGRLNLAEKSLNLLLEEGSAENPSRAPPQVVYAQLKYM
                     WAKGQRPEALRHLVDFTTRMSQDLKLNPNDLITQPLPSEGPGIPKHVEEYTRLLARCF
                     LKQGEWQIALNSNWRLETSEIILGAYLLATHFDSKWYKAWHNWALANFEVISLYTSEV
                     QMGNNDNNNSNNNSLNSNNKVEHLEDQPLNNGQPRDANFDKYNGNNKSNNSNNNNNNN
                     NNNNNNNNNNAGFGAGAAGAAYGTNIVMMETVQRHVIPSIKGFFHSIALSNTNSLQDM
                     LRLLTLWFKFGGIPEAAKAMTDGFSMVKIDNWLEVIPQLISRIHQPNEIVSSSLFGLL
                     TELGKAHPQALVYPLAVAITSESASRKKAAQSIIEKMRFHSATLVDQSELVSKELIRV
                     AVLWHEQWYEGLEDASRLFFGEKNTDKMYEVLEPLHQMLQRGPETMREQAFANAFGRD
                     LADAFEWVMNFKRTNDVTNLNPAWDIYYNVFRRITRQLPQLVSLELQFVSPMLEKAHN
                     LELALPGTYEAGKPIIRIVKFDPTFSVISSKQRPRKLSIRGSNGKDYQYVLKGHEDIR
                     QDNLVMQLFGLVNTLLVNDPECFKRHLDIQRYSAIPLSPKVGLLGWVPNSDTFHMLIK
                     GYRESRSIMLNIEHRLLLQMAPDYDILTLLQKVEVFTSALDNTRGQDLYKVLWLKSKS
                     SEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLNRTTGKVIHIDFGDCFEAAIL
                     REKYPEKVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLRDNKESLMAILEAFAYDP
                     LINWGFDFPTKVLAEATGTRVNLVNVKDLLRAGKIDEVEAARLQKQNQLEIRNARAAL
                     VLKRITDKLTGNDIKRLKGLDVPTQVDKLIQQATSVENLCQHYIGWCSFW"
     gene            complement(<426347..>427492)
                     /gene="RCL1"
                     /locus_tag="PVL30_003309"
                     /old_locus_tag="LELG_02469"
                     /db_xref="GeneID:5233100"
     mRNA            complement(<426347..>427492)
                     /gene="RCL1"
                     /locus_tag="PVL30_003309"
                     /old_locus_tag="LELG_02469"
                     /product="rRNA-processing endoribonuclease"
                     /transcript_id="XM_001525861.2"
                     /db_xref="GeneID:5233100"
     CDS             complement(426347..427492)
                     /gene="RCL1"
                     /locus_tag="PVL30_003309"
                     /old_locus_tag="LELG_02469"
                     /note="BUSCO:EOG0926307V"
                     /codon_start=1
                     /transl_table=12
                     /product="rRNA-processing endoribonuclease"
                     /protein_id="XP_001525911.2"
                     /db_xref="GeneID:5233100"
                     /db_xref="PFAM:PF01137"
                     /db_xref="PFAM:PF05189"
                     /translation="MSSKKDVVTFEGHKNFRLRIILSTLSGKPVKITKIRSNSLNPGL
                     KDYEVSFLRLIESVTNGSHIEISYTGSTVIYRPGIIIGGEITHNCPLSKPVGYFIEPA
                     LMLAPFSKKKFSILFKGLTNSPNEVSVDTIKWGFLPIMEKFGVRDCLLHILKRGSPPL
                     GGGEVHLVCNSLLPVPLTIHAIEVPKFSAIRGVAYCTRVSPSTVNRMIDAARQVLKGT
                     GCEVNIAADVWRGENAGKSPGFGVTLVAESKRGFRISSDNVGAAQTLPEEVGETTAYQ
                     LMEEITTSGCVDRYQLPLCLVYMTIGKEDIGRIKIHKSQVNEDLVYMLRDIKSIFGTE
                     AFLKSDDDDEADYSYDGGEKGRGNNGDSFITLSLKGSGFVNIAKKVA"
     gene            <427979..>429631
                     /gene="TAF4"
                     /locus_tag="PVL30_003310"
                     /old_locus_tag="LELG_02470"
                     /db_xref="GeneID:5233367"
     mRNA            <427979..>429631
                     /gene="TAF4"
                     /locus_tag="PVL30_003310"
                     /old_locus_tag="LELG_02470"
                     /product="transcription initiation factor TFIID subunit 4"
                     /transcript_id="XM_001525862.2"
                     /db_xref="GeneID:5233367"
     CDS             427979..429631
                     /gene="TAF4"
                     /locus_tag="PVL30_003310"
                     /old_locus_tag="LELG_02470"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription initiation factor TFIID subunit 4"
                     /protein_id="XP_001525912.2"
                     /db_xref="GeneID:5233367"
                     /db_xref="PFAM:PF05236"
                     /translation="MSEDLKRSASDIQDELAQSPKRVKFNDPPQIDDVNKYDANNVNA
                     NANVNANANVNANANDGNSNNFASIASNVTTNPIDSTVTQPQPVSPEIQNPITTLLQT
                     DPGVGASKDSSTTNGSAINITKNADTNNIETNTASINPVSNTNTNTKPASVDTVDIKS
                     VSANTADTATDTKPVSADNADTATDTKPVSADTADTADTDADAKPASANTSNTTNANT
                     AGTGASNTDVANSSSATTSTGDAKPQVQGANETGSNQHDQRDSSKLNDAIAAAGVDIQ
                     KEEELLQQRQSNRKPGAPSEKQDGSKSQTQVPLLNPYHLSAFLAKVSKTHQIHQNFLE
                     DGNLLNLISDACEDWLSHIASKALILSRHRRRGTQFSSKKGGSSSSTQLSQQRSAVSK
                     ELRNLALRQKEMEEKRVQKRIALGLEKSSGNGTDDAANGKPGSEETLHRAANATAAMM
                     ATGKKKYSWMSSGGGGAGSIGSLGDDARGSGVGIGGGGVGGGDSKTKQSAILSTRGDN
                     GLRYRDLRSTNAIVLKDLLNALEGEKKGTQHAITKGYAKLRD"
     gene            <430933..>434628
                     /gene="cnd1"
                     /locus_tag="PVL30_003311"
                     /old_locus_tag="LELG_02471"
                     /db_xref="GeneID:5233314"
     mRNA            <430933..>434628
                     /gene="cnd1"
                     /locus_tag="PVL30_003311"
                     /old_locus_tag="LELG_02471"
                     /product="condensin complex non-SMC subunit Cnd1"
                     /transcript_id="XM_001525863.2"
                     /db_xref="GeneID:5233314"
     CDS             430933..434628
                     /gene="cnd1"
                     /locus_tag="PVL30_003311"
                     /old_locus_tag="LELG_02471"
                     /note="BUSCO:EOG0926079Q"
                     /codon_start=1
                     /transl_table=12
                     /product="condensin complex non-SMC subunit Cnd1"
                     /protein_id="XP_001525913.2"
                     /db_xref="GeneID:5233314"
                     /db_xref="PFAM:PF12717"
                     /db_xref="PFAM:PF12922"
                     /translation="MDFNLQSYFNEFDVDKEYDVQFDDLNGKLGLVTDTLAHDSQAIV
                     SNPELFEDILELAQGYRKLESKQQRQLSYLLASSFNNIGQSLSRGLVEDDYQDGLDQI
                     KTTLERYGYLIYVLMKFLGSEDHSQISAARSQKKVPRDVLAKWNSNCADVENALLAIK
                     SVLNIDLDKVFLTTPERDAYVELFSRPIINLMESPERMKVEGLRVLIYDVLAVAVTKH
                     AHGEIMQHSIIQSLTYYAHLPPYMAIFLSLLNRKYDHPYLTERILREIAQTRFIANDT
                     NGPKAIAEFITKLSELSPHQMFKQMTSISQLLTNTNFTLRCAVVEACGNVIIGVLKDR
                     SRFSLIETANDFNGADNNNNSSSNDNNNDNDNDNNNNNSSSSSGDGEDDSEKVDNGRQ
                     SDEVHVGKLLDLLAERVFDQNPFVRSKAIQALTRVAESSLKAPAKRQQILRLAVNSLD
                     DRSTLVRRNSIKLLGKLILKHPFQGTHGTQLSRKFWSSQLQDAEDEYIACIPKPMDLG
                     ADMEMEEDTGDEMQEDNAEEKDDENDNIREEQEEFDGGEKSENSDNDEEDREEETERL
                     SATETAAATSSSSSSSSTTGESPLSSASTINHQQTPSPIAIARAKLKRDFYKDAVKFI
                     KTAEKGTTTICRLLFSRNRNEAIDAMDFIVLADAFGIENANYGIKRMLHLVWVKGTSE
                     EGKSVSAHLIDCYKALFLRAPEGASTTQKAAHIAKSLMGLTKGASVADLASLEKLLCM
                     MYRLNMIHSEIIAVLWQVYKTEVEDTDEIIEMRRSSIKILGMLGTDEPKIIAQGFSSI
                     LNIGLNEKGLHDLELCRYSCIALQKLDLAFFSSSIENSQERQKEATDRIVNVLLHVHD
                     DAEWFAVAEQAIDAIFEICNDPVDLCSDLIREKSNSVFASQKFSELQKCTALSQLLFI
                     VGHVAIKTIVYLESLEAQFKKKRQHAETKATEGNKADHERDEELEMIGGTSEDDFADA
                     VQHVREKELLYGQTSILAGFGALVKRICSMPKKYDNLNLQRHATLCLVKLMCISSIYC
                     EENLPLLLSIMEKSQDPVIRCNCVLGLGDLAVSFNRLIDENTDFIYRRLTDENIMVQK
                     TCLMTVTFLILAGQVKVKGQLSSMAKCLENSDQGISDMCRLFFTELATKDNAIYNGFI
                     DIFSGLSFDESLSHESFKKIIKFLLGFVTKERQQKQLSEKLLVRLKKAKSEKEWKDIA
                     FALETIPNTNADIAAILKEGYQMVSAK"
     gene            <435280..>437085
                     /gene="ale1"
                     /locus_tag="PVL30_003312"
                     /old_locus_tag="LELG_02472"
                     /db_xref="GeneID:5232987"
     mRNA            <435280..>437085
                     /gene="ale1"
                     /locus_tag="PVL30_003312"
                     /old_locus_tag="LELG_02472"
                     /product="Lysophospholipid acyltransferase"
                     /transcript_id="XM_001525864.2"
                     /db_xref="GeneID:5232987"
     CDS             435280..437085
                     /gene="ale1"
                     /locus_tag="PVL30_003312"
                     /old_locus_tag="LELG_02472"
                     /note="BUSCO:EOG0926251E"
                     /codon_start=1
                     /transl_table=12
                     /product="Lysophospholipid acyltransferase"
                     /protein_id="XP_001525914.2"
                     /db_xref="GeneID:5232987"
                     /db_xref="PFAM:PF03062"
                     /translation="MIAVIQTFLNLISDNTGLDQASVKILLCTLLSYPFSIIFKRLPD
                     REYTLKNVYVVIVSAFYVFGICDLRSGFGTLILSTLGCYFITRYLRTSSMPWVNFIFL
                     MTHMAYSHFHLQFFADYDPRVIDITGAQMILVMKLSAFGWSVYDGKQPLESLSEYNRS
                     RAIKQHPNILPFIGYSFFYASLLTGPAFDYADYDKFIHATLFDDVPEDKRPGRRRKRL
                     IPKSGKQATSKLFQGFFWAALLFVVPKYVELDEVFTKSFIYNHGFVYRIFYMWGLGFL
                     YRLKYYAIWLIAEGACILCGIGYNGIDATTGKFKWNRVQNIDPLAFETGQNVHACLEA
                     WNQNTNKWLKHYIYLRVAKPGRKPGFKSTVFTFATSAFWHGTRPGYYLTFVIGAFMQT
                     VGKYYRKNIRPLFLTADGSPKPTKRVYDFVSWVVTQLAFGFAVQPFVILDFKKSLLCW
                     ATVDYWLVAAIAITFFIYNGPLAKYFKISQKKKLPVKINETKELSSDKKLSTKEHGYV
                     TNAIDKKLGKEYDSPTLGLPSLDVFEDLDKSELDEDIEHLHQAWESFKKRRFLDDEDA
                     EGLKSAYSNFTDEINEIYRAKKDEFFASDDKPKQS"
     gene            <437866..>439092
                     /gene="HEM15"
                     /locus_tag="PVL30_003313"
                     /old_locus_tag="LELG_02473"
                     /db_xref="GeneID:5233159"
     mRNA            <437866..>439092
                     /gene="HEM15"
                     /locus_tag="PVL30_003313"
                     /old_locus_tag="LELG_02473"
                     /product="ferrochelatase hem15"
                     /transcript_id="XM_001525865.2"
                     /db_xref="GeneID:5233159"
     CDS             437866..439092
                     /gene="HEM15"
                     /locus_tag="PVL30_003313"
                     /old_locus_tag="LELG_02473"
                     /note="BUSCO:EOG09262BHE"
                     /codon_start=1
                     /transl_table=12
                     /product="ferrochelatase hem15"
                     /protein_id="XP_001525915.2"
                     /db_xref="GeneID:5233159"
                     /db_xref="PFAM:PF00762"
                     /translation="MRAAMFSNFRSRLSCCGPFAHRFGSRLNSSVSSNGNITSNKSPT
                     GVVFMNMGGPSKVEETYDFLLRLFQDGDLIPFGIFQKPLGKLIAKRRTPKIEEHYKEI
                     GGGSPIRKWSEYQCKKLCEILDETNPETAPHKPYVAFRYAKPLTEETLAEMKKDGVKR
                     AIAFSQYPQFSYSTTGSSINELYRQTLKHDPERSIEWSIIDRWPQQNGLVKAFASNIK
                     EKLAEFPPEIRDDVIILFSAHSLPMEIVNLGDSYPAEVGATVYKVMESLNFSNPYRLV
                     WQSQVGPKPWLGAQTAKIIDKLEKRDDVKGIVLVPIAFTSDHIETLHELDIEIMEEAE
                     NPEKIKRAESMNGNEVFIKGLADLVAEHLKSGRKYSKQLELDCILGGEKAHGTFKHPD
                     EMFGKQSPQSSKPTQN"
     gene            complement(<439239..>440240)
                     /gene="MED4"
                     /locus_tag="PVL30_003314"
                     /old_locus_tag="LELG_02474"
                     /db_xref="GeneID:5233204"
     mRNA            complement(<439239..>440240)
                     /gene="MED4"
                     /locus_tag="PVL30_003314"
                     /old_locus_tag="LELG_02474"
                     /product="Mediator of RNA polymerase II transcription
                     subunit 4"
                     /transcript_id="XM_001525866.2"
                     /db_xref="GeneID:5233204"
     CDS             complement(439239..440240)
                     /gene="MED4"
                     /locus_tag="PVL30_003314"
                     /old_locus_tag="LELG_02474"
                     /codon_start=1
                     /transl_table=12
                     /product="Mediator of RNA polymerase II transcription
                     subunit 4"
                     /protein_id="XP_001525916.2"
                     /db_xref="GeneID:5233204"
                     /db_xref="PFAM:PF10018"
                     /translation="MLPYRRPDSPLLSSSISRTASATKLNQLYQDSATRSATATPSAY
                     VTSSLNPARNVPILDSSSRFQNGNSSIDSLPVISHIDEFRALLDELSEAVTSFKDDEV
                     FTKFEKLTKLNTTIENDIKELHLHKQRRKSLKQLQNRHKSLDDLQKNTLKKLLSYRSE
                     LRKLPRAKTYELKQDKDNDPNSLKIDVKDIFAYSMKLAKFSKAPVAMGNLSHQIHPNN
                     YIWPAEDSLRRGMLAMSYIQEKEILENVLGEEKPVSVAKEETSKENSERVSISPSKES
                     GDTSLNGTPHPSNRDHIEIAPTAPTAPTAVDEDENGYSNEVADLDLDLFDPDAELSD"
     gene            complement(<440717..>442390)
                     /locus_tag="PVL30_003315"
                     /old_locus_tag="LELG_02475"
                     /db_xref="GeneID:5233627"
     mRNA            complement(<440717..>442390)
                     /locus_tag="PVL30_003315"
                     /old_locus_tag="LELG_02475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525867.2"
                     /db_xref="GeneID:5233627"
     CDS             complement(440717..442390)
                     /locus_tag="PVL30_003315"
                     /old_locus_tag="LELG_02475"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525917.2"
                     /db_xref="GeneID:5233627"
                     /db_xref="PFAM:PF00076"
                     /translation="MSYYNIQRDHSRRYERSERSERSEQRHGGYNSNYGRNTQDGGGH
                     TGHQNRNYRNHHDYSARSTPNQYSSYASSSYRSRQNVYSQHNQNYDSTQQSQSGQSGQ
                     SGPSGPSGGHQHQQFQMWMGDLDPYWTEESIKTMWSTLVSAPIFVKIVRDRVNPSKPQ
                     FAFVGFDSQESLDLAVKRNGQPVPQSSRRFKLNYTKSGGRGSSYAQSQSRSQSQFHAQ
                     SQFQAQSQFQSQSQSQYNVGSRFGSGVKGKGGVVGTHNGAAATSAAFGSGIGNNSSYS
                     NSYNNSIGGEFTMFVGDLSPEVSESALFAKFNLKYPNQIRSARVIMDPLTKKSRGFGF
                     VKFNGHDTLNKALKEMQGLMLGSKAIRVGIAAGSETALQSAPSETRNELYRIQLPQPQ
                     PTANYNSDENNTTLTLTNLQSLITEKELEQHFAAFGDIVYCKITTDGQTGHVKFLLRS
                     SANSALMYMNGLQINGLKPVIGWGATMRVLNEKTNFLPSNSGRYEASDPVPSLYMPNR
                     FKKRKFDNFDETVVKALKSELDESEIHQTNQIDSIYLDDKIARAAILES"
     gene            complement(<442758..>445422)
                     /locus_tag="PVL30_003316"
                     /old_locus_tag="LELG_02476"
                     /db_xref="GeneID:5233287"
     mRNA            complement(join(<442758..443444,443633..444013,
                     444166..444174,444898..444904,444957..445196,
                     445382..>445422))
                     /locus_tag="PVL30_003316"
                     /old_locus_tag="LELG_02476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525868.2"
                     /db_xref="GeneID:5233287"
     CDS             complement(join(442758..443444,443633..444013,
                     444166..444174,444898..444904,444957..445196,
                     445382..445422))
                     /locus_tag="PVL30_003316"
                     /old_locus_tag="LELG_02476"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525918.2"
                     /db_xref="GeneID:5233287"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MANITDTTEVAAEKYFQKPDEIHYRYAKHVLRYLVLTKKLMHYL
                     TCEEGDENYVAYNDRTFLSLSDDLISMTISDDISKTVRKDGITGDIKLGYAPEIPPIV
                     YVIDNSRNGVLHNSEEMQKGEIRYLRHGDKLELKTACTIEFFESESCSVIDSPAMSQV
                     TQSVNGWQISSIKLGSGSFGSVHIARSLIHKGAFAVKIIPKQKTSRFDNSKVFQSREA
                     TLLSKINHPNIIKIHEAIEKNNKFYIFQDLICGGDLFSYLVNDNYLKAIPEREAIFIV
                     FQIMKALQFLHKNLLIVHRDLKLDNVLMHIPLPKSRIYLCDFGIAKQLPSGRTTTCVG
                     TIEYSAPEVFKCDSNGRAIEAYNFKCDIWSLGIITHILLSGISPFYAHEKASILLASR
                     EGKLNFNRKQFSHTSSLAQRFVSALLKVDASKRLDIDECFEHGWIKRNKAKLEAFYRD
                     HILI"
     gene            <445614..>445937
                     /locus_tag="PVL30_003317"
                     /old_locus_tag="LELG_02478"
                     /db_xref="GeneID:5233535"
     mRNA            <445614..>445937
                     /locus_tag="PVL30_003317"
                     /old_locus_tag="LELG_02478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525870.1"
                     /db_xref="GeneID:5233535"
     CDS             445614..445937
                     /locus_tag="PVL30_003317"
                     /old_locus_tag="LELG_02478"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525920.2"
                     /db_xref="GeneID:5233535"
                     /translation="MFNSLSKRLIAKRFQSSTTRASTTKEAHPFQNKFNFNLNPPQVH
                     EYWNIYNTSVLLAFIPVFLGTAFIAKDIGSQIQGYTGLLQYADGEKSPLKSIKFDDAK
                     EISKE"
     gene            <446320..>447245
                     /locus_tag="PVL30_003318"
                     /old_locus_tag="LELG_02479"
                     /db_xref="GeneID:5232943"
     mRNA            join(<446320..446323,446335..446341,446609..>447245)
                     /locus_tag="PVL30_003318"
                     /old_locus_tag="LELG_02479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525871.2"
                     /db_xref="GeneID:5232943"
     CDS             join(446320..446323,446335..446341,446609..447245)
                     /locus_tag="PVL30_003318"
                     /old_locus_tag="LELG_02479"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525921.2"
                     /db_xref="GeneID:5232943"
                     /db_xref="PFAM:PF05821"
                     /translation="MFDKTSLRSVQRIVRSGVLQNATAKQVNCAQLGSIRTIRNYSDK
                     TILDLPTGKTITLADPNHPEYGDYKNPEPVLAQSRDPYAKYDDQQNRRNLNDPVNMDA
                     DLYDMWSPDYYDFVSDSEALKQNAIFFGLLFGAAGLVAYFQLNPEKPAMIRSFPYNGM
                     AEALGSTSDENAPFYQAKVDHTAEKECGVLPQDVEQKSNTESYLKANDAFINTSK"
     gene            <447979..>453291
                     /gene="SWR1"
                     /locus_tag="PVL30_003319"
                     /old_locus_tag="LELG_02480"
                     /db_xref="GeneID:5233264"
     mRNA            <447979..>453291
                     /gene="SWR1"
                     /locus_tag="PVL30_003319"
                     /old_locus_tag="LELG_02480"
                     /product="swr1 complex component"
                     /transcript_id="XM_001525872.2"
                     /db_xref="GeneID:5233264"
     CDS             447979..453291
                     /gene="SWR1"
                     /locus_tag="PVL30_003319"
                     /old_locus_tag="LELG_02480"
                     /codon_start=1
                     /transl_table=12
                     /product="swr1 complex component"
                     /protein_id="XP_001525922.2"
                     /db_xref="GeneID:5233264"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF07529"
                     /translation="MPNARTGKRSSSRLSQNTTSTSEDSFESSNLQRNKRQSPNPYAN
                     SNGNDNDSVDQQQEQPQKKKPKTQGKTKEVQLATILTDFAEAVNELYQLLEYASIVAW
                     KPNEFSENNPQQSLREHYKAFCDDNNYRIKWNDEIEDDTSIKSLPLRFQRKKLTEREN
                     ALQNMYPFRKEVFTLQKQMEENRYISKKPEVNQKLNLDPQQQWQQGQQEQQEQQQEQQ
                     QEQLPGKSKSTTTNNKTNTSKKVVKKVEPPPKSNDKLKSKPKSKHKPTLRAREIESSE
                     IKEIEKNEKITEIYVATKESTDDKLVEHSDDEEGLEVHEEQIEEEEEEEGEEEEEEGE
                     EEEEEEEEKSDQSPNPHGVFHNNSKKVSVSLTVPSLLITHPSHIPGWQPQPQDQMQTD
                     IAATERDLQHLDYQPQTIRVTNLNNAQREVTSSLSQRLSTFLENRYKTPIIDEANAID
                     FAYTKEEYDEINKQQQKMFKDIYNKIYAENTLVFTNQKIERRKIVLPPSSSNFKLNDP
                     FRNANAVSPKLPGTSNNMTFQDHLVAQGASFSRIHHQMRKQHINRARKVALIVDQHFK
                     RKRGEKERLQRERELSLKKLSRTVMQAVKRRWNEAAKVYSIIQSEKDEELKKIKGREH
                     LSQMLEHSTQLLEAQLISSREQTADAESNFDNSEMSPSSDDFDASKDSDDYLSSSDSD
                     DDNENNDYEGAKPLSKMSSNQNLTEISSTDDNDFNLSVDELRKKYAGIEGSMEAAELS
                     EIKTNDIKMKNLEDDDKNGINTKNASQELITNSESETTALSIKNGKMSGKTLMNESED
                     NLGSEVDNDSSDADAKPVSSLISLLGGGMEDSDDDDDDEDAELDSVYSSSDEEMSTSG
                     DDDDDEKEEEEEKETEEEETEEKQKEKEEEVESEKDTEVGVEKEVNGESKANNRETPI
                     SNGHVDDTHKESEEDTGAVEIINGAKVKDVPVPQLLRGTLRPYQKQGLNWLASLYNNN
                     TNGILADEMGLGKTIQTISLLAYLACEHHVWGPHLIVVPTSVMLNWDMEFKKFAPGFK
                     VLTYYGSPQQRAQKRKGWFKPDAFHVCITSYQLVVQDQQAFKRKKWRYMILDEAHNIK
                     NFRSTRWRALLNFNTENRLLLTGTPLQNNLMELWSLLYFLMPSSKANMAMPEGFANLE
                     DFQQWFGKPVDKILEQTTLTNNADLIDENEKTTSKMDEETRNTVSRLHQVLRPYILRR
                     LKKDVEKQMPGKYEHIVYCRLSKRQRYLYDDFMSRAKTKETLMSGNFLSIINCLMQLR
                     KVCNHPDLFEVRPIVTSFAMPEAVSSTYLAINSAVQNWTNGNAMDCVDLKVLNLDITR
                     HENLDYFVADSASKLVSITDFEKQIAQLKSVSSEVNTFENPHYVKSYQQLKALDQIEA
                     RDKIQHVSYINKLRCNRKPIYGKSLLNKLKIVKPVDSNDTSIQLGITVSQRAELMTDA
                     IEKFSILTPAVVTLDLNNQMFSKSLQDRVHSEVLDGKILNPFHQSQVKLSIAFPDKTL
                     LQYDCGKLQKLATLMRDLVANGHRALIFTQMTKVLDILEQFLNIHGYRYMRLDGATKI
                     EDRQLLTEKFNRDPKIPVFILSTRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCH
                     RIGQVRDVHIYRFVSEYTIESNIIKKANQKRQLDNVVIQEGEFTTDYFGKFSVRDLVS
                     DSNVTDIAERTIDFSGDSKMGSVLAQAEDEEDRAAAGAAMKEVAVDDEDFTEDANGRR
                     ENSDLALNTATANDEGDADMDLDYDEGIGHIDEYMLRFISEGYL"
     gene            <453798..>454139
                     /gene="VMA10"
                     /locus_tag="PVL30_003320"
                     /old_locus_tag="LELG_02481"
                     /db_xref="GeneID:5233039"
     mRNA            <453798..>454139
                     /gene="VMA10"
                     /locus_tag="PVL30_003320"
                     /old_locus_tag="LELG_02481"
                     /product="H(+)-transporting V1 sector ATPase subunit G"
                     /transcript_id="XM_001525873.2"
                     /db_xref="GeneID:5233039"
     CDS             453798..454139
                     /gene="VMA10"
                     /locus_tag="PVL30_003320"
                     /old_locus_tag="LELG_02481"
                     /note="BUSCO:EOG09265PWR"
                     /codon_start=1
                     /transl_table=12
                     /product="H(+)-transporting V1 sector ATPase subunit G"
                     /protein_id="XP_001525923.1"
                     /db_xref="GeneID:5233039"
                     /db_xref="PFAM:PF03179"
                     /translation="MSSGIQSLLKTEKEAAEIVNEARKYRTNRLKTAKQDAQQEIENY
                     KKQKEADLKKYEQEHEGINEKIDKEADAEVEKELKDLKKQFTEKKQSVIKLLVDATIT
                     PNPQLHINAGH"
     gene            complement(<454575..>456422)
                     /gene="MSC7"
                     /locus_tag="PVL30_003321"
                     /old_locus_tag="LELG_02482"
                     /db_xref="GeneID:5233232"
     mRNA            complement(<454575..>456422)
                     /gene="MSC7"
                     /locus_tag="PVL30_003321"
                     /old_locus_tag="LELG_02482"
                     /product="Meiotic Sister-Chromatid recombination aldehyde
                     dehydrogenase"
                     /transcript_id="XM_001525874.2"
                     /db_xref="GeneID:5233232"
     CDS             complement(454575..456422)
                     /gene="MSC7"
                     /locus_tag="PVL30_003321"
                     /old_locus_tag="LELG_02482"
                     /codon_start=1
                     /transl_table=12
                     /product="Meiotic Sister-Chromatid recombination aldehyde
                     dehydrogenase"
                     /protein_id="XP_001525924.2"
                     /db_xref="GeneID:5233232"
                     /db_xref="PFAM:PF00171"
                     /translation="MIAIDLEFHHWQWQYQISTTFILFVIIPALYYIYSKYITSSPNG
                     YNKLESPIKLTVTIPDEARPNWKGKRLYPKPSIIVENEPTKIRGYCPATGQDLGIYET
                     TSRSQMDEMIAKAAKAQKHWSKSSFTLRRKLLKTLARYILENQENIARIACRDSGKTK
                     LDASMGEIMVTLEKLNWIIAHGEKTLKPSQRPGPSNFLLGFLKNAEVRYEPMGVVSAI
                     VSWNYPFHNLMGPIIAALFTGNAIVVKCSENVVWSSQWFVEMCRAALKALNIDQDLVQ
                     LCFCFPEDANYFSSHPGLNHITFIGSETIAHHVVANAAKELTPCVVELGGKDSFIILD
                     DIKDVNAISSIVLRGTFQSAGQNCIGIERVICLPNVYKQLKEILSERVKQLRIGSDID
                     QLDDVDMGAMISNNRFDQLEELIADAVLKGAKLLHGGKPYQHPNYPQGHFFEPTLLVD
                     VDESMRIFHEEVFGPILTMIKANNVDEAIKLANGSKFGLGNSIFGSDFTQLNKLADEL
                     KSGNVAINDFATYYVAQLPFGGVKKSGYGKFGGEEGLLGLCNAKSIVMDKPFFRLMGV
                     ATAIPPPIDYPIPDGKRAWNFVRNLNIAGYDGRMWAKVKAFKSLARGGA"
     gene            complement(<456975..>459494)
                     /locus_tag="PVL30_003322"
                     /old_locus_tag="LELG_02483"
                     /db_xref="GeneID:5233341"
     mRNA            complement(<456975..>459494)
                     /locus_tag="PVL30_003322"
                     /old_locus_tag="LELG_02483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525875.2"
                     /db_xref="GeneID:5233341"
     CDS             complement(456975..459494)
                     /locus_tag="PVL30_003322"
                     /old_locus_tag="LELG_02483"
                     /note="BUSCO:EOG09260TDY"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525925.2"
                     /db_xref="GeneID:5233341"
                     /db_xref="PFAM:PF04910"
                     /translation="MSARALKKLGGKSLEDELRALENKRLGHTKNGKKATNNADGVDE
                     DTDEEDKDKAEQEDEEEEEEEEQQQEKNQTNSSKSRFNAFAFLNDDDDDDDDDDEEED
                     DDDNDEEEKKQGKDDKNDESIENDIEGSSTIDSINEPESNSSIQPVLQSKNSKKQKKK
                     TKTKAKAKSKKKAKSQSPGLNNEGTSRKDTEEDDDDEDDDEDLDAILAELSMKDRQND
                     SMKGTVHFASESFTFEDEFDSINEPQQFFDSNYKKFTTKKLKESLPLLSVNSVRNLDP
                     DQEYRNLFGNSLSFDLIEDANSTSSLAILPEALEQYKKLAKMTRNWGGKDRRNIPGTS
                     RKLLLSKIRDDWLPTHLKSVSMELLSNDEVRQIYAYKEDIISEDELETKLERERELGV
                     QYFRFNKVHDIKNRVANTKFYAATVLTPDPESLFQLLQVSPYHHETLLQVAMVLLRQG
                     DNKATSNALIERSLFTFDRSFHRVFHELLSSAQNGLIRLPYEFFSNRQFYLNLFRYIV
                     SLGERSLFSTAMSYCKLLLSLSPAEDPMGVRYFMDFYAIMSDNFDYLIKFRKSPLVTC
                     YTRWYTPGIAFSTALAYLKLEQTELAIEELRNAVKEHPYTAYKILTEICISNNVHLKD
                     SDFDVDAETLISAETYLVRAKILWASDLEFLTINLESNLAENRQKSSGWFFGSSGSSS
                     GSGSGSGSSPGSSSGGNGSITNTLKNFFGRVGLEGSTSASAKNKDVPFNLVRFAILSG
                     ENKIMGKLPQKIWNRDDLHEYDVLPPQDVLYGSESLDTQSHRERPKITDSFIDYVDQN
                     LLGAIVQERTRGDDRQLTEDEMNIMRQLLEQVNERDNELEE"
     gene            <460084..>461889
                     /locus_tag="PVL30_003323"
                     /old_locus_tag="LELG_02484"
                     /db_xref="GeneID:5233079"
     mRNA            <460084..>461889
                     /locus_tag="PVL30_003323"
                     /old_locus_tag="LELG_02484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525876.2"
                     /db_xref="GeneID:5233079"
     CDS             460084..461889
                     /locus_tag="PVL30_003323"
                     /old_locus_tag="LELG_02484"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525926.2"
                     /db_xref="GeneID:5233079"
                     /db_xref="PFAM:PF00621"
                     /translation="MYTKQHLQSSTRLSGQPHTSTETEDKAESAVLVSSKSLDFVFKN
                     VRFNYSISRHLNENSMLSKPKSAEFLFDDYESSPSPSIVFFPQPGPKQSELIYLQKTL
                     DEVVYTERSYLEKLYYLKKMYLDSVSSNIKIELPTPIVIIRLCLEQIINIHETILYDL
                     DDIMSNKITNIKKQVDKVSVLLAQIGLHNFWYSWFCIQHETVGKTFNEAKNMSNKTNF
                     KNINRSTQSMVQGVRNLIEAGQVGVQNKDLSFSSLCRQPISRILKYPLFLKDLSKKYS
                     ILGFDNTILEKNLSIIHRSLDQINDAKKNFDESIQNLKTSLDQLIDFEHCWGDSVIDN
                     NSNSNNNDKHKESKNDNPYSCSEYNDVELNIDFFGDPVLIGFSAVITVHNGKPKVHHC
                     PLILFKSHLLILKYRNIIKRNFEKQLGEKNGKKFKVDFIIPLANTTVYCESKNFNQGL
                     HLISENTIKLVFRVHYVQFEVVLCYPSHLEFRIWRTHFRVMVNEVNCGSCEFADDANI
                     MVRLHAVPREVDTYCQRNLETSKVFHYKHIKVSLHAEWCLHDRGAGETQISRCSELDK
                     VHYKLVLKALDVFINERLFAHLVSAETHIYFNKFH"
     gene            complement(<462155..>462499)
                     /locus_tag="PVL30_003324"
                     /old_locus_tag="LELG_02485"
                     /db_xref="GeneID:5233130"
     mRNA            complement(<462155..>462499)
                     /locus_tag="PVL30_003324"
                     /old_locus_tag="LELG_02485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525877.2"
                     /db_xref="GeneID:5233130"
     CDS             complement(462155..462499)
                     /locus_tag="PVL30_003324"
                     /old_locus_tag="LELG_02485"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525927.1"
                     /db_xref="GeneID:5233130"
                     /db_xref="PFAM:PF01172"
                     /translation="MTNNPHKFFYKGADNDFVIFVDDPELYKKYKSGDTTIPLIDIVS
                     VFKVFINRQGGADGILDEASKQDLNNNFKTSNVDEVIKIILDKGSDKHNSDLNDEDAS
                     RNDSIGARDTGN"
     gene            <464183..>466168
                     /locus_tag="PVL30_003325"
                     /old_locus_tag="LELG_02487"
                     /db_xref="GeneID:5233386"
     mRNA            <464183..>466168
                     /locus_tag="PVL30_003325"
                     /old_locus_tag="LELG_02487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525879.2"
                     /db_xref="GeneID:5233386"
     CDS             464183..466168
                     /locus_tag="PVL30_003325"
                     /old_locus_tag="LELG_02487"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525929.2"
                     /db_xref="GeneID:5233386"
                     /db_xref="PFAM:PF00018"
                     /translation="MVVDTIKSFSNNVGTHIKDAYKTTGTELHHFSRTVKDTITFHHR
                     DYDKDDELISDYKHDLKQARKGLKHLISQNNQLYKRLLPGVLAMNLKVAKDFINLIGP
                     NSLHFKNIERYYHDFDVYQATQIIPHVHPKEREFLIESVNEELYQYTRSIEGLKVHLD
                     EENEYFAHSLNPKIKNMRKRLNETLKLIKHRDRARQDQDILNRKIAKMNQKQPPLSEK
                     DQKHIEEYLKEFEVIDTKYNALNDKAVAILPHIMSFLQEFLENIIKLLICHQTTVYEK
                     TMETLKYFNIFYGYMNEETIPDYETITTQWEQDITRTRLQLESFLQVVQGKHTDINED
                     IDDKDKASKTHKFWVSMTNRLQEKKHVVKPKNQTSGMFNDTVAIDPLDAFVKYENPQA
                     NQTETYHPRKVIAIEDVVVLKKEVTPPPPLPPRRMSALPILIQTQTHYQSQSQSQNQN
                     QDQAYNQSSLPVYPSALNESMESLNLDDDYDDDGASSIISDSSDVSSISSASFSRVTT
                     RTSSDKQSSTERHLSKIYNTAKNEIKVAPLALSPSLSAEKNVLSWDFPVTVQNSSERP
                     PMTRAYELSLWQKFFDKLDKSASTERVAKYDFDGRHVGDLSFKQGDTIEIIFDFQRVD
                     SLYSQDNHNWLIGIIRGDDSANTLSCRIGLVPSNYLV"
     gene            complement(<466500..>468581)
                     /gene="ILV2"
                     /locus_tag="PVL30_003326"
                     /old_locus_tag="LELG_02488"
                     /db_xref="GeneID:5233160"
     mRNA            complement(<466500..>468581)
                     /gene="ILV2"
                     /locus_tag="PVL30_003326"
                     /old_locus_tag="LELG_02488"
                     /product="Acetolactate synthase, mitochondrial"
                     /transcript_id="XM_001525880.2"
                     /db_xref="GeneID:5233160"
     CDS             complement(466500..468581)
                     /gene="ILV2"
                     /locus_tag="PVL30_003326"
                     /old_locus_tag="LELG_02488"
                     /codon_start=1
                     /transl_table=12
                     /product="Acetolactate synthase, mitochondrial"
                     /protein_id="XP_001525930.2"
                     /db_xref="GeneID:5233160"
                     /db_xref="PFAM:PF00205"
                     /db_xref="PFAM:PF02775"
                     /db_xref="PFAM:PF02776"
                     /translation="MKKQLYQVAKSQTRTFTKVNQQNASSAASSASATRPTPSPAFNT
                     ADVDSPSKQTPPITSLHNTPLAQQQQQQQQQQRHRRGGLGGQKDVVMDDSFIGLTGGE
                     IFHEMMLRHNVDTVFGYAGGAILPVFDAIYNSEKFKFVLPRHEQGAGHMAEGYARASG
                     KPGVVLVTSGPGATNVITPMADALMDGVPLVVFTGQVPTTAIGTDAFQEADVIGISRS
                     CSKWNVMVKNVAELPRRINEAFEIATSGRPGPVLVDLPKDVTASILRESIPIKTTLPS
                     NALSMITKKAVNEFTSEAIKRSANILNKAKKPIIYCGAGILNHEDGPKLLKELADKAN
                     IPVTTTLQALGAFDQRDSKSLDMLGMHGSAAANTAIQNADCIIALGARFDDRVTGNIA
                     KFAPEAKLAASENRGGILHFEISPKNINKVVEATEAIEGDVTANLKKFIPLVNSISDR
                     PEWFAQLNEWKEKYPYSYQLETPESKIKPQTLIKEISDQSMTYNKEVIVTTGVGQHQM
                     WAAQHFTWTKPRTMITSGGLGTMGYGLPAAIGAQVAKPDAIVIDIDGDASFNMTLTEL
                     SSAVQAGAPVKICVLNNEEQGMVTQWQSLFYEHRYSHTHQTNPDFMKLAEAMGVKGIR
                     IETQDQLKSGVKEFLDCKEPVLLEVYVEKKVPVLPMVPAGKALDDFILWDSETEKQQN
                     ALRKQRTGGLY"
     gene            complement(<469934..>471661)
                     /gene="MEP1"
                     /locus_tag="PVL30_003327"
                     /old_locus_tag="LELG_02489"
                     /db_xref="GeneID:5233488"
     mRNA            complement(<469934..>471661)
                     /gene="MEP1"
                     /locus_tag="PVL30_003327"
                     /old_locus_tag="LELG_02489"
                     /product="low affinity high capacity ammonium permease"
                     /transcript_id="XM_001525881.2"
                     /db_xref="GeneID:5233488"
     CDS             complement(469934..471661)
                     /gene="MEP1"
                     /locus_tag="PVL30_003327"
                     /old_locus_tag="LELG_02489"
                     /codon_start=1
                     /transl_table=12
                     /product="low affinity high capacity ammonium permease"
                     /protein_id="XP_001525931.2"
                     /db_xref="GeneID:5233488"
                     /db_xref="PFAM:PF00909"
                     /translation="MTEEVIKQLLTRRQLFTQNLEYDESYVLLFTIASAMIWIMVPGL
                     AFLYSGLARRKSALSMIWIVIMSSFIGIFQWYFWGYSLAFSDKSTNPFIGDLHFFGFK
                     NLLGASSDDSDFPQLAFAIFQLQFLLVTLAILAGGCIGERGRFLPAMVFLFCWATIVY
                     CPVVYWIWGGGWAMNYKSGALDYAGGGPVEILSGVSAFVYSAFLGRRNETLMINYRPH
                     NISTVFLGTALLYVGWLFFNGFSCANPSVKVAYSMMNTHLCGAFGAISWCLLDFRLEN
                     KWSMVAVCSGCISGLVAATPSSGMIPLWASVILGVVAGIVCNLSTKIKYLCHVDDSLD
                     VWAEHGVAGVIGLLFNALFGSATVIGYDGVTTHEGGWIDHNWKQLYIQIAYILATFAY
                     AGVVTAILCFVINKIPGLHLRVDYNGEEMGVDEDQIGEFAYDYVEVRRDFLDWGTPQD
                     REKELEKIHAYVKEPYDEHNLGVRGSENENDIINSNNNNNNINNNSNNFKNNNSKMQA
                     PEIINGIGGSLENDDTSGTMSDEKIQPRHLATEDHLQHQIPIHSQNPSRSQSVARTED
                     LEPRPYLAE"
     gene            <478052..>480121
                     /gene="ACS1"
                     /locus_tag="PVL30_003328"
                     /old_locus_tag="LELG_02490"
                     /db_xref="GeneID:5233359"
     mRNA            <478052..>480121
                     /gene="ACS1"
                     /locus_tag="PVL30_003328"
                     /old_locus_tag="LELG_02490"
                     /product="acetyl-CoA synthetase"
                     /transcript_id="XM_001525882.2"
                     /db_xref="GeneID:5233359"
     CDS             478052..480121
                     /gene="ACS1"
                     /locus_tag="PVL30_003328"
                     /old_locus_tag="LELG_02490"
                     /codon_start=1
                     /transl_table=12
                     /product="acetyl-CoA synthetase"
                     /protein_id="XP_001525932.2"
                     /db_xref="GeneID:5233359"
                     /db_xref="PFAM:PF00501"
                     /db_xref="PFAM:PF13193"
                     /db_xref="PFAM:PF16177"
                     /translation="MPEQKNTSQKQSQSHISLDHEKMQQPPQGFFDRQPNGQEPNLKD
                     FATYQKLYNQSIQDPNAFWTKQAQEYLHWSKPFEVARFPQDPKDDFKNGDLPAWFING
                     ELNACYNAVDRWALKNPNKPAIIYEADEVGEGRIITYGELLKEVSKLAQVLVKLGVKK
                     GDSVAVYLPMIPEAIVTLLAIVRIGAMHSVVFAGFSSASLRDRILDADSKIVITADES
                     KRGGKTIETKKIVDGALKECPDVRNVIVFKRTGNPHVPFDNSNGRDLWWHEEMAKNGS
                     YFPPTPMNAEDPLFLLYTSGSTGKPKGVQHTTAGYLLGALMTTKYTFDVHEDDILFTA
                     GDIGWITGHTYCVYGPLLNGATSVVFEGTPAYPNFSRYWEIVDKYKVNQFYVAPTALR
                     LLKRAGTKYIENYDLGSLRVLGSVGEPIAAEVWHWYNDNIGRGKAHIVDTYWQTESGS
                     HLLTPLAGITPTKPGSASLPFFGVEPKILDPTTGAELKDNDVEGVLAIKQAWPSITRG
                     IYNDYNRFIDTYLAPYPNHYFSGDGAARDLEGFYWILGRVDDVVNVSGHRLSTAEIEA
                     ALIEHQLVAESAVVGYADELTGQAVAAYVALKKDKLPANTTEEDLELIKKELVLTVRK
                     EIGPFAAPKLILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDTSTLSNPQVVQQIID
                     IVHKSKK"
     gene            complement(<480505..>481356)
                     /gene="HEM4"
                     /locus_tag="PVL30_003329"
                     /old_locus_tag="LELG_02491"
                     /db_xref="GeneID:5233107"
     mRNA            complement(<480505..>481356)
                     /gene="HEM4"
                     /locus_tag="PVL30_003329"
                     /old_locus_tag="LELG_02491"
                     /product="uroporphyrinogen-III synthase"
                     /transcript_id="XM_001525883.1"
                     /db_xref="GeneID:5233107"
     CDS             complement(480505..481356)
                     /gene="HEM4"
                     /locus_tag="PVL30_003329"
                     /old_locus_tag="LELG_02491"
                     /note="BUSCO:EOG092634MM"
                     /codon_start=1
                     /transl_table=12
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="XP_001525933.2"
                     /db_xref="GeneID:5233107"
                     /db_xref="PFAM:PF02602"
                     /translation="MTIDDKQTVILLKNPSTPTDPYEALLQAKNYSPKFIRLLTHEHK
                     DKSLTKQYLTNHAFLKDTQYFIITSQRAVEMFQECIEEIRQDAILGNHEENVVETILS
                     KTGYTVGPATYSILKKVGFKDVRGGIDAGNGAKLSDLIINDIKDVNTKIVFFTGEIRK
                     DIIPKKLTTPVPCEFLGFSQFEEFVMYKTMERDDIIDKFQELHAEMNGQGWVIFYSPQ
                     GTRDIVKHLKQNIREGKKYWKLGVIGPTTEEYLIANDLKPDVVAQRPDAESLCSAMIE
                     FDTSNSQ"
     gene            481880..481951
                     /locus_tag="PVL30_003330"
                     /old_locus_tag="LELG_06045"
                     /db_xref="GeneID:5233294"
     tRNA            481880..481951
                     /locus_tag="PVL30_003330"
                     /old_locus_tag="LELG_06045"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:5233294"
     gene            complement(<483770..>484252)
                     /locus_tag="PVL30_003331"
                     /old_locus_tag="LELG_02492"
                     /db_xref="GeneID:5233230"
     mRNA            complement(<483770..>484252)
                     /locus_tag="PVL30_003331"
                     /old_locus_tag="LELG_02492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525884.2"
                     /db_xref="GeneID:5233230"
     CDS             complement(483770..484252)
                     /locus_tag="PVL30_003331"
                     /old_locus_tag="LELG_02492"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525934.2"
                     /db_xref="GeneID:5233230"
                     /db_xref="PFAM:PF00173"
                     /translation="MSRASRRPAYVSLEEVQRHSEPDDLWMILYNKVYDLTNFAKNHI
                     GGIEVLYDCGGSDATEAFEDVGHSDFAIDMLEPFYVGEVEPEQRKSYRSCNLIFESKN
                     ETSVTSSKGTIATSSVVASSIKQLKEISIRIQDSISLFWLTFIALTSFTLLVLIQQLK
                     "
     gene            <486631..>487950
                     /gene="AGE2"
                     /locus_tag="PVL30_003332"
                     /old_locus_tag="LELG_02494"
                     /db_xref="GeneID:5233157"
     mRNA            <486631..>487950
                     /gene="AGE2"
                     /locus_tag="PVL30_003332"
                     /old_locus_tag="LELG_02494"
                     /product="ARF GAP with effector function(s)"
                     /transcript_id="XM_001525886.2"
                     /db_xref="GeneID:5233157"
     CDS             486631..487950
                     /gene="AGE2"
                     /locus_tag="PVL30_003332"
                     /old_locus_tag="LELG_02494"
                     /codon_start=1
                     /transl_table=12
                     /product="ARF GAP with effector function(s)"
                     /protein_id="XP_001525936.2"
                     /db_xref="GeneID:5233157"
                     /db_xref="PFAM:PF01412"
                     /translation="MSYASRSSSRALPSSKKTHSETHKQILKQLLREEANKSCADCKT
                     TKNPRWASWNLGCFICIRCSGIHRSMGTHISKVKSVDLDAWTDEQIENMVKWGNEKCN
                     GYWESKLPEAYIPDGSKIENFIRTKYDLKKWCSSPTVPNPSTIPGKSQTVNNQNKSTN
                     SSTNSSTSSSTNFNNNSSTASNASRVDSSSTKKTLGSLPTANSSAKSNSLLDDDFGHF
                     TTSSKHTSSHAPPVPQKHSSQPVTPRTPQVPISRTPQPAQVSRTSQQLQSAQSTGGSI
                     SSNSRPDLKKSILSLYASPSSSNSFLQTQQTPPPQSQSQPLHLQQQIRANSQTNSLTD
                     SLAGLSFHSNSTSNLYPGLNNTTTTTTTTNSSNYNNNNNLNNYSQPQSHSTGSLNAPS
                     KLQQNIQNNTWNNEWSDASSTSSNATRAAQRSTTTNLDDDLFKNVWS"
     gene            complement(<488310..>489326)
                     /gene="PIC2"
                     /locus_tag="PVL30_003333"
                     /old_locus_tag="LELG_02495"
                     /db_xref="GeneID:5233335"
     mRNA            complement(<488310..>489326)
                     /gene="PIC2"
                     /locus_tag="PVL30_003333"
                     /old_locus_tag="LELG_02495"
                     /product="Cu/Pi carrier"
                     /transcript_id="XM_001525887.2"
                     /db_xref="GeneID:5233335"
     CDS             complement(488310..489326)
                     /gene="PIC2"
                     /locus_tag="PVL30_003333"
                     /old_locus_tag="LELG_02495"
                     /codon_start=1
                     /transl_table=12
                     /product="Cu/Pi carrier"
                     /protein_id="XP_001525937.2"
                     /db_xref="GeneID:5233335"
                     /db_xref="PFAM:PF00153"
                     /translation="MAGSIADKITQPIEDQIRKATGQGGPGSSSSTPSPVKPEPKIKE
                     FTAAYYAACTVGGIIACGPTHSAITPLDLVKCRRQVDAHLYKSNMQGFRTIIKTPGDS
                     LFTGFGATFIGYSFQGAGKYGFYEFFKRQYSVLVGPKYAEQYKTGVFLAASASAEFLA
                     DIALCPFETIKVKTQTTIPPFANSVWDGWHKIVAKEGMAGLYKGIVPLWCRQIPYTMV
                     KFASFENVVERIYKFLGKPKKDFSTLQQTGVSFLGGYIAGIFCAVVSHPADVMVSKIN
                     SDKQPGESTGQALGRIYKKIGFTGLWNGLPVRIFMIGTLTGFQWLIYDSFKVIIGLPT
                     TGGH"
     gene            <492874..>493491
                     /locus_tag="PVL30_003334"
                     /old_locus_tag="LELG_02496"
                     /db_xref="GeneID:5233087"
     mRNA            <492874..>493491
                     /locus_tag="PVL30_003334"
                     /old_locus_tag="LELG_02496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525888.2"
                     /db_xref="GeneID:5233087"
     CDS             492874..493491
                     /locus_tag="PVL30_003334"
                     /old_locus_tag="LELG_02496"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525938.2"
                     /db_xref="GeneID:5233087"
                     /translation="MKFTTLVATFIALISLTSAVAVPQPAELVERDFGSWLESAVNGL
                     LGAFGININPGSSTTSAAGAGAATTTTPAAGGAAATTTAKPATTTTAAATSGSSGSSS
                     SSSGGWFNDFIGNLGCLFQGWFGKRELKTRTVSVPLSNLKDGINALLGAQIESSTTGY
                     DKLLSILQINTDQAEELGLDSSRSNSYWLGQLGITYLAEENDDDE"
     gene            complement(<494002..>494487)
                     /locus_tag="PVL30_003335"
                     /old_locus_tag="LELG_02497"
                     /db_xref="GeneID:5233092"
     mRNA            complement(<494002..>494487)
                     /locus_tag="PVL30_003335"
                     /old_locus_tag="LELG_02497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525889.1"
                     /db_xref="GeneID:5233092"
     CDS             complement(494002..494487)
                     /locus_tag="PVL30_003335"
                     /old_locus_tag="LELG_02497"
                     /note="BUSCO:EOG09264X31"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525939.2"
                     /db_xref="GeneID:5233092"
                     /db_xref="PFAM:PF05907"
                     /translation="MVKFLLKVSAELDNVTALEPYDTPQDPFYYTFRIECTKCRTIHD
                     KEIQITQYEKHEISGSRGEASFVFRCKECKNEHSASIERTKEKLEQGNSKPVSILEID
                     ARGLDFNEFIPDGRFQAKGLDTGTLFTEVDLEDSEWYDVDEKTNEEVSIVDVKWTISR
                     S"
     gene            <495858..>497171
                     /locus_tag="PVL30_003336"
                     /old_locus_tag="LELG_02498"
                     /db_xref="GeneID:5232969"
     mRNA            <495858..>497171
                     /locus_tag="PVL30_003336"
                     /old_locus_tag="LELG_02498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525890.2"
                     /db_xref="GeneID:5232969"
     CDS             495858..497171
                     /locus_tag="PVL30_003336"
                     /old_locus_tag="LELG_02498"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525940.2"
                     /db_xref="GeneID:5232969"
                     /db_xref="PFAM:PF00153"
                     /translation="MTKDPRLNQEAFQPPLAPLAPTTPDFSDVVQGEDLEFRRRADHY
                     TIPITHKIETLGYISPPNILSRCSTSQLITLAGAASGFFAGVVVCPLDVIKTKIQARG
                     GAEGSRTGRVKGEKGFKAMGFLETLKSTLRHEGVRGLYRGLVPITIGYLPTWTIYFTV
                     YEKAKNFYPNFLSSHWGFHSSSLNHFCAAVTAGMASSIAVNPIWVVKTRLMVQTNKPS
                     TSPNDVQYKGTIDAFRKMYREEGIRVFYSGLIPSLFGLLHVGIHFPVYERLKTLLHCN
                     TIDQQHETPHLLWRLIAASSISKMFASTITYPHEILRTRLQIRHNAEKDGNGDGTKSS
                     RSSSSSSGGSSTTSSRRRTSNPKSSSKLLSTVKNTPTSQCSNKPSLLKVISNIYHREG
                     LRGFYAGYFTNLLRTVPASAVTLVSFEYFKTYLLDISGKSGKLTN"
     gene            <497801..>500194
                     /locus_tag="PVL30_003337"
                     /old_locus_tag="LELG_02499"
                     /db_xref="GeneID:5233346"
     mRNA            <497801..>500194
                     /locus_tag="PVL30_003337"
                     /old_locus_tag="LELG_02499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525891.2"
                     /db_xref="GeneID:5233346"
     CDS             497801..500194
                     /locus_tag="PVL30_003337"
                     /old_locus_tag="LELG_02499"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525941.2"
                     /db_xref="GeneID:5233346"
                     /db_xref="PFAM:PF00085"
                     /translation="MKLLYIYLLIGLACVVAANAPEKLNLLNSPGSQLQEAPSVRNEP
                     QQDTINKNAGVAGQDKTNQVNQDNQNNQGDQGNENLEGKEVVNKKDELDTSNIEELEL
                     PPTLSTEEFDKLTGKQLVLVEFYSPYCHHCKDFFPKWKEAYQTFKRKYPQLSIDMRQV
                     NCVENGDLCEREMIEFYPNMLLYAPVLDKDGLPTGRSKNIDSFPRHLPKTAENVVKYL
                     QESVAEYDEGAGNLPSQSRAYTLDEMFKAISGEIDRPVFVSFWQANKKQWDSVELGGK
                     MKFSGGCADCLHTKQVWDKLSNKIMSIADSAHIMCQDLPELCNKLELDSFKNGKTSRA
                     QFIMFLPKDKGTIRFDYDSRVDVDVMKWWASKLIENSAYQLASARDVTEVMEYTKVLS
                     HQPIAQMYPLKSKVTVLFYYDIDTVTPEDKAVLPHMLRTLQKSPFNIQLYQGKHKRIE
                     ENLQTMGENLINYINYDENDKYEYDKALQIATTITGKPTIIVFKDNSLVPSIFQSFAV
                     EDMRIYKNIEKFLETAQYPFYGELKPELVSTYFFQNKKQKQKQKQKQDGGEEEKKDIS
                     KDDKVVVVVFVDLENLKQTDEQLYKLSLIAHEYNFLKRKYYFNKVLEQRKDKEEVVEK
                     LKAQNAETDKILLAMREEVPHLWGNDDVLFTFIDKPKAKQYKYIKGWKVNPDQYEVGD
                     AVVISRDCRYVWNKDLQGAALKNEPKQLKQVLMSLLTKDGQLSHGGMGSSLVGKAFSF
                     LNHVSSIGFLGYILLIIVSYFLSNYIIKIVKKRRYRAQGLIGVNNGNNNHSFLPKKD"
     gene            <501020..>502333
                     /gene="PMI1"
                     /locus_tag="PVL30_003338"
                     /old_locus_tag="LELG_02500"
                     /db_xref="GeneID:5233208"
     mRNA            <501020..>502333
                     /gene="PMI1"
                     /locus_tag="PVL30_003338"
                     /old_locus_tag="LELG_02500"
                     /product="Mannose-6-phosphate isomerase"
                     /transcript_id="XM_001525892.1"
                     /db_xref="GeneID:5233208"
     CDS             501020..502333
                     /gene="PMI1"
                     /locus_tag="PVL30_003338"
                     /old_locus_tag="LELG_02500"
                     /codon_start=1
                     /transl_table=12
                     /product="Mannose-6-phosphate isomerase"
                     /protein_id="XP_001525942.2"
                     /db_xref="GeneID:5233208"
                     /db_xref="PFAM:PF01238"
                     /db_xref="PFAM:PF20511"
                     /db_xref="PFAM:PF20512"
                     /translation="MSDKLFRLQCGYQNYDWGKIGSSSAVAQFAKNSDPSIEIDESKP
                     YAELWMGTHPSVPSQAIGFNKTLRELITEEPKNLLGDAVIQKFGSSKELPFLFKVLSI
                     EKVLSIQAHPDKKLGAQLHAQDPKNYPDDNHKPEMAIAVTDFEGFCGFKPVEQILETL
                     QTVSQLRNIIGEEISEEFAKGIKCNATTGTEEDKTNRELIQKVFSKLMNTDDSTINEA
                     AQSLVKASQEQPEIFAKLDARLPELIQRMNKQFPNDIGLFCGCLLLNHVNLNKGEAMF
                     LQAKDPHAYICGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYASEPVEKQKMTPK
                     PFAKSHGDAKTSSLYDPPIEEFSVLQTVFDKTGGKQTFDAFDGPSIIIATNGSGTIQI
                     TGDDSTKQSVETGYVYFVAPNTAVELTASDSQKDGLTTYRAFVEV"
     gene            <503297..>503971
                     /locus_tag="PVL30_003339"
                     /old_locus_tag="LELG_02501"
                     /db_xref="GeneID:5232997"
     mRNA            <503297..>503971
                     /locus_tag="PVL30_003339"
                     /old_locus_tag="LELG_02501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525893.2"
                     /db_xref="GeneID:5232997"
     CDS             503297..503971
                     /locus_tag="PVL30_003339"
                     /old_locus_tag="LELG_02501"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525943.2"
                     /db_xref="GeneID:5232997"
                     /db_xref="PFAM:PF00076"
                     /translation="MSQEQQYQQDQQAQSQQPQLQPQLQQQQSTLETIQPRSDSFQKQ
                     FQNETEEEKAERLAKQEETDSRSVYVGNVDYQSTPEQIEELFHKVGIVERVTILFDKF
                     SGLPKGYAYVEFQTPENAKKAVEELHGESFRGRELRVSEKRTNLPGFRKRGNGFGRGS
                     GRGFGRGGRGGRGRGGRGGRGGRGGRGGSWIGRNSTVVDDTTTGNEDGNVHVVEIGGA
                     EIYEVN"
     gene            <504864..>505559
                     /gene="NOP16"
                     /locus_tag="PVL30_003340"
                     /old_locus_tag="LELG_02502"
                     /db_xref="GeneID:5233485"
     mRNA            <504864..>505559
                     /gene="NOP16"
                     /locus_tag="PVL30_003340"
                     /old_locus_tag="LELG_02502"
                     /product="Nucleolar protein 16"
                     /transcript_id="XM_001525894.1"
                     /db_xref="GeneID:5233485"
     CDS             504864..505559
                     /gene="NOP16"
                     /locus_tag="PVL30_003340"
                     /old_locus_tag="LELG_02502"
                     /codon_start=1
                     /transl_table=12
                     /product="Nucleolar protein 16"
                     /protein_id="XP_001525944.2"
                     /db_xref="GeneID:5233485"
                     /db_xref="PFAM:PF09420"
                     /translation="MVSVRKRKMARSSVKKNTRRRKDKQRDINIHSNPIIAKNWDKSL
                     TLKQNYKRLGLRSKLGNIAGGVEQKVETLTEIRNKRRAKSELSSSSQSVSIEEIEETE
                     DPSRIPIGEARIIRDPETNEVLRVIYGTMKVDGDDNDNVSDAAEETEEREGQGANSVI
                     KELEEYAAKHAKVRKERHMSDRESEWAKALYEKYGDDYERMKWDKKLNVYQQSAGDLK
                     RRITKWKKANNIQ"
     gene            complement(<505653..>506561)
                     /gene="CFD1"
                     /locus_tag="PVL30_003341"
                     /old_locus_tag="LELG_02503"
                     /db_xref="GeneID:5232965"
     mRNA            complement(<505653..>506561)
                     /gene="CFD1"
                     /locus_tag="PVL30_003341"
                     /old_locus_tag="LELG_02503"
                     /product="cytosolic Fe-S cluster assembly factor cfd1"
                     /transcript_id="XM_001525895.1"
                     /db_xref="GeneID:5232965"
     CDS             complement(505653..506561)
                     /gene="CFD1"
                     /locus_tag="PVL30_003341"
                     /old_locus_tag="LELG_02503"
                     /codon_start=1
                     /transl_table=12
                     /product="cytosolic Fe-S cluster assembly factor cfd1"
                     /protein_id="XP_001525945.2"
                     /db_xref="GeneID:5232965"
                     /db_xref="PFAM:PF01656"
                     /db_xref="PFAM:PF10609"
                     /db_xref="PFAM:PF13614"
                     /translation="MSLEDQAQLQAQAQDQTPVPKSLSSVRHVILILSGKGGVGKSSV
                     TTQTALTLVNKGFRVGVLDIDLTGPSLPRMFGVESKQVHQSVHGWVPVEVYNSNDTKL
                     GGSLKLMSLGFLIGDRGNSVVWRGPKKTAMIKQFLKDVVWSGNDGEPLDYLLIDTPPG
                     TSDEHIAIAEELRYAQPIDGAIIVTTPQQVATADVRKEINFCKKVNFEILGIVENMSG
                     FICPYCAECTNIFSSGGGKQMAETLQLAYLGNIPIDPSFVEIIESQEDIQGKRLIELY
                     EKSELKPIMETVIDRILMQNLPSRIP"
     gene            <507094..>507585
                     /gene="BET1"
                     /locus_tag="PVL30_003342"
                     /old_locus_tag="LELG_02504"
                     /db_xref="GeneID:5233253"
     mRNA            <507094..>507585
                     /gene="BET1"
                     /locus_tag="PVL30_003342"
                     /old_locus_tag="LELG_02504"
                     /product="protein transport protein bet1"
                     /transcript_id="XM_001525896.2"
                     /db_xref="GeneID:5233253"
     CDS             507094..507585
                     /gene="BET1"
                     /locus_tag="PVL30_003342"
                     /old_locus_tag="LELG_02504"
                     /codon_start=1
                     /transl_table=12
                     /product="protein transport protein bet1"
                     /protein_id="XP_001525946.2"
                     /db_xref="GeneID:5233253"
                     /translation="MGNGAHQRDLRTQLFSTPSPHHFNGLRQQNSRTPPSRTPSRNTH
                     SASPYDNTTTQTRAGASAAVAAQNESFLNSLESQNDEEMDSMGQKIHMLKNLGERMGI
                     EINKSIKLNDDITDGFERGKVSLKNTFNKMIVMSQRAGITWKMWLVVFALVGLFFFYV
                     WLF"
     gene            complement(<508687..>510951)
                     /locus_tag="PVL30_003343"
                     /old_locus_tag="LELG_02505"
                     /db_xref="GeneID:5233646"
     mRNA            complement(<508687..>510951)
                     /locus_tag="PVL30_003343"
                     /old_locus_tag="LELG_02505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525897.2"
                     /db_xref="GeneID:5233646"
     CDS             complement(508687..510951)
                     /locus_tag="PVL30_003343"
                     /old_locus_tag="LELG_02505"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525947.2"
                     /db_xref="GeneID:5233646"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08022"
                     /db_xref="PFAM:PF08030"
                     /translation="MLCSVAYLVLLLQFLVHVTAYGTNYENYEPSRFFYACQLQLGLE
                     ATFCSPENVSCPCLNPNYLASMAGCIETNGGAHDDASTKASIKSGIKDCTYYGVTLNS
                     SWYDIAINDYHNNAKSASEIANFNMSDIIDVPFIVNHTASYPYQESYRRFYANYQGSL
                     YYGAAILGFWLIVLLVGGFINWSKILFPQTTKKMTSPLVNYWRKHVTVPATFRKKKAQ
                     DQPFLKVFGFLIPSRFESLILALFYGITILCNALNMEGIDNDPLFNSRYAAENRYVAD
                     RSGITATMFMPLIFLFAGRNNFLQWLTRWNYSTFLAFHRHTSRVMVILVIIHSFAFTY
                     AVYDEYAEDAAESYFYWGIVGTIAGGLILVQAILFLRRNWYELFLFLHVILAALWVLG
                     TWLHLVDMGYIQMVYPAVAVWVFDRLVRIVRLFIFGFPKADVYLLADETLKVVIPKPS
                     YWKSIPGGHAFIHFLKPTYFWQSHPFTFTDGIEDKNAITLYCKVKGGITHSLYKMLVA
                     APGRQCKVRVAVEGPYGEATPAKYADTAVFVAGGNGIPGIYSEIIDIAKHTTHSEKQS
                     LKLYWVIREWRSLFWFYEELVNLNKTNIQTTIYVTRPDVITCIEDFSQRFTATTTTTK
                     TTTINSGSLKLESNTDASFEENENEKQETLGKDMAVKEVVHDDLSSDEKSDVTLIINS
                     IKNELSHITFLEGRPDFEKIVPQEIHESNGSVTFVTCGHPAMVDELRYCCAHNVDNKE
                     RKRVDFFEQIQVWA"
     gene            complement(<513050..>515302)
                     /locus_tag="PVL30_003344"
                     /old_locus_tag="LELG_02506"
                     /db_xref="GeneID:5232891"
     mRNA            complement(<513050..>515302)
                     /locus_tag="PVL30_003344"
                     /old_locus_tag="LELG_02506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525898.2"
                     /db_xref="GeneID:5232891"
     CDS             complement(513050..515302)
                     /locus_tag="PVL30_003344"
                     /old_locus_tag="LELG_02506"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525948.2"
                     /db_xref="GeneID:5232891"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08022"
                     /db_xref="PFAM:PF08030"
                     /translation="MWFSISLCVVLTQYFFTFAVAWENYEDISPYRYLYACQYQLRSE
                     ATFCPPTNESCPCLNPNFLASVAGCLEANVDGTPTSKMLYAADRNCEYYNVTLADDWY
                     ETSLKLYHEKAKKTSDIPNFNMTKIIDIPIIMNHTRSIMFQTSYKNFYNNYQNSLYYG
                     AGILAYWALVLVMGAVINWGKFLFPGTTKKMTYPIVNYWRKYVTIPATFRKKKAQDQQ
                     FLKIFGFLIPSRFESLIIVLFYGVTLIVNAVEMEAMEDDPLMDSKYRAETRYVGDRTG
                     ITGTMFMPLIFLFAGRNNFLQWLTRWNYSTFMTFHRHVSRVCVILIIVHSFAYTALLA
                     DQFASRAAEPYFYWGIVGTLAGGLMLAQAILFLRRNWYEIFLLVHIALAAVWLLGCWY
                     HLIDLGYIQMVVPAIAIWVADRFARILRLFFFGFPKADVYLLADETLKVVIPKPSYWK
                     SIPGGHAFIHFLKPTYFWQSHPFTFTDGIEDKDNITMYLKVKGGITHSLYKMLVAAPG
                     RQCKVRVAVEGPYGEATPAKYADTAVFVAGGNGIPGIYSEIIDIAKHTTHSEKQSLKL
                     YWVIREWRSLFWFYEELVNLNKTNIQTTIYVTRPDVITCIEDYSQRFVSSASSSSSSS
                     SVAATRKHQSETCSDVGIVAEGEEKQDSLTKDLTVKIDTNSTDEKRDASEIVRAIKNE
                     LSHITFLEGRPDFEKIVPQEIHESNGSVTFVTCGHPAMVDELRYCCAHNVDNKERKRV
                     DFFEQIQVWA"
     gene            complement(<519272..>521524)
                     /locus_tag="PVL30_003345"
                     /old_locus_tag="LELG_02507"
                     /db_xref="GeneID:5233334"
     mRNA            complement(<519272..>521524)
                     /locus_tag="PVL30_003345"
                     /old_locus_tag="LELG_02507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525899.2"
                     /db_xref="GeneID:5233334"
     CDS             complement(519272..521524)
                     /locus_tag="PVL30_003345"
                     /old_locus_tag="LELG_02507"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525949.2"
                     /db_xref="GeneID:5233334"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08022"
                     /db_xref="PFAM:PF08030"
                     /translation="MHLSTSLFVILFQIIVPIVAWKDYENEYPYKYFYACQYQLRFEA
                     TYCPPTNRTCSCLNPNFLASIAGCLEANIDGHPTEQMLHATFETCERYNVTLADDWYD
                     TSLKYYHENAKAPVEIPNFNRSKVIDVPIIMNHTRSIMFQTSYKNFYNNYQNSLYYGA
                     GILAYWALVLVMGAVINWGKFLFPGTTKKMTYPIVNYWRKYVTIPATFRKKKAQDQQF
                     LKIFGFLIPSRFESLIIVLFYGVTLIVNAVEMEAMEDDPLMDSKYRAETRYVGDRTGI
                     TGTMFMPLIFLFAGRNNFLQWLTRWNYSTFMTFHRHVSRVCVILIIVHSFAYTALLAD
                     QFASRAAEPYFYWGIVGTLAGGLMLAQAILFLRRNWYEIFLLVHIALAAVWLLGCWYH
                     LIDLGYIQMVVPAIAIWVADRFARILRLFFFGFPKADVYLLADETLKVVIPKPSYWKS
                     IPGGHAFIHFLKPTYFWQSHPFTFTDGIEDKDNITMYLKVKGGITHSLYKMLVAAPGR
                     QCKVRVAVEGPYDEATPAKYADTAVFVAGGNGIPGIYSEIIDIAKHTTHSEKQSLKLY
                     WVIREWRSLFWFYEELVNLNKTNIQTTIYVTRPDVITCIEDFSQRFTATTTTTKTTTI
                     NSGSLKLESNTDASFEENENEKQETLGKDMAVKEVVHDDLSSDEKSDVTLIINSIKNE
                     LSHITFLEGRPDFEKIVPQEIHESNGSVTFVTCGHPAMVDELRYCCAHNVDNKERKRV
                     DFFEQIQVWA"
     gene            <525342..>527621
                     /locus_tag="PVL30_003346"
                     /old_locus_tag="LELG_02508"
                     /db_xref="GeneID:5233534"
     mRNA            <525342..>527621
                     /locus_tag="PVL30_003346"
                     /old_locus_tag="LELG_02508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525900.2"
                     /db_xref="GeneID:5233534"
     CDS             525342..527621
                     /locus_tag="PVL30_003346"
                     /old_locus_tag="LELG_02508"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525950.2"
                     /db_xref="GeneID:5233534"
                     /translation="MSQSNHTLHSDATKSTSSTSATTSATTSATGSTSKPTSVSQSGT
                     KTHSQSRPRSFSSASTKKYKRYQPRFLSKSEDSIIPSLPSLSSTAQLSPNQSGSVYCI
                     PTIDSFRLKTILSEILDEEVTQTIDDLLNVSTRYKDDLRQEVKMQLSSEQRLQSKNIA
                     VCKLTKQLNHSLHSRMKKLSKLDGSEGRLEINDLLNKSLGVSYRIKEVLKRIEKIENK
                     NSLQGEGNKQATANEGAVISKITKNKYPLLYSFLSKENTELSINGHDQANDINSGHDM
                     EETDEMQVYMHGEQRRSSPEAEDPQNPQDPQDPQKPQDPQKPQKPQDPSLVPSTTIDK
                     SDTEAPSIFIYQEESSLSPDQYNVETFERNIPSCFQYTTDSVGSASPEENSSIEDFMI
                     STVSKFRKFKAQKGNVDGNNNYIKQDNISNLTSAKGAKSSPTTLGLRRQSLNNPLNLL
                     LKHVPKSNEAIETHNFAQKSFATAVESEISSNYKKFRINGDILNTEYFRKQQEKLEAA
                     THPRLSNPTSNHETSDSMMSNGEERNVLGINELDTDTLSSPGFGLGSDSDSNSEMEED
                     IMIRSMLEAKKKKATRIQSPTPKHKPSHHCLQPTKSILKTKQDPVLAKKLRKCLDEEE
                     QVQKQEHKKDKKLKQQEQQEQQEQQEQHRKAREQDSNQQHVLVEFIDNDRIDFDVGSN
                     ATVQPSKVTNSRNTENWTDNEDRESRISKGDSILFGQWGTTHAPTDNKVSRFTVQGAI
                     FEDDIDSVSILKKKLGAEK"
     gene            complement(<527767..>529416)
                     /locus_tag="PVL30_003347"
                     /old_locus_tag="LELG_02509"
                     /db_xref="GeneID:5232904"
     mRNA            complement(<527767..>529416)
                     /locus_tag="PVL30_003347"
                     /old_locus_tag="LELG_02509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525901.2"
                     /db_xref="GeneID:5232904"
     CDS             complement(527767..529416)
                     /locus_tag="PVL30_003347"
                     /old_locus_tag="LELG_02509"
                     /note="BUSCO:EOG09262YQG"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525951.2"
                     /db_xref="GeneID:5232904"
                     /db_xref="PFAM:PF00790"
                     /translation="MPIFNEHPFTSITVKINQLVKSNGNDDNDFRDNDGQREDNSLEL
                     QLSTLIDLIKVQHNSGATEAARAIRKKVKYGSSTQEQIRALNILELLLLNSGRKIGPI
                     LARDDKLLDVLKGILNGHGKTGTGLGYDVKVQKRVIAMAIGWKSEFENLDGYKNMQQL
                     YKALPKSKTKSEASMSKSRRAREEFVNDDDDDDVFDSQDEVDPYADNHKINGNSSRAS
                     RNSDSPPPPSSSRSIKSPKVPPPRPTTSSPYSSATKKSSTNYKKEKKDKRYKKKQKRS
                     KNGIIYADEQFGIPQINYRKEAPKINALLNDCQIACVDLKNQLLQLPPDASPLDDSKI
                     NSNFDNLKGLRRKLLKYIQFVGAGDPQTKSSEVNEMDEKFLPRLIYANEEIVECFKQF
                     DAKTGHTTNSFATIRDDPNEEWDESDESYYSSDDDDDDDDDYGYDEEEENDEGDIRER
                     QAKSKNAINEEDQYQDSIAARLQSVTMDEKRRAAPPPPPPTAPSALAFGIQNKESSND
                     RISGLDHGFEERPAINKTDTSESFGLEGNPFGDTNAVEKIL"
     gene            <530616..>532904
                     /gene="SUP35"
                     /locus_tag="PVL30_003348"
                     /old_locus_tag="LELG_02510"
                     /db_xref="GeneID:5233524"
     mRNA            <530616..>532904
                     /gene="SUP35"
                     /locus_tag="PVL30_003348"
                     /old_locus_tag="LELG_02510"
                     /product="translation termination factor GTPase eRF3"
                     /transcript_id="XM_001525902.2"
                     /db_xref="GeneID:5233524"
     CDS             530616..532904
                     /gene="SUP35"
                     /locus_tag="PVL30_003348"
                     /old_locus_tag="LELG_02510"
                     /note="BUSCO:EOG09261PUF"
                     /codon_start=1
                     /transl_table=12
                     /product="translation termination factor GTPase eRF3"
                     /protein_id="XP_001525952.2"
                     /db_xref="GeneID:5233524"
                     /db_xref="PFAM:PF00009"
                     /db_xref="PFAM:PF03143"
                     /db_xref="PFAM:PF03144"
                     /translation="MSEQYNQDKLNQDFQIASLGGDQQFSQQQSQQQQQQQQQQSYYN
                     PNQAQAFVPSGGYQAYQAYQGYQQQQPQQYGGYNQGYQQNYNNNSNNNNRGGSQQNYN
                     NRGGYQQNYNSRGGYQGGYQGGYQGGYQGGYQGGYQGQGQQQQYGAYNPQAQTQASQQ
                     QPTGMSLADFQKQAQEKQASLNKPVKKTLKLAPSSGIKLANATKKAETPASKESSPAP
                     AESTSTKDKEIKADANAKEEIKAETSSKVEESKKEEGEAKAEAKEEPKEEKTESAASN
                     SASTPTPAAAAKKESTPTPAAPAAAAAAAKSTPVATSDSIAKEQEDEVDEEVVNDMFG
                     GKDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMD
                     TNKEERNDGKTIEVGKAYFETDKRRYTILDAPGHKMYVSEMIGGASQADVGILVISAR
                     KGEYETGFEKGGQTREHALLAKTQGVNKIVVVVNKMDDPTVNWSEERYNECTTKLGMY
                     LKGIGYQKEDIIYMPVSGYTGAGLKDRVSAKDCPWYKGPALLEFLDNMDTLNRKINGP
                     FMLPISGKMKDMGTVVEGKIESGHIRKGGNLLLMPNKESVEVLTIYNETEQEADVAYS
                     GEQVRMKIKGVEEEDLQAGYVLTSPKNPVKTVTRFEAQIAIVELKSILSNGFTCVMHL
                     HTAIEEVKFVELKHKLEKGTNRKSKKPPAFAKKGMKIIAVLETNESVCAETYNDYQQL
                     GRFTLRDQGTTIAIGKITKLLK"
     gene            complement(<533150..>534373)
                     /locus_tag="PVL30_003349"
                     /old_locus_tag="LELG_02511"
                     /db_xref="GeneID:5233319"
     mRNA            complement(<533150..>534373)
                     /locus_tag="PVL30_003349"
                     /old_locus_tag="LELG_02511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525903.2"
                     /db_xref="GeneID:5233319"
     CDS             complement(533150..534373)
                     /locus_tag="PVL30_003349"
                     /old_locus_tag="LELG_02511"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525953.2"
                     /db_xref="GeneID:5233319"
                     /db_xref="PFAM:PF03770"
                     /translation="MDTLDISISSLIPSEHQAAGHDGCMTSNSLFFKPTNQQELDFYT
                     KCNQVDHQRLNKLEKIEKEKEGVDLGALITHWMPAWLGILNEGDIRVNHHSSVSNSPS
                     SQLHNQQDLVKPNTEKTQYIVLQNLYHKYLHPSILDIKLGSKLTDDSKTTKEKIARLQ
                     KVSETTTSGSLGFRICGMKQYIGKETLKPQLELFHGMNENTIVLQKNKECITFNGEII
                     VEHHNYLEYNKHFGRSLNKHNVEDALQLFFSKIPPTQAAWLIQRFHQRLQLLYNCLLS
                     YEVRIFSGSLLFIIEGDKRVWKKMVDEEKYANSDPLICEFDPTSDDEEEEEEEEEEEE
                     EEFEKKEPAKEKQTNLVNTIFIPVNESPEKLSGLHIIDFAHAKFVEGAGHDDNILDGI
                     ENLIDIFAKLAENNV"
     gene            <535824..>536768
                     /gene="SSO2"
                     /locus_tag="PVL30_003350"
                     /old_locus_tag="LELG_02512"
                     /db_xref="GeneID:5232973"
     mRNA            <535824..>536768
                     /gene="SSO2"
                     /locus_tag="PVL30_003350"
                     /old_locus_tag="LELG_02512"
                     /product="Plasma membrane t-SNARE, secretory vesicle
                     fusion"
                     /transcript_id="XM_001525904.2"
                     /db_xref="GeneID:5232973"
     CDS             535824..536768
                     /gene="SSO2"
                     /locus_tag="PVL30_003350"
                     /old_locus_tag="LELG_02512"
                     /codon_start=1
                     /transl_table=12
                     /product="Plasma membrane t-SNARE, secretory vesicle
                     fusion"
                     /protein_id="XP_001525954.2"
                     /db_xref="GeneID:5232973"
                     /db_xref="PFAM:PF00804"
                     /db_xref="PFAM:PF05739"
                     /translation="MSNPYQQSSYPAQGQSQNAYEMSNVAHSTSNYNYNNNTNNNYDS
                     KQYSSSNEDDFVQFMNEIQDINAQLDNYSQLINLIDNKQKSFLYNIDLNDEDTEYSSK
                     QLDSLVGEAQSIQLDLKTRIKNVQYQAITSKDQTKVDQAETSRKRFLDLIQDYRLIEA
                     KNKEQSKEQSARQYQIIKPDATQEEINAVVEDGGTQYFQQALLQSNRRGEARSVLDEV
                     QVRHRELLKLEKTMAELTQLFHDMEELVIEQDQPIQQIEEQVATAQHDIEQGVGHTDK
                     AVTSARSARKKKLWCLAIVIICIIIVVVIIAAYFGSKN"
     gene            <537812..>539692
                     /gene="NOP7"
                     /locus_tag="PVL30_003351"
                     /old_locus_tag="LELG_02513"
                     /db_xref="GeneID:5232900"
     mRNA            <537812..>539692
                     /gene="NOP7"
                     /locus_tag="PVL30_003351"
                     /old_locus_tag="LELG_02513"
                     /product="mRNA-binding ribosome synthesis protein nop7"
                     /transcript_id="XM_061119460.1"
                     /db_xref="GeneID:5232900"
     CDS             537812..539692
                     /gene="NOP7"
                     /locus_tag="PVL30_003351"
                     /old_locus_tag="LELG_02513"
                     /note="BUSCO:EOG09261L4M"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA-binding ribosome synthesis protein nop7"
                     /protein_id="XP_060975443.1"
                     /db_xref="GeneID:5232900"
                     /db_xref="PFAM:PF06732"
                     /db_xref="PFAM:PF16589"
                     /translation="MGKIKKRATSGNAKNFITRTQAIKKLQVSLADFRRLCIFKGIYP
                     REPRNKKKANKGSTAPVTFYYAKDIHYLLHEPVLDKFRQHKTFAKKLQRALGKGEISS
                     AAKLDANRPKYTLNHIIKERYPTFLDALRDLDDPLNMLFLFSNMPAIDKVSTKIIADA
                     EKLCNYWLAYVSKERLLKKMFVSIKGVYYQATIKGQEVRWLIPYKFPTNIPTDVDFRI
                     MLTFLEFYSTLLNFVLYKLYNESGLIYPPHIDIAKLKAAGGLSSYVLQSKDGKNVAIL
                     QKKQDDAGSNVEGKELSSAELKKAIKADKDQKDQDTIEDAEEVTEPTVEETELDEFQN
                     GTTNNAVDTLVQPSQFSSPTSQLFSKFIFFIGREVPLDILEFVILSCGGKVISEISLD
                     DLKLNDPKLYASLDLNSITHQISDRKKILQKVPGRTYIQPQWVFDSINKGELVSVGDY
                     APGETLPPHLSPWGDAGGYDPNAKAQVTAEGEEAEGAAEEEEEEEEEDEEEEEEEEEI
                     EVADGDEDQDDEEEEEIEDEDLKAQKELEMEVAGKKFSELQNAEEGSKQKKQKKNAST
                     KAALTPEEEAKELAKIMMTNKQKKLYKKMQYGIEKKTNRVDELTKKRKQLEKKKKQLK
                     DV"
     gene            complement(<539853..>541190)
                     /locus_tag="PVL30_003352"
                     /old_locus_tag="LELG_02514"
                     /db_xref="GeneID:5233089"
     mRNA            complement(<539853..>541190)
                     /locus_tag="PVL30_003352"
                     /old_locus_tag="LELG_02514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525906.2"
                     /db_xref="GeneID:5233089"
     CDS             complement(539853..541190)
                     /locus_tag="PVL30_003352"
                     /old_locus_tag="LELG_02514"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525956.2"
                     /db_xref="GeneID:5233089"
                     /db_xref="PFAM:PF00107"
                     /db_xref="PFAM:PF08240"
                     /db_xref="PFAM:PF13602"
                     /translation="MSNIPRVSKVAKITRPRKDAKSSRKNTSTRLTIDSPMPEATNQT
                     TVLSETDEHNPPFTPAVPTTQSAFIYSRSVGKLVYRTDIPVPQPKAGEVLLRIESAGL
                     CHSDLHILDGEIPCGDNYVMGHEIAGTICSINSTPSVTTTSNVTGTDPVTTTATAVAN
                     MEQKPKFEVGDRVAVLGTNHCTSCASCRADSANTCPNAMMKWIGLGSDGGFQQYLLIS
                     NPSRDLVRIPQDVSFDVAAIATDAVLSPYHALKMTGAKPGMKVLIIGCGGLGINAVQL
                     AKNMQLKVTVLDGKEEAREQAKKYGADFVCSNGKELESLNWSREYSHGNKVEEVHAEK
                     DQVVQFDVCLDFVSKQETFDICQQLIKPRGCIVAVGLASSELKINLLSINLREVRVLG
                     SFWGTSPELEEVFALISKGAVTPVVASASLEELPSYIDLLRDNKLKGRVVFHP"
     gene            complement(<542334..>543461)
                     /gene="SRB5"
                     /locus_tag="PVL30_003353"
                     /old_locus_tag="LELG_02515"
                     /db_xref="GeneID:5232984"
     mRNA            complement(<542334..>543461)
                     /gene="SRB5"
                     /locus_tag="PVL30_003353"
                     /old_locus_tag="LELG_02515"
                     /product="Mediator of RNA polymerase II transcription
                     subunit 18"
                     /transcript_id="XM_001525907.2"
                     /db_xref="GeneID:5232984"
     CDS             complement(542334..543461)
                     /gene="SRB5"
                     /locus_tag="PVL30_003353"
                     /old_locus_tag="LELG_02515"
                     /codon_start=1
                     /transl_table=12
                     /product="Mediator of RNA polymerase II transcription
                     subunit 18"
                     /protein_id="XP_001525957.2"
                     /db_xref="GeneID:5232984"
                     /db_xref="PFAM:PF09637"
                     /translation="MVHQLFLVSSIPHANYLQAVATLQAITGQLEPQEISTYTLITKP
                     NHVFKPQVKAGKINQIEQHYMKCITTWQDYPFDISLPVIESKLDGKSEITAKKLFVEE
                     EVVEEEEDDDAEKKRQRERGEFFTASGYKNGEQSQFGREKVWTLQIGDIPIAGKNQVC
                     SQQTIYSSTLVHTHVAVPPKTASIDGAEAIQQAGQESGIESKQELKPISGSNESTIKE
                     EKMAESNKDLNTDGSDSMDIDIVEQKIKAESVPPKPRRRNDSFLVFLNDLGYSVINQY
                     WVKGVRFFYGDIVIELFKLFIRDDHAPKDNSDGIKLKLLDESNTFQIKCYINVSKSTD
                     IDQINQGVKDLAHLKDFLKGLFVLEIPDRMYLDSRVSNPIK"
     gene            complement(<543737..>544056)
                     /gene="VMA21"
                     /locus_tag="PVL30_003354"
                     /old_locus_tag="LELG_02516"
                     /db_xref="GeneID:5233047"
     mRNA            complement(join(<543737..543971,544040..>544056))
                     /gene="VMA21"
                     /locus_tag="PVL30_003354"
                     /old_locus_tag="LELG_02516"
                     /product="vacuolar ATPase assembly integral membrane
                     protein vma21"
                     /transcript_id="XM_001525908.2"
                     /db_xref="GeneID:5233047"
     CDS             complement(join(543737..543971,544040..544056))
                     /gene="VMA21"
                     /locus_tag="PVL30_003354"
                     /old_locus_tag="LELG_02516"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar ATPase assembly integral membrane
                     protein vma21"
                     /protein_id="XP_001525958.2"
                     /db_xref="GeneID:5233047"
                     /db_xref="PFAM:PF09446"
                     /translation="MADIPKSVVQKLMIFTALMIIFPLTTFFTVQFFTSNSIISGGLS
                     AFAANVVLIGFIVVAFNEDTSQLAPSDESAEKFESKKHL"
     gene            <544461..>545333
                     /locus_tag="PVL30_003355"
                     /old_locus_tag="LELG_02517"
                     /db_xref="GeneID:5233053"
     mRNA            <544461..>545333
                     /locus_tag="PVL30_003355"
                     /old_locus_tag="LELG_02517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525909.2"
                     /db_xref="GeneID:5233053"
     CDS             544461..545333
                     /locus_tag="PVL30_003355"
                     /old_locus_tag="LELG_02517"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525959.2"
                     /db_xref="GeneID:5233053"
                     /db_xref="PFAM:PF20520"
                     /translation="MLYSSLVAICALYVTTVIAFANSGALLIRNKAIEGAYKPKHIER
                     ARDVKQALVDLKVGENDDEYVDVYQLRSNDWDSSLLNEEHQTINIPAVIYKNIEELDG
                     FSKTFSGKSVKILSKDEIRNLLNSKDSSFIVQVIPTFDAPSIKDKIEEKIINLYNNED
                     TIIVAAKREDTQEVTDDNDDENESAADTVKLEQEIENDFAMAEKLAAEEDKLNDNPVT
                     ILGEDVPGENSTTTKPNNLFTNYQFFTSGIWSGIIVSGFLLAILYTAISWIASLEITY
                     SSFEKQVDFDKKNE"
     gene            complement(<545522..>546847)
                     /gene="ERG24"
                     /locus_tag="PVL30_003356"
                     /old_locus_tag="LELG_02518"
                     /db_xref="GeneID:5233056"
     mRNA            complement(<545522..>546847)
                     /gene="ERG24"
                     /locus_tag="PVL30_003356"
                     /old_locus_tag="LELG_02518"
                     /product="erg24, C-14 sterol reductase"
                     /transcript_id="XM_001525910.1"
                     /db_xref="GeneID:5233056"
     CDS             complement(545522..546847)
                     /gene="ERG24"
                     /locus_tag="PVL30_003356"
                     /old_locus_tag="LELG_02518"
                     /codon_start=1
                     /transl_table=12
                     /product="erg24, C-14 sterol reductase"
                     /protein_id="XP_001525960.1"
                     /db_xref="GeneID:5233056"
                     /db_xref="PFAM:PF01222"
                     /translation="MSELNPHTKHREFNGVVGALGITIFLPAVLEFFQLVCNPTYSIK
                     GINIDFHQISEQLPTTSQQWLDLAFNTQVWKAYLAWFFGLVVLDQILPGKELQGVELR
                     DGTKLKYTINGVSMSVSLIALLFSRLAVSRNFYLPELQFIYDHQLHLVITTIIFSFIL
                     AIFVYVYSFVPLTKPNGKGTKERILSVNGNTGNIFYDWFIGRELNPRIGSWDIKLFCE
                     LRPGMLLWFLINLSCVHQQYHIKGYVTDSLILVNILQAIYLFDGVLNEAGCLSMIDIT
                     TDGFGFMLSFGDLAWVPWSYSLQSRYLAIPGNEVDLGWFYFTAILLLQFVGFYIFRAA
                     NQQKSDFKNGKLNHLKSIETKTGSKLLVDGWWGMSQHINYLGDWLIGWSWCLPTGFQT
                     PLTYFYVIYFASLLIHRQVRDDMKCQAKYGKDWDKYKELVPYKIVPYLY"
     gene            complement(<547623..>549830)
                     /gene="PUS7"
                     /locus_tag="PVL30_003357"
                     /old_locus_tag="LELG_02519"
                     /db_xref="GeneID:5232961"
     mRNA            complement(<547623..>549830)
                     /gene="PUS7"
                     /locus_tag="PVL30_003357"
                     /old_locus_tag="LELG_02519"
                     /product="multisubstrate pseudouridine synthase 7"
                     /transcript_id="XM_001525911.2"
                     /db_xref="GeneID:5232961"
     CDS             complement(547623..549830)
                     /gene="PUS7"
                     /locus_tag="PVL30_003357"
                     /old_locus_tag="LELG_02519"
                     /note="BUSCO:EOG09261EY9"
                     /codon_start=1
                     /transl_table=12
                     /product="multisubstrate pseudouridine synthase 7"
                     /protein_id="XP_001525961.2"
                     /db_xref="GeneID:5232961"
                     /db_xref="PFAM:PF01142"
                     /translation="MSQDLKRTNPQDETILGSTSKKIKVEIDASKTDTTTTSKQPATS
                     ITEASVGITRFINPNHTGFKGLLKTLHSDFQVNEIQPNGTVVHLTDEGVNAGKSNRQK
                     RAEKLAQEQAELEGKSEEEIAEIKARREKEREKERQEKEALPKYTLSEEDKAELLTMI
                     TQDELQQMEDLFHTGNNMETKTTFDDKEQRTKLHQLIRRAFQGKLETITSPEQTFKVA
                     IAKNRNGANNRGGGQQQSNPQDSMHHVDENGVVNYGLGPFKPYLHFTLYKTNRDTMDV
                     IHNISKLIRTPNKSISFAGTKDRRGVTCQRVSIHRGKVLRVNALNNMRKSNFKLGAFA
                     YEDEPLKLGDLKGNEFTITLRDVKLSGAHEQSGEVDIREIINQSFASLKEKGFINYFG
                     LQRFGSFSVATHKFGIALLHEDWGKFVELLLSEQEIQAPGTAEMRRIWKETRDPKQTL
                     KKLQQHYVAENSVLKVLAKEPQREDKSFSPHSYLMGIMSIPKNLRMMYVHAYQSYIWN
                     IVASKRLELFGLEVQEGDLVLESEDAEDVILGDDLEDKEDEMDEDVVKSTKSPVKIVT
                     KEDIENKKYTIYDVVLPSPGFKVQLPENAKLKQVYIDEMAKDGLDPYNLRRKNIVFSL
                     TGAYRHLVTKPMDASYDLISYKDGLDGEARPLVKTDLEILEEKKQYTLEGKSGEEGSN
                     ISRYFETKEESVDDAHLEDKLAVVLRMQLGVSSYATMALREFMKIDTSRGAVN"
     gene            <550520..>552160
                     /locus_tag="PVL30_003358"
                     /old_locus_tag="LELG_02521"
                     /db_xref="GeneID:5233503"
     mRNA            <550520..>552160
                     /locus_tag="PVL30_003358"
                     /old_locus_tag="LELG_02521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525913.2"
                     /db_xref="GeneID:5233503"
     CDS             550520..552160
                     /locus_tag="PVL30_003358"
                     /old_locus_tag="LELG_02521"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525963.2"
                     /db_xref="GeneID:5233503"
                     /translation="MESDPTLDVVNVYEKRQNVSQMSTIPQRVPSFFSTQTMSEEEYE
                     VRKKQFQNRFREVGGGGGCGGGDDSVVAEQVKKDLINVEGLDTEYQKKHNGSANTLQS
                     RRSVFLKKYSWPFGKGFNNEKGPFLHRDHEREVFTKEHEEISKEKSQESKFLYTSDGL
                     PKNNTIAVFDKKNLQGSFLGSQQQQQSSMSLRISRPLTGNPGLENIGFQVNLNQNNYN
                     HNYNHNHNHNYNHNHNHNNNNSSNYKYITAPKYGTVFGKSKQSHLQQMSLPHLQQQRI
                     TNDIYRRCVVLSNINETMSISAILQQVCGGPLEKIVRLPENKIELHFIFPLQAKSFYN
                     FGRKNTLFKVNGINLNVAWSDGEFCGDAETGVEERLVRGVVGVESQRLDCGEEAIHGL
                     ECSLYQSTQNGSKPELSPSSAAANMALAHFTLPKWLSHEIVMNGCRRCLIISQVVAGK
                     KLRTSDKMFYPEPEVHYSQDLHIYNLRRDFKQFGEIVDIGSVISRKLSFSVFYWDIRS
                     AIKAKTEFERTGSSLNLKYKDWNIWYGKDITDRACFVL"
     gene            <552620..>555139
                     /gene="KIP2"
                     /locus_tag="PVL30_003359"
                     /old_locus_tag="LELG_02522"
                     /db_xref="GeneID:5233139"
     mRNA            <552620..>555139
                     /gene="KIP2"
                     /locus_tag="PVL30_003359"
                     /old_locus_tag="LELG_02522"
                     /product="Kinesin-like protein kip2"
                     /transcript_id="XM_001525914.2"
                     /db_xref="GeneID:5233139"
     CDS             552620..555139
                     /gene="KIP2"
                     /locus_tag="PVL30_003359"
                     /old_locus_tag="LELG_02522"
                     /note="BUSCO:EOG092631IR"
                     /codon_start=1
                     /transl_table=12
                     /product="Kinesin-like protein kip2"
                     /protein_id="XP_001525964.2"
                     /db_xref="GeneID:5233139"
                     /db_xref="PFAM:PF00225"
                     /db_xref="PFAM:PF16796"
                     /translation="MSHTPLRSRSSLGSGHHTTNATIATATNTSMEPTGTGMKRMTYR
                     PPSRRASTHRPASPAHPLHSQSQAQLQTQSYSTRSISSSHGLHRQNSFSNPQEIRSRS
                     RPGSSLGVSRPSTPVNGYQRQQEPYTGHISVSIRPNPHSYTENCQGWLINEYTNTITN
                     SLDGTTFQFDHVFPPNDLSLNNNYEVYRRTCRPVVEQFLEEGYNGTVFAYGMTGSGKT
                     YSMKGSDTDLQSTGFVELAINDLFSKIERMNEMMKYQVHISYLEIYNERIIDLLSTAS
                     TTSNHSFLSSSSSSSYSSSSLSSSPSSSSLADLKIRDDPEYGVKVIGLTTAQVTSKEQ
                     ILSLIKRGDMNRKTSATDFNAHSSRSHSILQIKLSKVDLLTNLESWATLSLCDLAGSE
                     RASSSLERRKEGSYINKSLLALSNVINKLSQSSNLAGYANTDMHISYRDSKLTRLLQP
                     ALSGKSLVSILCTIHMGGNLSSNNNNGINSGPTNSVNTMNQSVSETYKTLRFAARAKN
                     IITNVEKNSIRSEYNDLDVQRLIRELNNTIELQKQELMVLKATNSTDVLSPPPLLNTS
                     QLQSASSSAATTTTNNNNNNNNNDTLSSVEQELRAENKILMDKVEHLTRLTDLQRTET
                     IIIKDNVINDIIGSGATNAQLYLANIEEYFRRSMYEAQNHKMYIEQLENQLKNHYISN
                     PRDLAQTNKHVSPSVAGANIKEDNEDDANLLDVLKEQEGEIMQLKEVIKDKDHIIKSF
                     TKSSRMRKLADSSNLGNVGNTLKNSYCAMDLEYKLSSSLSSSSQREQQYQYSSSRSHG
                     DISKGKESSGHDMYLDKENEPMMAVDVKSSPKRLRSSFDII"
     gene            <556359..>558824
                     /locus_tag="PVL30_003360"
                     /old_locus_tag="LELG_02523"
                     /db_xref="GeneID:5233470"
     mRNA            <556359..>558824
                     /locus_tag="PVL30_003360"
                     /old_locus_tag="LELG_02523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525915.2"
                     /db_xref="GeneID:5233470"
     CDS             556359..558824
                     /locus_tag="PVL30_003360"
                     /old_locus_tag="LELG_02523"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525965.2"
                     /db_xref="GeneID:5233470"
                     /translation="MFRRYRNSSNSSRVQQQEQQRKQREQRQQKVEEEQEDVHHPQQQ
                     QQQQQQQLQQESQRSRSKRLSEDNPIIHSRSRSAASEPSSVPRPVRPPVTSSSPSPRR
                     EVSSSPLSIFPRRKSSQSNNALTSLASSSSSSANAPLQRDYKYEVLHPGSLPESRNDG
                     LNRSQIYHGNQNGNQNGNGNESDDLLSPMTSAAFGSNNYSNYDNDGVASDDQHSIALS
                     ESDTLIVTRNDRRELQPSYTDNFTLYYPYVIRRMLLAQIGERHHQRNVEGESRSVSAS
                     GSGSGSRAGPEEQHTHRTFTNGEEVSEQDREEVEHEYYEYNADGVDDGDLSTIINDDQ
                     APVEYTAIEGAKIMRKGLVDFDYKRELVIMTGMLLKHTTYIFPTVKSFELFKELRLKV
                     KQERKNSIILYDPKNGGIRRASSSTSVDKIKKEFAIPEGSEEIVDERNHIVPMDYKIK
                     GLGLPLFKMFVPYMSTFRRNSPFIIFKRYKEVPSSPVSCSSSSGSSPDDTSFETYDFC
                     YVQSRYFQNYRRFIYEFLPNTPDAFKVISIQSNFCPFTDFVYKETRFRILGTTISTGL
                     MCQYIPHMKLVVIDDDQDSLCDELYNKPPSSATSFLHLKKDSHAELPQFNFNDPSTFI
                     NPVPSKQNKLAYRLSTSLTPIDLKHGLIPIELPPFGSFKDSSLYLPNTTFGIPKKYND
                     LGRVEVYQNLNATLPSSSSLNAGPVTPQVSSSETDQGIFPMTSASSHANTANEANNTN
                     GTISGNDNNPFRSEYAKDVNSTLSVDMDTMVLTVILSTMREVNVRNAGKSSSNTGIIG
                     GHAASMARVGGFGMGGAGPLNLM"
     gene            complement(<559128..>561518)
                     /locus_tag="PVL30_003361"
                     /old_locus_tag="LELG_02524"
                     /db_xref="GeneID:5233515"
     mRNA            complement(join(<559128..559860,561137..561213,
                     561492..>561518))
                     /locus_tag="PVL30_003361"
                     /old_locus_tag="LELG_02524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525916.2"
                     /db_xref="GeneID:5233515"
     CDS             complement(join(559128..559860,561137..561213,
                     561492..561518))
                     /locus_tag="PVL30_003361"
                     /old_locus_tag="LELG_02524"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525966.2"
                     /db_xref="GeneID:5233515"
                     /db_xref="PFAM:PF00076"
                     /translation="MSHFRLPEKMPKNTLYVTGFTRESKAADLAPEFEKFGELVRLDI
                     PPPRTTDGEKFAFVEFKDAESCERALDLDGKQTSWTNGNGLVVQVARSDPFSRSERSS
                     SSSYGRGGGYRGGRGPARYGGYRDDGYGRGGDDGYSRGGYPPRGDYPPRGGYGRRGYD
                     DGYSSGGRGGYGGYSRGGYGGYDDGYRGRDGGYSSRSRVGGGGGYGDYRGSGRSSSSN
                     GGGSGAGGSFDSGRERERDREYRGGDINERERGEERGGRYSRSPSRSPVRRERSRSPE
                     RY"
     gene            <563842..>568176
                     /gene="SPT23"
                     /locus_tag="PVL30_003362"
                     /old_locus_tag="LELG_02525"
                     /db_xref="GeneID:5233536"
     mRNA            <563842..>568176
                     /gene="SPT23"
                     /locus_tag="PVL30_003362"
                     /old_locus_tag="LELG_02525"
                     /product="SPT3 Dosage dependent suppressor of Ty-induced
                     promoter mutations-like protein"
                     /transcript_id="XM_001525917.2"
                     /db_xref="GeneID:5233536"
     CDS             563842..568176
                     /gene="SPT23"
                     /locus_tag="PVL30_003362"
                     /old_locus_tag="LELG_02525"
                     /codon_start=1
                     /transl_table=12
                     /product="SPT3 Dosage dependent suppressor of Ty-induced
                     promoter mutations-like protein"
                     /protein_id="XP_001525967.2"
                     /db_xref="GeneID:5233536"
                     /db_xref="PFAM:PF00023"
                     /db_xref="PFAM:PF01833"
                     /db_xref="PFAM:PF12796"
                     /translation="MTFAIKEEPLSSPFMNIDDNHDIRNPLRNIPGNIGNEGVVGDDE
                     NRDILDEFLDQRVYDTPEADMQLPLHKFENCASKHHQHQHHQHQHHQHQHQHQRSQNE
                     DEDENLLSSLYALTSNGNTTINNYPDHNQSQQQNMDTSLDDAINDFDNQFQDIFTTQR
                     DSSLNSEGVSPGDADYVYRDIPRDSNVSQLGANLNEQQSQQSQHGQTQFPTPINNPAF
                     ANSLGNSSHMVSALPPTSIPLTVYESIREELAKLKFGSHRINAVPKSISVPDPSYLDF
                     SPEAMDKLPYKLTLDGLPCYSRVETQIKCKITLSPSPSESHLLHISQDLISKNKFCLA
                     TPVQSLDPLLKENLLYLDAYVLSSDLRKSCHICSRCIKREQKRASRGKAASTKSNSTN
                     ANKTADSGGDTEGANLDNQTDSKTPIKNNSSAWSDESMIKKAIIFNCKEIVSFPPPSG
                     IPNEAFKSLELSARIICYCRHHKEQAGFKILVVIKNNKGDVVAKQISSPIMIMDRKKN
                     IPLTRDSIPNSVASSSVNLKELGRGPENGLGQLSGSINGTGNDSVNGDGEATYKKKKL
                     SASESDHDIKFDVSGDPHQLTPNSIDESNSDFHTNTDLESTNGLGMGLGNGNGHGTGI
                     GNSNGTGNSHVRGLKRKKLSVDDPFNHPSNPMYNGSVNGHSPMSNSDTNTSANFNFLK
                     QQPSSMSFQGMSPMALGSHCPPAPHLIQPNFQQSMSLPQQQQQQSPSQSQHLSQQQQM
                     EQLRLPSIQRIIPAHGPVRGGIEITLLGFNFRPGLSVKFGAHRALATHCWSETTIVTY
                     LPPAQQPGQVLVTFESDEIPILQPQQQSQIFTYTDDTDRQLIELALQIVGLKMNGKLE
                     DAKNIARRIVGTDTKSGNGSTSTTPVESSNTPPTNTSGNANVHAYAWFDAAHRSLKKL
                     TTSGLSTQIILVKLLSLVDMPNCPIVIPNWQLANKEGQTLLHLATMKNYAKLIKFLVT
                     HGCKIDVKDNHGITPLFLASMNGNRSLMEFYIGYCKSNWNLKLSNNLYLKDYCDLNVI
                     DMFSTLERETGSAREITDEEEIDEQGVVRRTMSFDSIDSVLEHNYGRHISTMVSYDEV
                     TTPTLPSQAPSPSPTTHQQQQEQIGTSSPPNIPADDSNGKNYMDDRNYISDFADSEFD
                     SEDDFDEDDADYCDDEYSENDDNNDDDDDDDDYGDDVNERKGENYDRGENIATAGSMI
                     ALAHGSMTPASIASVSSVATSSASTIRQVEENQVDNSVSNVATSAPSSPGIWQKVKNV
                     FYKEEDSDSLPNYVDLYPSGPSSSSGAKPKSAIEQTLNQSQSITASQVTQVKDDLQES
                     QRSSALPIVQESTLVEQDHDLDAGAASDSSEDMVISYINHPRKSVEHDKMLVFFWIPM
                     LVMIVALFFMVNVMGYRIKQIDQIQSTMRDVLGNIMLGGNERIGRVFATKAAAVAASA
                     TGVLTGRG"
     gene            <568660..>570883
                     /locus_tag="PVL30_003363"
                     /old_locus_tag="LELG_02526"
                     /db_xref="GeneID:5233564"
     mRNA            join(<568660..568803,568958..>570883)
                     /locus_tag="PVL30_003363"
                     /old_locus_tag="LELG_02526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525918.2"
                     /db_xref="GeneID:5233564"
     CDS             join(568660..568803,568958..570883)
                     /locus_tag="PVL30_003363"
                     /old_locus_tag="LELG_02526"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525968.2"
                     /db_xref="GeneID:5233564"
                     /db_xref="PFAM:PF01399"
                     /translation="MSDEELFSEDSYEFEFEEDEDGDGDDSAGQFDGSNDEDDQIEQD
                     DMSVENLYYTAKATKDDDPLLAIGKFKKITEMELKDSEVEWQFRCYKQLIKLSFSEGD
                     YDAALSWLKHVLSLAPNLSQGYLEESLSRMISRYSNISNADFIEQFYKTILEQKEYIN
                     DRVWLKIKSNQLSSLIDSGINDKYHIGKSGIDSVESLLREIQTKLLHVPDATRKLFNL
                     EIIAAEMEFLFQTKTLDLFRMNRLYKQSLKSTTAVTHPKIVGIIKECGAKVHFFRQDY
                     ERAKYEFYQSFKSYDEAGGSTNEKKNKNLKYLALCSLLTDDELDPFQSQETQTFASNN
                     PDFDNLKSLIHAYHSLSIHELQSVLNNDPLFRTDDIFVHAAMQLQKNLRLNLLSKLIA
                     ETDQLTFVDLIATLDLDSFSDLEDLLSKLVSRGQLKDVKIDYVKGIIFSKDVCTNLLR
                     PTSARSIYYNIKFIDSLWGRDQPRVTKAGTESRTESGSGFGSGLETGLESGLESGLEG
                     SVEPTDEMMQVDSNPSLLFATGELAGSFTSSSLANKLFFLIDRPQSPPDWFPAIEKWY
                     TYVMSALPKPYKVQMSHNEQVVQEQQKFIADSNAAKASAAARGQELANFNTGLLNSTI
                     GGVGENVGGGVGTDTGTGTGTGTRDDGFFAGNSGSGDNIDDEDESEITLVKRVDLLKT
                     WVQTLTS"
     gene            <574582..>577092
                     /locus_tag="PVL30_003364"
                     /old_locus_tag="LELG_02527"
                     /db_xref="GeneID:5233489"
     mRNA            <574582..>577092
                     /locus_tag="PVL30_003364"
                     /old_locus_tag="LELG_02527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525919.2"
                     /db_xref="GeneID:5233489"
     CDS             574582..577092
                     /locus_tag="PVL30_003364"
                     /old_locus_tag="LELG_02527"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525969.2"
                     /db_xref="GeneID:5233489"
                     /translation="MSNQFLPSVLYAPSLEHQLHTHQQPETRSNSNSNLNLNSNLNLN
                     LNLNLNSYPVSSNRQQFPPAKPLLPPHQPTLNSDPYHANSFYAQQNSYQYQMQQQQLQ
                     REQELQQEKQRQQLGQTPQSHKSQPHTQAQAQAQTQAQAQAQAQAQAQGFVLPQPTPT
                     PKRKRGRPPKKNSFAERITTTVNISVNTSPLHGSPAESNSNMAAKQGAPNVFTPLMRV
                     SPSNKGKKKRKYSSTSTVSNSSPVMSVKRSKSYTSNSEATGSSLATPLTSQSTYFRHS
                     NSNSSLNSYLVDKKALDNMSRITQSQGYYGTPPATSNTLHEENARVALVPVTSTAATA
                     AAAAAAAETTTNNDIVNGIATNTKTTPSATTLSTVPVAPTHSKSMSLHYQQNTATDMA
                     HDNLEPRFAHARSFSEQNTRNLLPPVSLMGAFNEPVGRSTESHKSTPGTQPTSTLTST
                     STSTSASASASAGVLTAKSAPISRKHSEDFLLSLTVDKSGKAVFSTNAFSSENSTFAN
                     KKETVIDDKAKKDNNVEDEHQNGKKKSILAYSSDDTEAVVNHGHSAPRTPLRRHNSDI
                     TGLATHQKLESTQLASIDEIMSITNTPTAPSSQSQPQPQQNTSLQPPSQTLPQTPRDL
                     NGIHNSSFLSNFSTGLTPMFNLTPQFNSLMNSVMSLNSPQYKKLGGSHSNYNLMMNPF
                     LANNQDSISSSSLSMSLPMGSSIPGSTVQLPLPESTPILPPHHHHHHHHHHHQSVGST
                     EKQREVDNEENNREVLDQQHISHHQHSDQPAEHEVYPQVTTFHAYSENSGNAQRYEAR
                     SIDSNVDDATGGVSDHANSSDESGDARLALKRVMYEGK"
     gene            <577702..>578871
                     /gene="RPL3"
                     /locus_tag="PVL30_003365"
                     /old_locus_tag="LELG_02528"
                     /db_xref="GeneID:5233093"
     mRNA            <577702..>578871
                     /gene="RPL3"
                     /locus_tag="PVL30_003365"
                     /old_locus_tag="LELG_02528"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_001525920.2"
                     /db_xref="GeneID:5233093"
     CDS             577702..578871
                     /gene="RPL3"
                     /locus_tag="PVL30_003365"
                     /old_locus_tag="LELG_02528"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_001525970.1"
                     /db_xref="GeneID:5233093"
                     /db_xref="PFAM:PF00297"
                     /translation="MSHRKYEAPRHGSLGFLPRKRAAKQRGRVKSFPKDVKSKPVALT
                     AFLGYKAGMTTIVRDLDRPGSKMHKREVVEAATVVDTPPLVIVGVVGYVETPRGLRSL
                     TTVWAEHLSEEIKRRFYKNWYKSKKKAFTKYSAKYASDAKQIETELARIKKYASVVRV
                     LAHTQIKKTPLSQKKAHLAEIQINGGSISDKVDWAKEHFEKEVSVDSVFEQNEMIDVI
                     AVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPANVNWTVARAGQNGYHHRT
                     SINHKVYRVGKGGDESNGATEFDRTKKTINPMGGFVRYGNVNNDFVLLKGSIPGVKKR
                     IVTLRKSLYVDTSRRALEQVNLKWIDTASRFGKGRFQTPAEKHAFLGTLKKDLEN"
     gene            <580415..>581935
                     /gene="utp15"
                     /locus_tag="PVL30_003366"
                     /old_locus_tag="LELG_02529"
                     /db_xref="GeneID:5232894"
     mRNA            <580415..>581935
                     /gene="utp15"
                     /locus_tag="PVL30_003366"
                     /old_locus_tag="LELG_02529"
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /transcript_id="XM_001525921.2"
                     /db_xref="GeneID:5232894"
     CDS             580415..581935
                     /gene="utp15"
                     /locus_tag="PVL30_003366"
                     /old_locus_tag="LELG_02529"
                     /note="BUSCO:EOG09261MMR"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /protein_id="XP_001525971.2"
                     /db_xref="GeneID:5232894"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF09384"
                     /translation="MSSARQGVQPVRNPTLVAQTTPEQRYWRSYVSPQLIKENHPINH
                     IEFNPVSPHDFSVTSSTRIQVFSSKTRQVIKTFSRFKDVVLASNYRFDGKLICASDAT
                     GLVSIYDSYQPRNLLVSLNPSSHPTHAVKFHPTIASQLFTGSDDRKLRLWDISQTSQG
                     PIMQFDESHHGDYIRSINYIPGNPNMVLTGCYDGVVRLFDTRDSTGAVARFDQEDLVT
                     DVLAVSSSTIVSAGGPHVKIWDLTRNAQIHQLDNFTKTTTCLHDTKEKGLLVGSLDGH
                     VKIFDYNTTNWDVKFGWKFSSGGVLTCAVSPENHKHFAAGLTSGLISIRTKKTEPKVK
                     QGVKQETTNAYARMMKGRDYSGEEEYEIVNNTSTPQSQQKGKLKQFEKYLNAFKWAEA
                     LDSAFAPGLPKEQTITILNELKKRGKMRIALFERDEISLLPMLQWFTKNIEDVRSFNL
                     LCDYSAVILEMYGDKIDKSVILEESFNSLLKKIETEIKKCNEAIEINGMLELLTAQ"
     gene            complement(<582203..>583366)
                     /locus_tag="PVL30_003367"
                     /old_locus_tag="LELG_02530"
                     /db_xref="GeneID:5232941"
     mRNA            complement(<582203..>583366)
                     /locus_tag="PVL30_003367"
                     /old_locus_tag="LELG_02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525922.2"
                     /db_xref="GeneID:5232941"
     CDS             complement(582203..583366)
                     /locus_tag="PVL30_003367"
                     /old_locus_tag="LELG_02530"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525972.2"
                     /db_xref="GeneID:5232941"
                     /translation="MVESIDVNNRQEILVDPSFSLLNSFISSVDHLPCDIIRSLWLVQ
                     TCNLKIDKLRQGLNDILHKYQTDGYLKDAELATVYELQNQIKWLSKEAVSESKALNCQ
                     LITHKLYLQEEINQLHNLKNIEQYNSINDRHAMELLRKQLKAHYRENPLRSQVEALAQ
                     QQEQSQQSLTKQSQQSLPTQSQQSLTKQSQSEKKSDQTSIKKESSGLKLILRIPKHDK
                     LDKKDDRDIKEVSQNNRPKLGRPKLKTTITPVQKPNKIVKPGEKAKDTRAAEFKKGNK
                     KKITTQIPAINENNLKIIVSQNAVEKDEEDKRYCFCNQPSLGDMIACDNEDSCPNGEW
                     FHYKCVGLLNRVDAMKYTTGKEQWFCSEKCREVVESKTTTKEEQKKRKRRKKW"
     gene            <584598..>585671
                     /locus_tag="PVL30_003368"
                     /old_locus_tag="LELG_02531"
                     /db_xref="GeneID:5233037"
     mRNA            <584598..>585671
                     /locus_tag="PVL30_003368"
                     /old_locus_tag="LELG_02531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525923.2"
                     /db_xref="GeneID:5233037"
     CDS             584598..585671
                     /locus_tag="PVL30_003368"
                     /old_locus_tag="LELG_02531"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525973.2"
                     /db_xref="GeneID:5233037"
                     /db_xref="PFAM:PF02535"
                     /translation="MNRYEQEYTILNIIQRNEDECLAGNDYNGKYFVARITTVPVLFI
                     LSALGAFAPLVAMYTQKFKVPSYVFFAIKFFGSGVIIATGFIHLMAEANASLTNTCLG
                     APFTEYPFTEAIALMALYLIFFFDAVAHKKLVEKAANMSGLENPSQPSDKISISRCSS
                     GSLSVLSATKNIDKEKHSDNENEENKVNIKSFEKMYQKILNCIVLECGIVLHSIFVGL
                     SLTISGDEFVTLYIAIGFHQFFEGLGLGTRFATTQWPPGKKYVPWLMSLAYSLTTPLA
                     AGIGLIVRGSYPAGSRTALIVTGTFDAACAGILIYNSVAELMAYDLIYSGDFENSSMN
                     QLLLAYFFLALGALAMAIIGKWA"
     gene            complement(<585956..>589423)
                     /gene="MSU1"
                     /locus_tag="PVL30_003369"
                     /old_locus_tag="LELG_02532"
                     /db_xref="GeneID:5233169"
     mRNA            complement(<585956..>589423)
                     /gene="MSU1"
                     /locus_tag="PVL30_003369"
                     /old_locus_tag="LELG_02532"
                     /product="3'-5' RNA exonuclease complex component"
                     /transcript_id="XM_001525924.2"
                     /db_xref="GeneID:5233169"
     CDS             complement(585956..589423)
                     /gene="MSU1"
                     /locus_tag="PVL30_003369"
                     /old_locus_tag="LELG_02532"
                     /note="BUSCO:EOG09260JNY"
                     /codon_start=1
                     /transl_table=12
                     /product="3'-5' RNA exonuclease complex component"
                     /protein_id="XP_001525974.2"
                     /db_xref="GeneID:5233169"
                     /db_xref="PFAM:PF00773"
                     /translation="MKRIKWNNNLVRELNRAFSGQKISTRCRSSKSSLHNRRRGTRDS
                     FAEKDYNPLAKYQESADLGRLYDYDSRVFVNKKMKAGGSGDLRNVVKLDKSFLDELKD
                     KATLKQKNSNDEKFNSQNLKNLIKSKKKIVDYDAPHLDLSKSNKQLFDEIRKNARQSR
                     DLKYNNPSKKWSNSFSNQELKQMKKLFNSIPVDATVSGKSITDALQVGDLVAIGQELL
                     KLYIVAKVPESFASAIVTLLSDRGDVLFVHTSTICLRIPGAVPTSLRPMLKQFVELET
                     KHLDSMPIGVPDAKFSKSKEALPTDLQAEYVSIEASAELDEEAEYEPQNLLVTQASSQ
                     LLTNTAVQTFLVPEPAREMYYKALTQVSSDAFSMIEEFNTKLEKLHRSLQFDMTSELN
                     APRSISIFELLSRVEDVEKQNQNPSATTSLALSPAKMVDYDKISFPIAKYMAIVFVLK
                     KQSRLWTIQKSSQTPTRVTIWPLAQIVHEDLILQYLNNKGGIAEIAKYCVEKIAQVDS
                     MHQTSLSSLPPPPPQFENIKNILKAYVIGKYENNPGVSSTVISLLRAIDDGLYKKTGV
                     SQIEDAYKFEYSSGKAYDLLTKLDNDIISNPNNWFPEAKLPSEELKLKSSSQEEYLRY
                     FDDAYNSINRDILMDKCLSENLFANDPLAKIRVDMTEVPVYCIDDASAHEIDDGISIH
                     EEKGEYVISTHIAEPSSFIKPDSPLSSIALERASTTYFPENVVPMFPKAIADLAGLGV
                     NGKETRTFVIQYRLKKEDIDFFIEQSEQDSMYIPEPTFLERVKQQAESSAKVKFALTK
                     RYPQGFTYDAVENLLNSGGIFGASNLGNGRNSGVSLSATRTDFQNLNKLSKISKLFWL
                     HRKLKNAYVGTGNARISIKQTMAEDKDLLIDGSNLIRIKLPNSTNSISFVKDKKKTSV
                     QLVTENMIMANYLVANIADKLGIDILYKFSDPKYEKNLLNEYNDLLRKASQNGDIPMQ
                     KKLDLFLLFPKTFISATPQMHFPMALSMYSNITSPLRRYIDIINQWKFQEYLLKTEMV
                     SKTSVDAVISHLNSRGEIQKRLQKSTEGFWQALMLKVFIQQYSSQENMAKDLNLTLCL
                     RHNPASSQMVSLVHDLFTFVRMHLEVSNALLQDIKSGKVQVGDPLDPTRLVCKKLDII
                     ENELIFEYK"
     gene            <590008..>593529
                     /gene="SMC2"
                     /locus_tag="PVL30_003370"
                     /old_locus_tag="LELG_02533"
                     /db_xref="GeneID:5233640"
     mRNA            <590008..>593529
                     /gene="SMC2"
                     /locus_tag="PVL30_003370"
                     /old_locus_tag="LELG_02533"
                     /product="Structural maintenance of chromosomes protein 2"
                     /transcript_id="XM_001525925.2"
                     /db_xref="GeneID:5233640"
     CDS             590008..593529
                     /gene="SMC2"
                     /locus_tag="PVL30_003370"
                     /old_locus_tag="LELG_02533"
                     /codon_start=1
                     /transl_table=12
                     /product="Structural maintenance of chromosomes protein 2"
                     /protein_id="XP_001525975.2"
                     /db_xref="GeneID:5233640"
                     /db_xref="PFAM:PF02463"
                     /db_xref="PFAM:PF06470"
                     /translation="MKVDELIIDGFKSYATRTVISGWDASFNAITGLNGSGKSNILDA
                     ICFVLGISSMQTVRASNLQDLIYKRGQAGVTKASVTIVFNNSEISKSPIGFENCSTIS
                     VTRQIILGGTSKYLINGHKAQQQTVLSLFQSVQLNINNPNFLIMQGKITKVLNMRANE
                     ILSLIEEAAGTRTFEEKKAKAKKIMSKKDTKLLEIKTLLIEEIEPKFEKFRNDKRVFF
                     EFQQTQIDLEKQQRLLVALEFSNLSSLLTNSSDSTNKYENKLAELQLDIDKVTHEIES
                     LNEDLAQVKAARERNMNKDGELNALEQNESRLANELARLTTQRTLAKEELDSLLSKKQ
                     SLFIKKKELENLTNETKLSYDEHQKRLEEAKSNLARCKEIYEKKEELLAGLSTGLSAK
                     GNVATGYSAELAELKNKLHSSKNLINQHKFKIEHLQRENQADEPKLFEAKKEYEHFVS
                     KIKTIKEEITFREEKLQQSMGDFVGDTNPNELRDREERLHYEQDRLYNQLNHMKNNLR
                     GLEFNYERPSQDFDDRLVRGVVAQLFELPEDSHDKAIALQQCAGGRLYNVVVDTSEVA
                     SQLLERGRLRKRVTMIPLDKINPAVIGSATIGHAEQIAPGKVQLALSLVNYHRDLHKA
                     MQYVFGTTFICDDPNTAKAVTFHPQVRARSITIEGDTYEPEGNISGGSRRNNSALLLA
                     VKDYNKLSQKLKVVDKEVSAVRDQLTQWEKTQHATSGLRNEIQMKKHELALLERKLET
                     NKSVSLIRAVETRQQEISALEAEIEEHKKISAQLQQEITSTEKDLNEFNNDKSSKLES
                     LKIEVGKLKKEYESKKELLANETENFQVLQWESEQRCSELEEIAQELHTMESALGQSE
                     TKESEDQDKQENLERDLAMVRAKIEDEKNSLAGLDEEFNELTRIIASKTKRVENHKIK
                     IKSVQFELEKARNATSSLKERLDLIMGEFEWVMDARSVEKTIEQHPGVNYDEVKSQVA
                     KLDEKFQSMRRKVNVNIMSMIEENEKREASLKSKVKIIEKDKKKIETTIAKLNGEIRK
                     ALNATYQKVSEDFGQIFADLLPGSFAKLVPVDMMDVTKGLEVKVKLGSVWKESLVELS
                     GGQRSLIALSLIMALLQFNPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVS
                     LKEGMFTNANRIFRTRFQDGTSVVSVM"
     gene            <594403..>595779
                     /gene="ANP1"
                     /locus_tag="PVL30_003371"
                     /old_locus_tag="LELG_02534"
                     /db_xref="GeneID:5233449"
     mRNA            <594403..>595779
                     /gene="ANP1"
                     /locus_tag="PVL30_003371"
                     /old_locus_tag="LELG_02534"
                     /product="Mannan polymerase II complex anp1 subunit"
                     /transcript_id="XM_001525926.1"
                     /db_xref="GeneID:5233449"
     CDS             594403..595779
                     /gene="ANP1"
                     /locus_tag="PVL30_003371"
                     /old_locus_tag="LELG_02534"
                     /note="CAZy:GT62"
                     /codon_start=1
                     /transl_table=12
                     /product="Mannan polymerase II complex anp1 subunit"
                     /protein_id="XP_001525976.2"
                     /db_xref="GeneID:5233449"
                     /db_xref="PFAM:PF03452"
                     /translation="MSLSMGVKPYEYDDGFEDRSKMKSSDFNRSLQSILNYPYFKSLR
                     DIIISLLIFILILVTILSRLFIFGSSYSPNLKGIDDTVQFFDLANYNGKPNGWQYEER
                     VLFCVPLRDAAAHLPMFFDHMKKLTYPHHLIDLAFLVSDSKDDTMGALLRHLNQVQES
                     PLQFGQIEIFEKDFGQAIGQGFSDRHGFAAQGPRRKLMARARNWLWSVALKPHHSYVY
                     WRDADVETIPPTILEDLMHHDKDIIVPNVWRPLPDWLGNQQPYDLNSWQESDGGLQLA
                     DTLDEDACIVEGYVEYQTWRPHLAYLRDPYGDPEVEMELDGIGGVSILSKAKVFRSGS
                     NFPAFSFEKHAETEAFGKLSKRMGFSVVGLPHYVIWHIYEPSQDDLKHMEWMASEEIR
                     QQEEIKIKNKYDKVWDKAYVDVQGDWQKEKAKVLKNTDMSKVRKIQVDWSGSDDWHLD
                     KNVKAGKN"
     gene            complement(<596930..>601897)
                     /locus_tag="PVL30_003372"
                     /old_locus_tag="LELG_02536"
                     /db_xref="GeneID:5232910"
     mRNA            complement(<596930..>601897)
                     /locus_tag="PVL30_003372"
                     /old_locus_tag="LELG_02536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525929.2"
                     /db_xref="GeneID:5232910"
     CDS             complement(596930..601897)
                     /locus_tag="PVL30_003372"
                     /old_locus_tag="LELG_02536"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525979.2"
                     /db_xref="GeneID:5232910"
                     /db_xref="PFAM:PF11766"
                     /translation="MLYYLVQALAVLSIVSAAQVSNVFQSFNSLVWQNGASYALSTPA
                     APNWIATLSWQILGSNVKAGDSFTLHMPCVFKFTTTQTGVSLAVGNTVYATCNFEPGD
                     LVVAFSELQCVATSNVQASTNAYGTVSFPFTFNVGGSANAVDLQSSTCFNSGTNTVTF
                     TDGGNPLSISVNFQGGSNTNAATGVSTNNIVYSNRIVPTLNRQQVYLLAGSCPNGYTS
                     GTLGVSVTSGSIDCSSVHAAISNAFNAWYYPESASTFSYTNTCSTSGFSISYSNVPAG
                     YRPFLDMLVAVATGASLTTSFTNKYKCVGSSTTVDNSKSVTWGAYNNNQAGANGQEVV
                     VTTVTWTGSTTLVTTLPFNSGVDKTKTIQVDVPVPTTTLSSQFCGPSTSFTTFTATPG
                     KTATVIEFDPNTALCPITSEKPTTSEEPTTSEEPTTSEEPTTSEEETSSEEPTTSEEP
                     TTSEEPTTSEEPTTSEEETSTEEPTTSEEPTTSDEETSTEEPTTSEEPTTSEEETSTE
                     EPTTSEEETSTEEPTTSEEPTTSEEPTTSEEETSTEEPTTSEEPTTSEEPTTSEEETS
                     SEEPTTSEEETSTEEPTTSEEPTTSEEETSTEEPTTSEEPTTSEEETSTEEPTTSEEP
                     TTSEESTSSEEETSTEEPTTSEESTSSEEETSTEEPTTSEEPTTSEEPTTSEEETSTE
                     EPTSTEEPTTSDEPTTSEEETSTEEPTTSEEPTTSEEPTTSEEPTTSEEETSTEEPTT
                     SEEETSTEEPTTSEEPTTSEEETSSEEPTTSEEETSTEEPTTSEEPTTSEEETSSEEP
                     TTSEEPTTSEEPTTSEEETSTEEPTTSEEPTTSEEETSSEEPTTSEEETSTEEPTTSE
                     EPTTSEEPTTSEEPTSTGEPTTSEEETSTEELTTSDEETSTEEPTTSEEPTTSEPPTS
                     TGEPTTSEEETSTEEPTSIREPTTSDEETSTEEPTTSEEPTTSEPPTSTGEPTTSEEE
                     TSTEEPTSTREPTTSDEETSTEEPTTSEEPTTSEPPTSTGEPTTSEEETSTEEPTSTR
                     EPTTSEEPTSTGEPTTSEGETSTEELTSSKEENSTEEPTTSEEPTTSEPPISSSSIVP
                     PYQNTTVSETSSENTETGTEVPPTDTGSNTGVPPTGTDTGTNTGVPPTGTDTGVPPTG
                     TDTNVPPTGTDTNVPPTGTDTNVPPTGTDTGVPPTGTDTNVPPTGTDTGVPPTGTDTG
                     VPPTGTDTGVPPTGTDTGVPPTGTDTGTNTGVPPTGTDTGVPPTGTDTNVPPTGTDTN
                     VPPTGTDTNVPPTGTDTGVPPTGTDTGTNTGVPPTGTDTNVPPTGTDTGVPSTGTDTG
                     VPPTGTDTNVPPTGTDTGVPPTGTDTNVPPTGTDTGTNTGVPPTGTDTGVPPTGTDTG
                     VPPTGTDTGVPPTGTDTGVPPTGTDTATPPTGTGTGTNTATPPTGTGTGTNTATPPTG
                     TGTGTNTATPPTGTDIGVPPIGTNTATPPTGTDIGVPPIGTNTATPPTGTDIGVPPTG
                     GGTNTATPSATSLETGKVYPPLSSTTFEGAIVPTIAPNESAVEPTTSQKPSTEQPSAE
                     QPSAEQPSAEQSTAEQIGEDQTGAGQTLGISSGNEGVASAINTGAQSTATTSLIEQFS
                     TVPVESASSAVTVPSMIGYEGSAAGKFTKRSSLLTGFAILVSILL"
     gene            <607783..>608097
                     /locus_tag="PVL30_003373"
                     /db_xref="GeneID:85890358"
     mRNA            <607783..>608097
                     /locus_tag="PVL30_003373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119461.1"
                     /db_xref="GeneID:85890358"
     CDS             607783..608097
                     /locus_tag="PVL30_003373"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975444.1"
                     /db_xref="GeneID:85890358"
                     /translation="MTQESSVNIAEAYKQISEAEARAAELERSLDAFEAKLDSILKDA
                     EDISKESSKIDREASSSSSSSLSTATTTATESEKEKKEEKENLLNEADDESVGDRQET
                     SQ"
     gene            complement(<608158..>611130)
                     /gene="INP51"
                     /locus_tag="PVL30_003374"
                     /old_locus_tag="LELG_02538"
                     /db_xref="GeneID:5232929"
     mRNA            complement(<608158..>611130)
                     /gene="INP51"
                     /locus_tag="PVL30_003374"
                     /old_locus_tag="LELG_02538"
                     /product="inositol-1"
                     /transcript_id="XM_001525930.1"
                     /db_xref="GeneID:5232929"
     CDS             complement(608158..611130)
                     /gene="INP51"
                     /locus_tag="PVL30_003374"
                     /old_locus_tag="LELG_02538"
                     /codon_start=1
                     /transl_table=12
                     /product="inositol-1"
                     /protein_id="XP_001525980.2"
                     /db_xref="GeneID:5232929"
                     /db_xref="PFAM:PF02383"
                     /db_xref="PFAM:PF03372"
                     /translation="MRLYLNEKPRTFVITTSTHALVIRHPNPTYKHRSLRNFLHGHKH
                     NKDNGKDSSKVLVEFVLKDFINLSAFRDVTPKNSKLIGFLGLLSLKNKIYLGFITNDD
                     FVASPTADEKIYRILGTEFYCLNNDEYDYLLNRNYESSGHSESERVKYPASSVRKLLS
                     SGAFYYSKQFDITSTIQERGFGRTDFRLIADSAYFEQFHWNKFMLGELLEFRNRLTAS
                     EQKQIDQSGFLTIIVRGYAKTVNTQIGGEEAMMTLISKQSCAKEGPLFGDWGCDGNGY
                     VSNYLESEIVLYTDKFCLSYVLIRGNAPMYWELENSFTTKGLLAANGKKILFPRSFEA
                     SQEAFVRHIERIAIQFGDVHIFNELSNKSYKGVLNASLEEQIKYFVQHREQSALDFRL
                     SYTHLPIPAARVRKLWYTAQNPYDIVATFANSAVNFGALFYENSSNTFIGKQLGVFRI
                     NSFDSLNKANFLSKVISQEVIKLAFQDIGIDLERELYTKHAKLWEENDRQITKMVMNY
                     VSYSDKLKTSTQSHASSVKTHIKKNYLKGVVDTTKPNELALLKLLGRLQDQQAITLHN
                     PLHDYVARELSSRQKEFTSQSQISVFASTFNVNGTVYEGDIDSWIYPTDVKHDLVFLG
                     LQEIVELKPGQIVNTDLRNKTQWERKILGCLSKRDKYMTMWSGQLGGLVLLLFVKESQ
                     VKYVSNVEFTFKKTGLGGVAANKGGVAVSFKYSDTSMCFVSSHFAAGLSNDEERHHNY
                     KTLVKGMKFTKNRRIPDHDVVLWVGDFNYRINLPNDQVKPLILQKKWGKLLEFDQLNQ
                     QMASGESFPFFAEQEISFPPTYKFDNGTKIYDTSEKQRVPAWTDRILYKSRQNAIKPN
                     GYNCVQNIIFSDHRAVYAVFEVTVKIVNYAIKKSISNQLYESYKLKHGELQDIASLSF
                     DVGKKIIDYDNDNLPPPSTDKEKWWLKDGKPAKVTISALNSERNDLVINPWHPINPFV
                     RTNEPEFVPLKELQGMLT"
     gene            complement(<611593..>612312)
                     /gene="IRC22"
                     /locus_tag="PVL30_003375"
                     /old_locus_tag="LELG_02539"
                     /db_xref="GeneID:5232897"
     mRNA            complement(<611593..>612312)
                     /gene="IRC22"
                     /locus_tag="PVL30_003375"
                     /old_locus_tag="LELG_02539"
                     /product="Increased recombination centers protein 22"
                     /transcript_id="XM_001525931.1"
                     /db_xref="GeneID:5232897"
     CDS             complement(611593..612312)
                     /gene="IRC22"
                     /locus_tag="PVL30_003375"
                     /old_locus_tag="LELG_02539"
                     /codon_start=1
                     /transl_table=12
                     /product="Increased recombination centers protein 22"
                     /protein_id="XP_001525981.1"
                     /db_xref="GeneID:5232897"
                     /translation="MKVFTLLAAAAASIATVVGYETAEKQFVDILIEYQIVQTPEVTK
                     NDVAQWTNGDEVTLKYNIVNNEEKEVTVIGVTGQFTNPVTNEIVTNLTQGRVGPLSIP
                     PGQSASFEQNIGIDVIPNNYELIPQVFFAHDELIKVIPCRGQLATVADKSISFFDPRL
                     IFLELVLLASFAGIAYLAYQIWGKKYIQGTAPVKVKKTTAVTSVPAGTGVSTTTTGAS
                     GYDVNWIPEGHLKQKKTKKVA"
     gene            <613243..>614823
                     /locus_tag="PVL30_003376"
                     /old_locus_tag="LELG_02540"
                     /db_xref="GeneID:5232944"
     mRNA            <613243..>614823
                     /locus_tag="PVL30_003376"
                     /old_locus_tag="LELG_02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525932.2"
                     /db_xref="GeneID:5232944"
     CDS             613243..614823
                     /locus_tag="PVL30_003376"
                     /old_locus_tag="LELG_02540"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525982.2"
                     /db_xref="GeneID:5232944"
                     /translation="MLRTSFIKDSTVRTRCLATSIRSNDALYKSQKELLADPNWAYER
                     AKRRNRQRLKEYDQAVIASRQYLQHRENVLKLLGKSDNIKALFTANDGFCKTDNYDEV
                     CKRLGAEPLQYNDIEMRNTIMLVCTMLLENIMVEMKLNTLRGENGNNEEQNLTELMAS
                     LRSSDEFFSLYRYRTNFYHFKSSQFLNYSDSELGPEIDSNNVVKFLLSEYDDTEILNN
                     LDKVFKKYKSIISTIGTSTNADTAHINLAQQIINTLTAPHRCIPTVKIWAYLIDELGK
                     VGLTNYQQIIYLSMFQYKHAPSVLAKPSEATNTITAPLMADHFLHLIQQDPNMLSTLL
                     QYQVPRKDYGMFVELLSFLKLDRVAAETMVIKSPLFSRSSCKSPKVIPGSVLDITGLT
                     ISRGCMYSIMRSTIDIGLFEYLDLLFDKIVLHSMDKDNIELHYTQVVPVEGKVFDLEL
                     FLIMLDAALKSNDMGRLVWLLPFIDEYITDNKGQVPKVLRQKLFESLTFFKLEGKLKT
                     YKSVFSKVEKPVASPSVS"
     gene            complement(<614898..>615485)
                     /locus_tag="PVL30_003377"
                     /old_locus_tag="LELG_02541"
                     /db_xref="GeneID:5233498"
     mRNA            complement(<614898..>615485)
                     /locus_tag="PVL30_003377"
                     /old_locus_tag="LELG_02541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525933.1"
                     /db_xref="GeneID:5233498"
     CDS             complement(614898..615485)
                     /locus_tag="PVL30_003377"
                     /old_locus_tag="LELG_02541"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525983.1"
                     /db_xref="GeneID:5233498"
                     /translation="MPEKPQITKSVSRNCSAKIGNAKKSCKTCTKNKKYYNDLVSAEA
                     SLLDDIFVCLMTIFTSPSFDNHFQKFQFNVALFLALVECLVANEEIQQEMGKNDLCTL
                     DTTLQSQSAFEKSRYPNSVDGFNKTTQKFVHNKRVDPSIREKDKDCKVDDDDLAIYSN
                     DKTNCFNFNMQIGSILALTNARLKEWEKVGRNAVL"
     gene            complement(<616198..>617736)
                     /gene="FCY21"
                     /locus_tag="PVL30_003378"
                     /old_locus_tag="LELG_02542"
                     /db_xref="GeneID:5232966"
     mRNA            complement(<616198..>617736)
                     /gene="FCY21"
                     /locus_tag="PVL30_003378"
                     /old_locus_tag="LELG_02542"
                     /product="Purine-cytosine permease fcy21"
                     /transcript_id="XM_061119462.1"
                     /db_xref="GeneID:5232966"
     CDS             complement(616198..617736)
                     /gene="FCY21"
                     /locus_tag="PVL30_003378"
                     /old_locus_tag="LELG_02542"
                     /codon_start=1
                     /transl_table=12
                     /product="Purine-cytosine permease fcy21"
                     /protein_id="XP_060975445.1"
                     /db_xref="GeneID:5232966"
                     /db_xref="PFAM:PF02133"
                     /translation="MSYDPEKNIALAAEKNSLNSYEVNSPTSASDAEVHDAHVHIIDR
                     WAHKLGAETKGLDLVTDEEKTDTSLWNSASMWLSANLVIATFALGALGITVFDLAFGQ
                     AVLVIIFFSALGNFTVAYFSCFGPPLGLRQIILSRFMIGDIPVRIFSFINVVACVGWG
                     AVNIMSSAQLLHIVNNGLLPPWAGCLILVVCTILVTFFGYHVIHLYEKWAWVPNFAIF
                     IVIIVQFARSGTFSSDAFVGGETTAGNVLSFGGTVFGFATGWTSYASDYTVYQPRNAN
                     LVKIFFAIFLGLFLPLVATLILGAACATGIANKPEWAQLYAENSVGGLVYGILVVDSL
                     HGFGQFCCVVLALSTVANNIPNMYSMALSAQTFWSPMAKVPRIVWTFVGNGATLAICI
                     PAYYKFESVMENFMNLVSYYLAIYESLMLSSHFIWHKGNFRAYDYTQYQNKQAYPIGL
                     AGTFGFCCGVAGVVVGMNQTWYSGVIAKQIGDYGGDIAFELAFAFAFIGFNITRYFEK
                     KYIR"
     gene            complement(<621333..>622376)
                     /gene="GCN4"
                     /locus_tag="PVL30_003379"
                     /old_locus_tag="LELG_02543"
                     /db_xref="GeneID:5232970"
     mRNA            complement(<621333..>622376)
                     /gene="GCN4"
                     /locus_tag="PVL30_003379"
                     /old_locus_tag="LELG_02543"
                     /product="General control protein"
                     /transcript_id="XM_001525935.2"
                     /db_xref="GeneID:5232970"
     CDS             complement(621333..622376)
                     /gene="GCN4"
                     /locus_tag="PVL30_003379"
                     /old_locus_tag="LELG_02543"
                     /codon_start=1
                     /transl_table=12
                     /product="General control protein"
                     /protein_id="XP_001525985.2"
                     /db_xref="GeneID:5232970"
                     /db_xref="PFAM:PF00170"
                     /db_xref="PFAM:PF07716"
                     /translation="MSAATTTTITMQNNQGSLIESAYRAAPTEMTSDVNCAEAESQRE
                     HVHEREVASPFQIHSSVLDSVFSTTNLDGKDAMLDHTPMFDELDFIVDGINVNSKDDW
                     VALFGEGDEGSAAAAATAAASSTASMFAGEGVSADAVCTNGPIIDLGCSVSAEARTES
                     GDVKHGIFEDSMLEALLAEPSPNGLSDETISAATTSASSPEVDASTVCTSVAPSTSSA
                     NGRKRSFKEVEQTQLFTPNPSSTLPTPQLDVKKSSSLSSSSSSNKKARVDHLGCVAYS
                     KKQRSQTLEPIDFSGIEDVSALKRAKNTEAARRSRARKMERMTQLENRVGELMAENDD
                     LKKEVERLRALLS"
     gene            <625282..>626043
                     /locus_tag="PVL30_003380"
                     /old_locus_tag="LELG_02544"
                     /db_xref="GeneID:5232971"
     mRNA            <625282..>626043
                     /locus_tag="PVL30_003380"
                     /old_locus_tag="LELG_02544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525936.2"
                     /db_xref="GeneID:5232971"
     CDS             625282..626043
                     /locus_tag="PVL30_003380"
                     /old_locus_tag="LELG_02544"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525986.2"
                     /db_xref="GeneID:5232971"
                     /translation="MKSDPFRSFTNIFKKKKTDSASNDKTTSEKPKKQVAAASSPSSS
                     KKQASSPVQSQNQSQPESQPRPQTERKADVSQSLLAAEQRANKYTKKPSSSALSAGKS
                     TPATTTTATKASTSNFNSTSTPTSPAVDDEDYRVTKQDLQTYQKSIRSSGKINKKKAQ
                     QKQTTKEPFSPMIKLKLPNGKMTQVEFTQLITEITFEELFQKIDTVVPQDLVGKYVLK
                     TSTPPFKIITAKNDTLLSQIPEFQHERLVLVLGHK"
     gene            complement(<626373..>629378)
                     /gene="MSH3"
                     /locus_tag="PVL30_003381"
                     /old_locus_tag="LELG_02545"
                     /db_xref="GeneID:5232975"
     mRNA            complement(<626373..>629378)
                     /gene="MSH3"
                     /locus_tag="PVL30_003381"
                     /old_locus_tag="LELG_02545"
                     /product="Mismatch repair protein msh3"
                     /transcript_id="XM_001525937.2"
                     /db_xref="GeneID:5232975"
     CDS             complement(626373..629378)
                     /gene="MSH3"
                     /locus_tag="PVL30_003381"
                     /old_locus_tag="LELG_02545"
                     /note="BUSCO:EOG09260LI6"
                     /codon_start=1
                     /transl_table=12
                     /product="Mismatch repair protein msh3"
                     /protein_id="XP_001525987.2"
                     /db_xref="GeneID:5232975"
                     /db_xref="PFAM:PF00488"
                     /db_xref="PFAM:PF01624"
                     /db_xref="PFAM:PF05188"
                     /db_xref="PFAM:PF05192"
                     /translation="MASKKQSSISSFFSSQTRKSPGRDAKKNDISSSPFSAASSTNNS
                     IGSTPRVSPIAKFQYNKSTSTLHENTNPRVKRVSTLNVDVEKEHKKIKRARSTKLTPL
                     ESQILQLLSEHPDKILLIQVGYKYKVYGEDARHVARCLNIMFISSSTDPTFSYCSFPE
                     NRLHINLQRILNTGVKVGVVKQMESAIIKEVDKIGKSGDLMKRELTGVYTRGTYMNDE
                     FIDSGLNSPEQEELGYIVCVNEISRYQFAIVAIQPLTGEIIYDDFTDDVSHDELETRL
                     LYLRPSEVLLLGCGGNESNNNNNNSSSSSNNNNSNNSNNSNDNGTDADAQNQTSTLQC
                     FQKLVNHNIKIERKPKGSNNLKAVLNAAALNFYRELSEPVQVCVSELVKYLEEFNLSN
                     IFTVIENVSKFDSKKTMILPASTMLSLEIFQNSENSTTKGTLFSLLNHTKTPFGMRLL
                     ESWVSHPLIDKDKIEERYQAVEDLSTGSHFNDCLSRLLQKIGKNLDLESIAIKIHYST
                     TTRSLATKINRKDIFMMLSMYQSALQFVSQFEKTIKASNLSPLLKRVLDNLLQSANTD
                     TVDRFMDMINPSYLLGEQQNLHQSSRSTREQKVKFFNLNNGFEEINRELAEIMNVKML
                     LEEELVKVKKLLQRPQLNYVTSNGEPYLIEVRNGKAVESLPIDFIKINGTTTVSRFRS
                     KEIAHLYKMKQYHEEVLNNRCDEAFNTFLNELDSHYGFFQGITKNLAVLDCLLSLAAV
                     SNSNSNTHVKPNLSDELIIDVKNARHPIIEHLRDGYVANDIDIRYDSNRVLVITGPNM
                     GGKSSYVKMVALLIIMTQIGCYIPCEAATIGIFDSILIRMGASDNLLKGRSTFMTEML
                     ECSNIIQKLTPRSLVILDEIGRGTGSIDGYSLAYAILRYLVESKLKPIVLCITHYTGL
                     LSETEDEKFDKDAKDENLDTGDDVVKSYYMGYEEITQPDQVFPEIVFLYNLCPGVSNS
                     YGLQVAKMAGLPKRVLLEAYLMSSVTDFD"
     gene            complement(<631021..>632457)
                     /locus_tag="PVL30_003382"
                     /old_locus_tag="LELG_02546"
                     /db_xref="GeneID:5232998"
     mRNA            complement(<631021..>632457)
                     /locus_tag="PVL30_003382"
                     /old_locus_tag="LELG_02546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525938.2"
                     /db_xref="GeneID:5232998"
     CDS             complement(631021..632457)
                     /locus_tag="PVL30_003382"
                     /old_locus_tag="LELG_02546"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525988.2"
                     /db_xref="GeneID:5232998"
                     /db_xref="PFAM:PF00096"
                     /translation="MSTKSNQSSSLQQQQQQQNSPSIPTETTKAIFSNTMFSQTQPSF
                     GTKIDYSQASAFNAPSSSHTIHYPQQYSQIHQQYQQYQQLQQPLFPLQGSGSQSQAQS
                     QAQSQAQVQTQAPASNNLYNAQFYHNDNYLLQGSPALQSNPSYGQFPSAVAPSQTTQH
                     NDIGLQPSQSTSSISIERPYAMTSITLDQTANSMHSLPPIVPFQGLASISHPQQQQSQ
                     QSQSQQEHNQYQMTKHSNSSPSIPVAYYSRGIDGQYSNIYDSTRYSASTTHNTNTMGG
                     NGGVNLINDGGFEPKKNRKRRQATSTLHSMTPETAERNRCRLCGKQFRRPSSLQTHYY
                     SHTGEKIFKCPWKECGKLFSVKSNMTRHYKLHERDLQRAHEFKLQSQNPQLMNHLEVH
                     SNTPNRGVAGTNTVGNAVSTGSDIAVGGLLHSYPLQQQIQHQQQHHQQNQQQQNQQQQ
                     HHLYPSYAQIQNPTGHSLDNVQQRNSLP"
     gene            complement(<639496..>640611)
                     /locus_tag="PVL30_003383"
                     /old_locus_tag="LELG_02548"
                     /db_xref="GeneID:5233024"
     mRNA            complement(<639496..>640611)
                     /locus_tag="PVL30_003383"
                     /old_locus_tag="LELG_02548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525940.2"
                     /db_xref="GeneID:5233024"
     CDS             complement(639496..640611)
                     /locus_tag="PVL30_003383"
                     /old_locus_tag="LELG_02548"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525990.2"
                     /db_xref="GeneID:5233024"
                     /translation="MKYYLVSSLLTLSTTVFAAVRPVRLYATSEDISFNGRGLYSIHE
                     GAGINYLFLGAPQLLQYNNESRVLYLELSTPPSNAKQYLAFQSEFLALTVAQEPLPVD
                     IASDGTVTFPRSELLYAAKSVSDPYRHSEEVYAVVNSIHDGAIPIGLRAEFEEPDDEH
                     TNPVEPESSDSEKLDDKTSEGAGDKTSEGTGDKTSDKTSDGTNDKISDDTSDKTSDKT
                     SDKTSDGTSDKTSDGTSDKTSDGTSDKTSSGTSDKTSDGTSDKTSSGTNDKTSDNTSG
                     KTSNTSQTTSKPSSADNSKPKSPNDRASTENISKSTDGLNSTGGDSSNSTNATPHTPV
                     PSHTLSSSATPETGAAGRYGFVASVFAIALGALGLVL"
     gene            <646084..>647145
                     /gene="PIR3"
                     /locus_tag="PVL30_003384"
                     /old_locus_tag="LELG_02549"
                     /db_xref="GeneID:5233036"
     mRNA            <646084..>647145
                     /gene="PIR3"
                     /locus_tag="PVL30_003384"
                     /old_locus_tag="LELG_02549"
                     /product="beta-1,3-glucan linked protein"
                     /transcript_id="XM_001525941.2"
                     /db_xref="GeneID:5233036"
     CDS             646084..647145
                     /gene="PIR3"
                     /locus_tag="PVL30_003384"
                     /old_locus_tag="LELG_02549"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-1,3-glucan linked protein"
                     /protein_id="XP_001525991.2"
                     /db_xref="GeneID:5233036"
                     /translation="MRITNTFATTAALISSTLAATVPSAPWSTLTPTGAIPTDASTDW
                     SHSFGIQIETIEVASQLATETGTIAGKKRDVVNGLSDGQPNVIPTASYSILSESVAPV
                     AQITDGQIQHQTTAAAASVVNQITDGQIQHQTTAAAASVVNQIGDGQIQHQTTAAAAS
                     VVNQIGDGQIQHQTTAQTVAGVNQISDGQIQNPSTTLLSSVAGAAQITDGQVQATNTV
                     AAESRLPTNATVATSGSSDPVVESDSAEPEDTNIQEACYSSNNLAMTLQDGLLADSKG
                     RVGAIVANRQFQFDGPPPQAGTIYAAGWSISSDGYLTLGDADVFYQCLSGDFYNLYDE
                     NVASQCNAVKLKIINFVDC"
     gene            complement(<648015..>651351)
                     /gene="NRC2"
                     /locus_tag="PVL30_003385"
                     /old_locus_tag="LELG_02550"
                     /db_xref="GeneID:5233044"
     mRNA            complement(join(<648015..650854,651348..>651351))
                     /gene="NRC2"
                     /locus_tag="PVL30_003385"
                     /old_locus_tag="LELG_02550"
                     /product="serine/threonine protein kinase, AGC"
                     /transcript_id="XM_001525942.2"
                     /db_xref="GeneID:5233044"
     CDS             complement(join(648015..650854,651348..651351))
                     /gene="NRC2"
                     /locus_tag="PVL30_003385"
                     /old_locus_tag="LELG_02550"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine protein kinase, AGC"
                     /protein_id="XP_001525992.2"
                     /db_xref="GeneID:5233044"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MNIYIKPSAMVNLSLFNLATSSPKHDDNTETSTASSNKSSNLSF
                     KINNGKDSQDPSPELGPTSRSSSRNRNRSISISRLLFNKETESNNSQKTEAAFDSQTS
                     NSPQHVPPLSSNTDETLNNDYKHNSIISNNSSQNQKQNQNQSHNNGNVNNSTSMSKLR
                     SIFRIPSASFNSQDDKSTMGRIRSLSSPFGQSSGNGNELSKPNKANVLQVPQVTVDAP
                     SSNTPPTVSSASMGTKGPTIPTESHDLGDEASPVVQANPYFHHQGLPPHLGVDQPPQP
                     HFLGSNKSEITVALRHNDSVYSLNENGIAKPPQVHHNQISSGDEEQDGEEEEKDGEEE
                     KNRNIPVDKQRQNQMQIQKSGKGLGLEMQLELDTKQEQKKKNKHNDEGEDLASPRIAH
                     TSHTSHTSHTSHTSHTSHTSHTSHTSHRPETPETLGTPHNEHTPSKLKSDISLKPIEV
                     DSGLAPPVSPFQRALRRVASAPLIHKMANDRLDSTDQNQGNDPNEEVFDINKHIGEVK
                     VSGRPRTYTQDRTYSHSATKAVDVQVGPDSFEKIKLLGKGDVGKVYLVREMQSNKLYA
                     MKILSKKEMIERNKIKRALAEQEILATSNHPFIVTLYHSFQSKEHLYLCMEYCMGGEF
                     FRALQTRETKTISENDARFYAAEVTAALEYLHLMGFIYRDLKPENILLHQSGHIMLSD
                     FDLSKQSERAKNPEITFAKSGMHLTSSGSNSPHHGPTIDTKACIDGFRTNSFVGTEEY
                     IAPEVIRGKGHTSAVDWWTLGIFLYEMLFGTTPFKGTDRKKTFANVLKRDVKFPDTQS
                     ISSSCKSLIKKLLIKEEEKRLGSKTGASEIKCHSFFKNTQWALLRHQKPPMIPVLTKS
                     SSKKRESSPKKPPTEETPASNEKKEPGTETFTDPNDPFAKFSSVTLRYGEEFEEDFNL
                     NSIYNPESTAYTSVAYTMTSDQSPSKSKGFLKR"
     gene            complement(<652551..>652943)
                     /locus_tag="PVL30_003386"
                     /old_locus_tag="LELG_02551"
                     /db_xref="GeneID:5233050"
     mRNA            complement(<652551..>652943)
                     /locus_tag="PVL30_003386"
                     /old_locus_tag="LELG_02551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525943.1"
                     /db_xref="GeneID:5233050"
     CDS             complement(652551..652943)
                     /locus_tag="PVL30_003386"
                     /old_locus_tag="LELG_02551"
                     /note="BUSCO:EOG09265F2Y"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001525993.1"
                     /db_xref="GeneID:5233050"
                     /db_xref="PFAM:PF03966"
                     /translation="MKFITTNFVKCAVKACQSSTDSFPLQYKECQLVQQEQEFKPEYV
                     LHMLDKLDWDAVVAVARDLGNDSIPQTKPEGLDPIMEDDVVVLKDLHTLLMETQLVEG
                     QMVCKNCQHIYYIKNSIPNFLLPPHLVN"
     gene            <653575..>654408
                     /gene="RPN12"
                     /locus_tag="PVL30_003387"
                     /old_locus_tag="LELG_02552"
                     /db_xref="GeneID:5233077"
     mRNA            <653575..>654408
                     /gene="RPN12"
                     /locus_tag="PVL30_003387"
                     /old_locus_tag="LELG_02552"
                     /product="regulatory particle non-ATPase"
                     /transcript_id="XM_001525944.1"
                     /db_xref="GeneID:5233077"
     CDS             653575..654408
                     /gene="RPN12"
                     /locus_tag="PVL30_003387"
                     /old_locus_tag="LELG_02552"
                     /note="BUSCO:EOG09263XN3"
                     /codon_start=1
                     /transl_table=12
                     /product="regulatory particle non-ATPase"
                     /protein_id="XP_001525994.2"
                     /db_xref="GeneID:5233077"
                     /db_xref="PFAM:PF10075"
                     /translation="MSLQKLTAELYSSFEKEDFAKCHQLLAPVKIELIKHNLLVPTAQ
                     NTSTSDQVNDIKIAQRILEIGALSSLLTNDYLGFENYFAQLKPFYSNDKIHNLKKPHL
                     NTDATKIISLYLLYLLSKGSVSQFHVELESISNSDQYNVEEDKYLRFPIELESNLMEG
                     NYIKIWTLLKEEKKLPCKEFTHFVTTLVDALRLEIAKSLENSYASIPISNCKNLLYLP
                     QELSDSSLEQMLRDSVDVSNWKFENGTIYFNQVEQENEVDNEKIIKNVLTYAEQIESI
                     V"
     gene            complement(<654483..>655569)
                     /gene="VPS28"
                     /locus_tag="PVL30_003388"
                     /old_locus_tag="LELG_02553"
                     /db_xref="GeneID:5233389"
     mRNA            complement(join(<654483..655307,655564..>655569))
                     /gene="VPS28"
                     /locus_tag="PVL30_003388"
                     /old_locus_tag="LELG_02553"
                     /product="Vacuolar protein-sorting-associated protein 28"
                     /transcript_id="XM_001525945.2"
                     /db_xref="GeneID:5233389"
     CDS             complement(join(654483..655307,655564..655569))
                     /gene="VPS28"
                     /locus_tag="PVL30_003388"
                     /old_locus_tag="LELG_02553"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar protein-sorting-associated protein 28"
                     /protein_id="XP_001525995.2"
                     /db_xref="GeneID:5233389"
                     /db_xref="PFAM:PF03997"
                     /translation="MFKYNYSARGGTMSTYQDYAPTSSTSFTVSSDSVKYSQEISKST
                     LIETSTHQSVYNALAEVCSILPTLDMLEVSFIKDFITEKEKYTTTTYRLINQYQMILK
                     GFDNDAIQVLQKLLPDLENDLSNFLPLFVDKFNLNCPQAVKRLISGVPSVIDQVSHNS
                     AGEQNVNQNGNQNGQNSQSVSGNARLIAEITGNFITCMDALKLNYSTRAQLHPLLSDL
                     VVNLNELSENIQFEGKSKLINWLIKINNLEKELNQEDSDAFLKDLDVAYKGFYSSLDR
                     "
     gene            complement(<655699..>656972)
                     /locus_tag="PVL30_003389"
                     /old_locus_tag="LELG_02554"
                     /db_xref="GeneID:5233308"
     mRNA            complement(join(<655699..656832,656967..>656972))
                     /locus_tag="PVL30_003389"
                     /old_locus_tag="LELG_02554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119463.1"
                     /db_xref="GeneID:5233308"
     CDS             complement(join(655699..656832,656967..656972))
                     /locus_tag="PVL30_003389"
                     /old_locus_tag="LELG_02554"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975446.1"
                     /db_xref="GeneID:5233308"
                     /translation="MVFGSNDAFKEFKLYEDSMAFKPANDFSQKVLGVSLPILIPVPR
                     DIPSSALSSSFGSSTTHSLVVKVILGDSAANESFVVETFPIVIKTYDTLPLYRQFNEP
                     LVRSSKSPDNQIIAEAVVPVTAVGPSDSLCLNCRIFTNSSNNKLKKHITLKQITFQIK
                     EYLECYDGGLPPVTENKLFTTTSEPGKEVTTQGIQENYSINFPQSNDYLKIHSFEEPY
                     IIEQETINDYETTIIESANISSFVLKDKLGEGLPLTHFQSFTSSGQFYSIKFELILKL
                     KFSKAKDFDVRIPIIVCPYDRKTSEPLLKWIMLECEVAKARFGKQFIDQFFAAKNYSE
                     ICSLMGKYRPPPVVYRYCKEDWEKLGYDGVAFNNPRSPNLVSYID"
     gene            complement(<657629..>658456)
                     /gene="DFG10"
                     /locus_tag="PVL30_003390"
                     /old_locus_tag="LELG_02555"
                     /db_xref="GeneID:5233566"
     mRNA            complement(<657629..>658456)
                     /gene="DFG10"
                     /locus_tag="PVL30_003390"
                     /old_locus_tag="LELG_02555"
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase"
                     /transcript_id="XM_001525947.1"
                     /db_xref="GeneID:5233566"
     CDS             complement(657629..658456)
                     /gene="DFG10"
                     /locus_tag="PVL30_003390"
                     /old_locus_tag="LELG_02555"
                     /codon_start=1
                     /transl_table=12
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase"
                     /protein_id="XP_001525997.2"
                     /db_xref="GeneID:5233566"
                     /db_xref="PFAM:PF02544"
                     /translation="MNFSDQIQLSICFIYGLLISSILLVTFAQPLRTLLKYGKNSQVS
                     GNKSSNQFVNFVAVKFVVPKQWFKHFYICLFSLATASFFYPCHENTIKPASAAFKNIK
                     IIQILLWLQGGRRLIESYAVTKFSPKSTMNFSHYIVGMAHYILISTATYFGLWESCSA
                     STALTTTDYILIFAYGVAVVQQFKVHNYLANLRKYSLPQFKVVASPHYFWEIVIYTVL
                     FTFSVKERVNMISASFLAALAFVSVNLSITSLETYKFYVQKYGHDFKLRWAILPGIL"
     gene            complement(<659000..>662978)
                     /locus_tag="PVL30_003391"
                     /old_locus_tag="LELG_02559"
                     /db_xref="GeneID:5233592"
     mRNA            complement(join(<659000..659853,659866..662228,
                     662398..>662978))
                     /locus_tag="PVL30_003391"
                     /old_locus_tag="LELG_02559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119464.1"
                     /db_xref="GeneID:5233592"
     CDS             complement(join(659000..659853,659866..662228,
                     662398..662978))
                     /locus_tag="PVL30_003391"
                     /old_locus_tag="LELG_02559"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975447.1"
                     /db_xref="GeneID:5233592"
                     /db_xref="PFAM:PF11765"
                     /translation="MLIKQLFYPVLFFLVQGLNAITISSDRVTRGTINLSIGDITINS
                     GAYWSIIDNAVSAFVGDLTVQSDAGFYISSTNPLLGLQVTLLGVLNSISNDGIIAFNS
                     LKTLIAPNYNLIGLSFHNTGEIYFAADGTNPPVFGLTAANWDNSGLIVFYQNHRSEAL
                     INLGTPLLSITNDGSVCLYSSVYQQLTKIDGSGCFVANQDSTIYIASSALSISSSQSF
                     YLQDSQSSIVVQPLSLPATYNVYGFGGGNKIGISIPLLSVPFLGQPAVSYDSGSGILT
                     LRGLGVGLLSQKFNIGKGYDSTKFEVVTDTGAGLPTTILGSVRYNGPVVNSNVPSACI
                     CKPPPPAPGTDESSTTEAPTSTEPTGPTEPTGPTEPTGSSESTEPTGPTEPTGPTEPT
                     GSSESTEPTGPTGPTGPTGPTGSSEPTGPTGSSESTEPTGPTEPTGPTGPTGPTGSSE
                     STEPTGPTEPTGPTEPTGPTGSSESTEPTGPTGPTGPTGPTEPTGPTGSSESTEPTGP
                     TEPTGPTSSSESTEPTGPTEPTGPTEPTGPTGSSESTEPTGPTEPTGPTGSSESTEPT
                     GSSEPTGPTGSSESTEPTGPTEPTGPTGPTEPTGPTGSSESTEPTGSSESTEPTGPTG
                     SSESTEPTGPTEPTGPTGSSESTELTGSSESTEPTGPTEPTGPTESTGGNGGQTSTGG
                     NGGETSTGATGSSEPTGPTESTGGNGGETSTGATGSSEPTGPTESTGGNGGETSTGAT
                     GSSEPTGPTESTGGNGGETSTGGNGGETSTGGNGGQTSTGGNGGETSTGGNGGQTSTG
                     GNGGETSTGGNGGETSTGATGSSEPTGPTESTGGNGGQTSTGGNGGETSTGGNGGQTS
                     TGGNGGETSTGGNGGETSTGATGSSEPTGPTESTGGNGGNGTPTGGNGGNGTPTGGNG
                     GNGTPTGGNGGEPNPTGGNGGNGTPTGGNGGEPNPTGGNGGNGTPTGGNGGEPNPTGG
                     NGGNGTPTGEPNPTGGNGGNGTPTGGNGGEPNPTGGNGGNGTPTGGNGGNGTPTGGNG
                     GNGTPTGGNGGEPNPTGGSGTGSGSGSGSGSGSGSGSGSGSGSGEGSGSGSGEGSGSG
                     SGSGSGSGSGEGSGSGSGSGSGSGEGSGSGSGEGSGSGSGSGSGEGSGSGSGSGSGSG
                     SGEGSGSGSGSGSGSGSGSGEGSGSGSGEGSGSGSGSGEGSGSGSGSGSGSGSGSGSG
                     SGSGSGSGSGSGSGSVATLTTSTASSTNTASVTPAENSATSSKTNSLFAIFIGVISVV
                     ALI"
     gene            complement(<669303..>672668)
                     /gene="MET10"
                     /locus_tag="PVL30_003392"
                     /old_locus_tag="LELG_02560"
                     /db_xref="GeneID:5233479"
     mRNA            complement(<669303..>672668)
                     /gene="MET10"
                     /locus_tag="PVL30_003392"
                     /old_locus_tag="LELG_02560"
                     /product="sulfite reductase [NADPH] flavoprotein
                     component"
                     /transcript_id="XM_001525952.2"
                     /db_xref="GeneID:5233479"
     CDS             complement(669303..672668)
                     /gene="MET10"
                     /locus_tag="PVL30_003392"
                     /old_locus_tag="LELG_02560"
                     /codon_start=1
                     /transl_table=12
                     /product="sulfite reductase [NADPH] flavoprotein
                     component"
                     /protein_id="XP_001526002.2"
                     /db_xref="GeneID:5233479"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00667"
                     /translation="MAPHSLVKEASSLSATSTTSSSEKELDTGLTTLINSNPFGIAYD
                     PASLRGSSYTSATTIINQAIYSVATKIFSYETVGSKDILDSHIQLWSYKQWGNAFDVV
                     PFFNKFEVRSGAMNAVLGYMNKNGTRGQVLSVVTGIDGLDYARNSLSGSKKLPLALNV
                     SAIDFESSVFVNNYGRASRLANDLNLPTFTPVSSGVESQHLAILNHFFAFSTGKPSMF
                     LFGGVESAKTFKKFEDLLSVAELGSLYQSLLDSADGEISIDKAFELLNKFTGKKYSQF
                     EYFGSPAAETVFVVYGTHLAELWSKLAGDKIGVVAVRVPSPFNSEQFLSVLPEAAKKL
                     VVISSNDPLSATVCATVFLSARASTLTTETFEYPLDFNWTPITAVKLIAQYTDIDVEQ
                     LLNPTNRDVDEIITANSSPDGKYTIWGKDNGVLLDLANKLALSLSLDNSKNVAIRNVY
                     DNSRLGGVFQSQLSSTYISQGNGDVVDAADVVFIEDLSLLDSFDVLATAKPGSTIILV
                     NQKAAFDLEKVPTSFKKTLATNENKLLVVDLSIVDALDEASSGTKGITSTLLLQLAFW
                     RSAMPELGDFIVNKLLQANGGSFELLATVLDNFIKVANEKNAIIEIGVLSEWSLLKDD
                     TAAETAEAKETEKQVASEAAQKTQDKANEIKKANSAVESGKDNDNVKEENLEPKILSY
                     FLSENAIAPNPRAVKEVEEETNLVAPKNLAQRIVFNEAADVSLDLRPDLPVKNFVVKV
                     QENKRLTPTEYSRNIFHIEFDITGTGLKYELGEALGVHARNPEAEVDKFLEFYKVDAN
                     SLVEYSNREDPTYFETKTAKQLLTDSVDFLGKPPKRFYESLAEFATDDKEKEHLVKIA
                     SAEGAAELKTRQEVNFDTYFDLLQEFKSARPSFAELIKIISPLKRREYSIASSQKIHK
                     NAVHLLVVVVDWVDPKGRLRYGHSSKYLSDLKIGDELVVSVKPSVMKLPPLSTQPIVM
                     SGLGTGLAPFKAFVEEKIWQQQQGMEIGDIYLYMGSRHKKEEYLYGELWEAYKEAGLL
                     THIGAAFSRDQPQKIYIQDKIRESIEELTDAIVEKNGSFYLCGPTWPVPDITACLEDI
                     VVNGAKRKGEEIKEVSKVIEDMKEDGRYILEVY"
     gene            <675899..>677125
                     /locus_tag="PVL30_003393"
                     /db_xref="GeneID:85890359"
     mRNA            <675899..>677125
                     /locus_tag="PVL30_003393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119465.1"
                     /db_xref="GeneID:85890359"
     CDS             675899..677125
                     /locus_tag="PVL30_003393"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975448.1"
                     /db_xref="GeneID:85890359"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPTSRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKKYLRITN
                     TSHLAQKTTEKVAAVG"
     gene            <677926..>678372
                     /locus_tag="PVL30_003394"
                     /db_xref="GeneID:85890360"
     mRNA            join(<677926..677930,678036..>678372)
                     /locus_tag="PVL30_003394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119466.1"
                     /db_xref="GeneID:85890360"
     CDS             join(677926..677930,678036..678372)
                     /locus_tag="PVL30_003394"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975449.1"
                     /db_xref="GeneID:85890360"
                     /translation="MNLCQPGIILQTLDSHLPFSELQFPKESMEVDLDYEYEEPDASD
                     ARFDPSASAMNKELENLAMEDVVNPDEEHKSFLSGGEGNRNEPVPTSHESGNMQSQIL
                     EIRKAYLCERS"
     gene            <680538..>682958
                     /locus_tag="PVL30_003395"
                     /old_locus_tag="LELG_02562"
                     /db_xref="GeneID:5233612"
     mRNA            <680538..>682958
                     /locus_tag="PVL30_003395"
                     /old_locus_tag="LELG_02562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525954.2"
                     /db_xref="GeneID:5233612"
     CDS             680538..682958
                     /locus_tag="PVL30_003395"
                     /old_locus_tag="LELG_02562"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526004.2"
                     /db_xref="GeneID:5233612"
                     /db_xref="PFAM:PF01553"
                     /db_xref="PFAM:PF19277"
                     /translation="MSHPLQDISNSDFDVNILHDPLTNPSIDLKFPLPIDKKTYVDVE
                     DNYESLSQSFNILNSAFRLIVGGSKYDKIYANNEYKFFINKHSDEFRAKFKNYMTNKL
                     EKDDKKLDEIVYDLVNQELNMKLIKADDFKSRFKEVKDYMVKYYKKNNEKNLPTFPSH
                     NFVRSAYVTVMAIMQRLFPKGVWVSNQDLSDLYKKYLADPMSIIWTPSHQSHLDYIIL
                     HLICVRFQMATPAVIAGENLNVAVVGGLLKNLGAVFIPRTFNNDLYTERNLNNVIEFL
                     LVNKIPFEVFIEGTRSRDGKLLLPKYGILKNLVSVYMKQRFEEHKPQFNMLFQPVSVT
                     YERVYENDEFLKELKGEDKTQESLFGILSVAASAFSKPKDEVIRDKLGYTDNSTRKLT
                     GKIFVKLGESFTLSEFIDDPDIKTEKEVNLKKLGFKILHEVNRNSFIPEISIIGTALQ
                     AYNYYANKRVFTIEELIPVLRIVSEALLRENDSSKTNKTILQDMLKCTDAELSSLIVK
                     EITSFFRYIKVNDKKGLIKIESPIELLYYKNLTIHLIIQRCLIMYIITLLDGTEFCNR
                     RIIGKLFYILTGFLKNEFLFDYDENDRNGMTFIIEDLTELGVITKNKSEDSELSIYKI
                     SDAKYIRLFANLAQPFLESYVVLISNILEMTTNLKSNYARAKQQITHDKLILDDDELR
                     YPTTKGLLKYIIEQSRKKAQFQSLESINKQYLVSDLYYLNNLQLIKIFKNKAKTKAFV
                     QILNPRDLAVLNAFLNQLLQVNSKEKDLLTDEINVNYVIDITNKNFDRDYDELERLTR
                     QRATWAKL"
     gene            <684173..>685891
                     /gene="ASN1"
                     /locus_tag="PVL30_003396"
                     /old_locus_tag="LELG_02563"
                     /db_xref="GeneID:5233481"
     mRNA            <684173..>685891
                     /gene="ASN1"
                     /locus_tag="PVL30_003396"
                     /old_locus_tag="LELG_02563"
                     /product="asparagine synthetase"
                     /transcript_id="XM_001525955.2"
                     /db_xref="GeneID:5233481"
     CDS             684173..685891
                     /gene="ASN1"
                     /locus_tag="PVL30_003396"
                     /old_locus_tag="LELG_02563"
                     /note="MEROPS:MER0034539; BUSCO:EOG09261145"
                     /codon_start=1
                     /transl_table=12
                     /product="asparagine synthetase"
                     /protein_id="XP_001526005.1"
                     /db_xref="GeneID:5233481"
                     /db_xref="PFAM:PF00733"
                     /db_xref="PFAM:PF13522"
                     /db_xref="PFAM:PF13537"
                     /translation="MCGIFAAFRVQDVESFKPKALQYSKLIRHRGPDWSGNVITSKDT
                     ILCHERLAIVGLDAGAQPIVSPDERYSLAVNGEIYNHIQLRQQFPDYKFKSLSDCEPI
                     IPLFEKYDIEAPKHLDGMFAWVLHDKNTDRIVAARDPIGITTLYLGKSSKSPETRYFA
                     SELKCLVEECDTIEAFPPGHIYDSNTDKITRYYEPTWWDGSKIPETPVDYTKVRETLE
                     LAVRKRLMAEVPYGVLLSGGLDSSLIASIAARETKKAYETAAASHNQGIDANKELSGV
                     DNSGSLHASGGFQKLHSFAIGLPGAPDLIAAEKVAHYIGTIHHSHTFTLEEGIDALDD
                     VIYHLETYDVTTIRASTPMYLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFANAPSAPA
                     FHEECVKRVKNLHYADCLRANKSTMAWGLEARVPFLDKQFLEVCMNIRPEDKLITPEH
                     IEKYVLRKAFDTKDEPYLPDEILWRQKEQFSDGVGYSWIDCLKDTAEKLVSDEDMKNP
                     KPEWGDDIPQTKEAYWYRCKFDKMFNNSKAAASTVMRWIPKAEWGCHSDPSGRYAKTH
                     DHKVDA"
     gene            complement(<686278..>688956)
                     /locus_tag="PVL30_003397"
                     /old_locus_tag="LELG_02564"
                     /db_xref="GeneID:5233248"
     mRNA            complement(<686278..>688956)
                     /locus_tag="PVL30_003397"
                     /old_locus_tag="LELG_02564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525956.2"
                     /db_xref="GeneID:5233248"
     CDS             complement(686278..688956)
                     /locus_tag="PVL30_003397"
                     /old_locus_tag="LELG_02564"
                     /note="MEROPS:MER0019759"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526006.2"
                     /db_xref="GeneID:5233248"
                     /db_xref="PFAM:PF01433"
                     /db_xref="PFAM:PF11838"
                     /db_xref="PFAM:PF17900"
                     /translation="MSHVDQEPYYEALPTHLKPYHYDLSIYDVDTENDTFKGTVVIYL
                     NVVKSTKELHLNYRDLVITKEKISIVSSDSDGKNNKTIEVDSIVENKSKEYFIVKFNE
                     TIVPEKSELKVTISYDAKIQSNMAGFYKSPYTENGEEKIMLSTQFEATDARRAFPCLD
                     EPSFKATFTVDITANSQWEILGNTPVESTTNDSDKSLKKVKFEKTPIMSTYLVAWACG
                     DFEYVESFTETKYNGKPLPVRIYTTKGYVQDAQLASEIAPKVVDYFSKVFEIQYPLPK
                     LDLLAVHSFSHNAMENWGLITYRSTALLFSETKSDPSYKQKVAYVVAHELAHQWFGNL
                     VTMKWWDELWLNEGFATWVGFLAVDYLYPEWDIFSEFVSESLQQALNLDGLENSHPIE
                     VPVVDALDIDQVFDAISYLKGGSTILMLSEYLGRETFLKGVALYLNRSAYSNATSHDL
                     WSAIGQVSQKPIDQLMEPWIKKVGFPIVSVGQHENSLVLSQSRFLNGGKDNDIGKREE
                     NETQWWIPLNISTNSTQLKEHKTIDSFDSEKVVIDDFPLQSSDYFKLNKATSGVYRVN
                     YDASILKNNILAHFDKLSARDKVGLIADAGAIACAGNNPTTTFLTLVESIVQQLGNDY
                     VVWLELGKWLSNFAIAFTTETTASKIHAFLTSVYKQKAIEIVNSIKNIENLDNADFMS
                     TKFRSEILTRAGRLQIAEVYDFALGLFEKGDIHPSLRLFVYTTIAASSKFSEDQYKVI
                     LNQITHPTSLDSREVALTALGSVTNTDIAKELLKVMVDTKIVPLMDSHFLAKPLSANY
                     ATKNLFLDFFLENYEESFYKPMSTNAIVLDRLVKLTLRNYQNNEVHDRIDKFFATRDV
                     HGFERSLKQSLDNIKINANWYNRDLTKVNEYLESKY"
     gene            <690702..>692288
                     /locus_tag="PVL30_003398"
                     /old_locus_tag="LELG_02565"
                     /db_xref="GeneID:5233196"
     mRNA            <690702..>692288
                     /locus_tag="PVL30_003398"
                     /old_locus_tag="LELG_02565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525957.2"
                     /db_xref="GeneID:5233196"
     CDS             690702..692288
                     /locus_tag="PVL30_003398"
                     /old_locus_tag="LELG_02565"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526007.1"
                     /db_xref="GeneID:5233196"
                     /translation="MICNAIISFFFLAVATLVNAAPNDPTILTPERGVFCSPVQASPK
                     HPNKAYIKLHPEKTSADFKIQGLVFHYPDIINFTSVPILEEFTQLYAKEKTTLYKTML
                     NDDGTFNVDAADGYSTDPKKYWTGPIEKDVEITIVHSGIYCVYIAPPADDTDKFDIPI
                     VFKSYYGNLNYATHLMYSQIKWAVLLSIITFATLFNYILKFKVGENFKDLNSISVISK
                     AVIFLVLLPFIAILIFQWLVFFLINNFLESCQSSFIITGLLFIAQFASLGYNSFISYV
                     VLLFSMGFGVIYYHGGNSHNYRIFPQDSFKKITALLFVNLVVIFAAVVGEFQSKNSDP
                     LVGTYGQNSFNQQGMIVTLLMALTSIFSLSWFILSMIFYFKTKKTIATFPPAADADST
                     DKVVSAFRKSFFIIYVLPIAVGIFGACVAGALTAKSMKSLPKYPSNTDRELVYQSALA
                     MQALEHGIKKIILPMLWSSWLYFFTLIISIFFIWIVDNNGLIVDPNANDPIVYADVPN
                     FNISDDEEDDEERDEEDIRV"
     gene            complement(<692763..>693440)
                     /locus_tag="PVL30_003399"
                     /old_locus_tag="LELG_02566"
                     /db_xref="GeneID:5233567"
     mRNA            complement(<692763..>693440)
                     /locus_tag="PVL30_003399"
                     /old_locus_tag="LELG_02566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525958.1"
                     /db_xref="GeneID:5233567"
     CDS             complement(692763..693440)
                     /locus_tag="PVL30_003399"
                     /old_locus_tag="LELG_02566"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526008.2"
                     /db_xref="GeneID:5233567"
                     /db_xref="PFAM:PF02037"
                     /db_xref="PFAM:PF18592"
                     /translation="MSDYSSQTVAQLKELLKQRGLSTEGKKADLVTRLIDSDNSQVTA
                     AAQEEAPLQTEGSTTDAANEVSIEAPTEASAQPIDSKVAANESTASSAAPGSEPTLTV
                     IQPQPKTTQVAEGEAGADLKENKKESEPPKQLTAEERKQLAVELLQKKIARAEKYGDE
                     KSAEESRKSLNRVEKFGVELGTSLAREIGLVDDKLGSGNGFKKHHGRRGKFNRGRGIR
                     KNRGGRR"
     gene            complement(<693923..>695104)
                     /locus_tag="PVL30_003400"
                     /old_locus_tag="LELG_02567"
                     /db_xref="GeneID:5233507"
     mRNA            complement(<693923..>695104)
                     /locus_tag="PVL30_003400"
                     /old_locus_tag="LELG_02567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525959.2"
                     /db_xref="GeneID:5233507"
     CDS             complement(693923..695104)
                     /locus_tag="PVL30_003400"
                     /old_locus_tag="LELG_02567"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526009.2"
                     /db_xref="GeneID:5233507"
                     /db_xref="PFAM:PF07992"
                     /translation="MSIDSKEVIIIGGSYAALLALKTFLAQQPSSSDSIPQLKITLIA
                     PNDKAFFNIASPRLIVDEDLLIDKTFFSLKDHIEQLVTSQGNKGHEVVFIKGRVVNSD
                     FEANTITYEENSGEFERKELKYDNLIVASGTRTPSSVWKLDNVKDQDYTISAIEGLRK
                     QVKEAKSIAIIGGGATGVETAGELGYANKAKESKDKKRVVLYTGSFGPLSGPLPKHVE
                     QTSKKLKDLNVEIVNDQFVSKVKDGVALEGTGDEDRVEKFDLVIEAQRLIPNTEFIPA
                     SQLNEKKYIITDDYFRLPEHQNVICFGDVLAMGEQSSVDLTYAQKPVFAKTVAKEILS
                     QDVKLVSYQKLSRQIILVPIGKDGGVGVLFGFSIPNFLVRLFKSRDFMIPKAKGILSL
                     D"
     gene            complement(<695647..>697167)
                     /locus_tag="PVL30_003401"
                     /old_locus_tag="LELG_02568"
                     /db_xref="GeneID:5233042"
     mRNA            complement(<695647..>697167)
                     /locus_tag="PVL30_003401"
                     /old_locus_tag="LELG_02568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525960.2"
                     /db_xref="GeneID:5233042"
     CDS             complement(695647..697167)
                     /locus_tag="PVL30_003401"
                     /old_locus_tag="LELG_02568"
                     /note="BUSCO:EOG09264NDD"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526010.2"
                     /db_xref="GeneID:5233042"
                     /db_xref="PFAM:PF10310"
                     /translation="MSDPEDVLDFLNSLPETKNKANAPRSSSETTKSTSKDDEIFEFL
                     DEIAQHESSKPKKKLVPKQKEGTSSTTTIPASIQKAKPQEEKAASAPLPHSSADKNPY
                     EEQNQSGKKVANQDKGQEEQAEEDLPNPIASISNWWSREGTQKVTNLWGAITSNAERI
                     SETTYQIASQTTNQINERSKQIDRDQIEQHVGQLGSRLNGILSSISQQIKQGLELDDV
                     DEVLNVLIVSDIVNLQYLEDIVRENFEAVMDQVQGRIGVGVHEFYKPHGELKVNSDDI
                     GATNVNTDASDGRVSLGTFYGKLIDGEKLALANLENAIREYKKAEITKEKEEKEQEKE
                     EKEEKEEKEEKEEKEEKKTAKNGEKEEDGEEIDDDKEMLKSNIFLAVQPISVGKPVQQ
                     RQGEEGKEEAKVVEENASTQDSIIESHNAESFSFTLILNDITNNITITTRTQPFPLRW
                     AQWLDGEKLRNVRNEAVEEEDESVDPKEWVKDWIRQGLNLGVGVLAQEYVIKRMGI"
     gene            complement(<697698..>700166)
                     /gene="mcm7"
                     /locus_tag="PVL30_003402"
                     /old_locus_tag="LELG_02569"
                     /db_xref="GeneID:5233193"
     mRNA            complement(<697698..>700166)
                     /gene="mcm7"
                     /locus_tag="PVL30_003402"
                     /old_locus_tag="LELG_02569"
                     /product="DNA replication licensing factor MCM7"
                     /transcript_id="XM_001525961.2"
                     /db_xref="GeneID:5233193"
     CDS             complement(697698..700166)
                     /gene="mcm7"
                     /locus_tag="PVL30_003402"
                     /old_locus_tag="LELG_02569"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA replication licensing factor MCM7"
                     /protein_id="XP_001526011.2"
                     /db_xref="GeneID:5233193"
                     /db_xref="PFAM:PF00493"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF14551"
                     /db_xref="PFAM:PF17207"
                     /db_xref="PFAM:PF17855"
                     /translation="MATLTTTAAVLPSIQLKVNYKDCKEIIHDFIKNFKDSTIDIDEE
                     LEQLHEGKYMNILQRIANREESTIWIELDDVKKFLMNFDTDSASLLQESQNLFHTIMT
                     NTHRFIEVFSDVIDKLMPEPTKDISYQDDVLDVILSQRKLRNQRLQQDATEEFNQLRD
                     GFTQPMEGMGERDALADPTEVNLFPAKLTRRYCLYFKPLSGTRNDKALSVRQIKGKHV
                     GNYITVRGIVTRVSDVKPSVLVIAYTCDKCGYEIFQEVNSKVFTPLTTCNSPACISDN
                     NKGQLFMSTRASKFSSFQEVKIQEMSNQVPVGHIPRQLTIHVNGNMVRSMNPGDTVDV
                     SGIFMPSPYTGFRALKAGLLTETYLEAEYVRQHKKQYELMQLSEEMEFKIQELRNSAS
                     GGDVYEKLAKSIAPEIYGHLDVKKILLLLLCGGVTKEIGDGLKIRGDINVCLMGDPGV
                     AKSQLLKAINKIAPRSVYTTGRGSSGVGLTAAVMRDPITDEMILEGGALVLADNGICC
                     IDEFDKMEEGDRTAIHEVMEQQTISISKAGITTTLNARTSILAAANPLYGRYNTKLSP
                     HENINLPAALLSRFDIMFLILDQPNRENDEMLAQHVTYVHMHNKQPDASIQLANGAEE
                     EFQPIDSKTIREYISKARTYRPVVPQEVGDYVVQSYINMRKESQRNEGSIKKFSHITP
                     RTLLGILRLAQASARLRFADLVTMEDVDEALRLIEVSKSSLYADEEAMAQIRDDESVT
                     SKIFQIIKTLAINPANGKLKKYLKMQDIKSRVIAKGFTIQQLDDCMFEYDGVGLWQII
                     DNGETLMFTNINEDDEDNDEEMEE"
     gene            complement(<700920..>703169)
                     /gene="STB3"
                     /locus_tag="PVL30_003403"
                     /old_locus_tag="LELG_02572"
                     /db_xref="GeneID:5233360"
     mRNA            complement(<700920..>703169)
                     /gene="STB3"
                     /locus_tag="PVL30_003403"
                     /old_locus_tag="LELG_02572"
                     /product="DNA-binding proteins Bright/BRCAA1/RBP1 and
                     proteins containing BRIGHT domain"
                     /transcript_id="XM_001525964.2"
                     /db_xref="GeneID:5233360"
     CDS             complement(700920..703169)
                     /gene="STB3"
                     /locus_tag="PVL30_003403"
                     /old_locus_tag="LELG_02572"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding proteins Bright/BRCAA1/RBP1 and
                     proteins containing BRIGHT domain"
                     /protein_id="XP_001526014.2"
                     /db_xref="GeneID:5233360"
                     /db_xref="PFAM:PF10330"
                     /translation="MSNPTTINNNNNPQQQQQQQQQQQQQQQQEQPTLPSPRINNLSS
                     SPIYNYMQQLRQAQPQQNTIHTTSNNNSNGYHMPHSQLPKQEGSPVETNTNSATKQHS
                     DTTQPPLSDESIAPPASASASASASASTKKALLSTSSPEGIQVASQITPTRLANLLIR
                     KGPLPIRHITAQLSLEVGSFELLSLSKQRRLIMAAMEQMDPVNNVVFEKIGWGQWAVR
                     KIDSDYIFTEGSETLEKDQATVGEDGTKIGSKMRPKSMSFDTVDNKKVININDLRNQT
                     NLKLGWSKKKKQQEKTQPLSQNSQSSHPSTLKSLVNNDLDKLRRESITNQVRNLHDLK
                     LPNESIDNAIASDSEEGEEEEEEEEEEEEEEHVGMEGMGYLKRHNNGLYEEDEEANDD
                     YDDEEKEQDEEMFAFDETEHKNTSTSNANSKVKRTSPPIKFARRVPGKLHSPPISSSV
                     SSFDSKSKARRRKSSSSAPSSVTKPSTMRQYYAGTYQHHHNYLHPQSLGTNSNSSRSR
                     LDSLDNLDNYIVSSARNSTVSINSPPPSLPTIAFASSATMSPGLTSGSASALSGSSPI
                     GSLTTNQHGNYYIHNEEIAKANRDRRKSSFNESHVRSTLVVQQPPLQQQQQQQQQQQQ
                     QQQQQQQQQQQQQHQQQQQIKHSVNGGTTSNNGAVSSDTDEEDWESIGPAFLRSRNHT
                     ANSNGELDTTQHHQLVRKLVEEKNGKQNAGFARGSNPAANGGINEDDNEAGDAEKSAA
                     FALVNLMSV"
     gene            complement(<707378..>708307)
                     /locus_tag="PVL30_003404"
                     /old_locus_tag="LELG_02575"
                     /db_xref="GeneID:5233075"
     mRNA            complement(<707378..>708307)
                     /locus_tag="PVL30_003404"
                     /old_locus_tag="LELG_02575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525967.2"
                     /db_xref="GeneID:5233075"
     CDS             complement(707378..708307)
                     /locus_tag="PVL30_003404"
                     /old_locus_tag="LELG_02575"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526017.2"
                     /db_xref="GeneID:5233075"
                     /db_xref="PFAM:PF12273"
                     /translation="MPQISKIHHSDPVYVISTATKRSSTSISLFRRDWGDGYWETSNS
                     ARWAFFAIFIVLIIIIVLGTIRVNQKRAKHGVQPIYGTRWMTPPSYRQSQTAYDQPDH
                     VRDPDLPSSYVPTYTATANENDYDMGFYDSKGVFHRNPNAKSGLNMGHGGIVQQPDEV
                     YARDGGASGTNRVTDESTGATYLSSSFNANHQTSSTNTGTNNNNNNNNNNYNAHSDDD
                     LGDISRPTGPPPGRTSTSISLSNGANNRNIAAYTPTEERTSTGVDSDSDTSFQRPSGP
                     PPPQEQQQEPLQSSVSSSSKNNDVSEKTVDVKN"
     gene            <710122..>711256
                     /gene="SPO11"
                     /locus_tag="PVL30_003405"
                     /old_locus_tag="LELG_02576"
                     /db_xref="GeneID:5233270"
     mRNA            join(<710122..710129,710320..>711256)
                     /gene="SPO11"
                     /locus_tag="PVL30_003405"
                     /old_locus_tag="LELG_02576"
                     /product="endodeoxyribonuclease"
                     /transcript_id="XM_001525968.2"
                     /db_xref="GeneID:5233270"
     CDS             join(710122..710129,710320..711256)
                     /gene="SPO11"
                     /locus_tag="PVL30_003405"
                     /old_locus_tag="LELG_02576"
                     /codon_start=1
                     /transl_table=12
                     /product="endodeoxyribonuclease"
                     /protein_id="XP_001526018.2"
                     /db_xref="GeneID:5233270"
                     /db_xref="PFAM:PF04406"
                     /translation="MYKFAAILKLIQILTRFLSNSNSQSRRTTVRDIYYQDVEIFNKS
                     QTECKRLLDSIVENSLGWSLVKDLNIYPSQKGLFYEYNYYNPKLKLENNHPILIPMEF
                     EKYQFCGDGSGADDGAEDGGDYGGDDDEKKSANNTSGQEKKQYNEEKQLCVAIFEKDA
                     VFESFCKHLANGKFKFSTRLIIVTAKGYADSLTLAFLKWIQSKHTKCTFIGFFDADVY
                     GVNIYQQYKKVIESLKYAGIFLLNSKPQSWLNTTLRDIKVAATLADKAIQLDASCHRE
                     LTRQMFLLKKGEINVISGDDGNYNTYLISKIKTLAANT"
     gene            <711699..>712577
                     /gene="IPP1"
                     /locus_tag="PVL30_003406"
                     /old_locus_tag="LELG_02577"
                     /db_xref="GeneID:5233140"
     mRNA            <711699..>712577
                     /gene="IPP1"
                     /locus_tag="PVL30_003406"
                     /old_locus_tag="LELG_02577"
                     /product="Inorganic pyrophosphatase"
                     /transcript_id="XM_001525969.2"
                     /db_xref="GeneID:5233140"
     CDS             711699..712577
                     /gene="IPP1"
                     /locus_tag="PVL30_003406"
                     /old_locus_tag="LELG_02577"
                     /codon_start=1
                     /transl_table=12
                     /product="Inorganic pyrophosphatase"
                     /protein_id="XP_001526019.2"
                     /db_xref="GeneID:5233140"
                     /db_xref="PFAM:PF00719"
                     /translation="MSSQSPYTTRQIGAANTLDYKVYIEKDGKVVSPFHDIPLYANEE
                     KTILNMIVEVPRWTNAKMEISKDLKLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFP
                     QTWEDPNITHPETKAKGDNDPLDVCEIGERIAYVGEVKQVKVLGVMALLDEGETDWKV
                     IVIDVNDPLASKLNDIEDVESHLPGLLRATNEWFRIYKIPDGKPENQFAFSGECKNKK
                     YAQEVINECAEAWSVLVSGKSVDSKGIDLANTTLENTPGCVSEVSAADVPAASPKEAA
                     PIDKSIDKWFFISGAH"
     gene            713405..713491
                     /locus_tag="PVL30_003407"
                     /old_locus_tag="LELG_06046"
                     /db_xref="GeneID:5233398"
     tRNA            713405..713491
                     /locus_tag="PVL30_003407"
                     /old_locus_tag="LELG_06046"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:5233398"
     gene            <713931..>716021
                     /gene="rhp57"
                     /locus_tag="PVL30_003408"
                     /old_locus_tag="LELG_02578"
                     /db_xref="GeneID:5233542"
     mRNA            <713931..>716021
                     /gene="rhp57"
                     /locus_tag="PVL30_003408"
                     /old_locus_tag="LELG_02578"
                     /product="DNA repair protein rhp57"
                     /transcript_id="XM_001525970.2"
                     /db_xref="GeneID:5233542"
     CDS             713931..716021
                     /gene="rhp57"
                     /locus_tag="PVL30_003408"
                     /old_locus_tag="LELG_02578"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein rhp57"
                     /protein_id="XP_001526020.2"
                     /db_xref="GeneID:5233542"
                     /db_xref="PFAM:PF06745"
                     /db_xref="PFAM:PF08423"
                     /translation="MDDYKQIGHHECISSQKFPFLVSLLQSHGKFVNDVIEEPSYEHE
                     EKKGEEEEDDDDDEEEGGGGGGGEEEEEVKEKEKEKAEEEEEEEEEEEEEEEEEEEEE
                     EEEEEEEEEEVEEDGEEGDVEKINDKKHATDISQELAKLLSRPVREIKDYIRSLNEDL
                     AVPPSNIDNLFGDNLNDGDIDYENHISTGLPDLDEQLGGGIPIGEVSEVFGASGCGKS
                     QFVYQIIHNSILQGEKNTAVHVATESFMESKRLKDIFESDSSSSSSLSSKLDRMSYIY
                     CPDLETQDHILFTQLPIHLQENIGKTKLLVIDSIAQHFRREDAMSTASTLKNQIDEQV
                     LELAQDEEFKSTVMPNHKKQLKLVSYKSAKYATRSTKLHYLCQMYRHLARLARQYNIA
                     VVIINQVSAHTNDYDDLRRWENAHHEELVYPLNYDFQTLVSAGWDPKVISKYLPATSV
                     RLNERDIEHLEMEISQHLDPFGATRRRKRRRTDDNNENNDDDDDDDDDKGENNINNIN
                     NGDDDEGVYDGNEYENKTLDMERDPRYNKVKQSDLLETRKDLILKAHEMRNKNTKKLV
                     PTLGYPWSVRIQNRIMLMKTYKPILKSKSELEEEDDDKEKERRGEGLLDKKVSSVDPD
                     SGLTYAQLCEGFNTPTSSSSGNQDIAASSLLKGWQVQRFARVVQSSHNHGSGPMENVA
                     FEIRKEGLAQMQPS"
     gene            <716843..>718463
                     /gene="MAF1"
                     /locus_tag="PVL30_003409"
                     /old_locus_tag="LELG_02579"
                     /db_xref="GeneID:5233558"
     mRNA            join(<716843..716848,716958..>718463)
                     /gene="MAF1"
                     /locus_tag="PVL30_003409"
                     /old_locus_tag="LELG_02579"
                     /product="RNA polymerase III-inhibiting protein maf1"
                     /transcript_id="XM_001525971.2"
                     /db_xref="GeneID:5233558"
     CDS             join(716843..716848,716958..718463)
                     /gene="MAF1"
                     /locus_tag="PVL30_003409"
                     /old_locus_tag="LELG_02579"
                     /note="BUSCO:EOG09263FKC"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase III-inhibiting protein maf1"
                     /protein_id="XP_001526021.2"
                     /db_xref="GeneID:5233558"
                     /db_xref="PFAM:PF09174"
                     /translation="MKYIDEIDLELVNQELNFSSPDNNLIIKGGCELFTTKPIGSDKK
                     LFKTIDKHLNQIIEDNQLSRSLERERQNSIGSIFGGSGSPTDKRFNYHYPHHHHIQPQ
                     EQKQEQKHEENPGERPEKAPEVKQTSNNLPLPQESKRRSSSQSGKFKVEVKVDSPKAS
                     GPSLTTTAPTISTVDTINKTTATMNETENAASSLPKSFNDDSFIGSEQQDPIDESPFG
                     PLKSISTRKTFSYLIAILNNTFPDQDFSSLQPTTENFYKLDTPEDLVQKFNNLLISLG
                     KKEDILNWIWDIINSYMDVIPSKTSSPLLAATSGASESHSYGYNQNGSGSGSGSGSGS
                     RSGYGHSHNHGNEQRQGGTSSRKNSFLSKRRNSSFSTLIGGHSPSLSAQQPVEKNCQI
                     YQFQPSDESIFEDLTYPYQPMWSYYWFIYNKRKKRVTFLHLTAINKVHYSNVNEETRR
                     KRLKTDRVIRGDGYDDEEEYDENDEYRGDSEEFVASQSNAEEENTDIVGDLEI"
     gene            <719567..>720550
                     /gene="ARA1"
                     /locus_tag="PVL30_003410"
                     /old_locus_tag="LELG_02580"
                     /db_xref="GeneID:5233094"
     mRNA            <719567..>720550
                     /gene="ARA1"
                     /locus_tag="PVL30_003410"
                     /old_locus_tag="LELG_02580"
                     /product="D-arabinose 1-dehydrogenase (NAD(P)(+))"
                     /transcript_id="XM_001525972.1"
                     /db_xref="GeneID:5233094"
     CDS             719567..720550
                     /gene="ARA1"
                     /locus_tag="PVL30_003410"
                     /old_locus_tag="LELG_02580"
                     /codon_start=1
                     /transl_table=12
                     /product="D-arabinose 1-dehydrogenase (NAD(P)(+))"
                     /protein_id="XP_001526022.1"
                     /db_xref="GeneID:5233094"
                     /db_xref="PFAM:PF00248"
                     /translation="MTPIKKATDVYFTLNNGIKIPALGLGTVPSDDPSDVKDQVITAV
                     KAGYRLIDTAWYYGTEKYVGQALKELFDEGVVKREDIFITTKVWPSFYHSPEKSLDQS
                     LETLGLDYVDLFLQHWPVALHGDENGQPTAPKDKDGNLIYDDDPATGTKFIEVYHKLE
                     KILDETKKTRAIGVSNYSIPKLKQLLPTVKHVPVVNQIEYHPELPQQDLVDLCNEHKI
                     IVECYSPVGGPGAPVLKQPLVQELAKKYDVSTNEIVDAYQILNGRIAIPRSSNLERIK
                     SITNLPDLSKEELDELYQIGVNKPTRYTNDPWGYGLGFRWWQGDDKSKTFT"
     gene            complement(<720683..>722110)
                     /gene="DUS1"
                     /locus_tag="PVL30_003411"
                     /old_locus_tag="LELG_02581"
                     /db_xref="GeneID:5233366"
     mRNA            complement(<720683..>722110)
                     /gene="DUS1"
                     /locus_tag="PVL30_003411"
                     /old_locus_tag="LELG_02581"
                     /product="tRNA dihydrouridine synthase"
                     /transcript_id="XM_001525973.2"
                     /db_xref="GeneID:5233366"
     CDS             complement(720683..722110)
                     /gene="DUS1"
                     /locus_tag="PVL30_003411"
                     /old_locus_tag="LELG_02581"
                     /note="BUSCO:EOG09262Q6S"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA dihydrouridine synthase"
                     /protein_id="XP_001526023.2"
                     /db_xref="GeneID:5233366"
                     /db_xref="PFAM:PF01207"
                     /translation="MTPTATIANENFESVSQSVSKQINQSLEQPSSPQVKMLGRQLYN
                     SIGQPKTIVAPMVDHSELAWRILSRRYGADLCYTPMFHSRLFATDPKYRQSMWNEKDG
                     SRDNDRPLIVQFCANDPDYLLQAAKLVENQCDAVDLNLGCPQGIARRGKYGAFLMDDW
                     ELVHKLIRTLHDNLSVPVTAKIRVYDDWEKSLEYAKMVLDAGAQFITIHGRTREMKGQ
                     NTGLADWKILKHLRDNLPEDQVFFANGNILYPSDLKRCADEVGCDAVMSAEGNLYNPG
                     VFWTKDNDIEKQFPRVDKLLREYFEIVKEVDSPASTHVIKSHFFKLLNSFLKVHTELR
                     PKIGGTSVRQPFEDWNKIVEEVEQIVEEIYNKPNIKEIDVIEDGPVESWGGHYKKVPY
                     WRCQPYFRKINGEMQNTRMSKKFAEEKGTSSKIAADSVADKENRENGENGEETQGETK
                     QCKRALETEDNSESGPLAENKKQAV"
     gene            complement(<722761..>725607)
                     /gene="PMS1_2"
                     /locus_tag="PVL30_003412"
                     /old_locus_tag="LELG_02582"
                     /db_xref="GeneID:5233060"
     mRNA            complement(<722761..>725607)
                     /gene="PMS1_2"
                     /locus_tag="PVL30_003412"
                     /old_locus_tag="LELG_02582"
                     /product="ATP-binding mismatch repair protein"
                     /transcript_id="XM_001525974.2"
                     /db_xref="GeneID:5233060"
     CDS             complement(722761..725607)
                     /gene="PMS1_2"
                     /locus_tag="PVL30_003412"
                     /old_locus_tag="LELG_02582"
                     /note="BUSCO:EOG0926213Z"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-binding mismatch repair protein"
                     /protein_id="XP_001526024.2"
                     /db_xref="GeneID:5233060"
                     /db_xref="PFAM:PF01119"
                     /db_xref="PFAM:PF02518"
                     /db_xref="PFAM:PF08676"
                     /db_xref="PFAM:PF13589"
                     /translation="MSIQGINATDISKITSGQVIIDLRSIVKELVENAIDASAKKISV
                     NFANYGIDSITVQDNGKGISENDFDTVCLRSHTSKIKEFEDLSKLGTLGFRGEALNSI
                     CALANKVSIKTRTLDSNPICHILDFDQFGALVKNTKKRGDMSTPSGTVVTIESIFKKF
                     PVRWKNFIKNSKKEFHKTVSFITNYLLIYPTIKFEVTNVNNGKRSLILSSRGGENNTS
                     TENLISIFGTNGNTNLLEINLQINKDISIAGHISSYSFGLGRSTQDRQFLFVNKRPIV
                     YKKLAKIINEIYKSFNHVQFPVYILNLDINPEAIDVNLLPDKTSVLVHNEDKVLELIR
                     ESLITFYETKDEVVIPRNTQSQYTIPSRTHSMDEASTKSDQSKRQSNINETLKAFSND
                     TDSSFTEIVAKDHKIMKSDSKHRDDEETEEEKEEKEGQQQQGDDDDDHHHHHDGGGGG
                     TYKVIDEVINEIKAHETGFGTFHESVKSSFSSEADVELKKCSSPALSHEYASLRNPLY
                     IEGGVPTLVSYPSIHGSNDEINNKNDNNNDDNDDNDDKNNNDDNDNDNDNAVKKSTED
                     KEINSKASVNLKRHFDYTTTAATALQSDLDSEKDSNNATCISSPFIKTDNMDSASRKR
                     FKGIMSSYLYEKPVMQQSNSLEAEEINPADNHGKNYFPVSEEQTSENGLHIQIGDEQF
                     VEESLAKHKQTNRKSDLFKRWEIVSSESVMSLLEERMTIFGDDANYKAQKLLINKSLD
                     EQEIYQIKKTDFLDMKLIGQFNLGFILVCHGSNLFIIDQHASDEKFNFERLLETFAVN
                     YQPLITPLFVDLNVIDEMLVLDHEQIFQNNGFKISVDYDKPAGAKISLTSLPVYKNIM
                     FSVDDFYELINLINEQPSNRNIKCSKIRKIVAMKACRSSIMIGSFLSKQRMQKVVANL
                     SKLDKPWNCPHGRPTMRHLIESNNWQSRYPDYFL"
     gene            <725985..>726752
                     /locus_tag="PVL30_003413"
                     /old_locus_tag="LELG_02583"
                     /db_xref="GeneID:5233241"
     mRNA            <725985..>726752
                     /locus_tag="PVL30_003413"
                     /old_locus_tag="LELG_02583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525975.1"
                     /db_xref="GeneID:5233241"
     CDS             725985..726752
                     /locus_tag="PVL30_003413"
                     /old_locus_tag="LELG_02583"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526025.2"
                     /db_xref="GeneID:5233241"
                     /translation="MPQKGNHKNDVHQPLTVNNFFLVFREFVTAWLNEILYYNRVYDP
                     LIFDDYKAFEILIHKNRHPHLSEYIDDFVLNVINNLIISKKQSNGLQSISCSIYDTES
                     ESVVKVYTIKFTQFIVNLDKTITELKEDLINDTSASLNVPDLTWREIHTQFQTVLFKH
                     SQQLKKDAETVFVSSSSSSNLNSGDTTRSTGNNFFFKITVDLDASVYPKSSDWVRLEK
                     NLKSKEEVFETTAKLKTCGELDLSVLSFDLVNTYFSE"
     gene            <727821..>728801
                     /gene="pho2_2"
                     /locus_tag="PVL30_003414"
                     /old_locus_tag="LELG_02584"
                     /db_xref="GeneID:5233388"
     mRNA            <727821..>728801
                     /gene="pho2_2"
                     /locus_tag="PVL30_003414"
                     /old_locus_tag="LELG_02584"
                     /product="4-nitrophenylphosphatase"
                     /transcript_id="XM_001525976.1"
                     /db_xref="GeneID:5233388"
     CDS             727821..728801
                     /gene="pho2_2"
                     /locus_tag="PVL30_003414"
                     /old_locus_tag="LELG_02584"
                     /codon_start=1
                     /transl_table=12
                     /product="4-nitrophenylphosphatase"
                     /protein_id="XP_001526026.1"
                     /db_xref="GeneID:5233388"
                     /db_xref="PFAM:PF13242"
                     /db_xref="PFAM:PF13344"
                     /translation="MTVKSNPVCLSSRKDAERVVELFDNFLLDCDGVIWLSETLIEGV
                     ADFLRYLQLHKKNIAFVTNNSSKSRQSYVEKFRFLGIHGIEKEQIYTTGYSAVLELRK
                     MGIHPGSKIWVLGDSGIEDELADEGYIALGGSNPLLDQPWNPKNPLLKVDPEVKAVIA
                     GSTNDFNFMRITTTLQYLVYDNKKIPYIGTNGDRNYPGPDGLTLPAGGSIVEYMSYCS
                     NRPYIDVGKPSKTFADVIFYDTNFDRSKSIMIGDTLSSDIKFGNDADLGNGHGTMLVL
                     SGVTTINELEQLISPGSSSSHLHKAQGQDQALIPQFFVDSLTKFYNLLQS"
     gene            complement(<729090..>730769)
                     /locus_tag="PVL30_003415"
                     /old_locus_tag="LELG_02585"
                     /db_xref="GeneID:5233283"
     mRNA            complement(<729090..>730769)
                     /locus_tag="PVL30_003415"
                     /old_locus_tag="LELG_02585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525977.1"
                     /db_xref="GeneID:5233283"
     CDS             complement(729090..730769)
                     /locus_tag="PVL30_003415"
                     /old_locus_tag="LELG_02585"
                     /note="BUSCO:EOG09262PZ9"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526027.2"
                     /db_xref="GeneID:5233283"
                     /db_xref="PFAM:PF00153"
                     /db_xref="PFAM:PF13202"
                     /db_xref="PFAM:PF13499"
                     /db_xref="PFAM:PF13833"
                     /translation="MTRNITSISAYIHNDSNQNEGYSKDIVIPAKPNDYEALFKKLDV
                     EQTGQITFSDFTRAMKKLNHPMSENKEMLRTVFDSFDGDKDKVIDFNDFKRYLNQTDD
                     QILKGFNKIDADNDGKLNKSDFVKYLKENLNLKTSQVNTDLLFKQIDYKNDGYITYDE
                     FREFLILMPRLHGSRIKTAYTFIVDEYDVSSDGDVTLVSQFLNGFGFFLAGGLAGVVS
                     RTCTAPFDRIKVFLIARTDLTSTILHSKREIARQIASGAETSVIEELRRKLAHAELEK
                     KIEQQSSSAGTTKLREKTIRSPIVQAARTIWKEGGIRAFYVGNGLNVLKVFPESAMKF
                     GSFEAAKRFFARIEGVDDVAQISKLSTYLAGGFGGVVSQVVVYPIDTLKFRLQCSNLD
                     SSLKGNALLIQTAKDLFQEGGIRIFYRGMITGASGIFPYAALDLGTFSSIKSYLVKRE
                     ALKKGVSEDDVRLPNSITLTLGAFSGSFGATVVYPINLLRTRLQAQGTYAHPYTYDGF
                     FDVLHKTIAREGYPGLFKGLVPNLAKVAPAVSISYFVYENLKSLFGLQNTV"
     gene            complement(<731682..>733262)
                     /gene="CCT2"
                     /locus_tag="PVL30_003416"
                     /old_locus_tag="LELG_02586"
                     /db_xref="GeneID:5233469"
     mRNA            complement(<731682..>733262)
                     /gene="CCT2"
                     /locus_tag="PVL30_003416"
                     /old_locus_tag="LELG_02586"
                     /product="T-complex protein 1 subunit beta"
                     /transcript_id="XM_001525978.2"
                     /db_xref="GeneID:5233469"
     CDS             complement(731682..733262)
                     /gene="CCT2"
                     /locus_tag="PVL30_003416"
                     /old_locus_tag="LELG_02586"
                     /codon_start=1
                     /transl_table=12
                     /product="T-complex protein 1 subunit beta"
                     /protein_id="XP_001526028.1"
                     /db_xref="GeneID:5233469"
                     /db_xref="PFAM:PF00118"
                     /translation="MSVQIFKDQVEEDRGENARMAAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASNPDHSIVTNDGATILKSIPFENPAAKVLVNISKVQDDEVGDGTTSVTVLSAE
                     LLRESEKLIDQNIHPQTIIEGFRIARKHAIEALDKNAVNNGNNQEKFRQDLLNIAKTT
                     LSSKILSQDKEYFANLAVDAILRLKGSTNLNNIQIIKKVGGKLSDSYLDEGFILEKKF
                     GIGQPKKIENAKILIANTSMDTDKVKIFGAKFKVDSTSKLAELEKAEKLKMKNKVDKI
                     KKFDINVFINRQLIYDYPEQLFTDAKINSIEHADFDGVERLALVTGGEVVSTFDNPDS
                     VKLGYCDSIEEIFIGEDTFLKFSGVAAGEACTVVLRGATDHVLEEADRSLHDALSVLS
                     QTTRDTKTVLGGGCAEMIMAKAVDQAAANETGKKALAIEAFSKALRQLPTILADNAGY
                     DSSELVTKLRSAIYNGLSSSGLDLNNGTVADMRDLGIVESYKLKKAVVNSATEAAEVL
                     LRVDNIIRAKPRTADRNH"
     gene            <735452..>736162
                     /locus_tag="PVL30_003417"
                     /old_locus_tag="LELG_02587"
                     /db_xref="GeneID:5233146"
     mRNA            <735452..>736162
                     /locus_tag="PVL30_003417"
                     /old_locus_tag="LELG_02587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525979.2"
                     /db_xref="GeneID:5233146"
     CDS             735452..736162
                     /locus_tag="PVL30_003417"
                     /old_locus_tag="LELG_02587"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526029.2"
                     /db_xref="GeneID:5233146"
                     /translation="MVFGFGKDNNNDDDNNNNNNYGGRNNDDSRGGFGDSSDSASDNY
                     GSSNYGNDNQDSYGSSNDNFGSSNYGNSNDDDNYGSSGRGERGGRGGRGDNDNSYGSS
                     RNDNDDNGDSSFGSSNKRGGNSDNFGSSNRGGSDSYGSGSDDFGSSGRGGNDNYGSDN
                     FGSSGNDYSSNTKSGRKGNSFGNDNDNDNDNDFGSTSNQNRSGGFGNDDSFGGNNDDS
                     YGRSNRSGGDSYGNNDNY"
     gene            complement(<736507..>737991)
                     /gene="GAL83_2"
                     /locus_tag="PVL30_003418"
                     /old_locus_tag="LELG_02588"
                     /db_xref="GeneID:5233530"
     mRNA            complement(<736507..>737991)
                     /gene="GAL83_2"
                     /locus_tag="PVL30_003418"
                     /old_locus_tag="LELG_02588"
                     /product="galactose metabolism- protein"
                     /transcript_id="XM_001525980.2"
                     /db_xref="GeneID:5233530"
     CDS             complement(736507..737991)
                     /gene="GAL83_2"
                     /locus_tag="PVL30_003418"
                     /old_locus_tag="LELG_02588"
                     /codon_start=1
                     /transl_table=12
                     /product="galactose metabolism- protein"
                     /protein_id="XP_001526030.2"
                     /db_xref="GeneID:5233530"
                     /db_xref="PFAM:PF04739"
                     /db_xref="PFAM:PF16561"
                     /translation="MTNETQSEPIENGNGIKNGNTADSNGKDVSMVDVSAANTANGAT
                     QTISDSSSSSKNPTDDIDLDRMNIDQKDEPHQESSKHVEDAADEDRMHIDHSSTTLAQ
                     QQQQQQQQQQQQQQQQQQQQAQDKPPPSSASTRVQNEDQGSQTSAQNNPTQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPETVFTLPVDIKW
                     VQGGEKVYVTGSFTGWRKMIGLVRQPDGTFVITLGLPVGTHRLRFIVDNELRYSDFLP
                     TATDQTGNIVNYVEVAPPPQKDQVQTPAVPQQQQDEQQQQEQQEQQIGSTGAEKAKPN
                     MEEKKDIGGKEASDDSNGLTSRKSTRWQLTNDEDDMGNGYSRYYDQGPEGQNLSFITD
                     IPPIFTDPKVMEQYYVAIDKQSKSNNGQQQAWLHPPQLPPHLESVILNNFNSNENNSG
                     ALPTPNHVVLNHLATTSIKHNTLAVASIMRYKTKYITQVLYAPL"
     gene            <739567..>740565
                     /gene="RRG9"
                     /locus_tag="PVL30_003419"
                     /old_locus_tag="LELG_02589"
                     /db_xref="GeneID:5232957"
     mRNA            <739567..>740565
                     /gene="RRG9"
                     /locus_tag="PVL30_003419"
                     /old_locus_tag="LELG_02589"
                     /product="Required for respiratory growth protein 9
                     mitochondrial"
                     /transcript_id="XM_001525981.2"
                     /db_xref="GeneID:5232957"
     CDS             739567..740565
                     /gene="RRG9"
                     /locus_tag="PVL30_003419"
                     /old_locus_tag="LELG_02589"
                     /codon_start=1
                     /transl_table=12
                     /product="Required for respiratory growth protein 9
                     mitochondrial"
                     /protein_id="XP_001526031.2"
                     /db_xref="GeneID:5232957"
                     /translation="MLSQCFRSSLAKHCFVAKNQASHGKFVNSIMCLSSSSSNSGSSN
                     SNSNSGSSNSNIRYNDNYRSNDDGTNFEESQLPSALKSETESLNGKGKNKLSKRPQTL
                     LEALIESHGTLPEEVDEPKITRNVASESATSATSATSATSATSATSATSATSATSATS
                     ATSTTSTTTIITTTATVPVENNVSTPYWVKRELTMKAKHSQWNPKKKLSREDMLKLRE
                     LKENFPHYKTVELAELFRVSPEAVRRILKSNWVPNDIDEDRIIARREKQKQKRQQEIQ
                     LKKLEFISNRGKKNVSSRPQQRQQQQPKQQQRQRSKVGYKNGFAFNEKYGGLGNKF"
     gene            complement(<740590..>742122)
                     /locus_tag="PVL30_003420"
                     /old_locus_tag="LELG_02590"
                     /db_xref="GeneID:5232985"
     mRNA            complement(<740590..>742122)
                     /locus_tag="PVL30_003420"
                     /old_locus_tag="LELG_02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525982.2"
                     /db_xref="GeneID:5232985"
     CDS             complement(740590..742122)
                     /locus_tag="PVL30_003420"
                     /old_locus_tag="LELG_02590"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526032.2"
                     /db_xref="GeneID:5232985"
                     /db_xref="PFAM:PF01803"
                     /translation="MNGNSSIMENATGAPVNSGTDTGEMLQTPAQHASQFAHSGTRGV
                     GDVNQQTRSINTPPMGLPVNQFTQGGFSNPQMAPTVGMPISIPQQVSNPVVRQALPPG
                     AVPPPPNPPPSAAAATAATATTNLLPGPAQSQQELNVRIFKRNLGNAAVLRVLELIDF
                     VSNEMSSNLKRVDFWNLLAPAYFAPSAAIKLNFGKIVLNNDMSMESCTGLNFDFLKQN
                     SNTSTNEDGASFKLTLIAAPFFFSKCASDSGTKHARVNLSTLRHQVLDNGSIFIVARF
                     NLQFTYDDDTISMIDGNVKILVGRDLRIEWMDVDCATYESFINFKRPLESKAVSIKEL
                     YNKSRARQNASTAGLTRDAGRTLQLGSILSTMSQLIEFSQQSKVPQPETALKSLVQNM
                     QSSLMTQSKGGVFSAARGNINSNLGMEQGAQTNAEALSKDRTNLANGPKQEAKNGRDG
                     LISSRGIHDSSANVSSPSPKTVNAEDPKKKRKAPAQTQAQASGHTSQSNTANLDSNKR
                     KK"
     gene            <742248..>742595
                     /locus_tag="PVL30_003421"
                     /db_xref="GeneID:85890361"
     mRNA            <742248..>742595
                     /locus_tag="PVL30_003421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119467.1"
                     /db_xref="GeneID:85890361"
     CDS             742248..742595
                     /locus_tag="PVL30_003421"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975450.1"
                     /db_xref="GeneID:85890361"
                     /translation="MLAVVAVVAVVGAVGVVGGVVEAAAAADVVAKIVVDVVDLVVVA
                     KIVVGVVDLVVRKAVVVVVVGLDEIEDEDEVEVEDEDEDEVEVEDEDEVVAASFVQIV
                     AETSQMSRSSRIS"
     gene            complement(<743404..>744534)
                     /locus_tag="PVL30_003422"
                     /old_locus_tag="LELG_02591"
                     /db_xref="GeneID:5233172"
     mRNA            complement(<743404..>744534)
                     /locus_tag="PVL30_003422"
                     /old_locus_tag="LELG_02591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525983.2"
                     /db_xref="GeneID:5233172"
     CDS             complement(743404..744534)
                     /locus_tag="PVL30_003422"
                     /old_locus_tag="LELG_02591"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526033.2"
                     /db_xref="GeneID:5233172"
                     /db_xref="PFAM:PF04795"
                     /translation="MAKRRVIDSEDEDSSLSVQEEEDLAPKEIYLESEDGGEEDNEEE
                     DEEEEEEEEEEEDEAEEEEAEEGDDDFDLDEVDQNDSEFGAESGTENFGIGDAVDYDE
                     DSDENDGGNRGVRGGSLSEGTKTKQNIKDKQPSRSIKITIKPPKQNPKEEIAQSSAQS
                     VPTHDEGKRQTRKRQVNYYQDETDDFEEKYIEEKPASKPKRAKVVATRASKPVQSQRR
                     DIDPELLLTDEEEEEYNPGGIDDITKLTERQRARLTAEESGTPLFELDESGKKPKSKT
                     EKEEETEEEVALRKAENARKRLDYKNKVLEEEKRDTLNKLLKRRATKSREIIKDDNGE
                     GTQEEELSMFRKNRRPMLEHPALIRYVNNTTTLQGNSIIAYK"
     gene            complement(<745136..>745807)
                     /locus_tag="PVL30_003423"
                     /old_locus_tag="LELG_02592"
                     /db_xref="GeneID:5233540"
     mRNA            complement(<745136..>745807)
                     /locus_tag="PVL30_003423"
                     /old_locus_tag="LELG_02592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525984.2"
                     /db_xref="GeneID:5233540"
     CDS             complement(745136..745807)
                     /locus_tag="PVL30_003423"
                     /old_locus_tag="LELG_02592"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526034.2"
                     /db_xref="GeneID:5233540"
                     /translation="MSAVAKLTIPESSYNLASYNLSSPKSKSQLLIYLIKLTHGASVS
                     LIIAYAVGFLILKPLLEQTASRRLDLLECVRGNLREFYLKAITKINYVPIVAIRRQNK
                     LLADAAVQTESTGSKEEGERDPLMQNELHSRLKKIATFLQDSVRSYSMEGMSNYRSIN
                     YSIKDFQNKADLVYFNEDDFFLQDNVSSISNRPAGTKTRKKNIVVETKNEIRSIKGLF
                     MSGQI"
     gene            <746583..>748133
                     /locus_tag="PVL30_003424"
                     /old_locus_tag="LELG_02593"
                     /db_xref="GeneID:5233073"
     mRNA            <746583..>748133
                     /locus_tag="PVL30_003424"
                     /old_locus_tag="LELG_02593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525985.2"
                     /db_xref="GeneID:5233073"
     CDS             746583..748133
                     /locus_tag="PVL30_003424"
                     /old_locus_tag="LELG_02593"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526035.2"
                     /db_xref="GeneID:5233073"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF05496"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF13173"
                     /translation="MTIEEETVSTQVADNGLELSLSEAVRPNTLANYVGQRHLLNEEE
                     GIFANYIRMGYLPSMLLIGPPGSGKTTLARLVAKSCGYATSNIIELSATTLTTENIKN
                     LVNDCQEQLVVFIDEIHRLSKVQQDWLLPFVEDGKIVLIGATTLETPSRRIRKAILSR
                     CQVFPLQRLHDDELLSVLHSAIDFENQRRSRRSRNNNNTNNDREELGKAETSKSGELQ
                     FSDNALLGIVRAVNGDIRAAINTIERVSHTFKTGHDHKITSAEMNLVLKTHTRGQTHL
                     NELYDFLFASLREGCSKHAHARLSVGSSAIESGKYKGDISEYIQQMEVSDDELIDMES
                     SDTSTFQDPLYLLLPRHLSSVQSQIEQSITRSIYLSLLILKEGDTPQQLLKRLILFAF
                     EHLDLTPRILSTFTSLCKISIQETQETLSRTLHDLIHLIVSEGTISTNLGNHYLHARE
                     YFQHSKRNRAIPKNVGELEIYYDAAELAKVEAQPQVSLFPDMEIQITSPTITFDSREI
                     EQVEIGYS"
     gene            complement(<748566..>752207)
                     /locus_tag="PVL30_003425"
                     /old_locus_tag="LELG_02594"
                     /db_xref="GeneID:5233622"
     mRNA            complement(<748566..>752207)
                     /locus_tag="PVL30_003425"
                     /old_locus_tag="LELG_02594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525986.2"
                     /db_xref="GeneID:5233622"
     CDS             complement(748566..752207)
                     /locus_tag="PVL30_003425"
                     /old_locus_tag="LELG_02594"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526036.2"
                     /db_xref="GeneID:5233622"
                     /db_xref="PFAM:PF02854"
                     /db_xref="PFAM:PF12152"
                     /translation="MSGNGVSEKSDQQTSSVKIDDAPAKDLQHQSQTPASAQTQPSKG
                     SEVSEASASAPAASAPSPAVTPSSKAATPVAKPATGGQQAKNAHNSVPQSHLNQAEQN
                     HSDYNQYSGAYYQYNPNYNANYNGTYSNYKNHYNGGAGGGSGSGNHKQYSGNNRQGGG
                     SGNSSRYNNNNSNNNNNNNSNNTNAAGNSNNAQGGPAHRKQYNNSNHHQKNMNHGNHN
                     LAPGQQLPQGQYVNYNYGAAAAPQYYQFGGFYPPVYVQPLQYTAAAQSYATPGSGGAT
                     PQHQHQRTSSHSSSPKVTLTTKDGKPVDLEEKKRQTASSTPVASPLQKNASPVPSSTK
                     VAVESSKSPVVKEASLSTPASNATTTTTTTTTATTSTATKSDADNASNTKTSANLSAA
                     EEFKRRIRERAAANAAKKKQQEEQSSGQKTESGSKQEKPDEDAKKDTVEEPSHPAQEP
                     AAKDQTAVAKETKEETKPETTIETTPEVKTSTEQKLESPKPVEKPEAAEPTVKPTEQK
                     SEELNKTDEHTAEPAEKELQATTKPAESAESAEKPKEQTKEQKEENVDVNVNDNDNDN
                     DDDEEDEDEEDETEAGEPVQELSITQFLERLNQATPIDNILAVEYPQNINGVDKTKQL
                     PSKKYRYDPQFLIQFRDVVQYSIDADFKTRYEYLDVGAQQGMRRQGSAREGSLRGLGA
                     GGMRQGSGLPSRYSGPQGKGGLPSAYDSSRQNSRSGSKRRGVSTRDKSIRKGPSTRRG
                     GRGEMREKTEEELAKEQKPVEEVKPLEKSANRWIPKSRQQKTEVRYAEDGSVILEKED
                     VERKIKSLLNKLTLEMFTEITDEILDITKQSRWEKDASTIKQTISLTFAKACDEPYWS
                     EMYAKFCAKMTQNILPEITDETSTLKDGSHPAGGALARRVLLSTCQVEYEKGWIDKLP
                     TNEDGSPIEPEMMSDEYYAMAAAKRRGLGLVKFIGHLYNLNMLNDQIIYVCLRDQCSN
                     TTDPSEDRIENLAQLIKTVGPKMDSNERTRGMLTGVFESIKQILEKAQLSSRIKFMLM
                     DIQDLKAARWQSGKAEAQPTTIGAIHRDAEMSRLKQEQEKRKRGPGPSGGSSHYGGNK
                     AAPSRSASNSDFFSNSGFKKSPSFARSNSSLRGGNSIDRVDRSDRSERNAHSPVSSGS
                     DLQRDSSRRSENQQVNRFAALDNDDEEEEEEEEEQEEVHDNNNNNNNNNSEDKQEVGA
                     EGKGKKEDI"
     gene            <754411..>755616
                     /gene="RPT6"
                     /locus_tag="PVL30_003426"
                     /old_locus_tag="LELG_02595"
                     /db_xref="GeneID:5233240"
     mRNA            <754411..>755616
                     /gene="RPT6"
                     /locus_tag="PVL30_003426"
                     /old_locus_tag="LELG_02595"
                     /product="26S proteasome regulatory subunit 8"
                     /transcript_id="XM_001525987.2"
                     /db_xref="GeneID:5233240"
     CDS             754411..755616
                     /gene="RPT6"
                     /locus_tag="PVL30_003426"
                     /old_locus_tag="LELG_02595"
                     /codon_start=1
                     /transl_table=12
                     /product="26S proteasome regulatory subunit 8"
                     /protein_id="XP_001526037.1"
                     /db_xref="GeneID:5233240"
                     /db_xref="PFAM:PF00004"
                     /db_xref="PFAM:PF07724"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF17862"
                     /translation="MSTAVDKPYTHESGIRPYFEQQIQDTEIEIQQTTQNLRRLEAQR
                     NKLNNSVRQLKDELRLLQEPGSYVGEVIKVMGTKKVLVKIHPEGKYIVNVTKDVDIKK
                     LTPSIRVCLKADSHDLYKILPNKVDPLVSLMMVEKVPDSTYDMVGGLDKQIKEIKEVI
                     ELPVKYPELFSSLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGSELVQKY
                     IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSSGGDSEVQRTMLELLNQLD
                     GFESSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPAPTLQARTDILRIHSRSMNLT
                     RGINLKKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMSKNDEG
                     TVSLQKLFK"
     gene            <756418..>757079
                     /locus_tag="PVL30_003427"
                     /old_locus_tag="LELG_02597"
                     /db_xref="GeneID:5233004"
     mRNA            join(<756418..756425,756581..>757079)
                     /locus_tag="PVL30_003427"
                     /old_locus_tag="LELG_02597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525988.2"
                     /db_xref="GeneID:5233004"
     CDS             join(756418..756425,756581..757079)
                     /locus_tag="PVL30_003427"
                     /old_locus_tag="LELG_02597"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526038.2"
                     /db_xref="GeneID:5233004"
                     /translation="MAGTHYAKYDFYNFYNFYNFYNFYDFYDFYNFYNFYNFYNFYNF
                     YDFYNFYNFYNFYNFYNFYNFYNFYNFYNFYDFYDFYDFYDFYDFYDFYDFYDFYDFY
                     DFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYDFYD
                     FYDFYDEY"
     gene            complement(<757149..>759279)
                     /locus_tag="PVL30_003428"
                     /old_locus_tag="LELG_02598"
                     /db_xref="GeneID:5233569"
     mRNA            complement(join(<757149..757390,757925..758057,
                     758095..>759279))
                     /locus_tag="PVL30_003428"
                     /old_locus_tag="LELG_02598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119468.1"
                     /db_xref="GeneID:5233569"
     CDS             complement(join(757149..757390,757925..758057,
                     758095..759279))
                     /locus_tag="PVL30_003428"
                     /old_locus_tag="LELG_02598"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975451.1"
                     /db_xref="GeneID:5233569"
                     /translation="MPFFNKCFQNVFAKDSKPFYFSKKLGSQSPVQESIIPEEAERFL
                     IAEGVRRSTIAGKKRPCKRGDVCKVSLSFQGFRTKFKSFNPKMFQWMKWLQQVNDTDF
                     IQSFVSKQHSVVRIGESAFTSADKKYLIYRVSKEHFEEIESEVANSTTLWEEDLVLPP
                     YLHLFSMKVYDEDRYYTISPVLDNKADREYPSEQDTNSANYTNSANYTNNTSYTNNTN
                     YTNNTNNTNNANNANNTNNTNNTNNANNTNNTNNANNTNNANNTNNTNNTNNTNNTNT
                     NNTNNNTNNTNTNNTNNTNNTNNTNNNNNNNNNNNNNNNTNNTHNTNNTNDANYISDF
                     ISTRNTCYINEALSTAHCSRTSWQHIYCIDQDSIMGTIGIPMLAEERENLLLKLSQQT
                     KHLELSLMRKFDQKSKFGLTPTTEFIRERAGLRLSSGLAKKRSEHSKTADSHIYSELG
                     RSCDKMAPFSYDLVRGTKNVEDAYALGVSTRHSGIIESQVELYKSPCKLFQMVQKKSL
                     RNQLSGFNFAT"
     gene            complement(<760353..>761110)
                     /locus_tag="PVL30_003429"
                     /old_locus_tag="LELG_02600"
                     /db_xref="GeneID:5233593"
     mRNA            complement(join(<760353..760692,760785..>761110))
                     /locus_tag="PVL30_003429"
                     /old_locus_tag="LELG_02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119469.1"
                     /db_xref="GeneID:5233593"
     CDS             complement(join(760353..760692,760785..761110))
                     /locus_tag="PVL30_003429"
                     /old_locus_tag="LELG_02600"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975452.1"
                     /db_xref="GeneID:5233593"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCT
                     FFF"
     gene            complement(<761255..>762637)
                     /locus_tag="PVL30_003430"
                     /old_locus_tag="LELG_02601"
                     /db_xref="GeneID:5233001"
     mRNA            complement(join(<761255..761686,761954..>762637))
                     /locus_tag="PVL30_003430"
                     /old_locus_tag="LELG_02601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119470.1"
                     /db_xref="GeneID:5233001"
     CDS             complement(join(761255..761686,761954..762637))
                     /locus_tag="PVL30_003430"
                     /old_locus_tag="LELG_02601"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975453.1"
                     /db_xref="GeneID:5233001"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<762821..>764480)
                     /locus_tag="PVL30_003431"
                     /old_locus_tag="LELG_02602"
                     /db_xref="GeneID:5233444"
     mRNA            complement(join(<762821..762847,763759..764062,
                     764155..>764480))
                     /locus_tag="PVL30_003431"
                     /old_locus_tag="LELG_02602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119471.1"
                     /db_xref="GeneID:5233444"
     CDS             complement(join(762821..762847,763759..764062,
                     764155..764480))
                     /locus_tag="PVL30_003431"
                     /old_locus_tag="LELG_02602"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975454.1"
                     /db_xref="GeneID:5233444"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAAWREGYLV
                     "
     gene            complement(<764625..>766007)
                     /locus_tag="PVL30_003432"
                     /old_locus_tag="LELG_02603"
                     /db_xref="GeneID:5233407"
     mRNA            complement(join(<764625..765056,765324..>766007))
                     /locus_tag="PVL30_003432"
                     /old_locus_tag="LELG_02603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119472.1"
                     /db_xref="GeneID:5233407"
     CDS             complement(join(764625..765056,765324..766007))
                     /locus_tag="PVL30_003432"
                     /old_locus_tag="LELG_02603"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975455.1"
                     /db_xref="GeneID:5233407"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<767093..>767850)
                     /locus_tag="PVL30_003433"
                     /db_xref="GeneID:85890362"
     mRNA            complement(join(<767093..767432,767525..>767850))
                     /locus_tag="PVL30_003433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119473.1"
                     /db_xref="GeneID:85890362"
     CDS             complement(join(767093..767432,767525..767850))
                     /locus_tag="PVL30_003433"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975456.1"
                     /db_xref="GeneID:85890362"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCT
                     FFF"
     gene            complement(<767995..>769377)
                     /locus_tag="PVL30_003434"
                     /old_locus_tag="LELG_02158"
                     /db_xref="GeneID:5233913"
     mRNA            complement(join(<767995..768426,768694..>769377))
                     /locus_tag="PVL30_003434"
                     /old_locus_tag="LELG_02158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119474.1"
                     /db_xref="GeneID:5233913"
     CDS             complement(join(767995..768426,768694..769377))
                     /locus_tag="PVL30_003434"
                     /old_locus_tag="LELG_02158"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975457.1"
                     /db_xref="GeneID:5233913"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<769561..>771220)
                     /locus_tag="PVL30_003435"
                     /db_xref="GeneID:85890363"
     mRNA            complement(join(<769561..769587,770499..770802,
                     770895..>771220))
                     /locus_tag="PVL30_003435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119475.1"
                     /db_xref="GeneID:85890363"
     CDS             complement(join(769561..769587,770499..770802,
                     770895..771220))
                     /locus_tag="PVL30_003435"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975458.1"
                     /db_xref="GeneID:85890363"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAAWREGYLV
                     "
     gene            complement(<771367..>772749)
                     /locus_tag="PVL30_003436"
                     /db_xref="GeneID:85890364"
     mRNA            complement(join(<771367..771798,772066..>772749))
                     /locus_tag="PVL30_003436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119476.1"
                     /db_xref="GeneID:85890364"
     CDS             complement(join(771367..771798,772066..772749))
                     /locus_tag="PVL30_003436"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975459.1"
                     /db_xref="GeneID:85890364"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<772933..>774578)
                     /locus_tag="PVL30_003437"
                     /old_locus_tag="LELG_02153"
                     /db_xref="GeneID:5234018"
     mRNA            complement(join(<772933..772959,773857..774160,
                     774253..>774578))
                     /locus_tag="PVL30_003437"
                     /old_locus_tag="LELG_02153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119477.1"
                     /db_xref="GeneID:5234018"
     CDS             complement(join(772933..772959,773857..774160,
                     774253..774578))
                     /locus_tag="PVL30_003437"
                     /old_locus_tag="LELG_02153"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975460.1"
                     /db_xref="GeneID:5234018"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAAWREGYLV
                     "
     gene            complement(<774725..>776119)
                     /locus_tag="PVL30_003438"
                     /old_locus_tag="LELG_02154"
                     /db_xref="GeneID:5234039"
     mRNA            complement(join(<774725..775156,775436..>776119))
                     /locus_tag="PVL30_003438"
                     /old_locus_tag="LELG_02154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119478.1"
                     /db_xref="GeneID:5234039"
     CDS             complement(join(774725..775156,775436..776119))
                     /locus_tag="PVL30_003438"
                     /old_locus_tag="LELG_02154"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975461.1"
                     /db_xref="GeneID:5234039"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<777191..>777936)
                     /locus_tag="PVL30_003439"
                     /db_xref="GeneID:85890365"
     mRNA            complement(join(<777191..777530,777623..>777936))
                     /locus_tag="PVL30_003439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119479.1"
                     /db_xref="GeneID:85890365"
     CDS             complement(join(777191..777530,777623..777936))
                     /locus_tag="PVL30_003439"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975462.1"
                     /db_xref="GeneID:85890365"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIIGLCKSPCKLFQMVQKKSLWNSLPGFVNVAS
                     KSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGCVADV
                     MSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCTFFF"
     gene            complement(<778083..>779465)
                     /locus_tag="PVL30_003440"
                     /db_xref="GeneID:85890366"
     mRNA            complement(join(<778083..778514,778782..>779465))
                     /locus_tag="PVL30_003440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119480.1"
                     /db_xref="GeneID:85890366"
     CDS             complement(join(778083..778514,778782..779465))
                     /locus_tag="PVL30_003440"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975463.1"
                     /db_xref="GeneID:85890366"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<780579..>781336)
                     /locus_tag="PVL30_003441"
                     /old_locus_tag="LELG_02155"
                     /db_xref="GeneID:5234604"
     mRNA            complement(join(<780579..780918,781011..>781336))
                     /locus_tag="PVL30_003441"
                     /old_locus_tag="LELG_02155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119481.1"
                     /db_xref="GeneID:5234604"
     CDS             complement(join(780579..780918,781011..781336))
                     /locus_tag="PVL30_003441"
                     /old_locus_tag="LELG_02155"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975464.1"
                     /db_xref="GeneID:5234604"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCT
                     FFF"
     gene            complement(<781483..>782871)
                     /locus_tag="PVL30_003442"
                     /db_xref="GeneID:85890367"
     mRNA            complement(join(<781483..781914,782188..>782871))
                     /locus_tag="PVL30_003442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119482.1"
                     /db_xref="GeneID:85890367"
     CDS             complement(join(781483..781914,782188..782871))
                     /locus_tag="PVL30_003442"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975465.1"
                     /db_xref="GeneID:85890367"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<783943..>784700)
                     /locus_tag="PVL30_003443"
                     /old_locus_tag="LELG_02159"
                     /db_xref="GeneID:5234317"
     mRNA            complement(join(<783943..784282,784375..>784700))
                     /locus_tag="PVL30_003443"
                     /old_locus_tag="LELG_02159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119483.1"
                     /db_xref="GeneID:5234317"
     CDS             complement(join(783943..784282,784375..784700))
                     /locus_tag="PVL30_003443"
                     /old_locus_tag="LELG_02159"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975466.1"
                     /db_xref="GeneID:5234317"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCT
                     FFF"
     gene            complement(<784847..>786241)
                     /locus_tag="PVL30_003444"
                     /db_xref="GeneID:85890368"
     mRNA            complement(join(<784847..785278,785558..>786241))
                     /locus_tag="PVL30_003444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119484.1"
                     /db_xref="GeneID:85890368"
     CDS             complement(join(784847..785278,785558..786241))
                     /locus_tag="PVL30_003444"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975467.1"
                     /db_xref="GeneID:85890368"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            complement(<787313..>788070)
                     /locus_tag="PVL30_003445"
                     /db_xref="GeneID:85890369"
     mRNA            complement(join(<787313..787652,787745..>788070))
                     /locus_tag="PVL30_003445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119485.1"
                     /db_xref="GeneID:85890369"
     CDS             complement(join(787313..787652,787745..788070))
                     /locus_tag="PVL30_003445"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975468.1"
                     /db_xref="GeneID:85890369"
                     /translation="MIPKQGSPPTSATVSHSLPQHCTSVAADSHIYSELGRSCDKMAP
                     LSYDLVRGTKNVEDAYALGVSTRHSGIILSQVGLCKSPCKLFQMVQKKSLWNSLPGFV
                     NVASKSFVCYPTSTKLKLCHSNLSEMFLVLFSVFFPGCVTGCVADGVAGCVADVMSGC
                     VADVMSGCVAGVMSGGVTDVMSGGVADGVADVMSGGVADGVADVMFGGVAVPAINLCT
                     FFF"
     gene            complement(<788217..>789611)
                     /locus_tag="PVL30_003446"
                     /old_locus_tag="LELG_02605"
                     /db_xref="GeneID:5233595"
     mRNA            complement(join(<788217..788648,788928..>789611))
                     /locus_tag="PVL30_003446"
                     /old_locus_tag="LELG_02605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119486.1"
                     /db_xref="GeneID:5233595"
     CDS             complement(join(788217..788648,788928..789611))
                     /locus_tag="PVL30_003446"
                     /old_locus_tag="LELG_02605"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975469.1"
                     /db_xref="GeneID:5233595"
                     /translation="MSFFKNAFNTSPKSKGEKPAERKVRFQLPGEPVPQSTKQVFQNL
                     KSTLAKGFKPSQAPGKSPSGAPSSETPVKKLTKKEAERFLLVEGIHKSIADCLRRTWK
                     YDETFSVFLRHQEYTTNIESYHAKSFQRVRKSWGCSESTYLQSFASMEDSITKIGSTA
                     YKSTDGKFLIYKISDEHSQDIRRELPRMGSHYKEASLILPHFQLLKMNFGGEETIYAV
                     SPAYEHQATEGCPTGNVRFPLLTKEREDILHKLQRDTTHLIARNKTGYKLLVGVERKV
                     GSRPGIQVRIVDYHRTYTRERGFRRFFRFGRANVKTPEEYAAWLIKTLDQHIEVIEGE
                     LHLEKFKIKTLPPTTSFTRYIKNIKARIKSLMSVSTK"
     gene            <791229..>793340
                     /locus_tag="PVL30_003447"
                     /old_locus_tag="LELG_02606"
                     /db_xref="GeneID:5233414"
     mRNA            <791229..>793340
                     /locus_tag="PVL30_003447"
                     /old_locus_tag="LELG_02606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001525998.1"
                     /db_xref="GeneID:5233414"
     CDS             791229..793340
                     /locus_tag="PVL30_003447"
                     /old_locus_tag="LELG_02606"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526048.2"
                     /db_xref="GeneID:5233414"
                     /db_xref="PFAM:PF00226"
                     /translation="MRISLSWIFNCSLLASTVVCGPLWDELQKRHDSVQSLFATEGPS
                     ASVLQEFDKLVRNLWDATEKEVAVKEEIEKLMPQILFKKAIMEMNLNKDSLAIEDLEK
                     VLELDPSMQPARNKLVDLLVSRGDFDKLEKFLKVHKEQFVELGELVNLYKVHWSQAKN
                     DFQDAKYNSCIDQLNQIISMSSSNYELYKLYLDAMLELYREDKSQRFTFLDDADMPIN
                     KIVISLFAKLLRLQPLKDLELYEKYSSFQLYTEVDFDSASKTIKNCLRIDNEFKSCGD
                     LSKFYSRFADALKALETYSILHGHLYRESENNEQSKIDEDDLNNFKIDFKFVNQFLFK
                     DDLKVSKMELKRLGGVKFANNYEYLQYRGNQFVQEFSKSGAGTSAGSSAGGNNDDISY
                     LEYLLRLGCESCVEIGDYKASHKICAKVKDSKEHPFLPKHIPKIDKLLKQKKYSQADQ
                     ELRSFSSNVKMTKLFTDRAAQVNEYRQKINRQRQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQYQQQQQQQRQFWHPSKKPAHDYYKILEIPRDADDKTIRKAYRMQT
                     LKYHPDKYKGKDLTPEQIEKKMQNINKAYEVLSDKELRERYDRGDDPNDPMNTAQSQP
                     QWQRQQYSNSHGQEGFAFNFGSGMGGGDAHNFFQQFFGGMGGNANQGAGARNGNPFGG
                     SFNQHQKVKIKKNRKKSKTKA"
     gene            <794191..>795909
                     /gene="APE3"
                     /locus_tag="PVL30_003448"
                     /old_locus_tag="LELG_02607"
                     /db_xref="GeneID:5233433"
     mRNA            <794191..>795909
                     /gene="APE3"
                     /locus_tag="PVL30_003448"
                     /old_locus_tag="LELG_02607"
                     /product="Aminopeptidase Y"
                     /transcript_id="XM_001525999.2"
                     /db_xref="GeneID:5233433"
     CDS             794191..795909
                     /gene="APE3"
                     /locus_tag="PVL30_003448"
                     /old_locus_tag="LELG_02607"
                     /note="MEROPS:MER0001288"
                     /codon_start=1
                     /transl_table=12
                     /product="Aminopeptidase Y"
                     /protein_id="XP_001526049.2"
                     /db_xref="GeneID:5233433"
                     /db_xref="PFAM:PF02225"
                     /db_xref="PFAM:PF04389"
                     /translation="MKITFLTAVAAALVTLPNANAFPALRFWNNVLSTTTGMDDSILI
                     DVKEAPQHEFAGSGFTKDVASGNEEVYNVDFESFQQENILDESVYKKLPEIDTEELQS
                     LVNKKGLRERAETLFNLAGKSNETYGHPTRVIGSPGHFATVHYIIKELRKLGGYYNII
                     TQSFKAIDGHVESFSLLIDGIKPKSLQALALTPPTPNKAPVHGDLVLVLENGCSLHDF
                     PSNAKDNIVLIQRGQCSFGDKSRNAGKVGALAAVIYDSNGPLSGTLGTPNGEEVPTLA
                     VSEKDVADYIDKLQKNPNHKFETTLFIDSYVKNISTLNVIAETKFGDHNNVVALGAHS
                     DSVGEGPGINDDGSGTISLLEVAKYLTKFKINNAVRFAWWAAEEEGLLGSDYYANNLS
                     EEENSKIRLFMDYDMMASPNYEYGIYDANNKDHPDGSGNLKDLYVDWYEQHGLNYSLM
                     AFDGRSDYVGFIDNGIPAGGIATGAEGVKDKKSKEKFGGKVGEWFDPCYHQLCDDLSN
                     PSYEAWEVSTKLIAHSVAVYAKSFEGFPTRKSKKESMPEAEEASIEQNSITQSQFIRK
                     GDKFII"
     gene            <797524..>798135
                     /gene="RGI1"
                     /locus_tag="PVL30_003449"
                     /old_locus_tag="LELG_02608"
                     /db_xref="GeneID:5233132"
     mRNA            <797524..>798135
                     /gene="RGI1"
                     /locus_tag="PVL30_003449"
                     /old_locus_tag="LELG_02608"
                     /product="Respiratory growth induced protein 1"
                     /transcript_id="XM_001526000.1"
                     /db_xref="GeneID:5233132"
     CDS             797524..798135
                     /gene="RGI1"
                     /locus_tag="PVL30_003449"
                     /old_locus_tag="LELG_02608"
                     /codon_start=1
                     /transl_table=12
                     /product="Respiratory growth induced protein 1"
                     /protein_id="XP_001526050.1"
                     /db_xref="GeneID:5233132"
                     /db_xref="PFAM:PF10843"
                     /translation="MSGKKKSKSDTVPLDLDNIKPLDHLQAVPKTRKMSMTSIESADE
                     PGGFKEVLLPPTIKEFDELEQFEAFVRDETWDNDFDYFHGRLHYYPPFVLKECHDEIE
                     KIKPTSNKNSSKFKRNLQHHIKKHLIKDLEKCCGYELNFDKAEEIESFDKLTWKFKDE
                     TDHGFSKEEEDKYDRHWKIELDITSHNDSALVDIDMKSIPIGH"
     gene            complement(<798606..>799733)
                     /gene="EAF3"
                     /locus_tag="PVL30_003450"
                     /old_locus_tag="LELG_02609"
                     /db_xref="GeneID:5233063"
     mRNA            complement(<798606..>799733)
                     /gene="EAF3"
                     /locus_tag="PVL30_003450"
                     /old_locus_tag="LELG_02609"
                     /product="Esa1p-associated factor"
                     /transcript_id="XM_001526001.1"
                     /db_xref="GeneID:5233063"
     CDS             complement(798606..799733)
                     /gene="EAF3"
                     /locus_tag="PVL30_003450"
                     /old_locus_tag="LELG_02609"
                     /codon_start=1
                     /transl_table=12
                     /product="Esa1p-associated factor"
                     /protein_id="XP_001526051.2"
                     /db_xref="GeneID:5233063"
                     /db_xref="PFAM:PF05712"
                     /db_xref="PFAM:PF11717"
                     /translation="MVSYSPNQIVYAYHGPLIYEAKIIKTKQATESFVLNNDNQQETF
                     EQQGAKFDAAKWDGLNCFLLHYQGWNAKWDEWVGEERVLEINEENKFKKLELEQLTKK
                     KKVKKEESTKSSGNGKGGSKSGSKSRGEGGSRSGNGNGNSSSSSSSSNGGGGNASKRQ
                     RTSGSGSSNASSNSSNGGGGGGGESRRKTSNINLKFPPELKYVLVNDWQYITKDKKLV
                     KLPSNNYSVHTILQDYRNSRKEVLDKHQLGILLEILHGLEIYFNKSLSLLLLYKHENL
                     QYLDFLKRNVISYSQYQPGDAEGSSSRSHCQSKVYGFEHLLRLLVSFPSLISQTTMDS
                     LSISVLVSELEHLLVFLKDNMGKYQNEYEYQSPQYNSLATS"
     gene            <801302..>802663
                     /gene="CK1b"
                     /locus_tag="PVL30_003451"
                     /old_locus_tag="LELG_02610"
                     /db_xref="GeneID:5233373"
     mRNA            <801302..>802663
                     /gene="CK1b"
                     /locus_tag="PVL30_003451"
                     /old_locus_tag="LELG_02610"
                     /product="casein kinase I"
                     /transcript_id="XM_001526002.1"
                     /db_xref="GeneID:5233373"
     CDS             801302..802663
                     /gene="CK1b"
                     /locus_tag="PVL30_003451"
                     /old_locus_tag="LELG_02610"
                     /codon_start=1
                     /transl_table=12
                     /product="casein kinase I"
                     /protein_id="XP_001526052.2"
                     /db_xref="GeneID:5233373"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSQSSSIVGVHYKVGKKIGEGSFGIIFEGINILNNQQVAIKFEP
                     RKCEAPQLRDEYRSYRILNNTRGIPQAYFFGQEGVHSILIIDLLGPSLEDLFDWCHRK
                     FSIKTVLQVSKQMIQRVESIHEHNLIYRDIKPDNFLIGRPDTAEANNIFVVDFGMAKQ
                     YRDPRSKNHIPYREKKALSGTARYMSINTHLGREQSRRDDLESLGHVFMYFLRGSLPW
                     QGLKAPTNKQKYEKIGMKKQTTPINELCYGLPIQFAQYLTYVRNLKFDEDPDYKYLIG
                     LMDKAMATLGIEEDGHYDWMDLNNGRGWDAALNKKANLHGYGNPHPARKAHQVQHNNH
                     NTYSHQQQQSSSHQPLLGRASASYDNSRYKKHGYQAIQQQQQQQQQQQQPDKFSQSIL
                     AIHNEQNRFMKNGGGNRDRDRNGEEADMRNSGNRDLIGDTLHSDTSSFNRKKSRSCFF
                     CCW"
     gene            complement(<803189..>803569)
                     /locus_tag="PVL30_003452"
                     /old_locus_tag="LELG_02611"
                     /db_xref="GeneID:5233302"
     mRNA            complement(<803189..>803569)
                     /locus_tag="PVL30_003452"
                     /old_locus_tag="LELG_02611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526003.1"
                     /db_xref="GeneID:5233302"
     CDS             complement(803189..803569)
                     /locus_tag="PVL30_003452"
                     /old_locus_tag="LELG_02611"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526053.1"
                     /db_xref="GeneID:5233302"
                     /translation="MPDLFDNIFSRVHAKFNGGHTKPRYDGGSQVNSGKFYSYHSTPN
                     NNNYWLPRNAVKEEQMRKGSVSSEQGDMTMMGGGAVSGSLDSADDKQPFVGQKVGAFD
                     KDSMPIVDDSQLNRSRFNSVASEE"
     gene            complement(<805039..>805947)
                     /locus_tag="PVL30_003453"
                     /old_locus_tag="LELG_02612"
                     /db_xref="GeneID:5233588"
     mRNA            complement(<805039..>805947)
                     /locus_tag="PVL30_003453"
                     /old_locus_tag="LELG_02612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526004.1"
                     /db_xref="GeneID:5233588"
     CDS             complement(805039..805947)
                     /locus_tag="PVL30_003453"
                     /old_locus_tag="LELG_02612"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526054.1"
                     /db_xref="GeneID:5233588"
                     /translation="MGYPTNLKITTKSLTENILLASTAFTRFDRINFGARMAILKFPA
                     TTTPVANANANAGATAGADTNVGVGVGVAGDKSSRERVVIWSPLPYSPQVLEVIQKFT
                     GAKTEADIRIDYVIVPDREHNMAASVFKEKFPQAKIIGPEKTEKVDLDVVFTESLGNK
                     VIAGEDLRKLIDDDVIVDNFEFVYLPYHANSELVAVEKKSKVLFEADLLFNLGAKNEQ
                     QEQFSPATGYPENYNPHTGWSYPTRYLHPYSKVGKYMFNKIVNKAQSKAGLEAIGALD
                     FNAIVLCHGNIITKNAKEAFKHVFLS"
     gene            complement(<808112..>810736)
                     /gene="STP3"
                     /locus_tag="PVL30_003454"
                     /old_locus_tag="LELG_02613"
                     /db_xref="GeneID:5233043"
     mRNA            complement(<808112..>810736)
                     /gene="STP3"
                     /locus_tag="PVL30_003454"
                     /old_locus_tag="LELG_02613"
                     /product="Zinc finger protein"
                     /transcript_id="XM_001526005.2"
                     /db_xref="GeneID:5233043"
     CDS             complement(808112..810736)
                     /gene="STP3"
                     /locus_tag="PVL30_003454"
                     /old_locus_tag="LELG_02613"
                     /codon_start=1
                     /transl_table=12
                     /product="Zinc finger protein"
                     /protein_id="XP_001526055.2"
                     /db_xref="GeneID:5233043"
                     /translation="MAIISIGLFKDHNQVFDEVYTIKSTPPLSSTSTSSTSSSQKNKS
                     NTNTTTGTYANTPLEAAPLFNSTIYNSFTSLHILKKHKFSVYKFIHRLIHGTKRLNEL
                     FPAIDNVNFLNNSKKFSSASPATATATATATSTATSTRLPLSFPKPCAVDDLDFMFEG
                     DNANQIQIFDNVHTTDDFGAHEFHQFDKNAFYENLQTPLFQQQQQQQQQQQQQQQQQQ
                     QQQQQQVNSQYHPQSIPTSAPKSNITIPEFDDFYEAHQHQHQHHFAAQDLNKSLPIQV
                     ASNNHNFNEHIFERNVGGRSKYKMNVFDIIQKSTVVFSPKTQGTTSQSRDAHFAHDGR
                     FVETSQQQQSYNPQHQHQHQHQHHHFAQYQQQQVEQQVEQDPHSYLHPHSPPPFFEDF
                     NSFNEPDASQNKRQNNGHNDHNSVISNSNSNTNFHNHDPEFSSVSSSESFLSPLDDEF
                     FGKFKQSNHMNTRLQPQTEQQSSLLTIDFAQPQTESRKRRYESSSISTPSSSQIDSDI
                     PVSPTTAATTTTKTTTTTTAAAAATIVIKSKKLKTSLNRQVKPLKSKSRTSSSSSSSS
                     SGMGIGTGTGPSRGSAVPVALARRNNTEFDNKLDGKLDALNTATVTTTTTTTNNTTVR
                     KLSFTSKNGKVDHIFECPHCESHFTVKGYLTRHLKKHSLAKAFSCPFYQDTTTDSTAS
                     KSGNGSNNNNINSSNGFALSGTKCHPTGGFSRRDTFKTHLKALHFIYPPGTKSNDRGL
                     YSGRCAGCFQFFENNTQWLENHIESGECQGTVAMKEKLRRQLETECGNEENDEVATFV
                     ESMGLKVQGTGQVGAQDETQVQAETETETETDAKGETTNGNNDTEKNAANGYKSKSEF
                     DAELRHHASHYIKQEVID"
     gene            complement(815204..815277)
                     /locus_tag="PVL30_003455"
                     /old_locus_tag="LELG_06047"
                     /db_xref="GeneID:5233088"
     tRNA            complement(815204..815277)
                     /locus_tag="PVL30_003455"
                     /old_locus_tag="LELG_06047"
                     /product="tRNA-Val"
                     /db_xref="GeneID:5233088"
     gene            complement(820330..820403)
                     /locus_tag="PVL30_003456"
                     /old_locus_tag="LELG_06048"
                     /db_xref="GeneID:5233236"
     tRNA            complement(820330..820403)
                     /locus_tag="PVL30_003456"
                     /old_locus_tag="LELG_06048"
                     /product="tRNA-Val"
                     /db_xref="GeneID:5233236"
     gene            <823351..>826167
                     /gene="PHM7"
                     /locus_tag="PVL30_003457"
                     /old_locus_tag="LELG_02614"
                     /db_xref="GeneID:5233099"
     mRNA            <823351..>826167
                     /gene="PHM7"
                     /locus_tag="PVL30_003457"
                     /old_locus_tag="LELG_02614"
                     /product="phosphate metabolism protein 7"
                     /transcript_id="XM_001526006.1"
                     /db_xref="GeneID:5233099"
     CDS             823351..826167
                     /gene="PHM7"
                     /locus_tag="PVL30_003457"
                     /old_locus_tag="LELG_02614"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphate metabolism protein 7"
                     /protein_id="XP_001526056.2"
                     /db_xref="GeneID:5233099"
                     /db_xref="PFAM:PF02714"
                     /db_xref="PFAM:PF12621"
                     /db_xref="PFAM:PF13967"
                     /db_xref="PFAM:PF14703"
                     /translation="MAEQASTNSSASQFVSTLVPTLVIAAVYVIIFLIIRNRQKRVYE
                     PRSIVKSLPNDLQTPPPATGAFSWLTSLLKKPETFIIQYAGADGYFFLRFLFEFGVIC
                     LLGAIVTWPILFPVNATNGNNNQPGSTVAGFDILTIANVRNKWRTFAHVFLSWILFGL
                     VIFLIYRELVYYTTFRHVLQTTPLYDSLLSSRTMLLTEISTTKLTDSTLREYFPTATN
                     IWYAREYKKLGKEIEERTKLANKYEGALNKVLTKSVKLRNKCLKKNKPAPEPVDDLNK
                     YLKDGKKRPTHKLKFLIGKKVDTLNYGAERLGELNKSVAKQQAEFQAQEQLPAVFIEF
                     PTQLELQKAYQAIPYNKDFKGVKRLINVAPDDIIWKNLQLTPMKRRIKKVLANTFLTL
                     LIIFWCIPVAVVGAISNINFLTEKVPFLKFINNMPKVIMGVITGLLPVVALAVLMSLI
                     PPVIKWMGRISGRLSVQQVDEYCQTWYFAFQVVNVFLAIALGSSAASVAQEIVKDPGS
                     AMQQLSQRFPPSVNFYYSYLCLQGLTISSGTLLQIVALILSHILGRILDSTPRAKWNR
                     WNTIGQPGFATLYPGFSLLTVIALAYSVIAPLILGFTAIAFAAFYFAYIYTLVYVMRP
                     VTTEARGKNYVKSLFHLFTGLFLAQLWITALFVFTKNWACVALEAVIIIVTIAARWWM
                     KRRFLANIDAVPISAIKYAAGDTTYAYPMYDQGYKEIRSEGQNYWEGGNQLGLTPGDG
                     GLDQVVADRNPAAGAPASAQRDNLTVGDADYSTMGETKVGKFDSEKASTNVDTGRASS
                     VTGGPFQEPNSNDEEKGGFSKKNAVSGAAGAPGKGVSWLKIFFKPKTQTFDMIRNIMP
                     NTYFNYVEYNPEFVRHAYDDPNVSAEAPHIWIARDPMGLSEIEKNKALKEGVDVSDDN
                     ATFNDKSQIVFSGPPPTYEEAIRV"
     gene            827396..827469
                     /locus_tag="PVL30_003458"
                     /old_locus_tag="LELG_06049"
                     /db_xref="GeneID:5233162"
     tRNA            827396..827469
                     /locus_tag="PVL30_003458"
                     /old_locus_tag="LELG_06049"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:5233162"
     gene            827486..827558
                     /locus_tag="PVL30_003459"
                     /old_locus_tag="LELG_06050"
                     /db_xref="GeneID:5233229"
     tRNA            827486..827558
                     /locus_tag="PVL30_003459"
                     /old_locus_tag="LELG_06050"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:5233229"
     gene            827577..827650
                     /locus_tag="PVL30_003460"
                     /old_locus_tag="LELG_06051"
                     /db_xref="GeneID:5233543"
     tRNA            827577..827650
                     /locus_tag="PVL30_003460"
                     /old_locus_tag="LELG_06051"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:5233543"
     gene            827667..827739
                     /locus_tag="PVL30_003461"
                     /old_locus_tag="LELG_06052"
                     /db_xref="GeneID:5233198"
     tRNA            827667..827739
                     /locus_tag="PVL30_003461"
                     /old_locus_tag="LELG_06052"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:5233198"
     gene            complement(<828138..>831020)
                     /locus_tag="PVL30_003462"
                     /old_locus_tag="LELG_02615"
                     /db_xref="GeneID:5233296"
     mRNA            complement(<828138..>831020)
                     /locus_tag="PVL30_003462"
                     /old_locus_tag="LELG_02615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526007.2"
                     /db_xref="GeneID:5233296"
     CDS             complement(828138..831020)
                     /locus_tag="PVL30_003462"
                     /old_locus_tag="LELG_02615"
                     /note="MEROPS:MER0001911"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526057.2"
                     /db_xref="GeneID:5233296"
                     /db_xref="PFAM:PF04389"
                     /translation="MADNNSSSGSSVIDEQDYDVHEAGQQGQQGQQKHQQRQQERPSL
                     ITRVFRSVFGYRKTSLSLFVVATIALCVSLSYIDNSVDFISFPTVESEVNLLNAAWSD
                     LQVIAKEQHPYGSIGNDRVHDFLERRIQELITGANFITWDNDINGNNSFMFESSSNPK
                     TVSYYESNNLLVKIEGKNAKLPGILLSSHFDSVPTSYGVTDDGMGVASMLGILNYFSQ
                     QKKQPERTIVMNFNNNEEFGLLGATAFTRHPWFKLVKYFLNLEGTGAGGKAILFRATD
                     YGIAKYFQNVRTPYASSIFQQGFANGLVHSETDYKVYKEAGMRGLDLAFFKPRDYYHT
                     AEDNIRRTSEKSLWHMLSNSLDFIDYLSKDKEFGMNLEEKPNLLEEPAVFASFLNYFF
                     TISTSQLFKINVALLTVFPILNGLLLLYTIRSRKWQVSFSSAISIPVALLVTMFIVVY
                     LVVESYKSFNQYLPSSRPLLLVATITSISLLVFSIILVAFSFFSIIAEENLRLLAIVE
                     LSFAYWVGLAFTTHGLSGAESARHSGEFAVSILFTLEAVASFLGLIGWSLCRNRSHLQ
                     VAEGESVPLLNGIDARYSSDNDHDHEHRHGHEDNEHGEAHVQQQSQSRHKKQCKETVH
                     SFGYDWSLQYLITVPLSIFIIYNSGWLVLEGVNKTLQESAKAETFVYNLLWIVSVSLV
                     LPLIPFAGKLNRYMVFVLIAIGVLGTLLVHVVQPFNEANPLKLRFLQRIDGKNNASSV
                     HVYARKGLATEVLEQLPSVRQSNETIHCSQLADGMEDCSFVSALAPQILPGYELGNYI
                     EVTNNGSAPSQLFGVNYNQIKIVALKSQSCSLHFGDSKVKAVVVGSSLESAPAFKHLP
                     SGYSFNKDHFYKDTSGIWNLTLNKLDSHSSFDISLYWLPGIDDEANTLQFDVECFWAD
                     LSPVALNNTVFEAIPAFNEVQQYSPISVSWANREKGLVAYTKQVHV"
     gene            <831630..>832712
                     /gene="HEM12"
                     /locus_tag="PVL30_003463"
                     /old_locus_tag="LELG_02616"
                     /db_xref="GeneID:5233638"
     mRNA            <831630..>832712
                     /gene="HEM12"
                     /locus_tag="PVL30_003463"
                     /old_locus_tag="LELG_02616"
                     /product="Uroporphyrinogen decarboxylase in heme
                     biosynthesis"
                     /transcript_id="XM_001526008.2"
                     /db_xref="GeneID:5233638"
     CDS             831630..832712
                     /gene="HEM12"
                     /locus_tag="PVL30_003463"
                     /old_locus_tag="LELG_02616"
                     /note="BUSCO:EOG09262JZK"
                     /codon_start=1
                     /transl_table=12
                     /product="Uroporphyrinogen decarboxylase in heme
                     biosynthesis"
                     /protein_id="XP_001526058.2"
                     /db_xref="GeneID:5233638"
                     /db_xref="PFAM:PF01208"
                     /translation="MSDFAPLKNDLILRAAKGEKVERVPIWIMRQAGRYLPEYHEVKG
                     NKDFFQACQDAETASAITIQPVDHFDGLIDAAIIFSDILVIPQAMGFEINMVEGKGPV
                     FASPLRSPDDLARIDLNPDVKVKLDWAYKAITLTRKKLDGRVPLLGFVGAPWTLLVYM
                     TEGQGSKMFRFAKQWIFEYTEAAHKLLQATCDACIEFLAQQVVAGAQMLQVFESWAGE
                     LSPADFNTFSLPYLKQIASRLPKRLSELGIKEKIPLTVFAKGAWYALDDLCNAGYDTV
                     SLDWLYDPKAARKVVGDRRITLQGNLDPGVMYGSDDVIDQKVKEMISGFGKENYIINF
                     GHGTHPFMKPEKIERFLKSCHKYGTA"
     gene            <833013..>834911
                     /locus_tag="PVL30_003464"
                     /old_locus_tag="LELG_02617"
                     /db_xref="GeneID:5233348"
     mRNA            <833013..>834911
                     /locus_tag="PVL30_003464"
                     /old_locus_tag="LELG_02617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526009.2"
                     /db_xref="GeneID:5233348"
     CDS             833013..834911
                     /locus_tag="PVL30_003464"
                     /old_locus_tag="LELG_02617"
                     /note="BUSCO:EOG09262BCZ"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526059.2"
                     /db_xref="GeneID:5233348"
                     /db_xref="PFAM:PF18826"
                     /translation="MVQTYIYSLTKEFLDSLELLYFDIETHKVVKAPEAEVSESGKQN
                     NVIKDKQYYKSDLHRYNLKRAQNDLEPINEDEFNKLLEAESAESASEDSDEYSDTGSD
                     TGSEHIGSDTDGDDDSETEGEWNLKEGGSIDAELSHSRKAKKVESLLRKLHTKDILPE
                     EVSSGSHLHTRSPMVLFSSSAVPTDKVVMFYKALFTEAELKAPLESLKRFQNNGDART
                     GKSAIFMLGGGHFAGAVISHEPVKVKGQLLNEELPYSQKIQSINVLESKTFHRYTTRR
                     KQGGSQGASDNSRGKAISAGSSIRRYNEQALAKEVRELLETWRDHLRECDSIYIRANG
                     PTNKKVILGYEEAPLAVGDPRVKKVPFSTKRASLSEIKRIWVELSNLKVSDFPKVETK
                     AKATSLSPSPSPSPSLSRPSSPAAVNSSISNARTESSKSPQKQDPLTEELLSALKRQK
                     APAFVKLIKEHSIDVDSFSLSISDNNAPSLLHFASANDLAHMVQVLLVNLKASPLVVN
                     KTGKYPAEVSRSNAKRAFQIARSKLGEAAWDWNKAKVLPAKTKEEFDKEAETKEAEMK
                     KEKLDIMKKLQEKEAQENEAAQAKVPQSKSPIPPVSRMSGLNAEQKNRLMREQRARAA
                     EARLKRQT"
     gene            complement(<837850..>840288)
                     /gene="VPS70"
                     /locus_tag="PVL30_003465"
                     /old_locus_tag="LELG_02618"
                     /db_xref="GeneID:5233061"
     mRNA            complement(<837850..>840288)
                     /gene="VPS70"
                     /locus_tag="PVL30_003465"
                     /old_locus_tag="LELG_02618"
                     /product="Vacuolar protein sorting-associated protein 70"
                     /transcript_id="XM_001526010.2"
                     /db_xref="GeneID:5233061"
     CDS             complement(837850..840288)
                     /gene="VPS70"
                     /locus_tag="PVL30_003465"
                     /old_locus_tag="LELG_02618"
                     /note="MEROPS:MER0015691"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar protein sorting-associated protein 70"
                     /protein_id="XP_001526060.2"
                     /db_xref="GeneID:5233061"
                     /db_xref="PFAM:PF02225"
                     /db_xref="PFAM:PF04253"
                     /db_xref="PFAM:PF04389"
                     /translation="MKAKKEMEMEKVKEQTMEMEMEKDTKTKPNRHLQQVSQERIANA
                     HGGPLKLLLIGGLLYLFYRLFAISTPPSIGNLALVEPAQIVLDALESNYARNWSQKYT
                     AEAHLAGTNYPLVEWTEQKFSEYGFDTTIDSYEILASYPKDHSLSLLDKHEQIVYTAP
                     LKEDSIDEDPTTHNNTVPTFLGYAANGNVTAQYVYANYGTKSDFEALKEHNVDVTGKI
                     VVVRYGKIFRGLKVKFAQDRGAVGVLIYSDPGDDFGITPKNGYKQYPHGPARQESSVQ
                     RGSVQFLGGEGSAPGDPTTPGYASKPGVERKDPHTSIGKIPVLPISYREVKPILQKLN
                     GKGAKVKGFEGELDGFEYTTGPSEYSLNLYSDQDFKYATMWNVYGEIKGEKADEVIIL
                     GNHRDAWIKGGAGDPNSGSATLLEVARALGTLKAKGHKFKRTIVLHSYDGEEYGLLGS
                     TEQGEYFAKKYQREVVAYLNLDVSVSGKNLGLGSSPVLNNLLLDVAKELEYPEGGSLY
                     DHYVKVHGSDAIKSLGSGSDYTVYLEHLGIPSVDLGFGGGKKDPIYHYHSNYDSFHWM
                     EKFGDKNFVYHNLAAKYLALLALRLSEKEVIQFRLESYASNLIDYFEKTSQRVPAEWL
                     NKTTAFSDYRGSHLLDEDTFIRDVTQSQYTCPMRKKQQMRLTHGLNCFEAKKTATLGQ
                     RLDQTLHLLHGFQKSAQAFDEKSLHLQDQADNYLNLSLPGKIWLHLKIRKHNRSLKYF
                     ERNFLHHEGLDTRPWFKHILFASGRFTGYAGQDLPGLNEAIEDGDLGRLSKWIGILDR
                     TVHRVSHHLHQRVI"
     gene            complement(<841287..>844569)
                     /locus_tag="PVL30_003466"
                     /old_locus_tag="LELG_02619"
                     /db_xref="GeneID:5233032"
     mRNA            complement(join(<841287..844216,844383..>844569))
                     /locus_tag="PVL30_003466"
                     /old_locus_tag="LELG_02619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526011.2"
                     /db_xref="GeneID:5233032"
     CDS             complement(join(841287..844216,844383..844569))
                     /locus_tag="PVL30_003466"
                     /old_locus_tag="LELG_02619"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526061.2"
                     /db_xref="GeneID:5233032"
                     /db_xref="PFAM:PF00172"
                     /translation="MSNNLNNYNNNFGNHSINNYNHHPEPLDPSAYIADRTDHTHHPI
                     PPRTKERKSRRSHKNSRDGCPNCKQKRIKCSEELPSCSNCIKKNYHCGYLDYPKEKLD
                     ALRRKHAQIASEEMEEGASEGISSSNEQPIVTASGKRRRPSAAVALTTSQNVPNTSLN
                     NGGNSVLGDKSYNNTTNVTSKFEPFHNSAPDTFPNKTKRMRLGPALQHYDSTSLQVPP
                     NFAESNTRELFQGFSTTITPPTSNKAVSLNSSPFSESPNNTNELFKNYSASKIPNVSE
                     NDTTPPNLFIPMQESEWDKLLNVPLEDVDLNLALYKDAMSKLSSSQGLHLPETFGNGR
                     KQPKWGQVGRHGVSTLNGTANEANIVDTDAVKYSITNTDPNTNTNATTDADADANADA
                     NANANTDTDTDTKAKTDVQDFDTRSVDSFENSTSIFNQHFGINIYELSAPERSDLSRK
                     IDMDKALPNAILCLKTFPTLKRSQSLHPLFTKGSSKCKWTYNCSMSLSNPDWTLEDDK
                     KMWMSNFTQALVLHFIFFTFFMDRSLNVILKVCNKSISSTSSTTCFTPEIQKILTKKS
                     YSYFGNLIKDLRESIAGVDIESSTIISWLSGWSRFSHTQASAKAVTLFHAGSASLLWN
                     CLDRYTGFEEISPTLQFIIFALRNHTSTAVAPDYKFDVIAELHTNLVQFKTFINYNPE
                     LTSQRNGYIIKNFLALESFLNDLITTLYPRFLQIDKYFKTKNGDTDTESGIRYFSPSL
                     LYEFINRWLKLIPSYSRSMGSEMSPLKRTFYLFYVATAKALSNVFPIIRSTYLIDTWN
                     AIYPQVDFNYKLFAYSRSDVADDSQYHYLTNLSAKLLRIIKFFNTRQQIISHYMSSTS
                     ILETGGQYLESVAAEGPIIDGQQFSGIVHLKPAKIDFKEIMITNFSINTIVNIYNYPL
                     LINFGAHLNGRTEEYRKIIEHENHNQKVRIHEYRQKYEGLSGGNQPLYEDGFFTNINH
                     SYEFDFSRGMYSFDYKVEPAVNYFYKYLEKAHAGKQLSLNQLKDEIQNFEAAQKALFG
                     SMDEPNGV"
     gene            846602..846674
                     /locus_tag="PVL30_003467"
                     /old_locus_tag="LELG_06053"
                     /db_xref="GeneID:5232976"
     tRNA            846602..846674
                     /locus_tag="PVL30_003467"
                     /old_locus_tag="LELG_06053"
                     /product="tRNA-Val"
                     /db_xref="GeneID:5232976"
     gene            complement(<846962..>847987)
                     /gene="MDH2"
                     /locus_tag="PVL30_003468"
                     /old_locus_tag="LELG_02620"
                     /db_xref="GeneID:5233587"
     mRNA            complement(<846962..>847987)
                     /gene="MDH2"
                     /locus_tag="PVL30_003468"
                     /old_locus_tag="LELG_02620"
                     /product="malate DEHYDROGENASE, NAD-dependent"
                     /transcript_id="XM_001526012.2"
                     /db_xref="GeneID:5233587"
     CDS             complement(846962..847987)
                     /gene="MDH2"
                     /locus_tag="PVL30_003468"
                     /old_locus_tag="LELG_02620"
                     /codon_start=1
                     /transl_table=12
                     /product="malate DEHYDROGENASE, NAD-dependent"
                     /protein_id="XP_001526062.1"
                     /db_xref="GeneID:5233587"
                     /db_xref="PFAM:PF00056"
                     /db_xref="PFAM:PF02866"
                     /translation="MVKVTVAGAAGGIGQPLSLLLKLNTNVSELALFDIVNAKGVAAD
                     LSHINTPAKVTGYQPENKEDKTAITEALKGTDVVIIPAGVPRKPGMTRADLFNINASI
                     IRDLVANIARTAPKAAILIISNPVNSTVPIAAQVLRKLGVFDPTKLFGVTTLDSVRAE
                     TFLGELTNTNPQKLKGKISVIGGHSGDTIVPLINYNSSVPVLNKSQYDEFVHRVQFGG
                     DEVVKAKNGAGSATLSMAYAGYRFAEYLIDTLSGGPNNYKVPDSAYIYLPGIEGGKEF
                     SAKYLGGIEFFSVPVVLNHGQTVSFINPFEQLRVSEDENKLIKVALNGLKGSIDQGVE
                     FVNASKL"
     gene            <849270..>850082
                     /gene="ATG27"
                     /locus_tag="PVL30_003469"
                     /old_locus_tag="LELG_02621"
                     /db_xref="GeneID:5232914"
     mRNA            <849270..>850082
                     /gene="ATG27"
                     /locus_tag="PVL30_003469"
                     /old_locus_tag="LELG_02621"
                     /product="type II membrane protein"
                     /transcript_id="XM_001526013.2"
                     /db_xref="GeneID:5232914"
     CDS             849270..850082
                     /gene="ATG27"
                     /locus_tag="PVL30_003469"
                     /old_locus_tag="LELG_02621"
                     /codon_start=1
                     /transl_table=12
                     /product="type II membrane protein"
                     /protein_id="XP_001526063.2"
                     /db_xref="GeneID:5232914"
                     /db_xref="PFAM:PF09451"
                     /translation="MLNRLLIFITLALAVRALDCSAKELQQYNLESVKGTYSISNIKS
                     TPPSKTNITWSIGICEPIKDVADCPQNSDVCGITSILIDGKSPVVSEIIGFNSNVQKE
                     YETIAEGDGGIIVKDKAVNWGDSLIDAEIHFICDKNAKENDLKLDKWDGQSVKLSFKS
                     KAACITSDKDKKKNNGNNNDNNKNNDKKKDNGESWGWFTWIFIFLVLFLSIYIVGGAW
                     FQYNKGNAIDFQSALKEVIENFIDLLKSLPSFIREIIERFTGSSGRAEYSAV"
     gene            <850359..>852227
                     /gene="MET12"
                     /locus_tag="PVL30_003470"
                     /old_locus_tag="LELG_02622"
                     /db_xref="GeneID:5233589"
     mRNA            <850359..>852227
                     /gene="MET12"
                     /locus_tag="PVL30_003470"
                     /old_locus_tag="LELG_02622"
                     /product="methylenetetrahydrofolate reductase 1"
                     /transcript_id="XM_001526014.2"
                     /db_xref="GeneID:5233589"
     CDS             850359..852227
                     /gene="MET12"
                     /locus_tag="PVL30_003470"
                     /old_locus_tag="LELG_02622"
                     /codon_start=1
                     /transl_table=12
                     /product="methylenetetrahydrofolate reductase 1"
                     /protein_id="XP_001526064.2"
                     /db_xref="GeneID:5233589"
                     /db_xref="PFAM:PF02219"
                     /translation="MSKVKDLILSLGPDEKFISFEFFPPKTDSGFRNLLARLNRLSAF
                     NPLFITVTWGAGGSTSEKSLDLAATCQNKIGINTVLHLTCTNTDKEIIDSALARAKAN
                     GIRNILALRGDPPRTEEYWTPNCEFNNAVDLVKYIRQQYGDYFCIGVAAYPEGHVDGA
                     DTANQDPRKDIPYLVEKVKAGADFIITQLFFDADKLVTFQKMLQSTPELKDIPLIPGL
                     MPVTTYKVFTRATKLSHATIPRPILHEFETIKNDDDAVKQLGVDLICDIIDRIDEHTN
                     IKGYHFYTLNLEKAVASIMNQSQVLRGVLEGPSTSSEISKNEDAIASDSEDESPKHFR
                     RRSSVNEVARGSLSFHRQKDKKSIVDISRGKGALGKDATWDDFPNGRFGDSNSPAYGE
                     IDGYGPSLKIHNASEAIAKWGSPTNIKELGQVFVDYLSGKIDVVPWADTSLSPETALI
                     QEELFELNQKGWFSVASQPAVNGCRSNDNVFGWGPGNGVVYQKSFVELFIPAKDWKEL
                     KPRLDDATTYYVGDKSGRIESSLFTNESTRHLKNAVTWGVFPSKEVVQPTVIDYESFK
                     AWNEEAFLLWLEWARCYKKNSKTYELLNSVRDNYVLVSLIHHEYHDESALWDLLMQ"
     gene            complement(<852439..>852987)
                     /locus_tag="PVL30_003471"
                     /old_locus_tag="LELG_02623"
                     /db_xref="GeneID:5232974"
     mRNA            complement(<852439..>852987)
                     /locus_tag="PVL30_003471"
                     /old_locus_tag="LELG_02623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526015.1"
                     /db_xref="GeneID:5232974"
     CDS             complement(852439..852987)
                     /locus_tag="PVL30_003471"
                     /old_locus_tag="LELG_02623"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526065.2"
                     /db_xref="GeneID:5232974"
                     /db_xref="PFAM:PF08585"
                     /translation="MSYVPSNYSETTSASLSHVVMFHVLWVENIAKSKVAQLDEWKDF
                     IDPHNASADRIKKSRVIREVRDEGDRDGEATEGDTAYIGNTNGTAIYKLLLRDGFNNF
                     SYAYEAEPLRFMRQENTGTPMPIRLGGRLIVKQGAPIKRGVLFLTHKNCEYKGINPAD
                     AALVRTLNDGAAARAIDLLSRG"
     gene            <853312..>856464
                     /gene="rad16"
                     /locus_tag="PVL30_003472"
                     /old_locus_tag="LELG_02624"
                     /db_xref="GeneID:5232956"
     mRNA            <853312..>856464
                     /gene="rad16"
                     /locus_tag="PVL30_003472"
                     /old_locus_tag="LELG_02624"
                     /product="DNA repair protein RAD16"
                     /transcript_id="XM_001526016.2"
                     /db_xref="GeneID:5232956"
     CDS             853312..856464
                     /gene="rad16"
                     /locus_tag="PVL30_003472"
                     /old_locus_tag="LELG_02624"
                     /note="BUSCO:EOG09260AZK"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein RAD16"
                     /protein_id="XP_001526066.2"
                     /db_xref="GeneID:5232956"
                     /db_xref="PFAM:PF02732"
                     /translation="MASLFVDEDTDLAADEAQEEIEQVEPTQQIQDDAQYTAEPDTIP
                     TRRSESPSSIPVTYQDDEIIPMYPEREVISALPLKYQQEIVEDMLTRDALLILGRGLG
                     WELITANLLHALSSPFVQLDKVKRKRSLVFILNAQEEEVMRLSEEIADLGWLNGETEE
                     LVILAGDSLSSKRKTAYQNGGVIAISARVLVVDMLSGMVDPNDITGLFVFHAERIRET
                     SNNAFIINLYRDKNKWGFVKAFSDEPESFSGFTPLATRMKVLRLSNVILWPRFHVTVT
                     QSFKYHKGNEARKFVTEVNVKLSYKMNRIQSALLACIQACLGEMKRHNPTLVTEHWDM
                     ENVHDPDFVKKVRHPLDSQWHRLTYTTKQLVGDLGVLIELLDALLTVDSVTFYQMIKS
                     IVDANVKQQSTGINRSMSPWLNLDESQTVISYAKDRALGTLEGSYVLEELPKWSHLGQ
                     LIDDAIYEKTLSQDDNRKGPILIMCSSRKVAKQLRRILLTMKSEHKSTTSFQCRSYMI
                     QKLNEYLYWKEINTLAKTINMELNKEATEQQQHQQQQQQQQQQQMEATEITMSKTFTR
                     NGQPISKRRRNRGGTIATRVEKLYSTGNTEDNEQEDIAIKAFVERNGRGEGEIGVADH
                     KRVRGSAKLETELEEGKEENGGKEEVEEVEEVEEVEKDEEDDDFEIEELHAHGGPGFE
                     YVDSDDQIIIQVYNEKYSASFLEELSPSFIIMYQPDLSFIRRVEIYQATRGVDAAQVY
                     FMYYGDSVEEQKHLLRIKKEKEAFTRLIKEKANLGKHFETSEDNYKFRIQKNHVVNTR
                     IAGGAHFRTERDEMRVVVDTREFGSSLPNLLYRIGIQVVPCMLTVGDYIVSPRICIER
                     KSIPDLISSFKSGRLYTQCEQMFRYYDLPTLLIEFDENKSFSLEPFSEAKFLKARTSS
                     SSSLDPKLRQNLQSQILSLLYSFPKLKIIWSSSPYETAQIFLELKANQEEPDVGKALD
                     KGVNKAVVTQDGGPPIYNDDPIDFIQNIPGINNLNCYALIQKVRNIEELVNLSEKEFT
                     DILGNENGRKAYAFLNRKLY"
     gene            <857260..>859719
                     /locus_tag="PVL30_003473"
                     /old_locus_tag="LELG_02625"
                     /db_xref="GeneID:5233022"
     mRNA            <857260..>859719
                     /locus_tag="PVL30_003473"
                     /old_locus_tag="LELG_02625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526017.2"
                     /db_xref="GeneID:5233022"
     CDS             857260..859719
                     /locus_tag="PVL30_003473"
                     /old_locus_tag="LELG_02625"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526067.2"
                     /db_xref="GeneID:5233022"
                     /translation="MEFKNHYFKLQQLINSRVHLSLKYDQLKSPEIHSALISPITKAA
                     IAICESQQQPNLKVSTHAIFTLLLIRYEYLIQSESNLICYDLLITKATVCEILAVRML
                     REYKSQQRVQMILWSCPLSISGIGSRGTRINTLELCVVSKSKLFLSQPIIVQILDRFY
                     NGKFVPIENCIQKDGAGGCDGGGKCKCRSGSGSGLGFGFGSEVGGNDGNNDDEKGLLL
                     GEEMMRKWRKRSSLKQIIAKVNTVPKYQNIVINSKLIAFATLYFLIIFKRQYPLLEWA
                     FWSFSLSLNIEMAMKLMYIDWVFIKMVIWNYIDFCLITLLNFCFILRFVTLQRYYNDF
                     FSLIGIILFPRILSVFGNYQFFNLIVVSFNKMIWHLLGLIMFFFTLISGFYFSFIALN
                     INQSNGEILFNMVKIFFGFTPSVWNSWDDYNTLGKIMQMLYLFLLQFIVGTILAICLS
                     GVFHKARENADQEFAYTKSINMVSYFKMAKLNQSRGGLNRFLQVFKLPVALLISVIEI
                     IKMKFERQLSNEVDFKNFVFFTNEVNVNGLKMGKRNQQTIKNHQSISTLGGVQLRTAS
                     TDSFFIDQLLNRKYGGVGTSGGTGLAATASAVGGAGTIMDKSVNIDGLRTLSKTLRQS
                     QGPQGYQPVLQPPFSIPRRPTAFQQSPMSYASPSTIRGGYIPIGYYGGGGGGGGGGDK
                     NEDEDEKEEKKEGEEEEEEEVDKEHLDGKVGSGSGLGSGLGSGVDMGMNLNMEYIHIK
                     NASLGLNIKPNKIYDIKEINDYEIDDHDDDDNLDNEDNERLSINSETGSVKINRDSSI
                     AMKIDTHTEDELDRYDSDETF"
     gene            <860906..>861934
                     /gene="HEM3"
                     /locus_tag="PVL30_003474"
                     /old_locus_tag="LELG_02626"
                     /db_xref="GeneID:5233008"
     mRNA            <860906..>861934
                     /gene="HEM3"
                     /locus_tag="PVL30_003474"
                     /old_locus_tag="LELG_02626"
                     /product="porphobilinogen deaminase"
                     /transcript_id="XM_001526018.2"
                     /db_xref="GeneID:5233008"
     CDS             860906..861934
                     /gene="HEM3"
                     /locus_tag="PVL30_003474"
                     /old_locus_tag="LELG_02626"
                     /note="BUSCO:EOG09262YP5"
                     /codon_start=1
                     /transl_table=12
                     /product="porphobilinogen deaminase"
                     /protein_id="XP_001526068.2"
                     /db_xref="GeneID:5233008"
                     /db_xref="PFAM:PF01379"
                     /db_xref="PFAM:PF03900"
                     /translation="MPIESASSTTSLPHLQIGGRKSKLAVVQSQLVQQAIQKIYPDLP
                     SSILALSTLGDKVQTQPLYTFGGKSLWTKELEILLMDGIDDEFPRLDLIVHSLKDMPT
                     NLPEEFELGCIFQREDPRDAIVMKQGSPYKYLRDLPAGSIVGTSSIRRSSQLIKNYPH
                     LKFESVRGNIQTRLNKLDDPSNPYCCLILASAGLIRLGLGGRITSCLDEVYYAVGQGA
                     LGIEIRKDDHQVKEILKKIEDPVATICCLAERSLMRYLEGGCSVPLGVHSEYNESTKK
                     LTLKGIIVSPDGSKSIEDEVTKTIESREDCEAVGIDLGDRLKAKGAKEILDSIDMTRN
                     INARPTEV"
     gene            complement(<862368..>863501)
                     /locus_tag="PVL30_003475"
                     /old_locus_tag="LELG_02627"
                     /db_xref="GeneID:5233617"
     mRNA            complement(<862368..>863501)
                     /locus_tag="PVL30_003475"
                     /old_locus_tag="LELG_02627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526019.1"
                     /db_xref="GeneID:5233617"
     CDS             complement(862368..863501)
                     /locus_tag="PVL30_003475"
                     /old_locus_tag="LELG_02627"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526069.2"
                     /db_xref="GeneID:5233617"
                     /db_xref="PFAM:PF02582"
                     /translation="MFIRTHLLIKQLRARTPLSITLHRSNSSITTKIRGSKNLPKKKI
                     GAQKLRRADPKFQNESISYILSLLNENKEHVDAKSLEKHLSIVTSVTVGDSINFEKVL
                     PAIISLDHHVVISEEVINISTPKSNLMILSNGTLVGWNLTEEEILNSYLPTIQDAIEG
                     RTEEIESEEIDWIELKEVPDHPLNNGNSYLHGEILVVQGSSKEKRLLDMAAFAIGLSR
                     STRLSILEQQLDEFLEMTKQNANLLANGAKLTTSEHEFLQITGKLFLLRGKLNLYSEL
                     IDTPDLYWSEPFLEKIYNSVSKILDINSRISIMNRKLDYATEEQRAFLGVLNEKKSTR
                     LEWIIILLIMVEVGFEIFHFYEKYEEKKAEKGSKVKGEMTNEK"
     gene            <864343..>865158
                     /locus_tag="PVL30_003476"
                     /old_locus_tag="LELG_02628"
                     /db_xref="GeneID:5232945"
     mRNA            <864343..>865158
                     /locus_tag="PVL30_003476"
                     /old_locus_tag="LELG_02628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526020.1"
                     /db_xref="GeneID:5232945"
     CDS             864343..865158
                     /locus_tag="PVL30_003476"
                     /old_locus_tag="LELG_02628"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526070.2"
                     /db_xref="GeneID:5232945"
                     /translation="MLIFVFLYFISSFISYISCKVFPPTVPVYGHLQDDSNENVNKPF
                     IFYTESLQSLEKNINKFKTKYKESNDVHNGHAIVYFTNNNHFLISEVDAEPKRQVPKM
                     QNENTHTSFDLFSQGFPKHWVEFYTTDVNQTLDKAGFVVQTLTVVNDESAKGEIAYSR
                     GIANKFTLEYDISTTLFEGLFAVVGGTSGAAFTPEITFAKSASTYYSCPVIRGRTAQI
                     KVFPTTTTLKPLKRKVLWNEAKRKFIPDLDFEKSGKLALIFLTGLEDVECSYI"
     gene            complement(<865442..>866254)
                     /gene="YOP1"
                     /locus_tag="PVL30_003477"
                     /old_locus_tag="LELG_02629"
                     /db_xref="GeneID:5232947"
     mRNA            complement(join(<865442..866026,866204..>866254))
                     /gene="YOP1"
                     /locus_tag="PVL30_003477"
                     /old_locus_tag="LELG_02629"
                     /product="ER membrane protein DP1/Yop1"
                     /transcript_id="XM_001526021.2"
                     /db_xref="GeneID:5232947"
     CDS             complement(join(865442..866026,866204..866254))
                     /gene="YOP1"
                     /locus_tag="PVL30_003477"
                     /old_locus_tag="LELG_02629"
                     /note="BUSCO:EOG09264USX"
                     /codon_start=1
                     /transl_table=12
                     /product="ER membrane protein DP1/Yop1"
                     /protein_id="XP_001526071.2"
                     /db_xref="GeneID:5232947"
                     /db_xref="PFAM:PF03134"
                     /translation="MSGLPVQVKRILSEIDKNTSGLSILTQFERQTGFPRSYAVLGFV
                     GVYFLMIFLNFGGVGQLLSNIAGFIVPGYYSILALQTATSKDDTQILTYWVVFAFLNV
                     IEFWSKAILYWIPFYYLFKTIFLLYIGLPYTGGAEIIYKTVIKPVSDQYVRPIDSKIG
                     SNIGSSASSISGSGSGSGSGFGHTNFGDRSHENFADRVQNTAEGVSTSVHI"
     gene            complement(<866891..>868422)
                     /locus_tag="PVL30_003478"
                     /old_locus_tag="LELG_02630"
                     /db_xref="GeneID:5232986"
     mRNA            complement(join(<866891..868306,868405..>868422))
                     /locus_tag="PVL30_003478"
                     /old_locus_tag="LELG_02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526022.2"
                     /db_xref="GeneID:5232986"
     CDS             complement(join(866891..868306,868405..868422))
                     /locus_tag="PVL30_003478"
                     /old_locus_tag="LELG_02630"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526072.2"
                     /db_xref="GeneID:5232986"
                     /db_xref="PFAM:PF04935"
                     /db_xref="PFAM:PF15459"
                     /translation="MSNTLEERLKEHSTAFDGLLSLIPAKYFYDDATQDQWQQKKKSK
                     EEKNQNKRAKFNPNSKSTADETNNAHASAKDVMENRSKRVQQQSNGQSGQNERRKSLH
                     RIESKEEEEEDVENVGNEENDDDEENESGDVDVEEDSVEEDDHDDHDNDENLMNNDEQ
                     MIFDDDGNEIANESYAKQGLRNNAAAGAAGKSKSRSLTPEEQEAKQKKLNELRERLES
                     KINSLREKRKAVGTKTQGAPQSREQILAERKRKVELSKQQKRKLEEMEDDENNSDNSD
                     FSDINDDDDGEGEKNGANAHSVMFGNIAFQDGSQVTSDLTNLRRSADKKKQKGPANND
                     IKAHLKKLEKKKLKLASMTPEEREQQDKKDKWQRVLNQAEGIKVKDDEKLLKKALKRK
                     EKKKLKSEIEWRDRKQVVKDTVAARAKRREENLKARKESKGLKGHKKKNQPKLRKFSG
                     VVNKKAASGKKRAGFEGSVKSKPKTKK"
     gene            <869222..>870370
                     /gene="VMA5"
                     /locus_tag="PVL30_003479"
                     /old_locus_tag="LELG_02631"
                     /db_xref="GeneID:5232921"
     mRNA            <869222..>870370
                     /gene="VMA5"
                     /locus_tag="PVL30_003479"
                     /old_locus_tag="LELG_02631"
                     /product="Vacuolar ATP synthase subunit C"
                     /transcript_id="XM_001526023.1"
                     /db_xref="GeneID:5232921"
     CDS             869222..870370
                     /gene="VMA5"
                     /locus_tag="PVL30_003479"
                     /old_locus_tag="LELG_02631"
                     /note="BUSCO:EOG092631MU"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar ATP synthase subunit C"
                     /protein_id="XP_001526073.2"
                     /db_xref="GeneID:5232921"
                     /db_xref="PFAM:PF03223"
                     /translation="MSGTSQHSLIADYLILSLPQSAHAEEWLEQSLNNGKQPLYKLKI
                     PDFQSGTLDSLVQESEELSKIDQQLGGSVSKVVEILNSVSESKSNSNSSRTIQSRSVF
                     DYVQNFQWNTSKYRLDKPISQLVKIISSEAVTLDSDVRSTFQNYQTAKSNFLAADRKR
                     NGDLSIKSLHEIVKPEQFVLDSENLVTILIAVPNNLVSEFKNKYETLTQFVIPRSAEA
                     IAKDSEFTLFTVTLFKKFQQEFINNAREQKWHPRTDFVYSEETLNNLRKEFDITKATE
                     SKSKNEVIRLSKTAYSDIVACWFHIKVIRVYVEAVLRYGLPPQFDNYLIKFEGSNLKN
                     LGKAKKELVEKFGYLGGDGYSTNSNLHEYASLVDSDYEPFVLYNFEVV"
     gene            <871294..>872781
                     /gene="UGA2"
                     /locus_tag="PVL30_003480"
                     /old_locus_tag="LELG_02632"
                     /db_xref="GeneID:5233599"
     mRNA            <871294..>872781
                     /gene="UGA2"
                     /locus_tag="PVL30_003480"
                     /old_locus_tag="LELG_02632"
                     /product="succinate semialdehyde dehydrogenase NADP+
                     linked"
                     /transcript_id="XM_001526024.1"
                     /db_xref="GeneID:5233599"
     CDS             871294..872781
                     /gene="UGA2"
                     /locus_tag="PVL30_003480"
                     /old_locus_tag="LELG_02632"
                     /codon_start=1
                     /transl_table=12
                     /product="succinate semialdehyde dehydrogenase NADP+
                     linked"
                     /protein_id="XP_001526074.2"
                     /db_xref="GeneID:5233599"
                     /db_xref="PFAM:PF00171"
                     /translation="MSSPVLKHIKNHNLFQTKPFINNEFVESKSGKTFKVINPATEEV
                     IAELPEQTPEEIDEVIKLTAEAFKTFRKTNPYDRSKMLRKLYDLMIENLDDLATIITL
                     ENGKCLTDAKGEIKYAASYFEWFSEEAKRVYGDTIQPSNPNNKIITYKQPVGAVGLLC
                     PFNFPSAMGARKAAPAWAVGCTCILKPDGQTPLSSLALAYLAKEAGFPPGAFNVVLAS
                     VESTPMVGTKICESPSIKKVSFTGSTGVGKLLVKQSSSTLKKLSMELGGNAPIVVFDD
                     ADLDLAVEQSVASKFRSLGQTCVCANRLYVQEGVYDKFCEKFAEKVKSFKIGNGLDEG
                     VTHGCLINTKAIEKVEDHIEDAIKKGAQVLVKGGKLPELGKHFYAPTVLKDVQQDSKV
                     LHEETFGPLGAIAKFSTKEEVLELCNDTPYGLASYVFAQNINTIWYMSEYLEAGMVSV
                     NTGLFTDASMPFGGIKESGFGREGSLYGIDDYTVLKSITLGNVYN"
     gene            complement(<873310..>874983)
                     /gene="ALT1"
                     /locus_tag="PVL30_003481"
                     /old_locus_tag="LELG_02633"
                     /db_xref="GeneID:5233496"
     mRNA            complement(<873310..>874983)
                     /gene="ALT1"
                     /locus_tag="PVL30_003481"
                     /old_locus_tag="LELG_02633"
                     /product="alanine transaminase"
                     /transcript_id="XM_001526025.1"
                     /db_xref="GeneID:5233496"
     CDS             complement(873310..874983)
                     /gene="ALT1"
                     /locus_tag="PVL30_003481"
                     /old_locus_tag="LELG_02633"
                     /codon_start=1
                     /transl_table=12
                     /product="alanine transaminase"
                     /protein_id="XP_001526075.2"
                     /db_xref="GeneID:5233496"
                     /db_xref="PFAM:PF00155"
                     /translation="MLRSISNTASPAAPRSRICVSSKHLFTNNYNYNYNYNYNYYSTM
                     ASTATLSNLYAKPETVQRLYRFYSSFEPAQKLSIKDINQQTVEAKYAVRGKIPIIADG
                     LSEIIKKNPVDHGLPFSKIINANIGNPQQLDQKPLTWYRQVMSILQYPNLLDMNVDFP
                     QDVQKRAKTILDNIGSLGAYSHSQGSPFIRQSIANFITERDNGTLPANANNIFLTSGA
                     STAVSYLLQILSKDQQSGFLIPIPQYPLYTASIALNDAKPIGYYLDESNQWATNHEEI
                     RQLITQNKSQGVNIKALVVINPGNPTGAVLARDEMKALIDICAEHGIVLIADEVYQEN
                     VFDGKKFISFKRVLGELLEKDYNSYKNVQLASLHSTSKGVSGECGQRGGYMELVGFSD
                     DVKDVIFKLASINLCSPVSGQAMVELMINPPRKGDESYDLYKQETGEIFDDLKERANY
                     LYEAFTGMEDIAVDKPEGAMYIFPRLDFDPTKYHKLFSRARNSNLLIDDVYCIELLEN
                     TGICCVPGNGFGQKPDTFHLRTTFLPPGKEWIEHWSDFHKAFVKKYKDV"
     gene            <878177..>879187
                     /locus_tag="PVL30_003482"
                     /old_locus_tag="LELG_02634"
                     /db_xref="GeneID:5233574"
     mRNA            <878177..>879187
                     /locus_tag="PVL30_003482"
                     /old_locus_tag="LELG_02634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526026.1"
                     /db_xref="GeneID:5233574"
     CDS             878177..879187
                     /locus_tag="PVL30_003482"
                     /old_locus_tag="LELG_02634"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526076.2"
                     /db_xref="GeneID:5233574"
                     /db_xref="PFAM:PF15700"
                     /translation="MSISPTTSRPSTPSRPASRKCSLAIESPTTDCTGNNPLKAFLIY
                     SNDNDHNSNNKGISSRSSSSSSSSSSSSSTNSHSHSSHANNSDVTNLQPESNIETSIR
                     LSTDDDKTSKKGPFPQNSQLQHHYAASRSRSSHNDSNDFKNFNNFNNFNNCSNTTKKK
                     NNTHNIKRPQLAKCASVPSFKYDHLFDNNNYYYHNQPHFHYGNRRISICDLDNFSEEI
                     DLYKDNCSFMERERENNNNNMNNNKNRNKQEDETRNSHARLVDDNWPNMYELDTALND
                     HTEYYYKDNDDTSRRNSVKSDSDTLKMDSNTPKQLHHDFHSRNHRRRKSIALKFEEPK
                     IL"
     gene            complement(<879382..>881292)
                     /gene="URK1"
                     /locus_tag="PVL30_003483"
                     /old_locus_tag="LELG_02635"
                     /db_xref="GeneID:5233477"
     mRNA            complement(<879382..>881292)
                     /gene="URK1"
                     /locus_tag="PVL30_003483"
                     /old_locus_tag="LELG_02635"
                     /product="Uridine kinase"
                     /transcript_id="XM_001526027.2"
                     /db_xref="GeneID:5233477"
     CDS             complement(879382..881292)
                     /gene="URK1"
                     /locus_tag="PVL30_003483"
                     /old_locus_tag="LELG_02635"
                     /codon_start=1
                     /transl_table=12
                     /product="Uridine kinase"
                     /protein_id="XP_001526077.2"
                     /db_xref="GeneID:5233477"
                     /db_xref="PFAM:PF00485"
                     /db_xref="PFAM:PF14681"
                     /translation="MNKRRSSRISPFVDEDSSFISSSTDNLVPADFHDNNTSRSSHQL
                     ISGVTNSVDELTIDESCAIADDNNNGNNDGGESTLRTDLNNSCSGVASSESPLPSASK
                     STTTSPSLVSPSPQLSTPSNKNLLRPKSNMSDYNKSTSQVNSVTASATASVNSTLTKT
                     PLKNPSYIPPWTEPYIIGIAGNSGSGKTSISQQIIQGINQPWTVLLSFDNFYKSLTPE
                     QSKRAFANDYDFDTPDSLDIDAIVEVVENLKQGRKATIPCYSFAKHARLERTNTIYGA
                     NVVILEGLYALYDERLLSMMDLKIYVDTDLDVCLARRLTRDILYRGRDLEGAMKQWDG
                     FVKPNAVKFLNPTMRNADVVIPRGLDNTIAIELMIKHIKNQLAMKSARHLQNLKNLGI
                     NMEFNVDDHANIGILAPTNQVKGINSILFNKDTSMNDFIFYFNRMCGLLIEFAQQNYF
                     VTAKPSQITTTEGYKYDGVQFVQKQIVAINIIRSGDCFMWSLKKSFAELTIGKMLIQS
                     DSTTGEPQLHYESLPSNVGDIGKIMLFDSQVISGAGAIMAIQVLIDHKVREEDIILVT
                     YLSTEIGIRRIINVFPNVKIVIGKLSTMDPSKLDPKSNNGCLPWYNTEGFLDSHWHFR
                     HRFIDSLYFGTQ"
     gene            <881702..>884746
                     /locus_tag="PVL30_003484"
                     /old_locus_tag="LELG_02636"
                     /db_xref="GeneID:5233561"
     mRNA            <881702..>884746
                     /locus_tag="PVL30_003484"
                     /old_locus_tag="LELG_02636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526028.2"
                     /db_xref="GeneID:5233561"
     CDS             881702..884746
                     /locus_tag="PVL30_003484"
                     /old_locus_tag="LELG_02636"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526078.2"
                     /db_xref="GeneID:5233561"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04408"
                     /db_xref="PFAM:PF07717"
                     /db_xref="PFAM:PF13401"
                     /translation="MSNNSSKQSGEGYSRRSHDIDYDDLDGDKFPQEVEEQPKQEPSS
                     KEHTTNSTSNETYLSQHNSENDNNSNYNNNNNNNYNNNYNNNYNNNYKYNNNNNNNNN
                     SNNNKNKYCRNSNGNNAHHRQPQSRNSQIYRKRSRASYEEQLQLEIEELESRYDLRPA
                     DQSRLEQLQAQLEATYSRQSSGYSLPEVAQSKSDLLHGRGNSQRNQLDQHQQHQQQTY
                     RTENWEAEQFNRAQLLNLQTDDKIHINNDKQYEYVFDESQFVNYEEDEELSGDEREEQ
                     QQQQQQQQQQQQQQQQPEEEEEDEAERKKQFQRSLEAKEIADVQHSLPVYKFRDEFLR
                     LISENQVLIVVGETGSGKTTQLPQYLYQAGYSQNDTKIIGCTQPRRVAATSVAQRVAQ
                     EMQEPLGEKVGYTVRFDDKSSRNTRIKYLTDGMLLREFLNNPEMDSYGAIMIDEAHER
                     TLSTEILLSLLKDLTNSTRSDLKIIIASATINATKFSEFFNNAPILNIPGRRFPVKIH
                     YTKQPEANYLQAVMTTIFQIHLTQPLPGDILVFLTGQEEIESLEQQMQEAIAKLGDQL
                     KEQGKIMVCSIYANLPNEQQQRIFEPTPPFTRKLVLATNIAETSITIPGVSYVIDPGY
                     VKQTEFNPHTGMESLLVVPCSKANCDQRAGRAGRIGPGKCFRIFTKHSFDHEMEMNTK
                     PEIERINLNSVVLLLLSLGINDLIKFPFLDPPNRQSIIKSLSLLYQLGGLNSRGELTR
                     TGMKMSEFPLDPTYAKCILSSERFGITKEICIIIAMLTESSNLYYIPKKLDKEMVKKR
                     HEQFVDKQGDHLTLLNVYKQWAGTGGYSNQWCQDYFIQYKTMKRVRDIYKQLIGICSK
                     VGITVREEQKEEQEEGEKRKERDDGDVMAQLVQKCLITGFINNIVKLSPMGDCYERIS
                     IAKKKEKNNNNNNNGSGSGSGSGSSSGSSSSSSSSSSSSSNHNTANKANVPCYIHPSS
                     SLFKRKNPKPRYLMYYELVLTSKEYMRNCLILDEKLIREYQH"
     gene            <886847..>888259
                     /locus_tag="PVL30_003485"
                     /old_locus_tag="LELG_02637"
                     /db_xref="GeneID:5233557"
     mRNA            <886847..>888259
                     /locus_tag="PVL30_003485"
                     /old_locus_tag="LELG_02637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526029.1"
                     /db_xref="GeneID:5233557"
     CDS             886847..888259
                     /locus_tag="PVL30_003485"
                     /old_locus_tag="LELG_02637"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526079.2"
                     /db_xref="GeneID:5233557"
                     /db_xref="PFAM:PF01822"
                     /translation="MFHPTTSFAILSLLPLLLLSHFVAKVHAATYYPAAKLIGCYSQL
                     PSSSNIDSESEYQWQSSGYCFHNSCPDSQYIAIKNQECYCLSLLPNSEYVESDESKCD
                     ISCPGYDSENCGGDNDYSIFFGVATSEKEEDEEDGSSSSSSSSSSGSGSSSSTTAAAA
                     ASKSSSSPATTESAEKSSTSSFETPVSTTTASRSTVTSLVTSTDESGQTVIYKTLTQT
                     PSSATAASAETTTDADNNASSSATASATSDSTNSAESSDNSSSDNNNNNNNNSSKSTS
                     NKSTVGPIVGGVVGGIVGLAAIGGLIFFFVKRRNRDYGDDDEDSFDDGFYNADKYQGQ
                     QMQSQQQQHSHSQLGLPFAAVTRNNGAAKGSRKATKNSNITDLDMPMVNPFSHPDDSL
                     TSTQLNQGSLLGNSNSSHNNSSVHTAAGKMGLVDPRTNPVMVGRRRLSEGSLDDEAIY
                     NQRKTLHVINPDDRRSQMLQ"
     gene            <889140..>890148
                     /gene="CTP1"
                     /locus_tag="PVL30_003486"
                     /old_locus_tag="LELG_02638"
                     /db_xref="GeneID:5233559"
     mRNA            join(<889140..889154,889276..>890148)
                     /gene="CTP1"
                     /locus_tag="PVL30_003486"
                     /old_locus_tag="LELG_02638"
                     /product="CtIP- endonuclease"
                     /transcript_id="XM_001526030.2"
                     /db_xref="GeneID:5233559"
     CDS             join(889140..889154,889276..890148)
                     /gene="CTP1"
                     /locus_tag="PVL30_003486"
                     /old_locus_tag="LELG_02638"
                     /codon_start=1
                     /transl_table=12
                     /product="CtIP- endonuclease"
                     /protein_id="XP_001526080.2"
                     /db_xref="GeneID:5233559"
                     /db_xref="PFAM:PF00153"
                     /translation="MSQKKNVEPWKSFVAGGTAGAIEGVITYPFEFAKTRLQLVDKSA
                     SPNQSRNPLKLIYNVAKQQGVSALYVGCPAFVVGNTVKASVRFLGFDAIKNMLADKDG
                     KLSGPRGVIAGLGAGLLESVVAVTPFEAIKTGLIDDKQRPNPKYQNGLVSGTVKLCKD
                     MGFRGIYAGVVPVSLRQAANQAVRLGSYNAIKTAIQQATGTPPNQPLSSAATFAVGAF
                     AGIITVYSTMPIDTVKTRMQALGSEKEYTSTLNCFAKIFKNEGILTFWKGATPRLGRL
                     VLSGGIVFTIYEKMLVLLK"
     gene            complement(<890365..>892784)
                     /locus_tag="PVL30_003487"
                     /old_locus_tag="LELG_02639"
                     /db_xref="GeneID:5233357"
     mRNA            complement(join(<890365..891564,891897..891930,
                     892771..>892784))
                     /locus_tag="PVL30_003487"
                     /old_locus_tag="LELG_02639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526031.2"
                     /db_xref="GeneID:5233357"
     CDS             complement(join(890365..891564,891897..891930,
                     892771..892784))
                     /locus_tag="PVL30_003487"
                     /old_locus_tag="LELG_02639"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526081.2"
                     /db_xref="GeneID:5233357"
                     /db_xref="PFAM:PF10176"
                     /translation="MGLLGQTVRNFQSRKILDHGEAHINENHQQQQQQQQQSQSQRLI
                     PEVDEEDNPNPARLSLEPDGEFTSNQIAPSSLSSPPTLSDSNAINNTAPSSSSSASSS
                     SSSSSSFPSSSADLESQVPPRLTPKQRVLRVLHHFVPIRQTYQRLSNGIQTGRMERNV
                     PGRFIGQGTDGVFQNLMAKPDTAEALLQQERELHPPTYEEASQDASPEYWESTMISPM
                     YDDEVFVQGLPVGNIANFVWNALVTVAFQFVGFILCYLLHTSHAAKQGSRFGLGANLI
                     LYGWNIIPMNMGNPNELPKKIVIEDPNEFDIDRNARLMGKVDAYTAGGVFSQTQNIDD
                     SVGGADSNGGNHGSAPYVAYALIAFGLFIIVKSVIDFYKIKQLEKSILQPSSGTTVVN
                     SLTGHVENDEETSNERTTAQTSN"
     gene            complement(<892880..>893797)
                     /locus_tag="PVL30_003488"
                     /old_locus_tag="LELG_02640"
                     /db_xref="GeneID:5233601"
     mRNA            complement(<892880..>893797)
                     /locus_tag="PVL30_003488"
                     /old_locus_tag="LELG_02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526032.1"
                     /db_xref="GeneID:5233601"
     CDS             complement(892880..893797)
                     /locus_tag="PVL30_003488"
                     /old_locus_tag="LELG_02640"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526082.2"
                     /db_xref="GeneID:5233601"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSPRNTNSSRTKYALITGASSGIGFALAKEFSRKGYKVFACSPK
                     QFIPLQDPLVAEFGVISIPCDITNLEDLKHVKDVVLKETGGYLDILYNNAGIAIGGPA
                     TEMDEAQLDRIFQVNVIGHINATKYLSPFVINAKGSIIYTSSVAARVPLSWTSAYSAT
                     KAAIDAYAKTLHGEMAPFGVRVHSVITGGVDTEIAAGVPIETIEALYEGSKYNVEGIV
                     DCMIETQEMSHNSRYSPAKYAKEMVSQIGRNSTRFNLYGGFKAYLLHFISRWFPLWLV
                     EFLIQSNFKQRRVLKNVAKNVRAKKIKYD"
     gene            complement(<895057..>897816)
                     /gene="SNF5"
                     /locus_tag="PVL30_003489"
                     /old_locus_tag="LELG_02641"
                     /db_xref="GeneID:5233054"
     mRNA            complement(<895057..>897816)
                     /gene="SNF5"
                     /locus_tag="PVL30_003489"
                     /old_locus_tag="LELG_02641"
                     /product="SWI/SNF chromatin-remodeling complex subunit"
                     /transcript_id="XM_001526033.2"
                     /db_xref="GeneID:5233054"
     CDS             complement(895057..897816)
                     /gene="SNF5"
                     /locus_tag="PVL30_003489"
                     /old_locus_tag="LELG_02641"
                     /note="BUSCO:EOG0926115P"
                     /codon_start=1
                     /transl_table=12
                     /product="SWI/SNF chromatin-remodeling complex subunit"
                     /protein_id="XP_001526083.2"
                     /db_xref="GeneID:5233054"
                     /translation="MPLEGISPVHQQPQQQQQQHQQQSQGGPPQARTGGLPPITPQFL
                     ASLNPQQMQVLKNLPQFQEAMRQYRQRQELMQNPQNKRIMNNIQQQMSPQSASDGVGV
                     GTGFGVGGHTEQMLGSQQFQDLSMQSMSNEQVIRLQQQQAQQPQAHIQNLQNTQNIAQ
                     QSPPNFQPQYPHDLPYKRNVQNQMSPQSVSMQNLGIPGGLPIKKVPSRVPSVPGPKGI
                     GGTRASPQLYGEVTNGVNAGVGEVESVPNMMPNGIPTGGPPGVPPGVSGTLPTGLPNV
                     IPAGVPNGLPNNLPNGVLNGVPNGVPNGVPNGVPNGVPNGVPNGVPNGVPNGLSNGGM
                     ASNPGNFATPGGIPVQHPSQTQLDQAGQYPSSQQAGSNINVPVSAPSLSAQEFLSKVP
                     MKPLSSFHEWSDKLTKENKEVPLDTKVYETMIQKDAMFLAEHSKQSFENKMELESLSK
                     DLQQYNMVKQLRMNSIQLSAKNQLNNSIWGEGYQGYGNGVTNTGTKLLLPPRDYTDRM
                     INERLMRQDKQSKNYVPIRLEFDQERDQFKLRDTFLWDLNEEVLSVEDFTTQLLEDYK
                     FIPKVHYHTILSSIKEQIADYQQKPIKTTGELRIPIKIDIIINNTQLTDQFEWDILNN
                     GDSDPEEFATMMSDELYLPGEFATVIAHSIREQSQMYLKALNLAGYAFDGTPVTDDSV
                     RNHLLPALRLVSKDYQVVDDFFSILRNPSNVSDYCPQLIKLTEMEVERMDKELERESR
                     RKRRHNYNEDAQALFGSGGAFGSGSGGFEGRGGSSGVGGGGGGGGGGLGIGLGLGLGS
                     GGGGLGGGNSFSSSNDRGSVGSRGLVSSRRAAAHTGRGTISLDLSDVPRTFRTPAPSS
                     ILPGGVDLGVPDVYEYNEVVVKRSQVKNPDYRPPTPEPVANDLVTYHHDPIEGTFNVT
                     IKLLD"
     gene            complement(<898470..>903065)
                     /gene="POL1"
                     /locus_tag="PVL30_003490"
                     /old_locus_tag="LELG_02642"
                     /db_xref="GeneID:5233404"
     mRNA            complement(<898470..>903065)
                     /gene="POL1"
                     /locus_tag="PVL30_003490"
                     /old_locus_tag="LELG_02642"
                     /product="DNA-directed DNA polymerase alpha catalytic
                     subunit pol1"
                     /transcript_id="XM_001526034.2"
                     /db_xref="GeneID:5233404"
     CDS             complement(898470..903065)
                     /gene="POL1"
                     /locus_tag="PVL30_003490"
                     /old_locus_tag="LELG_02642"
                     /note="BUSCO:EOG09260375"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed DNA polymerase alpha catalytic
                     subunit pol1"
                     /protein_id="XP_001526084.2"
                     /db_xref="GeneID:5233404"
                     /db_xref="PFAM:PF00136"
                     /db_xref="PFAM:PF03104"
                     /db_xref="PFAM:PF08996"
                     /db_xref="PFAM:PF12254"
                     /translation="MSSRAARRDKLKQLQEARKSRGNVVIDSDDDGDDGVNLNKIYDE
                     VDEETFREHKRKQLMDDDFIVDDNGEGYVDNGADEWDDASRPNYYSDEDSDTEVRTSS
                     KKRKNRHHNQRAVKVAKTAPISNFFKHSNDINGGIKKKVDTNIDDILEDFQETKPSRK
                     INGPSAFASTSASAPKFLQENNSSSNNNNNNNNNNNGIGKIKKKTNNRSFAFSTVSKE
                     KKRPTRVDTFNASSDYTMDFDDFDQQSSPRKEEKERKINVKHEQVNILSSPTKNSLTA
                     TGSTLETTNASTTVDTTDKPGAANSVVKASDSDSDDDVIVTKRHRAVVSARRQNEATV
                     SSVKANTTILSSPSHPLGSASSSSSSSSSSQTNHTEKIAQANVDDEQGHFRMFWMDYA
                     EVENSLLLFGKVATRDGKLVSGVVQVNGLCRELFILPREYRMVDGEEDTSSPRVTPND
                     VREEITPLFMEHYKLETLRAKAETKKYAFELANIPKEAEYLKVLLPYNNATNRKVLPA
                     NTEGQTFRHVFGSNTNMFESFVTQRNIMGPCWLDIEGGNFEAIQNSTHCQVEVAVSSP
                     NKISPVDKAPPAAPNLTCTSISVQTVMNPKHNKQEVVSVTLATFFDLPQDAPIPEGLN
                     PNDVITFVRPVGSVSFPPGLNQLAQKEKFNLRLCPNEKVLLNAVAAKVKMLDPDVFVG
                     HRMENISLDVLVHRMYDNQVMTWSALGRRNRKQWPQHITKNKNSSGFNNNLLIREVFQ
                     GRLMCDIANEMGQSLTSKCQSWDLAEMYEVVCHKKHEPMDISFQNSKFAEDATLLFLA
                     LKENNFNAKITSEIAFSIQILSLSKQLTNIAGNAWSHTLSGTRAGRNEYILLHEFRKN
                     NYIVPDKEDALHKNTSYSQQAKLESFDDDVQTATSNKKPKFQGGLVFEPEKGLHKNYI
                     LVMDFNSLYPSIIQEFNICFTTVDRDRFNNTHDEERDLPTLPDNDADAGVLPRLLNTL
                     VTRRREVKKLLKDPKNTPFQNAQYDIKQQALKLTANSMYGCLGYVNSRFYAKPLAMLV
                     TNKGREILMDTRQLAESNSLRVVYGDTDSVMIDTGADNLRDAVKVGEQFKVQVNERYR
                     LLEIDIDNVFRRLLLHAKKKYAAMNASINKATGEEVTTLEVKGLDMRRREYCQLSKEI
                     STFVLMKILSNADPEEALMDVYQYLEEMRDKIIANQVPAIKYKINTKLSKDPTSYPNG
                     KNMPQVQVALKLKNQGKVIKAGSVITYVITAPTAENDTSSVADRARAIQDLLVQKTEL
                     RPDPTYYLEKQIFAPVERLLEKIDSVDMVRVATALGIDTKRYILKVKNGDLNGEIMPM
                     ESRISDAERFRQSSFLVLKCKCGHHFRFGGIQASVDYRVTFNGVQCSKCEYTFPLIKL
                     TAQLECTIRKHISVYYAGWLVCDDPSCGITTRQISVYGKRCIGSSGKGLDCKGVMSYR
                     YTDKALYNQLLYFQSIFDVEKTKQRKLRPIRDALEEEGKEGKDGKVAELAMGQIEALA
                     EQNRDVFAYCQGVVQKYLAECGRRYVNMGSIFDFMSI"
     gene            complement(<903724..>904797)
                     /locus_tag="PVL30_003491"
                     /old_locus_tag="LELG_02643"
                     /db_xref="GeneID:5233136"
     mRNA            complement(<903724..>904797)
                     /locus_tag="PVL30_003491"
                     /old_locus_tag="LELG_02643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526035.2"
                     /db_xref="GeneID:5233136"
     CDS             complement(903724..904797)
                     /locus_tag="PVL30_003491"
                     /old_locus_tag="LELG_02643"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526085.2"
                     /db_xref="GeneID:5233136"
                     /translation="MKVIYASISLGAFAVFAQALYAPLLSRNPADELNLSVTGLNTLA
                     VALRKINAIETQDSKYIDNGNLGAAVGAGVGASTGDGAGADDGDGAEVQVRAQVLNVA
                     QDLLKRSDSPLLDTILGYLNDSGAAIVVLDASLLNPQLLQVVIDTTIWILKQNLINLT
                     DLLIAIERSGLVFDILNLTLEDPEVLPGLIRITKEVMSQSNLDFSGLLKRDAIVSEED
                     DELNDVEILEAFLKWNTNNSKHARDSENTEEFQLDKRENEMLNEVFIALRNSGLAVSV
                     IRHLLTTPELAQPNAYFLVSILESHAIDVSDLLKALKESRLIWDSIASLLKNPQIVKE
                     FGGKIISRVTKGLVPQKFIDDWF"
     gene            <905787..>906854
                     /gene="VAM3"
                     /locus_tag="PVL30_003492"
                     /old_locus_tag="LELG_02644"
                     /db_xref="GeneID:5233518"
     mRNA            <905787..>906854
                     /gene="VAM3"
                     /locus_tag="PVL30_003492"
                     /old_locus_tag="LELG_02644"
                     /product="SNAP receptor"
                     /transcript_id="XM_001526036.2"
                     /db_xref="GeneID:5233518"
     CDS             905787..906854
                     /gene="VAM3"
                     /locus_tag="PVL30_003492"
                     /old_locus_tag="LELG_02644"
                     /codon_start=1
                     /transl_table=12
                     /product="SNAP receptor"
                     /protein_id="XP_001526086.2"
                     /db_xref="GeneID:5233518"
                     /db_xref="PFAM:PF05739"
                     /db_xref="PFAM:PF14523"
                     /translation="MSFANIDLEAQKQPLLRKTHASNHATTDIGGNSSASSNKNYGSN
                     NISGSNNISGSNNNGNNNAVGGVAVGVAVGPNGNDNNDDPLDTIIHKTSIELQNLSQL
                     ISQFDNQRRQLGTKRDCVELRRNIETSTTNITELLRAIEALVVRLTTLVNSAHGSRDS
                     NHNQERKEVGKVKVSSRQIMMKEKLTSEFSELEKKFANSKKLFDEKKKVFVIPQTHTV
                     SENGRSGVGQGIEDESPNQSQIQMQVQENEDPELVEQTELQYHLLLTEERNREIEQVA
                     NGVMEVNSIFKDLNQLLHQQGEQINTVEDNILQLHGHTQQADRELHKAHEYQKKKGRW
                     SCIFLVAICVFVLIVVLVVLS"
     gene            complement(<907004..>907667)
                     /locus_tag="PVL30_003493"
                     /db_xref="GeneID:85890370"
     mRNA            complement(join(<907004..907482,907607..>907667))
                     /locus_tag="PVL30_003493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119487.1"
                     /db_xref="GeneID:85890370"
     CDS             complement(join(907004..907482,907607..907667))
                     /locus_tag="PVL30_003493"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975470.1"
                     /db_xref="GeneID:85890370"
                     /translation="MDRQSRERKRSQSDNTMPFFTLPFTAKVALLVGGAVGAGLAVAN
                     NQEVILQTAETIFTKAAEYCRHRIDSAKNGALDVKYADDFEDHAFSDAAAQEEERSRA
                     TGSNLRSDDSDYDNISTPDTTDFSEIDTDFERDDEDEDGIQWASDSRRGRTTNTNANN
                     NSSKDFEDAAQLSKIASLD"
     gene            <908668..>910176
                     /gene="ATF1"
                     /locus_tag="PVL30_003494"
                     /old_locus_tag="LELG_02645"
                     /db_xref="GeneID:5233483"
     mRNA            <908668..>910176
                     /gene="ATF1"
                     /locus_tag="PVL30_003494"
                     /old_locus_tag="LELG_02645"
                     /product="Alcohol acetyltransferase"
                     /transcript_id="XM_001526037.2"
                     /db_xref="GeneID:5233483"
     CDS             908668..910176
                     /gene="ATF1"
                     /locus_tag="PVL30_003494"
                     /old_locus_tag="LELG_02645"
                     /codon_start=1
                     /transl_table=12
                     /product="Alcohol acetyltransferase"
                     /protein_id="XP_001526087.2"
                     /db_xref="GeneID:5233483"
                     /db_xref="PFAM:PF07247"
                     /translation="MSEAEVIISRPLSVAENFFRSRTASGFYRNFQVTATYNFDLKKN
                     NLQSLYYALRKTLIEYPILASNVQFNKKIKTYEYELLKEIKLRDVLVMETQTYSNQYL
                     THGVINEKFMKSANNIQFELYCQKPLFCLILIDEYNLSAVFEHTIGDGLVGNYFHEAL
                     LKNWARCENEGLLDKVEGEKIHACPDPLDSVLFSFQNDKSLIEHSLPPPMDIFLEDMD
                     LDYTYGDNKFHERVAPATHPTKWAGRFKAQDTHEIAFKLINLTANETATILRKCKEKK
                     VTLTPYIEIVLAYTLQPIFGDDCYATHKIAMTLRRHFTSSKAPVAYHKILNDPDYKIL
                     GTSAHMGFSENLPPITEFSWNLVQTVNMHLQHAIKNKRALNQLKLFKDTCDLTHDTNE
                     QFFTQQLGKPKADAVKISNLGLINAEETVGANNTSQRKLTFKNMVFSQDMAPYGSEFM
                     LSVISTPKGGLNLVLSYYNHSFDDSKWSNFDIFIERLKSNLMYFCSASPQNS"
     gene            complement(<910336..>911169)
                     /locus_tag="PVL30_003495"
                     /old_locus_tag="LELG_02646"
                     /db_xref="GeneID:5233484"
     mRNA            complement(<910336..>911169)
                     /locus_tag="PVL30_003495"
                     /old_locus_tag="LELG_02646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526038.2"
                     /db_xref="GeneID:5233484"
     CDS             complement(910336..911169)
                     /locus_tag="PVL30_003495"
                     /old_locus_tag="LELG_02646"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526088.2"
                     /db_xref="GeneID:5233484"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MTEEQAYYKNGFQDSIADTHSWRTVENSSKFTLSVLQPDFKVLD
                     VGSGPGTITVDFAKNYLTGKDGFIIGIEPTQELIDRSNSYKEEVAPELTNIQFQIGSV
                     YKIPFDDNTFDLVHAHQVILHLHDPILALQELKRVTKPGGYVCVKDVDIESAIVTPEK
                     YEVLKQFRLLKAQASKSTDVRAGRKLREKALKAGYEPTNIVTSMSYWLIGDDPKMKQS
                     RAALTKNRVENGGEDVFPNDEVKNSSAKKMTLELIDEWEQDDSAMFAVTNFEIIYTKP
                     T"
     gene            <920310..>922598
                     /gene="GEF1"
                     /locus_tag="PVL30_003496"
                     /old_locus_tag="LELG_02647"
                     /db_xref="GeneID:5233418"
     mRNA            <920310..>922598
                     /gene="GEF1"
                     /locus_tag="PVL30_003496"
                     /old_locus_tag="LELG_02647"
                     /product="glycerol ethanol, ferric requiring protein"
                     /transcript_id="XM_001526039.2"
                     /db_xref="GeneID:5233418"
     CDS             920310..922598
                     /gene="GEF1"
                     /locus_tag="PVL30_003496"
                     /old_locus_tag="LELG_02647"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerol ethanol, ferric requiring protein"
                     /protein_id="XP_001526089.2"
                     /db_xref="GeneID:5233418"
                     /db_xref="PFAM:PF00571"
                     /db_xref="PFAM:PF00654"
                     /translation="MSTLDRLEHFDDPLARYSPSLRNTETGLWTKQEQIREVQRFNDF
                     RTIDWVEDELDEQKQRLLKVRHISSRGNNFRDKMLSQTFNWVVLASMGIVIGLIAGTL
                     NIVTSFLASIRMGHCKGAFYLNESFCCWGESSTEHCSKWQTWSSFSGLNYIMYVLLSI
                     TMSFIAAKLVKFFAPLAAGSGISEIKCIISGFVMDGFLGWWTLFIKSIGLPLAIGSGL
                     SLGKEGPSVHYAVCVGNSLAKLVNKYKKSASKGREFLTATAAAGVAVAFGSPMGGVLF
                     AIEEMSSVFQLSTLWKSYFCSLVAVTTLAAMNPFRTGQLVLFEVTYDTNWHYFEIPVY
                     VLLGVFGGVYGIVVSKLNIRVVAFRKKYLGNWAIREVFVLTLLTSSFSYFNQFLRLDM
                     TECMQILFHECDANFNNPICDPDQKKVGMFVSLMFATVARMGLTIITYGCKVPAGIFV
                     PSMAAGAMFGRAIGILVDYIYKSHPESFLFSACSENERCIIPGTYAFLGAAAGLCGIT
                     DLTVTVVIIMFELTGAVRYIIPTMIVVAITKSINDKWGKGGIADQMILFNGLPLIDSK
                     EDYTFGTTVESAMSPVVTAFSTDADDALTIGQLKKTLRKTSYRGFPVIYSGSNPKIYG
                     YVSRYELEHILSRHVNVNDYAICNFNKEKDGSTDKVAFSSVVNRSPLTVSINASLESV
                     LDMFVKLGPRYILVESESTLVGIITRKDVLRYEYSRHPQDAKESDNNAQDEKIWQFMN
                     LLALSARKNLGKILHNDSNRYV"
     gene            complement(<922831..>926379)
                     /locus_tag="PVL30_003497"
                     /old_locus_tag="LELG_02648"
                     /db_xref="GeneID:5233113"
     mRNA            complement(<922831..>926379)
                     /locus_tag="PVL30_003497"
                     /old_locus_tag="LELG_02648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526040.2"
                     /db_xref="GeneID:5233113"
     CDS             complement(922831..926379)
                     /locus_tag="PVL30_003497"
                     /old_locus_tag="LELG_02648"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526090.2"
                     /db_xref="GeneID:5233113"
                     /db_xref="PFAM:PF10441"
                     /translation="MIHSTNRSSYLQDQNVMNKSTSAEAITKLLRSSTEPLDTIVKCA
                     HKVLNNDFDIYFPDSTMFILSLLIDRLNDRSSTKSKFYHWKYEMEVWELLEQVLKISR
                     LDVARRNRLIENLKLYDILIDLLACENTNHECLSRAFEITEWIQRNVYLEIEESTANS
                     LLKEYLKYALRSNNEYPRWSSIIAQLYRQSWDRATQNGSSKKIYAKFMDDCLALFVKV
                     VGGQSTESPALRQLFIEKAFLPEHYTEFTTKIERLLSPDDVTQHNIETLFSMAVAEIS
                     SKNVVHLEQLYVVLTSIFPELSVSLLHKLVDLNGTLSSKFVEELYTREIKDKKFIDLD
                     WDMVKLIFQTNSELATSKSKFIFEKYNTAFNLDDKVLAVAKVVVDSYAKNRELVEFFT
                     KIWPKVLKKDEVWETTEFVSHVASLVRLLSTRQLKEVLDFISQLDPTTISALSIAITD
                     GLRNTNAQTVSAVKEMLLTNLKEACGESWHVHYNILCLYPDSNVNYLVSELSLKSLES
                     DPYYYYVVFRLYELSKISSITNEQQDGFLKILNAFKDSDSSLVTSVTKRWFTVLNHCF
                     STENLNKLAVFLIKFASFKNIPDEFFEQQKFVTLVSKALSQRPEPSVILHFPVACIPK
                     RIRKEIIDELVEQYFKVPSNDKLYCIKHLLKGMSLHSNLETKFEVLKKLEQDVNGMTF
                     HEHDEDMKKESKELVEGIVSLIFAAHFKQIKDKESFRYISNVIESLLTSLSSDKFDMT
                     CELEIVTIILKECTTDSFAAIQKLRETFISYCLIALNNYRDDKVTRSSMLQSLVSCAI
                     ASEATFEQITTGISSFDAMSLKDATMSSTLTKLIAKIMPVSRKYAIYFLGLLLINSSL
                     GEEDALIASCCYFERQSMDVAAQDDIIAEFLGFLNQAGSVNSARALTIACALLNSSRK
                     GTNPKLISKLIWSISTLNAKANSGIVSSILRITREVLSTKPYLFDQYGLENTIYLVSN
                     IVKNVRAESDNNVSESIYVASTQVLSSILLYHRFQLTTRHHILMDIMTFLLQDLCTVG
                     SQAHSVQAASAYSRLLHNMCEPMKRVEDRSEKHSTTTTTTTTAAAAAASSSSSSSSKL
                     SIPTSSHSLTPLSNEYKKYLRRHVPILLTNYVNFQLKFNFDKAVNDTISSGIYSIFDV
                     LSQSQLHALNAALDFGGRAFFKSLYNDYKEYGKWKG"
     gene            complement(<926833..>927213)
                     /gene="SNU13"
                     /locus_tag="PVL30_003498"
                     /old_locus_tag="LELG_02649"
                     /db_xref="GeneID:5233116"
     mRNA            complement(<926833..>927213)
                     /gene="SNU13"
                     /locus_tag="PVL30_003498"
                     /old_locus_tag="LELG_02649"
                     /product="RNA binding protein snu13"
                     /transcript_id="XM_001526041.2"
                     /db_xref="GeneID:5233116"
     CDS             complement(926833..927213)
                     /gene="SNU13"
                     /locus_tag="PVL30_003498"
                     /old_locus_tag="LELG_02649"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA binding protein snu13"
                     /protein_id="XP_001526091.2"
                     /db_xref="GeneID:5233116"
                     /db_xref="PFAM:PF01248"
                     /translation="MSAPNPKAFPLADSALTQQILDVAQQAQNLRQLKKGANEATKTL
                     NRGISEFIIMAADAEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVIAASV
                     TSNDASSIKNQIYGIKDKIETLLI"
     gene            <927635..>928437
                     /gene="CUP5"
                     /locus_tag="PVL30_003499"
                     /old_locus_tag="LELG_02650"
                     /db_xref="GeneID:5233362"
     mRNA            join(<927635..927648,927969..>928437)
                     /gene="CUP5"
                     /locus_tag="PVL30_003499"
                     /old_locus_tag="LELG_02650"
                     /product="vacuolar ATPase V0 domain subunit c"
                     /transcript_id="XM_001526042.1"
                     /db_xref="GeneID:5233362"
     CDS             join(927635..927648,927969..928437)
                     /gene="CUP5"
                     /locus_tag="PVL30_003499"
                     /old_locus_tag="LELG_02650"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar ATPase V0 domain subunit c"
                     /protein_id="XP_001526092.1"
                     /db_xref="GeneID:5233362"
                     /db_xref="PFAM:PF00137"
                     /translation="MSDLCPVYAPFFGSIGCAAAIVFTCFGASYGTAKSGVGICATSV
                     TRPDLLVKNVVPVVMAGIIAIYGLVVSVLVSDSLAQKQALYTGFIQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRASQDVTC
                     "
     gene            complement(<928756..>931233)
                     /gene="NUP85"
                     /locus_tag="PVL30_003500"
                     /old_locus_tag="LELG_02651"
                     /db_xref="GeneID:5233128"
     mRNA            complement(<928756..>931233)
                     /gene="NUP85"
                     /locus_tag="PVL30_003500"
                     /old_locus_tag="LELG_02651"
                     /product="Nucleoporin nup85"
                     /transcript_id="XM_001526043.2"
                     /db_xref="GeneID:5233128"
     CDS             complement(928756..931233)
                     /gene="NUP85"
                     /locus_tag="PVL30_003500"
                     /old_locus_tag="LELG_02651"
                     /codon_start=1
                     /transl_table=12
                     /product="Nucleoporin nup85"
                     /protein_id="XP_001526093.2"
                     /db_xref="GeneID:5233128"
                     /db_xref="PFAM:PF07575"
                     /translation="MTQANFNGNGYVEVEMLDLPSGDEDGQDSFSQGDESASFSSSTS
                     ESATKPITTTTTTSRSPSSPTNSPSQSSLSWSSSPTAISELLHPDTNYPDLVDWLASE
                     EEELVFCFNKDLYQQTCTPSTGFFKAYVEYVNSNFKITEELLAYVKSTQIAKPSTIGL
                     ITTNSENEKNTISRLVDDALVNVSQNLSQLIETPVETDEEIAENEKLQDAVVILKCFE
                     STFLNTMVRTKPEIIMEWVNRFDPQPPTEIVNEVVVNEPQSYLHPLFWKHIISKLAMR
                     GLFKQLDEILQHADYKELEELCNPLFTAIEDFRNLMSMYSSYALNGQFARWKLSACEY
                     RDSLADVKSLVHEEGENPKYQIILSQLFDIACLISGMEKTIAAHSENWYDMYLALSLY
                     QIRDDEEVFKYFFEASISEKPPPPPHQSTTSSSSLLSSSWSSSMLAPKNGEQDLDAMT
                     EECLLNILKGNLMKALETVYYLSPATAAYLSLFMDLKNLLEGYYTSQVLHSTANSDNS
                     KKTASEYFLTRHAYNNLDIHELVPVGIGLLANPTLNKRSSSKNLNLQTIASFLPHYNV
                     VENEDLEWALTVCADLGLTSTARDLYFQAGLQALENGYLYEALNNFVNCYDPLEVSGS
                     LHQEGLRKIHYVIWEIIFTDSLVNNSPIDDELINNIVDGEIDIQLHPIIQQSISPYAV
                     LKEYFSSLSTEKTTVEPSSLSKIIHLLKFQYMPKKFRPLLLGQFLLFLRSEVELQIPD
                     LIIMIELIDNYEGDVTGNDKRDGEQLFAYSVAEYKQNIDSDGEQQQLNKLDWREDVVP
                     SSSPTVDDLLALLRRKVSERIAKVFIE"
     gene            complement(<931764..>935444)
                     /locus_tag="PVL30_003501"
                     /old_locus_tag="LELG_02652"
                     /db_xref="GeneID:5233531"
     mRNA            complement(<931764..>935444)
                     /locus_tag="PVL30_003501"
                     /old_locus_tag="LELG_02652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526044.2"
                     /db_xref="GeneID:5233531"
     CDS             complement(931764..935444)
                     /locus_tag="PVL30_003501"
                     /old_locus_tag="LELG_02652"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526094.2"
                     /db_xref="GeneID:5233531"
                     /translation="MFVLTELNNVEAITNSAQVNVNGENYLFIAEGNRIRIYELNSNS
                     LQYKLKCCKLLHHKVLSWTRFAFNVKNFMIYIDDEFHVQLIDVLQIVKSEVDSQFKPY
                     SLFRMSIKGQQQSSSFEKPLIIPQSVVNPEFVIFHVFHSNVQVLPMLKLMQSICEAKY
                     DESNEWLFPQQYRPLPVTIPMGNIDILQIVSMSDDNSKEEELVLEQEEEEEEGEDGRE
                     GINSRKRSRKVKYGDRNGEFPIKTTQFAILYKDLFSSYSIRLVNFDTKRRSANILHQM
                     DQFEEDPSLIVPWSKGKTLGLVALTPSSLFYFPDKSIAHMSLANSLGRNIAVSKQMED
                     PIMVMTLDKPGKDKALRIYKSYFVIDNSRTLLVTESGECFMLYIDIHQSSPNSLVINQ
                     VNFINLGILTPPIKDGLHHVRSNLFFQSSRSSKSVLFEVLATKPNLDIHDVLESSPPV
                     LDIAKFSTRSNLYACQGGWDGSSIRSYRLAHEKGVYGMVSQNGVIAGQHHHLQQHLQL
                     VSIGRVKGKCLFRDYSVTTSKKYVSLDSTGNLQHITDFLDDIIERDEVKGHSIVITTN
                     AFKIDSKVIADGKVSYGCISAENNTAVVIMEHNQAMIYQYDIVEKPTFLRFSLESSEA
                     EEQVSFVDICRLKGKLCVLITFSSGRIELWLEIDEQHKGRKLSLVCKKLISQGVYSAA
                     LVVRSLQYGCNAKSFLIDVFISCTYGSIQQLVVEIDLTNNTAVVVDNGKLQLQSREPY
                     RIKKLFNKLVLYNSQFLVLPYFNKLLEIYEYSLIRKPNTTDVIFLDTDSKSLNKSRIL
                     ITFATGLVEVADIIYKNQNEKLVEQHSLHSQKLFVKCMTLPMNRYMIALSYDKNSGQN
                     MQAELLLIHSQTFVVLDSFKLENTPGVADMCLLEEGPLEVPNKCKADFITLSSSEESQ
                     ISMFCVRDSKIKLVEKCAIKGLRLNKNVQLQNISALKNDKKEHRQFESDDQMQDVQDV
                     QDPNCITFVISGTVVFTVLLTYDGSRYIWELGQDSFSMPTYAIGHVSSYPLIIAADTV
                     AGLCSFTLNSLRHQEPLHHQDLEREYLTSIALTGSNGGNANHYVITGDTSGYIRISNK
                     RSSERVGAKFCVMASSPINVIVPLSGERHGIVSDLALIGTSSGGIYLLSEIIDKFDKP
                     FGDHALAALVEFGTEIGVQKIIGENFQQTDESILSKEIINISAVKLFLERYKTEPKLH
                     SQYREVIKLIPDLQNLVQSCAV"
     gene            <936044..>938812
                     /gene="HUL4"
                     /locus_tag="PVL30_003502"
                     /old_locus_tag="LELG_02654"
                     /db_xref="GeneID:5233217"
     mRNA            <936044..>938812
                     /gene="HUL4"
                     /locus_tag="PVL30_003502"
                     /old_locus_tag="LELG_02654"
                     /product="Putative E3 ubiquitin-protein ligase"
                     /transcript_id="XM_001526046.2"
                     /db_xref="GeneID:5233217"
     CDS             936044..938812
                     /gene="HUL4"
                     /locus_tag="PVL30_003502"
                     /old_locus_tag="LELG_02654"
                     /codon_start=1
                     /transl_table=12
                     /product="Putative E3 ubiquitin-protein ligase"
                     /protein_id="XP_001526096.2"
                     /db_xref="GeneID:5233217"
                     /db_xref="PFAM:PF00632"
                     /translation="MTISANQCNGPIQKPKLEPVDSRSGWNLNKIFSFGTSVAKKTSS
                     CNARESTCSKNNQAENSSTQGIETREESVQSNVSTSSTPSTKDIHKCFCCGTILAVPP
                     RAGKFRCSICQTTNILVELITKPELDERIGMEKGSEPISVASVKSLIGECYDRLQKNK
                     TDLGSSKSLHEIFDPLGKYLYDVFSSHDLLNKAFFSKPQYEMLNSSNKTNSVHVDRKG
                     IKEVFFLLTTLPTKRPLYYALKGANCSLRRLERVFTRGLDEDRWVFILFEIPFFQISL
                     TPPSVQKVPEMTDAPEIRMLCYEILKRCLGVLSNIHDSKKTKQIVLNFARMDESAFFS
                     ILEVFNLYLSFQLKKYYCVANNPQNSHDGSHSPNSILVPSLEEDEEYYRVVALKAETE
                     SASQSLVSLLIPGNSKHLDAGPSRSYSSKKSRKENKIKLLQYGNDWRIHSVLVAISFL
                     FRANRLRSKPIPTYHFYNFLVDYVHIKVDFDTWQRDERRAQRKDAIMRDVLNSIHGSG
                     ARNSKSVNFNFYMCQYPFTISLGSKISILEHEARRQMERKAEEAFINSLDKRVVFDTH
                     LRISVRRDHVVQDSLRCLQNNLGSFKKSLRVSFLNEPGIDAGGVRKEWFMLLTKEIFN
                     PLSGMFSNIEDSNLLWFALGPTEREDMYQLFGSILGLALYNSTVLELNFPQALYKVLA
                     GKSLNQSDYKTLHPTIYRSLSSLRKVDANELNTLGLTFEVTYKDVLGTTQTKELIEGG
                     ADVLVDESNLEQYIDLYTLFFLRDGVSRQLDAFIDGFKNVIGGNALSLFDEEEIELLL
                     CGHTDHGIDVEILESVTKYTGWPSAQEAKNSTVIKWFWEIMQSMDQNHRKLLMSFVTG
                     SDRVPATGIQNLPFRIHLLNDNQDSCRLPLAHTCFNELAIYNYSSKEKLSQKLYRAME
                     ESSGFGIK"
     gene            <939354..>940465
                     /gene="FES1_1"
                     /locus_tag="PVL30_003503"
                     /old_locus_tag="LELG_02655"
                     /db_xref="GeneID:5233387"
     mRNA            join(<939354..939405,939873..>940465)
                     /gene="FES1_1"
                     /locus_tag="PVL30_003503"
                     /old_locus_tag="LELG_02655"
                     /product="hsp70 nucleotide exchange factor fes1"
                     /transcript_id="XM_001526047.2"
                     /db_xref="GeneID:5233387"
     CDS             join(939354..939405,939873..940465)
                     /gene="FES1_1"
                     /locus_tag="PVL30_003503"
                     /old_locus_tag="LELG_02655"
                     /note="BUSCO:EOG09264MIL"
                     /codon_start=1
                     /transl_table=12
                     /product="hsp70 nucleotide exchange factor fes1"
                     /protein_id="XP_001526097.2"
                     /db_xref="GeneID:5233387"
                     /db_xref="PFAM:PF00355"
                     /db_xref="PFAM:PF02921"
                     /translation="MSSSLAFRSLKNGLGLKNSVRALSSTTSQLSNYNQPDYSQYLNN
                     KPPQTARNIAYFMVGSMGLLSAAGAKSTVEAFLSSMAASADVLAMAKVEVKLGAIPEG
                     KNVIVKWQGKPVFIRHRTAEEIEEANDVDVSKLRDPETDAQRVKKPEWLVMLGICTHL
                     GCVPIGEAGDYGGWFCPCHGSHYDISGRIRKGPAPLNLEIPQYDFTDDSTLMVG"
     gene            complement(<940785..>942674)
                     /locus_tag="PVL30_003504"
                     /old_locus_tag="LELG_02656"
                     /db_xref="GeneID:5233425"
     mRNA            complement(join(<940785..942099,942268..>942674))
                     /locus_tag="PVL30_003504"
                     /old_locus_tag="LELG_02656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526048.2"
                     /db_xref="GeneID:5233425"
     CDS             complement(join(940785..942099,942268..942674))
                     /locus_tag="PVL30_003504"
                     /old_locus_tag="LELG_02656"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526098.2"
                     /db_xref="GeneID:5233425"
                     /db_xref="PFAM:PF09994"
                     /translation="MEQTTSLGFKSKFSFNSHGKLPVRENVEPKSLILCLDGTDNEFG
                     PKPFTNVLKLYTLLDKNNELQICYYQSGIGSSYKAESTKIVENNFVSSKYNHLNSRID
                     AMIAFSLSKHVLDAYEFLAKNYKSNDKVFLFGFSRGSFTARIVAGMIELVGLVHNASR
                     DTIVMAWDIYNNWEQAGQPAHDSSTFRMAQEFRKTFSRRDVKIHFMGLWDSINSIGFL
                     WDHNFPYTIRSCNVRHIRHAVSIDERRSKYKPQLFDGSMNNNCCTSEDVISECSSGTS
                     QNSQTSFSTYNRLVSLSPSLTSIGGYLRRRFLGSRPGFREPPLENNKNDVVEVFFPGD
                     HADIGGGWATSTDGDGDDYTDGGTVNGQSLSNVSLRWMLAQAVKHGVNFRQGALREWS
                     LKFPSFFSMTAKNHDALSLLSQTKTMPAEVKIDNKGPLLPSNPINGFAGRSEESLAHL
                     WFWWVLECLPVFYKCKDQNSYWRRAYEPNLGHQRVLPIDCVLHWSFFYRLHYISDYCP
                     KNVTEEAFPDQFLHSLVDFKVFKFNELKNYAKDITLEKIKHDWESSIWKKIPDELAEI
                     SSDFATL"
     gene            complement(<943298..>944155)
                     /locus_tag="PVL30_003505"
                     /old_locus_tag="LELG_02658"
                     /db_xref="GeneID:5233246"
     mRNA            complement(<943298..>944155)
                     /locus_tag="PVL30_003505"
                     /old_locus_tag="LELG_02658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526050.2"
                     /db_xref="GeneID:5233246"
     CDS             complement(943298..944155)
                     /locus_tag="PVL30_003505"
                     /old_locus_tag="LELG_02658"
                     /note="CAZy:GH132"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526100.1"
                     /db_xref="GeneID:5233246"
                     /db_xref="PFAM:PF03856"
                     /translation="MLFSKLSFAFFTISTVVAGPLVKCPFPKDKKLVAVAEDCENEGW
                     AMSPDEPCIPGKYCPYACPPGQVMNQWDPSAKTYSYPSSMNGGLKCNADGSLTNPMGN
                     KPLCVNGAGTVSVVNKAGKNVAFCQTVLPGNEAMLIPTNVAKDKETKLAVPGCEYYAG
                     SAAHYYVNPPGVSTEEGCVWGTADKEIGNWSPYVAGMNMDKQGNTYVTIGVNPKHIDD
                     HDGKTPNFGLRIVCDNPHDCVGLECEINPKNGYNTATGPTSGNSLNADFCIVTARHHA
                     KAKIEVFEV"
     gene            <946554..>949784
                     /locus_tag="PVL30_003506"
                     /old_locus_tag="LELG_02659"
                     /db_xref="GeneID:5233189"
     mRNA            <946554..>949784
                     /locus_tag="PVL30_003506"
                     /old_locus_tag="LELG_02659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526051.2"
                     /db_xref="GeneID:5233189"
     CDS             946554..949784
                     /locus_tag="PVL30_003506"
                     /old_locus_tag="LELG_02659"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526101.2"
                     /db_xref="GeneID:5233189"
                     /db_xref="PFAM:PF17034"
                     /translation="MAASIVRTPQWDDSYEQQFIAIPPSGNEVKLYSTHREDPHVESN
                     TMVQLHSRKGFDNIQCSSYLTTQPGVLGVGSITGTVSIFNIKDQTIPEIHLRPKQPRP
                     CNAIAFNMTNMVAVGYDKGRQDNSLQIWDIEESLRIRAGAEVTSSISTGLSTSTGSRH
                     RAPVSSYLPNEAVLSTSFFTDSEYNLICGSYKFLRQIDLRSDAPVFQMATKCTLGLTM
                     DPFQPNLFQSYSEDGSLAIWDRRKLTVSGGSGGHGASQKTSSSGSNSIVITESPVLQF
                     NKLLSELPVRKIHNSCIRYSTMRRGEFAAIFNGDLIRRWHTGIVPASAENYSVGSGAG
                     GAGGASDIALSTISEQSNSETNPVLQSLKTQASKLYRSNEDSIFVSMVLDNKTDYEKV
                     VSFDYSPDLNSHTSTNFVCMRQSGTVFRMPVVESIEGLDFNPSNEFTIVGPEGTSTNF
                     VSQDVGNNHQNIMDKSSKSLEKLTIKHRMRRPSDRHNPGLNGYGNYGGGKNNDGDDDD
                     DDDDYDIETEELSTTVDDGDQSIINGGDTNREIDYRRASTDEDLVPLNKLLRPDDIFK
                     NDICLVIKRRAAMGYALDPEINYQILQELDPNDYQLSLRNTWKWLGLAKKSLEKGTMV
                     SEGIDLGYQGVSGIWNGAEALNDQKRIMSTGGPISNAWYTQAVRAITAAKGKKISGIH
                     IPVNSEKKSLRKLCLIVSGWYLTEDEFEEKLQLLVSMGYVTKAAGWAVFHGNISKAIE
                     ILSESKKERYRLMATAVAGYLAYKDTNVNSPWKDQCRKMASEMDDPYLRAIFAFIADD
                     DWWDVLDEHSLPLRERIGVAIRFLSDKDLTVYLNRIADTNVHRGELEGLILTGITSKG
                     IDLLQSYVDRTSDVQTAALMAAFACPRYFTDPRVKHWIDSYRAMLNSWGMFKVRAKLD
                     VARTKLSKSLNGRTTIQATPKQFYLQCTRCNKNISKPKSINMGQQAGGFNTANNQMLL
                     KQFSKASNKRNEIVSSCPHCGAPLPRCAICLMSLGSLIPSTDAIERVHSNSTSSKTLA
                     VKNNFKSWFSFCLSCNHCYHAHHAEEWFSKHYKCPVPDCDCQCNSK"
     gene            <950663..>954139
                     /gene="PKC1"
                     /locus_tag="PVL30_003507"
                     /old_locus_tag="LELG_02660"
                     /db_xref="GeneID:5233164"
     mRNA            <950663..>954139
                     /gene="PKC1"
                     /locus_tag="PVL30_003507"
                     /old_locus_tag="LELG_02660"
                     /product="Serine/threonine kinase"
                     /transcript_id="XM_001526052.2"
                     /db_xref="GeneID:5233164"
     CDS             950663..954139
                     /gene="PKC1"
                     /locus_tag="PVL30_003507"
                     /old_locus_tag="LELG_02660"
                     /note="BUSCO:EOG09260NHN"
                     /codon_start=1
                     /transl_table=12
                     /product="Serine/threonine kinase"
                     /protein_id="XP_001526102.2"
                     /db_xref="GeneID:5233164"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF00130"
                     /db_xref="PFAM:PF00168"
                     /db_xref="PFAM:PF00433"
                     /db_xref="PFAM:PF02185"
                     /db_xref="PFAM:PF07714"
                     /translation="MSNNPTKQDRSEAIKDIKSKIAIERNIIQGYQDVKRNSTNAEVV
                     QKCKSKIVESQTLIDFYSDSLNKLMRQMRELDTKSSADDDRSSRSRMSVTKPTFSRFD
                     LIKYECPSLGHKIQHMIQQLQFKLQVENQYREANMKISHLYLMDGDKSSSNAAEGGRA
                     ESDQKIQLLEKTLRKYQSFNINYDDFNKDYEIMDTPKHVRKPLSGKLTIGVTCVRDVD
                     HMATAAFKKRETIVVVKIDDVEKARTRPSKNDNWSEEMIINVDKSHEIELTVMDKQAG
                     NYVPIAINWLSLFDLAEEIRKKKVANDPGASGWLPASNLPQTSDYDQTPFQSSSNTSQ
                     GSSLTLPVQNDLAPSKSPIKGDRDVSERQKISVNTWISLEPCGQMLVNLNFEKSVSEG
                     KQFAGPLGRHGAIRQKKEEIFEQQGHHFVQKQFYNIMCCALCGEFLRYTGFQCQDCKF
                     LCHKKCYQKVVTKCISKPGSNDDAAQLKHRIPHRFEPITNHGTKWCCHCGYLLPWGKK
                     NARKCSECGVMCHAHCTHLVPDLCGMSLQMANEILATIKSTKVSPKKDSPTREKFVPS
                     GNEHQSPLSQQRQKPKALPPKPATSAMPSYNVVPTLNNQYQQHKSHREDDRNIEKPFE
                     SKLPTTYQNHQLQEPAAVNEYPRAGRRRPPTTETEEQAEQAEQEEDGKRGTEAVRQSR
                     AFAAEKNQLQTPEKHRNQSIFGHEDDDNDDDDDDDDEYAQQHGGAHNKARSNVSEVQY
                     DGKNIDLSQTDIKNIKDNDGKRDNIRNTFENFEYNNHSTQDQVVPMDVDTSNHVESPF
                     ADQHQQLQKEPSKAHSKSSKSKRRRRKVGLDDFQFLAVLGKGNFGKVMLAESRHTQKL
                     CAIKVLKKDFIVENDEAESVKSEKRVFLTANKEMHPFLLNLHCCFQTENRIYFVMEYI
                     SGGDLMWHIQNNRFTARRAKYYACEVLLGLKYFHDSGIVYRDLKLDNILLTTKGHIKI
                     ADYGLCKENMWHGNTTSTFCGTPEFMAPEIVTGKKYDRSVDWWAFGVLLFQMLLCQSP
                     FKGDDEDDIFNAIEHDEVKFPVSLSGPTVLVLQALLTKDPQQRLGSSERDAEEIMEHP
                     YFQDVNFDDVLNCRVPPPFIPELKSEHDYSNFDKEFTSETPRLTPVETVLTSEMQEQF
                     RGFSHISDHASI"
     gene            complement(<954487..>955491)
                     /locus_tag="PVL30_003508"
                     /old_locus_tag="LELG_02661"
                     /db_xref="GeneID:5233606"
     mRNA            complement(<954487..>955491)
                     /locus_tag="PVL30_003508"
                     /old_locus_tag="LELG_02661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526053.2"
                     /db_xref="GeneID:5233606"
     CDS             complement(954487..955491)
                     /locus_tag="PVL30_003508"
                     /old_locus_tag="LELG_02661"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526103.2"
                     /db_xref="GeneID:5233606"
                     /db_xref="PFAM:PF00071"
                     /translation="MSGEMCQDNLKVLTSKYGICVIGYNKVGKSSLIFNYVHEKVEDN
                     IDNEDVYPKRIYNDKLRQYESILLYDSNFGREDMFSGSQRRPIENATTLAFVYSVTDI
                     DSFNAVEEYYNGVRLFLKSDQFPPFVIIGTKSDLVDERRVYSHDGQTLADKLGALAFH
                     ECSAMKNEHVQDCFQELVNHITSITEQQQASRRKSDALEISANLSRESSKSLFYVPTI
                     DEANNDHYLDLDQNQNQDPEQIENENENKNENKNKSQDLDQKKRTTSKLDLNGFLKES
                     HSVEPVANISLSLVKSKNKPTLEKKSSYSRQRSQSIRRSRYSDDDNDESSNSKCCSIV
                     "
     gene            complement(<956960..>960457)
                     /gene="MAK21"
                     /locus_tag="PVL30_003509"
                     /old_locus_tag="LELG_02662"
                     /db_xref="GeneID:5233281"
     mRNA            complement(<956960..>960457)
                     /gene="MAK21"
                     /locus_tag="PVL30_003509"
                     /old_locus_tag="LELG_02662"
                     /product="RNA-binding ribosome biosynthesis protein mak21"
                     /transcript_id="XM_001526054.2"
                     /db_xref="GeneID:5233281"
     CDS             complement(956960..960457)
                     /gene="MAK21"
                     /locus_tag="PVL30_003509"
                     /old_locus_tag="LELG_02662"
                     /note="BUSCO:EOG092612XD"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-binding ribosome biosynthesis protein mak21"
                     /protein_id="XP_001526104.2"
                     /db_xref="GeneID:5233281"
                     /db_xref="PFAM:PF03914"
                     /translation="MSTGLNLSNLKDKISNKLNQSKPGSTGRGKKDKRGSKKNQKTSN
                     KKEDKEFKEKANENPKEESTDDILRQEALALGATEEDLKLLAGIESGEESEMEFGDDS
                     QQTSDKSLNNELSKFMNGIGLGNGEVPVVEEEEEEEEEEEEEEEEEEEEEEEEEEEKE
                     DEVDDDSREITAEGHAEVEDEDSQENEDSNVSVTDFSGSSDEEEEEEEEEPEDVPELV
                     YDDGTLNSSSKSKGNENKEILESSENNTNEDVQSGKETNEADPAVTAPSEISDFSSVS
                     SDKLKVPSRLDWYNSFSLPTVEVPKLDRFARERLLDRAKLTLDNDNKTYLEEFASNTS
                     QKKFLSQILTSGTLNDKISALTLLIQEAPMHNIKAMETLLGYCEKKSRTAALQSITAM
                     KDLLLNGLLPDRKLLAFDKQPLTKEDSDSRLAVYYFEDMLKKWYFKFIQILEKLLQDS
                     IVHVRMSALTHTFDLLSAKPEQEVNLLKLGVNKLGDMDNKVSAKASYSILQLQQAHPA
                     MKKIIVDAVIDIIFQSNNDDHSKYYGVTTLNQTIITRKEVELANTLVKTYFALFEKVL
                     LESNSLSKDGEGDKSNNNGVGKSEKGRHNNRKNFKKGKKGGRSVKKEEKTEHEIIEEK
                     NTKMFSALLTGLNRAFPFSELPNDVFQVHLDTLFKITHSANFNTAIQALVLINHIVSQ
                     QKINSDRYYRTLYESLLDSRLVNTSKQGIYLNLLYKSLKHDKDNVPRVLAFVKRIMQV
                     ILHWLNVGAIAGMLFLLIELSKTIPEVFDLLVEKAARPDQDEESEKQQAQVEVQKQKQ
                     KQEQEQEQEPKSLDEKEITPDSLYDPKKRDPTHANAQNSSLWEINQFLNHYHPTVAIY
                     ASSIIDGTPQPKPDLGLYTLAHFLDRFVYKNAKQKAQTKGSSIMQPLGGTHTGDLLVK
                     STNVLNKEVPANTENWLNKKVTDIKADERFFHQYFTTKVQKIKNKKVHKDGDVGDVDI
                     DDEIERDGDMDDEEVWKALVKSKPDVEDDISDGGFSDFDEADFSDMDDDDDDDDDGDQ
                     ENDGEREGELPSDLDEDGEDVVGEVDFSENEGSFDEDEEDDFDEEEREMFNINQDDEF
                     SDSEVDLDALNGVDEVEEEDEEEEETEGESELVEKTNKKRSRADEKDSLKKGKKSKRQ
                     RVKDLPLFASPEDYAQYLE"
     gene            <961100..>963385
                     /locus_tag="PVL30_003510"
                     /old_locus_tag="LELG_02665"
                     /db_xref="GeneID:5233458"
     mRNA            <961100..>963385
                     /locus_tag="PVL30_003510"
                     /old_locus_tag="LELG_02665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526057.2"
                     /db_xref="GeneID:5233458"
     CDS             961100..963385
                     /locus_tag="PVL30_003510"
                     /old_locus_tag="LELG_02665"
                     /note="BUSCO:EOG092618M2"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526107.2"
                     /db_xref="GeneID:5233458"
                     /db_xref="PFAM:PF00628"
                     /db_xref="PFAM:PF10513"
                     /db_xref="PFAM:PF13771"
                     /db_xref="PFAM:PF13831"
                     /db_xref="PFAM:PF13832"
                     /translation="MTTAYQNSMKPREEYELTEMYPDLAESVPMPVFFVMGDTECDRE
                     DGTGYKNGKAFNSTSGILNLKTPTFKKITSTMPNATVKFNKQLQEFGFQEPSKINSKN
                     KIQDTYIRPFEIANTKNTNKNASDSEIAVKQFLESKQMLVEYDMDEQDFLFLQARNKK
                     TTNVVKITPEVFEILISALETEWTKLEHTMNSMTGGIDSNGTDSSKKLLTMGHNNEMY
                     GNDDGIEPGSIYDQRCAVCNDSDCDNTNAIVFCDGCDIAVHQECYGVAFIPEGSWLCR
                     KCMINKNKSVTECVFCPSTTGAFKQLDNSLWSHVVCALWINELYFANPIYMEPIEGID
                     AIPKSRWKLACYICKQRVGACIQCANRNCFLAYHVTCAKRAGLYMEMTQGMKGALTNK
                     LTLKSFCEKHSPPSFDTGGVTKGIERTRRYFRDTKILKQENAKLKTDQKIANKLNVFK
                     WKTEQGTPIAPKLFSDVLVGLMYKLKVENQVSLPEESSSQVLELSRLPNRTKEDIYRD
                     LRNIANEMCRYWCLKRESKNGAPLVRRNNNLMSANSIVYDSNNLENDTMSSSQIAEKI
                     GFANLLIDDIEKLISINGDNIGRQEYLAAMELLNLEIVKTAYFPLRTFIETVVNSLRQ
                     RYDFNGAIFNYKPKDASCKSLLQILAKNDRFAYHSIEEFQSDINSLSSCVFAENRPSF
                     MVYKQMKKWKRDFDERVKSVEFRDGDIVQYPRLNLCGTETTFKEPSYRRILDENELSE
                     VEDDEIESEESKKLLTEFLAK"
     gene            <964780..>967080
                     /locus_tag="PVL30_003511"
                     /old_locus_tag="LELG_02666"
                     /db_xref="GeneID:5233315"
     mRNA            <964780..>967080
                     /locus_tag="PVL30_003511"
                     /old_locus_tag="LELG_02666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526058.1"
                     /db_xref="GeneID:5233315"
     CDS             964780..967080
                     /locus_tag="PVL30_003511"
                     /old_locus_tag="LELG_02666"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526108.2"
                     /db_xref="GeneID:5233315"
                     /db_xref="PFAM:PF01285"
                     /translation="MSFQSINPRVDNSSIYTERENYNENSAQIRSPAIKQTNTPTSVS
                     RSKSKHSHKRRARLPIIVDVALDRNGKQVYQVHETTKLVRSEMPKSLSFSSNYHVGQD
                     GTVTQPHAMPNAMPNTMPHSMPHSMPHTMPHTMPNANLPNTDLLADKSSGLQHYKSQQ
                     HTSSYAASPAHTHLIDDDIWSQDVERAFEHVLQFIPKSNSNKIKIAGRSCGRNELISD
                     YIYAKTGKRRTKKQVSSHIQVIKNLGQKTSIIQLINDGPTFSNEEDKEKMMKIFEKVF
                     TRIYLDMSIGVDDVRRGSLMDDEQEDEVSKSQQRRRRRRTKMTTATTATTATTATTLT
                     GNNNSDIDASNIVVNQFAMSLQKEPDHSSCSLLTKFTSLATDLPKKQFNPEIFVKFPD
                     MREFVHRPNIAVIHNTVNLFIPEIPTDKEVASLDSMYELRSTPNTIESAKSTKSTKSF
                     NSFTSIYSFGKPVFKFEDSHFKLYEKRNFLPEFWKPFLCSLAGTSSSNLDLIFSGLTM
                     KQIIYESKGLKHEHDSSYTSKSRIRVILLWEFSRVHRLEDGFTTSIPILLKTPDMPSL
                     LNPDIGDEFQRIDRNMGRGTFEATNLPLSVTDKPNNNENISQRQVSGPAIPPPLPLGA
                     ATAATATATAATATATAATTIPAAPIAASSLSSAHVPSHLPAFVPGQGLALARDQSGY
                     VWRHPLTHHPNSQLVNQSSIQNQFQFLSSQQQGYPPNVNYANPNSGQIVYFDHPSSME
                     THHTYSGTNYVPEEHYQPTGDEYHHQ"
     gene            <967877..>969583
                     /gene="ADE2"
                     /locus_tag="PVL30_003512"
                     /old_locus_tag="LELG_02667"
                     /db_xref="GeneID:5233249"
     mRNA            <967877..>969583
                     /gene="ADE2"
                     /locus_tag="PVL30_003512"
                     /old_locus_tag="LELG_02667"
                     /product="phosphoribosylaminoimidazole carboxylase ade2"
                     /transcript_id="XM_001526059.1"
                     /db_xref="GeneID:5233249"
     CDS             967877..969583
                     /gene="ADE2"
                     /locus_tag="PVL30_003512"
                     /old_locus_tag="LELG_02667"
                     /note="BUSCO:EOG09261D4D"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphoribosylaminoimidazole carboxylase ade2"
                     /protein_id="XP_001526109.1"
                     /db_xref="GeneID:5233249"
                     /db_xref="PFAM:PF00731"
                     /db_xref="PFAM:PF02222"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF17769"
                     /translation="MDSKSIGILGGGQLGRMIVEAAHRLNIKTVILDAPESPAKQINA
                     LDEHVDGSFTDYSSIEKLAEKVDILTVEIEHVDVDALKRIQTKFPKIEIYPLPETIKL
                     IQDKYLQKQHLIQHGVAVTESQAVAENSAADLEKIGEEYGYPFMLKSRTLAYDGRGNF
                     VVKDKSYIPKALEFLAERPLYAEKWCPFTMELAVMVVRSIEGEVFAYPTVETVHQNNI
                     CHLVYAPARITDTLAKKAQLLAQNAVKSFPGCGIFGVEMFLLPSGELLINEIAPRPHN
                     SGHYTIDACVTSQFEAHVRAVAGLPMPKGFTDFSTSITNAIMLNVLGDKETPNKELET
                     CRRALETPHASVYLYGKTTRPERKMGHINIVSSSMGDAENRLSYIMGESKKIPEVPES
                     ERVQPLVGIIMGSDSDLPVMAVGARILKQFNVPFEVTIVSAHRTPHRMSQYAIDAPKR
                     GLKCIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATV
                     AINNSTNAALLAIRILGAADSHWLNEMSTYMNNMESEVLGKAEVLEDIGYEDYLTDKL
                     KK"
     gene            complement(<970011..>970352)
                     /locus_tag="PVL30_003513"
                     /old_locus_tag="LELG_02668"
                     /db_xref="GeneID:5233453"
     mRNA            complement(<970011..>970352)
                     /locus_tag="PVL30_003513"
                     /old_locus_tag="LELG_02668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526060.1"
                     /db_xref="GeneID:5233453"
     CDS             complement(970011..970352)
                     /locus_tag="PVL30_003513"
                     /old_locus_tag="LELG_02668"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526110.1"
                     /db_xref="GeneID:5233453"
                     /db_xref="PFAM:PF10338"
                     /translation="MAKSLRSKSKLQAKSVKRKGEFAKFVDARNQRIAEKLHQETLKQ
                     EAKKKEEKENEGKDKDASDATDAAAAAAMDVDAEKKEKKISTSGWRSSNSQRYKQDQL
                     KKRVKKKVMKF"
     gene            <971386..>972324
                     /gene="RPL19A"
                     /locus_tag="PVL30_003514"
                     /db_xref="GeneID:85890371"
     mRNA            join(<971386..971402,971757..>972324)
                     /gene="RPL19A"
                     /locus_tag="PVL30_003514"
                     /product="60S ribosomal protein L19A"
                     /transcript_id="XM_061119488.1"
                     /db_xref="GeneID:85890371"
     CDS             join(971386..971402,971757..972324)
                     /gene="RPL19A"
                     /locus_tag="PVL30_003514"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L19A"
                     /protein_id="XP_060975471.1"
                     /db_xref="GeneID:85890371"
                     /db_xref="PFAM:PF01280"
                     /translation="MDYEIVANLRTQKRLAASVVGVGKRKIWLDPNETTEISNANSRA
                     AIRKLYKNGTIVKKPNTVHSRSRARALKESKAQGRHMGYGKRKGTKDARMPQQVLWMR
                     RLRVLRKLLAKYRDAGKIDKHLYHNLYKAAKGNTFKHKRSLVEHIITAKAEALREKAL
                     KDEAEARRVRNRAARERRQQRIAEKREALFAEEA"
     gene            complement(<972943..>974889)
                     /gene="RAX1"
                     /locus_tag="PVL30_003515"
                     /old_locus_tag="LELG_02669"
                     /db_xref="GeneID:5233468"
     mRNA            complement(<972943..>974889)
                     /gene="RAX1"
                     /locus_tag="PVL30_003515"
                     /old_locus_tag="LELG_02669"
                     /product="Bud site selection protein, Revert to axial
                     protein 1"
                     /transcript_id="XM_001526061.1"
                     /db_xref="GeneID:5233468"
     CDS             complement(972943..974889)
                     /gene="RAX1"
                     /locus_tag="PVL30_003515"
                     /old_locus_tag="LELG_02669"
                     /codon_start=1
                     /transl_table=12
                     /product="Bud site selection protein, Revert to axial
                     protein 1"
                     /protein_id="XP_001526111.2"
                     /db_xref="GeneID:5233468"
                     /translation="MYDEKYQSNFPNSNYLSNLNNLNGTNQSIHLNRLPTLGEILANK
                     SKSPVDLFTFYQFMKDVEGKVDYLDFWFDLINHLNLCKHYVKGLRDSIVRQSGTFSHH
                     NNNRLSQSHQSGAYTNDTLDLQQQSQQSQQSQQQPQAQQQQSQQQSQQRFSAPRNAMH
                     RSSDSPSIPSNRQSSGARPISETSQKHKSLSSSILLDLIINDNILEENDSHRLSAFLR
                     GDISLDNIDPKLKELIEQYNAETDAENRYSNEPLQSPLSPAFQTSARSSASLGSRSNN
                     PFLPQQPSPKLKHSQRQEKRVSSQSHLIDQYNDDDFLDRDHDHDHDHEDDDSSVDLHP
                     HSGDSLYDNQLDIGQADRAVHASKYVSLNSNSNNNNNNNNNNFNANANANTDTNHQQQ
                     IHNMQNTQPLAQPPNMFGDTGNLVYPQPKNKRASVINPSLLERLIRDSPAMSNKASSF
                     VTRDNLRGSSHNLLLKYFVEDSEKNLNLPPQLNSYIIKSIEVDGRDDPDIFNYVKTFV
                     FNKLENDHLPKFLDFTATRNINHSNFGRIITGFFFLFGAFWISFIFVFLNYRKGLRPV
                     IVAPFFIAFYFIISSIYLVDPILAWLGLSETFSKSNGKSILRIEEKFIYKFIVKRSLW
                     VMFLILVMTAIFTVLFSLVPGHRL"
     gene            <978742..>979839
                     /locus_tag="PVL30_003516"
                     /old_locus_tag="LELG_02670"
                     /db_xref="GeneID:5233231"
     mRNA            <978742..>979839
                     /locus_tag="PVL30_003516"
                     /old_locus_tag="LELG_02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526062.2"
                     /db_xref="GeneID:5233231"
     CDS             978742..979839
                     /locus_tag="PVL30_003516"
                     /old_locus_tag="LELG_02670"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526112.2"
                     /db_xref="GeneID:5233231"
                     /translation="MKSKWTSASGIKERFKKTIDSEDEHQKSHLPHGRQSHYGHVHRR
                     HRYRQYLSSDILESDKVQSMTSAAASTYNTTRSLTKSSWRIMKDATIMCTEVTVSATA
                     HAYTALSGGSSGGGSGGGNSSSGINSNAQTSSSERIVQEDEELELEQEQIPISKVQRR
                     KSKSSGKKNRKINRAQLRNNHPNVSFATNTQCTPSMPSLLLKQEQQEQQEQQHGYQKS
                     SLQTRRNHTMTTSNILSRYPSPLPIQSDISYDVDVDSLTISSRSSTISEVELSQVHIE
                     CRSEDNNLFSRHCRRCQVGIRDKNMDKNKDKNRTRNRNRNRNRCKGSGRCRGIEKKCM
                     SSVKGFENINLLELGILCLVMVMLFVIIKMK"
     gene            <982730..>983857
                     /locus_tag="PVL30_003517"
                     /old_locus_tag="LELG_02671"
                     /db_xref="GeneID:5233244"
     mRNA            <982730..>983857
                     /locus_tag="PVL30_003517"
                     /old_locus_tag="LELG_02671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526063.1"
                     /db_xref="GeneID:5233244"
     CDS             982730..983857
                     /locus_tag="PVL30_003517"
                     /old_locus_tag="LELG_02671"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526113.2"
                     /db_xref="GeneID:5233244"
                     /translation="MLTLSKWTGVSFIKNRLGRSNSLNDGQTRPTSTTPIPPIPQPQP
                     QPSMIINSSQNKTHNNRTKTRSSTSNNNGTSNSTTTIVNTSTLGKAPPIVKSNSTTAL
                     LKRRKNTFRQSHHSHRRDTDPASILLSSSSPPPSPSSQTPAHSLSSSSSKGRKLSLKK
                     KGKHTSNRLSINRAQILQSVPTQDQLRKGARPSMEIPSSLFLNASTELTSPPKSPKSF
                     SPASVHSTEYFAEIEDKLNSQFNNYTISTSLPSSFEKPRHASILSPTDYLTIDINKDQ
                     ESVYNFEGINEDDDVNEEEEEEEEEEEEEKERNSGDLGGCPMLPLFSATRNVELSTSS
                     LGLKQDRYVEEGSKVEFETKRKGSGKVDGELAPKKRSVRFA"
     gene            <986211..>988888
                     /gene="KRE9"
                     /locus_tag="PVL30_003518"
                     /old_locus_tag="LELG_02673"
                     /db_xref="GeneID:5233401"
     mRNA            join(<986211..986769,987328..987339,988137..>988888)
                     /gene="KRE9"
                     /locus_tag="PVL30_003518"
                     /old_locus_tag="LELG_02673"
                     /product="Cell wall synthesis protein kre9 precursor"
                     /transcript_id="XM_001526065.2"
                     /db_xref="GeneID:5233401"
     CDS             join(986211..986769,987328..987339,988137..988888)
                     /gene="KRE9"
                     /locus_tag="PVL30_003518"
                     /old_locus_tag="LELG_02673"
                     /codon_start=1
                     /transl_table=12
                     /product="Cell wall synthesis protein kre9 precursor"
                     /protein_id="XP_001526115.2"
                     /db_xref="GeneID:5233401"
                     /db_xref="PFAM:PF05390"
                     /db_xref="PFAM:PF10342"
                     /translation="MIIVKQSKSLLNKVTPDILTGQRSPSPSPSSLEPPSPKSNNVSR
                     RSTVSHHNHHTGSVNGAHSPPNSPSTHKGINYAGGGSGGTYFADHDISPVSSLDPDAD
                     LENTDNVKHLKDTLRRGRSSKHHGHNNGHSHAHGHNRQHRGNHKEDRDDAQREEKEAG
                     ATSSTTTTTGAVSREKRTGSNTLYEIKKGKADVEITSPESGDSFAASGGTAAVKLEWK
                     DSDDSDSDLSLDNVKTYTISLCTGSNSAIQCLDPSIDQEKLSSKSQTINIDSTDVPNG
                     YYYFQIYTVFTNGADTIHYSPRFKLTGMSGATGTFTVTATGDPPAGATENYDVATNTD
                     FSKSFTVPYTLQTGKTRFAPMQMQPGSTVTATTWTRRFPTSAVTYYTTKSKSPVVMST
                     ITPGWSYTMSSDVNWASVAPYPTYWYPASQRVSTASITATKKKRRWLD"
     gene            <989477..>991465
                     /locus_tag="PVL30_003519"
                     /db_xref="GeneID:85890372"
     mRNA            join(<989477..989801,991275..>991465)
                     /locus_tag="PVL30_003519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119489.1"
                     /db_xref="GeneID:85890372"
     CDS             join(989477..989801,991275..991465)
                     /locus_tag="PVL30_003519"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975472.1"
                     /db_xref="GeneID:85890372"
                     /translation="MCMNYPKSKPITDLSVNSNETNIVDMGCATFKQSIDGHLVSAIR
                     DETNHFVNDMDHQEITNGNGITGTNSSFAVDLEKQALKVKETVESGECGDNNNINNNN
                     NNNKNNKDVAQCLSRESTGSLIGERICSSLVRCPEADKLGMTRWYGPSGVLQEVSKGA
                     TYWLVASLITS"
     gene            <992685..>995210
                     /gene="KRE6_1"
                     /locus_tag="PVL30_003520"
                     /old_locus_tag="LELG_02674"
                     /db_xref="GeneID:5233372"
     mRNA            <992685..>995210
                     /gene="KRE6_1"
                     /locus_tag="PVL30_003520"
                     /old_locus_tag="LELG_02674"
                     /product="beta-glucan synthesis-associated protein"
                     /transcript_id="XM_001526066.1"
                     /db_xref="GeneID:5233372"
     CDS             992685..995210
                     /gene="KRE6_1"
                     /locus_tag="PVL30_003520"
                     /old_locus_tag="LELG_02674"
                     /note="CAZy:GH16"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-glucan synthesis-associated protein"
                     /protein_id="XP_001526116.2"
                     /db_xref="GeneID:5233372"
                     /db_xref="PFAM:PF03935"
                     /translation="MSSNRPRHLTNDNSFNGHAGSTQSLSTDGQNAGTIQLKNPFETS
                     SSSEEEIRTKENLPPRGVKEASNSSIELLSKSTSSSGYQQSKQQQQQQQHHHHHHPYI
                     GSSRNYGNQPYSADGSYIDESEANLLNNPSTASDYSSSSLTSSSTPGIQFIPPNTQPY
                     PSASGTTTPTNLHQKYTQNPVRGEQLSIKRPPSYDRYPLINEKKASSNFASDFEGSSL
                     QSQSQSQSQSQSQFQNQQYPPHPDSPFATPINYNSKHGQEYYKKIGQGQQDQQQQQQQ
                     QQLSSSSSMQMMRTTDPQYYGERKNFNSNSQINSQTNSLYKYTDYSPFGGYPASSFPL
                     DINDKEADDHLHNPDPIQDAKYEKNRFWYDLKNGDSRSRLGIAGFVFLLAAAIAVFVV
                     LPSLTYTGVTDHKAVPLTYSILTQYKYPTLSAIRQSLIDPDTPSDARTIEARDGSDWS
                     LVFSDEFNVVGRTFYEGDDQFFTAPDLHYDATKDLEWYDPDAVTTANGTLTLQMDAFK
                     NHNLFYRSGMLQSWNKMCFTQGRIEISARLPNYGTVSGLWPGLWTMGNLGRPGYLATT
                     EGVWPYSYDSCDSGITPNQSSPDGISYLPGQRLNKCTCPGESHPNPGVGRGAPEIDLI
                     EAEVMTDATGKKENNGVASQSLQIAPMDIWYMPDYNFIAVHNDSVTTMNTYAGGPFQQ
                     AISGITTLNITWYERSEKPGQPHLFQSYGYEYLNDNDNGYLRWFVGKTPTLTLQSTAL
                     HPNGNIGWRRISKEPMSIIMNLGVSNNWAYIDWASLVFPAMMRVDYVRVYQPSNAINV
                     GCDPDEYPTYDYIQDHLNIYENVNLTNFEDAGYTFPKNSLLGC"
     gene            complement(<995897..>997879)
                     /gene="NCA2"
                     /locus_tag="PVL30_003521"
                     /old_locus_tag="LELG_02675"
                     /db_xref="GeneID:5233220"
     mRNA            complement(<995897..>997879)
                     /gene="NCA2"
                     /locus_tag="PVL30_003521"
                     /old_locus_tag="LELG_02675"
                     /product="Nuclear control of ATPase protein 2"
                     /transcript_id="XM_001526067.1"
                     /db_xref="GeneID:5233220"
     CDS             complement(995897..997879)
                     /gene="NCA2"
                     /locus_tag="PVL30_003521"
                     /old_locus_tag="LELG_02675"
                     /note="BUSCO:EOG09260VCG"
                     /codon_start=1
                     /transl_table=12
                     /product="Nuclear control of ATPase protein 2"
                     /protein_id="XP_001526117.2"
                     /db_xref="GeneID:5233220"
                     /db_xref="PFAM:PF08637"
                     /translation="MDILSLGITPNSSRSNKVLRIINNNNRVSIAIKSQFERLNSFTK
                     TFLATQYQQQQQQQQKEEHGLNIQSAPHESLQPMENERLQDAFKDLYFLLDIENFNFE
                     KVSDIGLDKLAPIYAKLNGVKAQNQNDETTLKLVNEYLVLILSLNLSNSLIYKTLVLK
                     NQQVYWETIHNSTVNKLIYFIQTCPVKLYKFVETIVVKANRIISSNFHSASEIEAGAV
                     VENVSNWKKFKRFAIAIARSIVQTAETLFIEDNPAITLLSKSNTSRLSSFKWYITSIV
                     KSPITITNKEIKSKIREIKSEIRINTQHIDQFIKADATNLLPTLVKVLDFGNSTESGT
                     LPASKNPILQATSALERFNDKQYTSTSKPSFITRYWPIIILVLFYAPSQTRNIYNNRE
                     EIVYWIKYNGIEPIKGFFVNWVVGPINEMLNILRSDSGMTITSRDSLQSDVDSLEKMI
                     WEFAQDNNIETTPTAVSSDVRNGDLKLVMSRYEQEIRQPIKYIISGSLLRLILIQVQK
                     GKVDGAVAITGIDKLLKSQQLLFGLVSMSPSIIILYQVYRYLTSAKPIMVNGKQLNIV
                     CLKSLNSIENLLIMLQNNQSKKSKVDKEAKEDVYEGELLIEIINLIISAEPIIPKQLH
                     ADWIHDLNELNNSSFDLETKLYLVNRAWNMYGSYFK"
     gene            complement(<998446..>999201)
                     /gene="PRE9"
                     /locus_tag="PVL30_003522"
                     /old_locus_tag="LELG_02676"
                     /db_xref="GeneID:5233396"
     mRNA            complement(<998446..>999201)
                     /gene="PRE9"
                     /locus_tag="PVL30_003522"
                     /old_locus_tag="LELG_02676"
                     /product="Proteasome subunit alpha type-3"
                     /transcript_id="XM_001526068.1"
                     /db_xref="GeneID:5233396"
     CDS             complement(998446..999201)
                     /gene="PRE9"
                     /locus_tag="PVL30_003522"
                     /old_locus_tag="LELG_02676"
                     /note="MEROPS:MER0000554"
                     /codon_start=1
                     /transl_table=12
                     /product="Proteasome subunit alpha type-3"
                     /protein_id="XP_001526118.1"
                     /db_xref="GeneID:5233396"
                     /db_xref="PFAM:PF00227"
                     /db_xref="PFAM:PF10584"
                     /translation="MSRRYDSRTTIFSPEGRLYQVEYAQEAISMAGAAIGIVTSEGVV
                     LACEKKVTSKLLDDDGSAEKLYIINDQMICAVAGMTADASILVNNARVQAQQYLKTYS
                     EEIPCEILIKRVANIMQGYTQHGGLRPFGVSFLYAGWDDRYEFQLYTSNPSGNFSGWK
                     ATAIGANSSAAQTLLKKDYKEELTLKEGCELAIKVLSKTMDASNLNSEKLEFATLSLD
                     KEGKVLQKIWSDENIDSLIKASGVLDDKKNDDE"
     gene            <999827..>1000294
                     /locus_tag="PVL30_003523"
                     /old_locus_tag="LELG_02677"
                     /db_xref="GeneID:5233216"
     mRNA            <999827..>1000294
                     /locus_tag="PVL30_003523"
                     /old_locus_tag="LELG_02677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526069.1"
                     /db_xref="GeneID:5233216"
     CDS             999827..1000294
                     /locus_tag="PVL30_003523"
                     /old_locus_tag="LELG_02677"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526119.2"
                     /db_xref="GeneID:5233216"
                     /db_xref="PFAM:PF10190"
                     /translation="MSVFISSNNIPIGYRTPEFPSLFWPIGPTRGSYLNSFLYYSWDV
                     WRFTVYWSLILMGGLYFCVGLVAITSSVINNVRHKLPVGPSKIATSLLVLTFYVITGL
                     IKGFIGGAIIGIILAAIYQAGSLAMSCWIPLTWSIAQILYDIASSYSTSSIIL"
     gene            <1000717..>1002231
                     /locus_tag="PVL30_003524"
                     /old_locus_tag="LELG_02678"
                     /db_xref="GeneID:5233555"
     mRNA            <1000717..>1002231
                     /locus_tag="PVL30_003524"
                     /old_locus_tag="LELG_02678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526070.1"
                     /db_xref="GeneID:5233555"
     CDS             1000717..1002231
                     /locus_tag="PVL30_003524"
                     /old_locus_tag="LELG_02678"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526120.2"
                     /db_xref="GeneID:5233555"
                     /translation="MTQGSFDIDFIAINQIAYTFNKLVHSNNKDVYRDQLVAKAKETL
                     KLMDQYQAIHPSFSSLTSYLSSQGIADAEHLYNDSWAARVTTYSESFMLELADEIKGI
                     HESYSSALSQEQASALFDKVRKGVISRIIKTEYSDALRLLDKFASVVEFSNQPRGKDH
                     FQMNRFVEFLFLKYVATIFSLVWFPLDDNKYKVASGVYLKEGDKLLYSSSSFKPLDKI
                     YISITTYQRKNESLFEEQNDETRYYWIVKFLNLSLLFKQMDFVQFHNEFTELFINQKE
                     ALQNLVQDTSLIKSNLLVMYGIVSIFMKPFNQLSLLNIENDDFVELYYEDPTDIEFKF
                     YNKIVKPLGDGDNHEVKKAFADDNFMHELVSYLEYNLPVSTSKLAATTCSFIEYLKVI
                     IDSKLFLVIMSSTANITRRNMLRHLGYSLESTNESELHEVSNHLLGLISALGLGQIGI
                     GYLVKEQVFYNNGPPTTIEEIGQVQDSIDQTRHQLHGDSLAGLMTSLLIERLYN"
     gene            complement(<1002450..>1003573)
                     /locus_tag="PVL30_003525"
                     /old_locus_tag="LELG_02679"
                     /db_xref="GeneID:5233012"
     mRNA            complement(join(<1002450..1002501,1002555..>1003573))
                     /locus_tag="PVL30_003525"
                     /old_locus_tag="LELG_02679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119490.1"
                     /db_xref="GeneID:5233012"
     CDS             complement(join(1002450..1002501,1002555..1003573))
                     /locus_tag="PVL30_003525"
                     /old_locus_tag="LELG_02679"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975473.1"
                     /db_xref="GeneID:5233012"
                     /translation="MSVIEWKEHKGFCLAYEETVDQESRESKVTNGLECLPWSSFLPE
                     FEKDSNKYKLNDNDEEALEKEQLLQPPPSSSSSSLPSSSQSASSAPSPKKLSKSEKRE
                     LRQLKKVNAQRKRQLKRQTELEETGLEVESDTSFKPFLAKRDIKHIFTNIILNKAASE
                     TQDGEGSTNGDCSESRDEKGRRKGKAKANGNHSAKARDFKIFQYHSIAIYKSDLEHIL
                     PGEWLNDNDISFVYELITQAFINSGRCRDFANQVCLLFPSLIQLIQHFPAESIETLLP
                     MNDLLKSKFVFLPINYIEEPLEEINLEGSNNGDHWALGVLSLLENTLYVYDSMRVDDN
                     VNEERQKQDQDSTYAVRPTNEF"
     gene            <1004113..>1005681
                     /gene="ICP55"
                     /locus_tag="PVL30_003526"
                     /old_locus_tag="LELG_02680"
                     /db_xref="GeneID:5232950"
     mRNA            <1004113..>1005681
                     /gene="ICP55"
                     /locus_tag="PVL30_003526"
                     /old_locus_tag="LELG_02680"
                     /product="aminopeptidase"
                     /transcript_id="XM_001526072.1"
                     /db_xref="GeneID:5232950"
     CDS             1004113..1005681
                     /gene="ICP55"
                     /locus_tag="PVL30_003526"
                     /old_locus_tag="LELG_02680"
                     /note="MEROPS:MER0013463; BUSCO:EOG09261XGL"
                     /codon_start=1
                     /transl_table=12
                     /product="aminopeptidase"
                     /protein_id="XP_001526122.2"
                     /db_xref="GeneID:5232950"
                     /db_xref="PFAM:PF00557"
                     /db_xref="PFAM:PF05195"
                     /translation="MHPIISRISTAGLRLGSNFSKRSISVKTRPKVDIKLGQPTFETR
                     PHIIPQPGNLTPGISALEYFNRRLKLAAQLPDNSLAIIIGNSVQYSSGAVFYDFQQNN
                     DFYYLTGWLEPDSVMVLEKKGTGSRDEDVALHMLVPPNDPQREQWEGAKSGLEGAYEF
                     FNADYVEDISKAPVYIRKLLSSTSNVFYDNQSNGGHLTSKSSTFKSFFNLGGTDSKNQ
                     TLNDVIMNCGKPVNPLKKLVASQRSVKSPAEIEVMYAAGQISSRAINKAMGQVATTAP
                     FRTEKTLAKYLEYQFVKGGCDRQAYIPVVASGSNALGIHYTRNDDILYEDETVFVDAG
                     GKLGGYCADISRTWPNSSNGFSEPQKDIYSAVLNTNKACIDLCDESQNCSLHDIHEFS
                     VSTLKKELSNITGFQHVTAADVRQLYPHYIGHHLGLDLHDVPSVSRFDKLKEGNVITI
                     EPGLYIPETDAWPKSFRGIGVRVEDDIAIGKTAGETINLTSGCVKEIAGIESLVSKGI
                     TTPGIDDEVVVLDI"
     gene            complement(<1005902..>1006759)
                     /gene="PHB1"
                     /locus_tag="PVL30_003527"
                     /old_locus_tag="LELG_02681"
                     /db_xref="GeneID:5233020"
     mRNA            complement(<1005902..>1006759)
                     /gene="PHB1"
                     /locus_tag="PVL30_003527"
                     /old_locus_tag="LELG_02681"
                     /product="Prohibitin-1, subunit of the prohibitin complex
                     (Phb1p-Phb2p)"
                     /transcript_id="XM_001526073.1"
                     /db_xref="GeneID:5233020"
     CDS             complement(1005902..1006759)
                     /gene="PHB1"
                     /locus_tag="PVL30_003527"
                     /old_locus_tag="LELG_02681"
                     /codon_start=1
                     /transl_table=12
                     /product="Prohibitin-1, subunit of the prohibitin complex
                     (Phb1p-Phb2p)"
                     /protein_id="XP_001526123.1"
                     /db_xref="GeneID:5233020"
                     /db_xref="PFAM:PF01145"
                     /translation="MSQRIAEIVSKIALPAGVAFAIAQSSMYDVAGGRKAVLFDRLQG
                     VEQRVIGEGTHFLIPWLQKAIIFDVRIKPKVITTTTGSKDLQNVSITLRVLTRPDINK
                     LPTIYQTLGLDYDERVLPAIGNEILKAIVAQFDAAELITQREVVSARIRQELARRANE
                     FHIELEDVSITHMTFGREFTKAVEQKQIAQQDAERSKYLVEKAEQEKKASIIRAEGEA
                     ESADVVSKALAKAGDGLLMIRRLEASKDIATTLAGSPNVTYLPSNGTGAGGSEGASAS
                     NSLLLNLGR"
     gene            <1007845..>1009879
                     /gene="YRA1"
                     /locus_tag="PVL30_003528"
                     /old_locus_tag="LELG_02682"
                     /db_xref="GeneID:5232928"
     mRNA            join(<1007845..1008126,1009487..>1009879)
                     /gene="YRA1"
                     /locus_tag="PVL30_003528"
                     /old_locus_tag="LELG_02682"
                     /product="RNA-binding RNA annealing protein"
                     /transcript_id="XM_001526074.1"
                     /db_xref="GeneID:5232928"
     CDS             join(1007845..1008126,1009487..1009879)
                     /gene="YRA1"
                     /locus_tag="PVL30_003528"
                     /old_locus_tag="LELG_02682"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-binding RNA annealing protein"
                     /protein_id="XP_001526124.1"
                     /db_xref="GeneID:5232928"
                     /db_xref="PFAM:PF00076"
                     /translation="MSASLDKSLDDIISSSKKTFKSRRPGAKVGAKSNQNKVGKKLTN
                     GKAKKPATVSFNKPKAAAAVAAAAPAIDLSYATKVNVTGLPRDLKHDNVREFFQSQIG
                     GVNKVDMSYNEKGLFKGYATIIFKSSKNAALAVEKYNGASIDGGAGKLKLELIIDTSK
                     KPLAARITAKPVQQVRTPKAGAKAGAKKVLVKKNAVKAKKATKKPQKKKTVEELDQEM
                     ADYFEN"
     gene            <1010689..>1012704
                     /locus_tag="PVL30_003529"
                     /old_locus_tag="LELG_02683"
                     /db_xref="GeneID:5233055"
     mRNA            <1010689..>1012704
                     /locus_tag="PVL30_003529"
                     /old_locus_tag="LELG_02683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526075.1"
                     /db_xref="GeneID:5233055"
     CDS             1010689..1012704
                     /locus_tag="PVL30_003529"
                     /old_locus_tag="LELG_02683"
                     /note="BUSCO:EOG09263690"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526125.2"
                     /db_xref="GeneID:5233055"
                     /db_xref="PFAM:PF07792"
                     /db_xref="PFAM:PF08616"
                     /translation="MPNLEYILTAEFHIDKGPSLTYQYPNEIPGLQNLYFLPELMLPD
                     QIHKRNEDFTLFLLYRNLNTGEFQYLYNRNTCESEPYFLYTIVTNMKKDEFKRGSQIK
                     SLSVLTKLSFFKSFKPLLMICLDLYFPKNDHSVIKELYRAINEKDFSISHDLNGGKSV
                     GGGSDDDISIVKKILLTSILDLPINDKIYYDESFRNRILGIGKNQVMNESLFIRKDLS
                     LNSVIDFNSMKIPVRIPLLSLPDTIGDYLNPTDLNMRPNLISFLNCKLASSYLNNELT
                     IYGLQTPPIILLINAVLTGKKILFLSYENSAGHIIDHVLLLLKIVTGGGILSGLLTNY
                     NVFPIIDVSKIDLLEECESFIAGTINPFFKNNDKLWDLLYDLDANELFLSSNIENSKS
                     FGGAGVGAAGGAGGASGNSNSSGGFGYSEFRNSIIAEDARFLSNLQLSLFNYNDDLTT
                     LQLIFRRHINEIIRILLSSKNFNNSLVPSNKDLVLLLDGIGYFWTSDTNKLLEISCYQ
                     LISKKFQDLLYTEKLVYNLSLPNLSNELNLMIDLHYHLQSLSNVSVVNNKINEREIWF
                     NILKFLISGKSLEIFLLITYLIPPSSSTSLQSSSAHGGNLTIFDKNKGIEILLINLFN
                     HDDQIKSNIVMILQELQDNFLCGWCLEKFLKSNLIYEIAFKELIAES"
     gene            complement(<1012873..>1013280)
                     /locus_tag="PVL30_003530"
                     /old_locus_tag="LELG_02684"
                     /db_xref="GeneID:5233572"
     mRNA            complement(<1012873..>1013280)
                     /locus_tag="PVL30_003530"
                     /old_locus_tag="LELG_02684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526076.1"
                     /db_xref="GeneID:5233572"
     CDS             complement(1012873..1013280)
                     /locus_tag="PVL30_003530"
                     /old_locus_tag="LELG_02684"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526126.1"
                     /db_xref="GeneID:5233572"
                     /translation="MNRLAEKPTDTRSTLVRRYGIFAAVAVTLFLIGKKHIAYEKDQR
                     HKMENDSDLNNSDNEFAVSVKRPGFPENNPNLNYDDASRRSKYVGSGDAYSSRRPGDR
                     LNFYNVLKMKWFPDDKEKEAQYYTPSREDKIVK"
     gene            <1014406..>1015461
                     /locus_tag="PVL30_003531"
                     /old_locus_tag="LELG_02685"
                     /db_xref="GeneID:5233356"
     mRNA            <1014406..>1015461
                     /locus_tag="PVL30_003531"
                     /old_locus_tag="LELG_02685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526077.1"
                     /db_xref="GeneID:5233356"
     CDS             1014406..1015461
                     /locus_tag="PVL30_003531"
                     /old_locus_tag="LELG_02685"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526127.1"
                     /db_xref="GeneID:5233356"
                     /db_xref="PFAM:PF00153"
                     /translation="MSDNEEIAHAIAGAGGGALSMIVTYPLVTLSTLAQTQARKKEEK
                     ISNSPELEAKLEKLKSEPALKRFTYAVKNSNSVLAAKEIINEKGVFGLYSGLESALYG
                     IILTNFIYYYFYELTSNVFLKANRTAGKKRAGLSTIQSIITGAIAGAVTCVGSNPFWV
                     ANTRMMTEKKKKQQGEEDVSNSTFKTLLSIIENDGVGTLFAGVLPALVLVVNPIIQYT
                     IFEQIKNAIIAKNGVKSFTAIKAFFIGAFGKLIATSLTYPYITLKSRMHIKKKVLREK
                     HLTEEKEPQLSMYQEIKKIVHEEGLEGLYGGLAVKLSQSILTAAFLFYFKEELLVGSV
                     KLVEIFRLLKVKKQVSA"
     gene            <1017498..>1021337
                     /locus_tag="PVL30_003532"
                     /old_locus_tag="LELG_02686"
                     /db_xref="GeneID:5233486"
     mRNA            <1017498..>1021337
                     /locus_tag="PVL30_003532"
                     /old_locus_tag="LELG_02686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526078.1"
                     /db_xref="GeneID:5233486"
     CDS             1017498..1021337
                     /locus_tag="PVL30_003532"
                     /old_locus_tag="LELG_02686"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526128.2"
                     /db_xref="GeneID:5233486"
                     /db_xref="PFAM:PF00172"
                     /translation="MQVANPKAGLTKGSRDSSHDVQVQSQPKTQGQRQAQGQAQAQAQ
                     GQTQGQRPRRVARRACLSCREKKIKCDGEPVSSITSSDGTKIIPEKTRTCSNCKFLDI
                     DCVFVQSNRGGRRKRKDANDDETISMHESITDINMGSASTSASEAKRIRKTLSERESE
                     AATQRVSSYILDGTGNAVKPAPPSPAQSLTSSAYDRLPALAEPYSDRMGRQYPPPPQP
                     TIRSFPETRANYRRLDHHHDHHHGHKQGPPFMHSRTNPSISFSRPDVPRRPSSEDNYV
                     GHRVQSPLPPPLGSHNHTHPRRGGEEGPFSRGFDSYSHFPPPPPSVGYPLSQSQLQSQ
                     SQSQPAPPPPPFSTLPPPPPPQQLPPRTPLEGYDGHSYRLPPPPPSPPPHHLQHSRHD
                     PHHPYSPPPFHKFPSTSSQTASHQFPPFPPPQHSHFHPRFHPRGPHGPHGPHGPHGPH
                     GPRHGLRGPHGPHGPHGPHGPRHGPHGHQHHDFPPPPPFREHSDYPGSYEMRPFRPSP
                     SPQNDLFRTTGKTNREGDENEEQSILPTVENQKVQAKKATPESGLESVEGPGTSGGIA
                     SSAAGSLDVKSTRMKASASTESRPSNQMDRGESDEVKKRDNNIGSIVNHAGDNESQTS
                     DPILGRKVKEANFAKAKSYADSKVVPKIQAPQYDDEKDAPFSNKELAKYELPDWKTLN
                     KLVDYYYIYNQPGHQILPCKSIFLKNISLNTDSSILHIFIGTICIIATRKDSTLKISP
                     DEHYWIKKMYKYWDNLNGLGIMVCYKLIAKCTAVRFHMNKINQHNIKLYETIYDNNFV
                     EVYSQKRFDEKESQRKSKLGLKSEPKSKSKLGNSSSRTSRQIYEREVVLKSMWSFYVY
                     HIILLRFMQGRPYYKLSSIIDDFKFDYERDHYSNNVLLPLDDTDFQTLSLGANRTTWK
                     QLHDKDHIPSDFNSLTLASKIFESLLSKLANGDLTFDNLISKNEFNVDLTNKIKNLHS
                     SVVEDRKIIVVNVTYWLANMVLRVGEVLQYTYFIVRVMKFKLSKHDFRKRQLNDDDDD
                     DNNNNSSNNNNNNNGNSNDNDDEMNMSEADEMSQPLICDELLDLDDPTTLLKGFDVTH
                     WKSLVEVIKSMSGFVALIELIPSAKYKDFSIVCGPTLFNAEDDEFRKSPSSSSLRDVM
                     NTREWWEAPELKASVKQSWVKLPQYTLSFSTAFLSVACSLVFLTKFIKLSRNQETGKL
                     VVEFLTTGETRDIEGVELEDDVIESLFDQNVMAQQVSSICEFTKYKLSFCDEDLMEIT
                     IKRMNKLTQYLDNLLHR"
     gene            <1022151..>1023290
                     /gene="AIM6"
                     /locus_tag="PVL30_003533"
                     /old_locus_tag="LELG_02687"
                     /db_xref="GeneID:5233532"
     mRNA            <1022151..>1023290
                     /gene="AIM6"
                     /locus_tag="PVL30_003533"
                     /old_locus_tag="LELG_02687"
                     /product="Altered inheritance of mitochondria protein 6"
                     /transcript_id="XM_001526079.1"
                     /db_xref="GeneID:5233532"
     CDS             1022151..1023290
                     /gene="AIM6"
                     /locus_tag="PVL30_003533"
                     /old_locus_tag="LELG_02687"
                     /codon_start=1
                     /transl_table=12
                     /product="Altered inheritance of mitochondria protein 6"
                     /protein_id="XP_001526129.2"
                     /db_xref="GeneID:5233532"
                     /translation="MINVFKPSLHARETYNNNSIDSSYSSSAAAALLQYDGNSNSTPV
                     LPFNYTVEGLTRDVYPKPLHSHNDYWRAHPLFDALSVGAVSIESDIWYFPKTYTLQRT
                     STETTAEGGNKVNATTSNGSSNGGGEPSTLYFRDDEVYVGHNQVFLRPINTLFNLYLN
                     PLYQFLSYANPKFTYTDGSGNALLGDQNKHSIFYNDPEQQAYLWFDFKTEPNSTYDAL
                     KPLLQPFIDAGFLTYYNATDDTLHEGPLVLTITGNLPIEKVEEEEIRYTFLDGPLGYF
                     NSSANENELQRWSKLSRVASGGIQGLLGDEYNSTLRNDFNDDQQSKLQELFDSAHKHG
                     LKTRIWGDVTWPWNLVDSHLETLFQLGSDLLNVDDLQRASNLFPN"
     gene            complement(<1023557..>1024624)
                     /gene="ORT1"
                     /locus_tag="PVL30_003534"
                     /old_locus_tag="LELG_02688"
                     /db_xref="GeneID:5233252"
     mRNA            complement(<1023557..>1024624)
                     /gene="ORT1"
                     /locus_tag="PVL30_003534"
                     /old_locus_tag="LELG_02688"
                     /product="mitochondrial ornithine carrier protein"
                     /transcript_id="XM_001526080.1"
                     /db_xref="GeneID:5233252"
     CDS             complement(1023557..1024624)
                     /gene="ORT1"
                     /locus_tag="PVL30_003534"
                     /old_locus_tag="LELG_02688"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial ornithine carrier protein"
                     /protein_id="XP_001526130.2"
                     /db_xref="GeneID:5233252"
                     /db_xref="PFAM:PF00153"
                     /translation="MEEEQVSRDVARPTEQKIHPIKEVTFGAISGMVGKLIEFPLDTI
                     KVRLQSNHGQSPITTIQMIRQTYHNEGFVHGFYKGLKAPLLGACLETAILFSSYNYAS
                     TFIANRIDKSNGTNSRKIVSVDDIPFWSKCVSGGFAGLMASFILTPVELVKCQLQVVN
                     MHNSTPLTISSQLSPQVQKSSSSSTTSTTTTATTTTSTSTSTTHSYSSIVKRTIKDNG
                     ITGLWKGLESTIIREVVGTAIWFGTFEYLNNHFKSTADPWIENQDLQLLFSGAVAGVT
                     FNLSVFPVDTIKSNIQTHDILNKAEHKQSNTNFWKEARKLVSRKGGIINLYNGLGITL
                     VRCVPANALIFYTYELLKRNF"
     gene            complement(1025075..1025148)
                     /locus_tag="PVL30_003535"
                     /old_locus_tag="LELG_06054"
                     /db_xref="GeneID:5233011"
     tRNA            complement(1025075..1025148)
                     /locus_tag="PVL30_003535"
                     /old_locus_tag="LELG_06054"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:5233011"
     gene            <1027682..>1028347
                     /gene="OPI3"
                     /locus_tag="PVL30_003536"
                     /old_locus_tag="LELG_02689"
                     /db_xref="GeneID:5233466"
     mRNA            <1027682..>1028347
                     /gene="OPI3"
                     /locus_tag="PVL30_003536"
                     /old_locus_tag="LELG_02689"
                     /product="Phosphatidyl-N-methylethanolamine
                     N-methyltransferase"
                     /transcript_id="XM_001526081.1"
                     /db_xref="GeneID:5233466"
     CDS             1027682..1028347
                     /gene="OPI3"
                     /locus_tag="PVL30_003536"
                     /old_locus_tag="LELG_02689"
                     /note="BUSCO:EOG0926425H"
                     /codon_start=1
                     /transl_table=12
                     /product="Phosphatidyl-N-methylethanolamine
                     N-methyltransferase"
                     /protein_id="XP_001526131.1"
                     /db_xref="GeneID:5233466"
                     /db_xref="PFAM:PF04191"
                     /translation="MSTSTHTSLEFLTKDFSSLKEEIPFLAKNLTSYITFDNLFYYTL
                     ACIAFNPIFWNIVARLQYRTKFITKVTRSAKLGCYLLAITIFSLGIYRDSVYHELLKA
                     QPTYQPLLDSFIIKAVAVVSFAVGNIFVITSMWSLGVTGTYLGDYFGILMKERVTGFP
                     FSVNNNPMYNGSTLCFLGTALWYGKPVGLVVTLFVWVMYKIALLFEEPFTAKIYAYHL
                     KLD"
     gene            complement(<1029068..>1030747)
                     /locus_tag="PVL30_003537"
                     /old_locus_tag="LELG_02690"
                     /db_xref="GeneID:5233233"
     mRNA            complement(<1029068..>1030747)
                     /locus_tag="PVL30_003537"
                     /old_locus_tag="LELG_02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526082.1"
                     /db_xref="GeneID:5233233"
     CDS             complement(1029068..1030747)
                     /locus_tag="PVL30_003537"
                     /old_locus_tag="LELG_02690"
                     /note="BUSCO:EOG092648U2"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526132.2"
                     /db_xref="GeneID:5233233"
                     /db_xref="PFAM:PF09783"
                     /translation="MPATESNNHPLQRRSNTPGSHIPVSNEEAITDVDTVDFVTDAGD
                     TATAANTTTTTNTTTNTNSIADTTNINTNANTNTSTNTNTPIDAASTIIDTTTNNSNN
                     ITTIINAEQQAQQLLKLQQLQQQEKEKKQQQQQQQQQQQQQQQQQQQQQQNQEQPEKS
                     SLGSILQFDGSHRVTNQRDELTSVSLKSTIYDNNHEVPNKRPNTTSFNSSASCPIAAP
                     SSASSSSTTTTTTAAANSNCNSAGNNNINSQSQDDSFLPFSRTSPQKQTQDNDLSFNQ
                     HTKPIKGYNLDYFSSNNRYHHHYYDYNHNYNHYNCSQYSKIPHQFHSQYLQPNAQFVG
                     EQQSGKSRFQIKVEFKTVDLENSLVTGFLQINGLTKDHSEITTYFRGEVINNPLNTLK
                     SQQPTHLYQQRSAPFKRYSFMSEDKNWGSHPQNDIEHWKKLTDCQMMPTDAFKEKLKR
                     IYQGETTDEGGDHLIYMRWKEEFLLPDSRVKSIPNASFEGFYYIVLNLGAGRRREYTT
                     GSGFNTDSSSDSDSGSGSISGLYYHNSSEKFQSLSLQHVEQRGVSQVFDFN"
     gene            <1032740..>1033879
                     /locus_tag="PVL30_003538"
                     /old_locus_tag="LELG_02691"
                     /db_xref="GeneID:5233445"
     mRNA            <1032740..>1033879
                     /locus_tag="PVL30_003538"
                     /old_locus_tag="LELG_02691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526083.1"
                     /db_xref="GeneID:5233445"
     CDS             1032740..1033879
                     /locus_tag="PVL30_003538"
                     /old_locus_tag="LELG_02691"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526133.2"
                     /db_xref="GeneID:5233445"
                     /db_xref="PFAM:PF17110"
                     /translation="MQEPPSETPGSPLHPAPNEEIDPSSLPTTQLENNDIDLNPELYS
                     DNNNVNLGNSNSNNNDNINNDNNGATDYYTEPNLTSNNINGNNSNIANYEDYGKNNSK
                     GLLQQLNLRSAALETENLKQSFESPERQNTVLPLQTKSIHQITEPFQQIYLQFKNNFD
                     SSPQAHPITSAQESRFINIIDEQLLQIQRKFVKQQSDTKITYSCSNLIMDLDGVLDTL
                     WLSIQLKQRLFGQQDYYIKILGDLEDYINHYRRIFDEIWIESNVQGKFLDLEMKKVEA
                     FFKFLQKLDLQLSLLIDGYYLHSGKVQTVNLDADTQQQKQSIGQDLQRFSSTGLTRLL
                     LIISRTRLAIIEKIDAVRVKVSQQEIRDLLELEVSRIFEGVLERS"
     gene            <1034312..>1034920
                     /locus_tag="PVL30_003539"
                     /old_locus_tag="LELG_02692"
                     /db_xref="GeneID:5233642"
     mRNA            <1034312..>1034920
                     /locus_tag="PVL30_003539"
                     /old_locus_tag="LELG_02692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526084.1"
                     /db_xref="GeneID:5233642"
     CDS             1034312..1034920
                     /locus_tag="PVL30_003539"
                     /old_locus_tag="LELG_02692"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526134.1"
                     /db_xref="GeneID:5233642"
                     /translation="MWPFTSSTNKVNDEDLEKVTKDLPADLQEFLIKENPETRNINTH
                     DPTLPYKFESSRDIKTVDRVLSIKAQQIQRTPREQLEWDEFQVKNQIDKAVKINCSEI
                     EAAMNSDLQDTPFWKIFASLPGSTQRDTLKDCKKYQMDGLKTLFYHKCYSQAQCLAIK
                     MFVDTAFVKNFGELGQEQKDPEKVDQYYRDLNQAFDVLWSEK"
     gene            complement(<1035144..>1036082)
                     /gene="thp1"
                     /locus_tag="PVL30_003540"
                     /old_locus_tag="LELG_02693"
                     /db_xref="GeneID:5233000"
     mRNA            complement(<1035144..>1036082)
                     /gene="thp1"
                     /locus_tag="PVL30_003540"
                     /old_locus_tag="LELG_02693"
                     /product="uracil DNA N-glycosylase Thp1"
                     /transcript_id="XM_001526085.1"
                     /db_xref="GeneID:5233000"
     CDS             complement(1035144..1036082)
                     /gene="thp1"
                     /locus_tag="PVL30_003540"
                     /old_locus_tag="LELG_02693"
                     /codon_start=1
                     /transl_table=12
                     /product="uracil DNA N-glycosylase Thp1"
                     /protein_id="XP_001526135.2"
                     /db_xref="GeneID:5233000"
                     /db_xref="PFAM:PF03167"
                     /translation="MMNKSLKTVIETFKYEGDDKAKKNLENVSKSIKSVKVNKRVTSS
                     RRSSTKVKSTSIIHKSNASATYNVSNSPSKAQKVKIDTSKLPDLRHSLNSNLKLLFVG
                     YNPGVQSSIQQHHYAHHSNLFWKLFNQANVLQRVVQKRKKKENGMHQKVFDDDDDDDK
                     YLKTLLSTGCSAIHDFDLIKYDIGFSDLSLRCTVRAEELTSEEKIANIPRLIREINES
                     NAENVVLIGKGIWEVIVKFYKAQLGIKFQLNKDNFQWGQIAESKDKQYNQIIEHVYAQ
                     LPKHTTIYAFPSTSGLVASMKFSEKLRLWQEMANNL"
     gene            <1036408..>1037430
                     /locus_tag="PVL30_003541"
                     /old_locus_tag="LELG_02694"
                     /db_xref="GeneID:5232942"
     mRNA            <1036408..>1037430
                     /locus_tag="PVL30_003541"
                     /old_locus_tag="LELG_02694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526086.2"
                     /db_xref="GeneID:5232942"
     CDS             1036408..1037430
                     /locus_tag="PVL30_003541"
                     /old_locus_tag="LELG_02694"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526136.2"
                     /db_xref="GeneID:5232942"
                     /db_xref="PFAM:PF10104"
                     /translation="MDNGLDASQISHISFSGIEHESTPIRNSRVISTEKAGTDVDEIE
                     NQDEIEVKIEAEAETETEISDDEETNEFRSIVETHPELNIAGKELHQLNPVNVAHVMF
                     SPEKKNRQRDLQTVQSFENISGKPKGVPTEINREISSVPSAISTTTLAASVSKVFDPF
                     TPYTLNLYLQLIVNCILWSIIIFLVYSAITTIRTDIQIKTEQFTLQILEEIAKCSREY
                     IRNKCDSPHRPPAIDHECDLLNRCQNQDPSKFAKSKISVELIAEIVNAFFSKISFKSL
                     VVLILILMVTMVNTSLAVRDFQSVQVRKMENKVESIQRENKYKKEQELVEEDQETVFI
                     EQELNS"
     gene            complement(<1037601..>1040663)
                     /gene="UBA1"
                     /locus_tag="PVL30_003542"
                     /old_locus_tag="LELG_02695"
                     /db_xref="GeneID:5233570"
     mRNA            complement(<1037601..>1040663)
                     /gene="UBA1"
                     /locus_tag="PVL30_003542"
                     /old_locus_tag="LELG_02695"
                     /product="E1 ubiquitin-activating protein"
                     /transcript_id="XM_001526087.1"
                     /db_xref="GeneID:5233570"
     CDS             complement(1037601..1040663)
                     /gene="UBA1"
                     /locus_tag="PVL30_003542"
                     /old_locus_tag="LELG_02695"
                     /note="BUSCO:EOG09260ERO"
                     /codon_start=1
                     /transl_table=12
                     /product="E1 ubiquitin-activating protein"
                     /protein_id="XP_001526137.1"
                     /db_xref="GeneID:5233570"
                     /db_xref="PFAM:PF00899"
                     /db_xref="PFAM:PF09358"
                     /db_xref="PFAM:PF10585"
                     /db_xref="PFAM:PF16190"
                     /db_xref="PFAM:PF16191"
                     /translation="MSDNMQIDSPSPQEIDEGLYSRQLYVLGKEAMLKMQNANVLIIG
                     LNGLGIEIAKNIALAGVKSLSLYDPHPVELRDLSTQFFLSEADDGKPTDQVSAVKLRE
                     LNAYVPISVVENINEETLLKFKCIVSTNVTLEEQVRINQITHANDIGYINADIRGLFG
                     QIFVDFGDKFTIVDQTGEEPLSGIISDIDKDGTVTMLDDSRHGLEDGDFVKFTEVEGM
                     PKLNDGNPHKVEVLGPYAFKIKLDESFGTYKKGGQYTQVKVPKDLKFEPLLEQLKNPE
                     YLISDFAKFDKPPQLHIGFQALHAFKTKRGRLPAPYHLEDANEAFRYAQELATQNKNI
                     VEELDEKYLKELFYQAQGDIPGVVAFFGGLIAQEVLKCCSSKFTPIKQWLYFDSLESL
                     PSEKEFPRNAENNKPIGSRYDGQIAVFGKTFQDKIFDLKVFLVGAGAIGCEMLKNWAM
                     MGLGSGPNGKIFITDNDSIEKSNLNRQFLFRPKDVGKNKSDVAASAVQAMNPALKGKI
                     DSRLDKVGPDSENIFDDGFWKNLDFVTNALDNVEAREYVDRRCIFYKKPLLESGTLGT
                     KGNTQVVIPNLTESYSSSHDPPEKSIPLCTLRSFPSKIDHTIAWAKSLFQGFYVEAPE
                     SVNLYLSQPNFVEQSLKQNPDKKGTLENISKYLNERPYTFDDCIKWARLEFENKFNHD
                     IKQLLYNFPADAKTSTGEPFWSGPKRAPTPLKFDINNKDHFDFIVGGANLLAFIYGLK
                     EPSATVEDYKKVLDNITIPEFKPKTGVAIAATEAEAEEQANQLSGSFDDEEVRKIAAS
                     LPEPSTLAGYRLTPIEFEKDDDTNHHIEFITAASNCRALNYGIETADASKTKFIAGKI
                     IPAIATTTALVTGLVCLELYKVVDEKDDIEQYKNGFINLALPFIGFSEPIKSVKGKYG
                     KKEFDTVWDQIVIEDDITLQQLLDKFQKEDGLEISILSYDVVVLYASFFPAKKNQERL
                     GKPISELIKMVSKKEIPSHLKYLVLQACCEDEDGEDVDIPPISVKYNP"
     gene            complement(<1041542..>1042306)
                     /locus_tag="PVL30_003543"
                     /old_locus_tag="LELG_02696"
                     /db_xref="GeneID:5233641"
     mRNA            complement(<1041542..>1042306)
                     /locus_tag="PVL30_003543"
                     /old_locus_tag="LELG_02696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526088.1"
                     /db_xref="GeneID:5233641"
     CDS             complement(1041542..1042306)
                     /locus_tag="PVL30_003543"
                     /old_locus_tag="LELG_02696"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526138.1"
                     /db_xref="GeneID:5233641"
                     /db_xref="PFAM:PF00132"
                     /db_xref="PFAM:PF12464"
                     /db_xref="PFAM:PF14602"
                     /translation="MPQFKDKQDFCKQTNVKAERNEELIKFAKNNLNHIPFTDEAAFE
                     NYDRMISGMLYNPMQVDLEKSRMNLRDTLLDYGNFRCRDYKTTKEFANAKREYLKKFI
                     GHVGEGTFMEYPMYFDYGFNTYLGENFYSNFNLTILDCSVVKIGNNVMCGTGVSLLTP
                     SHPIDPTLRHSYLENALPITIGDNCWLGSNCTVLGGVTIGEGSVIAAGAVVNRDIPPN
                     SLVVGVPGRVVKTMEPRDPDFDVHKTLKEYGMDYIP"
     gene            <1042473..>1043407
                     /gene="ECM15"
                     /locus_tag="PVL30_003544"
                     /db_xref="GeneID:85890373"
     mRNA            join(<1042473..1042528,1042925..1042941,1043139..>1043407)
                     /gene="ECM15"
                     /locus_tag="PVL30_003544"
                     /product="UPF0045 protein M15"
                     /transcript_id="XM_061119491.1"
                     /db_xref="GeneID:85890373"
     CDS             join(1042473..1042528,1042925..1042941,1043139..1043407)
                     /gene="ECM15"
                     /locus_tag="PVL30_003544"
                     /codon_start=1
                     /transl_table=12
                     /product="UPF0045 protein M15"
                     /protein_id="XP_060975474.1"
                     /db_xref="GeneID:85890373"
                     /db_xref="PFAM:PF01910"
                     /translation="MVQIPSCNSRSNYRSIQNKCVFDSLSDEITAISKLAEDSPLSTT
                     LHSAGTTIAGPWNEVMDLIGQMHELLHNKHDVLRIQSDIRVGTRVDKSQTPADKIDVV
                     KRKLKALSGTD"
     gene            complement(<1044129..>1045721)
                     /gene="ADF1"
                     /locus_tag="PVL30_003545"
                     /old_locus_tag="LELG_02697"
                     /db_xref="GeneID:5233402"
     mRNA            complement(<1044129..>1045721)
                     /gene="ADF1"
                     /locus_tag="PVL30_003545"
                     /old_locus_tag="LELG_02697"
                     /product="actin depolymerizing factor, cofilin"
                     /transcript_id="XM_001526089.1"
                     /db_xref="GeneID:5233402"
     CDS             complement(1044129..1045721)
                     /gene="ADF1"
                     /locus_tag="PVL30_003545"
                     /old_locus_tag="LELG_02697"
                     /codon_start=1
                     /transl_table=12
                     /product="actin depolymerizing factor, cofilin"
                     /protein_id="XP_001526139.2"
                     /db_xref="GeneID:5233402"
                     /translation="MSFEHNSYYSYGQTNQNLSSGKAYSHIPQQQQQQQQQQQSPNVP
                     SSQQMMYSIPPPSSQQHMAPYYQQQYQQMQAAPAPTSTSASASASAQQQQQALPPAPQ
                     QQHYNNNGSQYFDPNMTSNYIMGISATHNLQSNHYQQPQFSYYNMNQPSYMQQLPQPQ
                     PQPQLQSTAQPLPPAIAPPPHPTSAPAPAPAQHGKSTTPENGKSKTRTSKRKQSQSQS
                     QSQSRSRSRSQSQSRSQQQQSPSLSQQGRRQDSVEVASTMQSHSLVIFPNFPERLQKV
                     LPPPPLSKAPIRPDITVSTTAKRAKRKSKFSQEQDDLIVTLKKKGKNWVEIAEILGVG
                     SYLAARNRYQVIVGQQGNNNSSAWDNTDKLFLKNLLDAAEFEKWRYITAELNKSTGKV
                     FTDYECREVIRELFWQDPSSFGVSEDTIKESIKEKKQTDKIIEQREQQRKKKASILEG
                     RYEAYPSSNSTSSTSSASQQLAQPHLQPQQSPPALASAPLQPQQTSQNQHQHQHHQQQ
                     HQHQHQHQQQMGVFQPRLSQLP"
     gene            complement(1050400..1050471)
                     /locus_tag="PVL30_003546"
                     /old_locus_tag="LELG_06055"
                     /db_xref="GeneID:5233126"
     tRNA            complement(1050400..1050471)
                     /locus_tag="PVL30_003546"
                     /old_locus_tag="LELG_06055"
                     /product="tRNA-His"
                     /db_xref="GeneID:5233126"
     gene            complement(<1051064..>1052338)
                     /gene="GLG2"
                     /locus_tag="PVL30_003547"
                     /old_locus_tag="LELG_02698"
                     /db_xref="GeneID:5233205"
     mRNA            complement(<1051064..>1052338)
                     /gene="GLG2"
                     /locus_tag="PVL30_003547"
                     /old_locus_tag="LELG_02698"
                     /product="glycogenin glucosyltransferase"
                     /transcript_id="XM_001526090.1"
                     /db_xref="GeneID:5233205"
     CDS             complement(1051064..1052338)
                     /gene="GLG2"
                     /locus_tag="PVL30_003547"
                     /old_locus_tag="LELG_02698"
                     /note="CAZy:GT8"
                     /codon_start=1
                     /transl_table=12
                     /product="glycogenin glucosyltransferase"
                     /protein_id="XP_001526140.2"
                     /db_xref="GeneID:5233205"
                     /db_xref="PFAM:PF01501"
                     /translation="MSASNSAFVTLLVGESYAPGVLTLGSKLKELGTSHKLVLLLDTS
                     TVSQELQDLISTVYDEIIPVDTIQAPLTKLAETLDRPELSITYTKLLLWGLTQYESIV
                     YLDADVLPLQSLDNLFDSYEIGVGEIAASPDSGWPDIFNSGVFKLKPNQETLNSLIEF
                     AGKGDSSTFDGADQGLLNEFYPNWHRLPYLYNVTPNYRQDYQYLPAFHRFFKDIKALH
                     YIGGAKPWSYDNILSSDLSNFHQFWWDDFNRFFDKSTRYKLLRLKGEGANLRFQKLVN
                     EWDVSNLKEPQQLQRASFASESVSDSGKHIEHPPIFPWEHRDKREATRFFHEGDDLPS
                     YQDVTQDEEKDKDEAFHEKLRRNLDVLKATKLGSSSSPAPPRTKKAPLSKEYNFGQGD
                     DDFNPDKSLDEVSKLPLKFFSKEKARRESEDK"
     gene            complement(<1053218..>1056607)
                     /locus_tag="PVL30_003548"
                     /old_locus_tag="LELG_02699"
                     /db_xref="GeneID:5233504"
     mRNA            complement(<1053218..>1056607)
                     /locus_tag="PVL30_003548"
                     /old_locus_tag="LELG_02699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526091.1"
                     /db_xref="GeneID:5233504"
     CDS             complement(1053218..1056607)
                     /locus_tag="PVL30_003548"
                     /old_locus_tag="LELG_02699"
                     /note="MEROPS:MER0020214"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526141.2"
                     /db_xref="GeneID:5233504"
                     /db_xref="PFAM:PF04096"
                     /db_xref="PFAM:PF13634"
                     /translation="MFGSSSSGFGGFGNNTANPANSPFGGGGTTQAGASPFGSSTTGG
                     GGLFGNNNNTTTAQQQQQQQQQQQPSTFGSGGAFGSNTGGIGGVGSNGGLFGTQTNTA
                     LSPFGQQQQQPQQSTQPSSVFGNANSTAGTSAFGTSSGGGLFGSKPATSSTFGGFGTG
                     NTTSSPFGGTATTATTNAFGTSAAIDPNVNNGTAGRAFTPFTEKDSANINNVFQNICC
                     MSEYKNFSFEELRLKDYEQGRRFANQAGAGAGTGAGVGGAGATGTGFGFGSSQQPLGG
                     GLFGSQNNNTSSPFGGNASGSAFGSSFNKPTGSPFGSNGQSTGAFGSAQNPSPFGATN
                     ATGGGAFGNSGGATNAFGSGGGAFGAKPATGFGGLGSTNTTGNAFGSNTGGGGAFGQG
                     GTGFGGSTNSPFGASNSNTGNAFGASSNSPFGQNNNSNALGGGAFGATNTGSVFGGSN
                     NTGSGSGGGGGGLFGQSNTNAFGSGSAGGGGGGGGLFGQSNNNNSNNVFGANKPATGF
                     GSGTSGGLFGQSNQSQSNQGGGLFGQNNSNQQSGGGLFGSKPAATGTTSAFGQNNTGG
                     LFGGGNQQNNTSGGLFGSKPAGTTGGGLFGNNTQQGTSGGLFGQQQQQPQSSGGGLFG
                     SKPAGSTGGGLFGGQSNTLGSSGVLFGGGNQNQQQQNSNAFGNGSSAGGLFGSKPGVG
                     GATGGLFGSGGQQQSTASGATGGGLFGGGSSSTSGGLFGSKPAQNGIGTGTGTGGLFG
                     GGNNTNNNNNNNNNNSNNSNTVGGGFGNFAGGLSTSGGFSQQSQPQSSQPSFLQQSQQ
                     QQTQPLANINTQNPYGNNPLFQSITGTSQEQGQGQRPQAVIVSSSLSSSNPAKKTVTL
                     GSASSRITPLFKVNVLSAKKPEEKAQDQLFKKKVDNLFSPITDSAIITSDVFKPNINF
                     KKLVIEKSSGEDGKNGQLLVSGTSSPTKQVTFGFESKKKPASSETLESQTKGDSGDKV
                     GSGERENGEEVFDADGYWMSPSLNELKKKSLLELKSVHDFKIGRKNYGTLKFIDPVDL
                     TAMINLEDIPGNLVTFDTKSCVVYPDDDVKPRPGEGLNLPAEITLEGCFPLNSVDKLP
                     ILDPKSDVVKRHIENLKKLPEMEFISYDPETGDWKFRVKEM"
     gene            complement(<1056958..>1058245)
                     /gene="APN1"
                     /locus_tag="PVL30_003549"
                     /old_locus_tag="LELG_02700"
                     /db_xref="GeneID:5233323"
     mRNA            complement(join(<1056958..1058098,1058232..>1058245))
                     /gene="APN1"
                     /locus_tag="PVL30_003549"
                     /old_locus_tag="LELG_02700"
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /transcript_id="XM_001526092.2"
                     /db_xref="GeneID:5233323"
     CDS             complement(join(1056958..1058098,1058232..1058245))
                     /gene="APN1"
                     /locus_tag="PVL30_003549"
                     /old_locus_tag="LELG_02700"
                     /note="BUSCO:EOG09262XMN"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="XP_001526142.2"
                     /db_xref="GeneID:5233323"
                     /db_xref="PFAM:PF01261"
                     /translation="MPPKVKAPKVKVEFTPKYERNLTTKFKFGAHVGASGGVYNAVTN
                     ARDIGANSFALFLKSPRKWVSPEYNPDDVKKFHELCSTHNYNPRTDILPHGSYLLNLG
                     NPDFEKAEKAYVSFVDDLKRCELLNIGLYNFHPGSSLDGNHEEALTRLATNINRAIKE
                     TNFVKIVLENMAGHGNLIGSNLQDIKDVIDMIEDKSRVGVCLDTCHSFAAGYDISDAT
                     KLEDFLQNFDDLIGAEYLSAIHLNDSKAPLGANRDLHQKLGQGFLGLEVFRAIANCKR
                     LQNIPIVLETPIEKNETDEIYGEEIKLLEWLEGKSVDDAEYIEKRDQLSTAGQKERSE
                     HLKKYEAKTKKNAKATASKRKTNKTIKAEERENDDDDIINKVTKKQKVTR"
     gene            <1059370..>1060734
                     /locus_tag="PVL30_003550"
                     /old_locus_tag="LELG_02701"
                     /db_xref="GeneID:5232982"
     mRNA            <1059370..>1060734
                     /locus_tag="PVL30_003550"
                     /old_locus_tag="LELG_02701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526093.2"
                     /db_xref="GeneID:5232982"
     CDS             1059370..1060734
                     /locus_tag="PVL30_003550"
                     /old_locus_tag="LELG_02701"
                     /note="BUSCO:EOG09263M8W"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526143.2"
                     /db_xref="GeneID:5232982"
                     /translation="MNVRLSILRYIHAFLIPDSSLHARQKWILGLINLATVVIFWVLS
                     SFLVNAMVEDDEYRKPFFITWTNTSCFSLYIIPYLRLKNMSLKQFMTKMRRGWRYSRV
                     SDKQRGAKAGTGAGTGEESISGSVRSSSPYGSDDNENNNISTMNVIEDEENDVESNLI
                     SVKSRPSTLDGTCSEAFANEDSTEDGILDVGIFETFQLSLSFIILWFTANLVTNASLS
                     YTSVASQTILSSTSSFFTLIIGFLKSVEKVSQSKVLGILLSFAGVLIVTKADTTATSS
                     NPIDTNPNADPNKSTLVIIWGNLLALAGALIYGIYTILLKQKITIPNSHKERNLNTHL
                     FFGFVGLICFLGLWPILIILHFTGVEEFELPPTLLMTELLIINAGITFISDFCWCNAV
                     LLTSPLTVTVGLSMTIPLAMIGDWVFKGFQLNLVYIFGAVIVTTGFLIINKEEEDDFV
                     IDEL"
     gene            <1061341..>1062301
                     /gene="OST6"
                     /locus_tag="PVL30_003551"
                     /old_locus_tag="LELG_02702"
                     /db_xref="GeneID:5233580"
     mRNA            join(<1061341..1062103,1062152..1062175,1062282..>1062301)
                     /gene="OST6"
                     /locus_tag="PVL30_003551"
                     /old_locus_tag="LELG_02702"
                     /product="ER oligosaccharyltransferase complex subunit"
                     /transcript_id="XM_061119492.1"
                     /db_xref="GeneID:5233580"
     CDS             join(1061341..1062103,1062152..1062175,1062282..1062301)
                     /gene="OST6"
                     /locus_tag="PVL30_003551"
                     /old_locus_tag="LELG_02702"
                     /codon_start=1
                     /transl_table=12
                     /product="ER oligosaccharyltransferase complex subunit"
                     /protein_id="XP_060975475.1"
                     /db_xref="GeneID:5233580"
                     /db_xref="PFAM:PF04756"
                     /translation="MADPHLGYIIPIANSDISILDGKRDYYTLITITSTNPQHGCLLC
                     QEITPVLAKVSKLWHADYSASNFLHFVTVDLNDDTNKPIFRSLNVGTVPHIWMVPPSS
                     VNENRENRESGESDEENRTKFDFHSVPFDEFAIPKGSQHQQVLALAKFIGHHTQHTLM
                     IRDENAMEKFIKTFIVVFSVVVLIKKKGPEMITSVPKRMVICFLAIIAILLFTAGYQF
                     TVQNQVPFIAKSNKGEVVFISGGMQYQFAVEVAIVARQYQVNEKMDIHMN"
     gene            <1062852..>1063886
                     /gene="UNG1"
                     /locus_tag="PVL30_003552"
                     /old_locus_tag="LELG_02703"
                     /db_xref="GeneID:5233134"
     mRNA            <1062852..>1063886
                     /gene="UNG1"
                     /locus_tag="PVL30_003552"
                     /old_locus_tag="LELG_02703"
                     /product="uracil DNA glycosylase"
                     /transcript_id="XM_001526095.1"
                     /db_xref="GeneID:5233134"
     CDS             1062852..1063886
                     /gene="UNG1"
                     /locus_tag="PVL30_003552"
                     /old_locus_tag="LELG_02703"
                     /note="BUSCO:EOG09264GMT"
                     /codon_start=1
                     /transl_table=12
                     /product="uracil DNA glycosylase"
                     /protein_id="XP_001526145.2"
                     /db_xref="GeneID:5233134"
                     /db_xref="PFAM:PF03167"
                     /translation="MVKRPITDYFSTVTITRKKPRPEELASHIKVTEPNVNSDKETNG
                     EKLEDDENLKYKDFCKEYKFNKTNWVNGLTLDQRETLQLEIEKLHITWLAALHQELTK
                     PYFIKLKKFLASQTLQKKVIFPKQEDIYSWSKLTPLPTIKCLILGQDPYHNYNQAHGL
                     AFSVLEPTRPPPSLVNIYKTLAIDIPEFVVPNYKSNNTGGGNLSKWAENGVLMLNAVL
                     TVEAHKANSHAKQGWEQFTEEVIKQAIRYHCNSESRVNGGFVIMAWGSPAQKRVENIF
                     RKMDKGDKEKFLVLQTVHPSPLSAHRGFFQSQVFKRCNDWLKEHDRDVIDWNALAEKE
                     IIEEGPKKEG"
     gene            <1064499..>1067765
                     /gene="ISW2"
                     /locus_tag="PVL30_003553"
                     /old_locus_tag="LELG_02704"
                     /db_xref="GeneID:5233213"
     mRNA            <1064499..>1067765
                     /gene="ISW2"
                     /locus_tag="PVL30_003553"
                     /old_locus_tag="LELG_02704"
                     /product="chromatin remodeling complex
                     Adenosinetriphosphatase"
                     /transcript_id="XM_001526096.1"
                     /db_xref="GeneID:5233213"
     CDS             1064499..1067765
                     /gene="ISW2"
                     /locus_tag="PVL30_003553"
                     /old_locus_tag="LELG_02704"
                     /codon_start=1
                     /transl_table=12
                     /product="chromatin remodeling complex
                     Adenosinetriphosphatase"
                     /protein_id="XP_001526146.2"
                     /db_xref="GeneID:5233213"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF09110"
                     /db_xref="PFAM:PF09111"
                     /translation="MVRNSRSDGASVLANTPSTTTMPSSTQNQVSEIEETSEERRKRF
                     LLEVDAKHAYANDKDDATKRFQYLLGLSPIFRKFIDLNASKDPEFKKRVREIDFQQSF
                     KESSSKSKRRKNSSRRRKTEKEEDAELLHDEENEDDEEHQHTIITESPSYVKEGKLRE
                     YQIEGLNWLISLNENRLSGILADEMGLGKTLQTISFLGYLRYIKHVDGPFIIIVPKST
                     LDNWRREFSKWTPDVKVVVLQGDKEQRNDIIQNQLYTAQFDVLITSFEMVLREKSALK
                     KFRWEYIVVDEAHRIKNEQSSLSQIIRLFYSRNRLLITGTPLQNNLHELWALLNFLLP
                     DVFGDSEQFDETFDRQNGNSELDEKAKQEEQDKVIQELHQLLSPFLLRRVKADVEKSL
                     LPKIESNVYTRMTDMQLEWYKKLLEKDIDAVNGVVGKREGKTRLLNIVMQLRKCCNHP
                     YLFDGAEPGPPYTTDEHLIDNSGKMIILDKMLKKFQKEGSRVLIFSQMSRVLDILEDY
                     CYFRDYEYCRIDGSTSHEDRIEAIDEYNAPDSAKFVFLLTTRAGGLGINLTSADIVIL
                     YDSDWNPQADLQAMDRAHRIGQKKQVKVYRFVTENAIEEKVLERAAQKLRLDQLVIQQ
                     GRSANANNNVGNSKDDLIEMIQHGAQKVFEGGKNKGEEDAIEDDIDKILERGMEKTKK
                     MNEKFNKLGLEDLQNFTSDGSAYQWNGKDFAKKETSGLGFSWINPSKRVRKEQTYSVD
                     NYYKDVLKAPPAVPKEKVQKQIVVKPKAPKQYTAQDHQFFPPGLVSLLEREQLAYKKE
                     IKFKYSLDDFGDSDEEFLVEEEKDELSREQKRKQEQKKIDNVEPLTEEEIQLKDKLLA
                     ESFYNWSRRDFTNFIHATAKYGRDAYAKISKALGRNTAGSAAKTRSEVERYAQTFWEK
                     YKQIDGYEKYINQIETSEKKREKLQNQQNILVSKIESLQDPREDLAIVYPPNNSKRVY
                     SKSEDKFLLNCVYKFGIFDEKLNNRIKQEIFDSEMFKFDWYFQSRTPQELGRRVNTLL
                     LALSREVDGPASTHKTRKKIDVSASSSRVGSTEPSTIVEKRPASEVSEVSPIIKKLKS
                     "
     gene            complement(<1068011..>1071736)
                     /gene="DOT1"
                     /locus_tag="PVL30_003554"
                     /old_locus_tag="LELG_02705"
                     /db_xref="GeneID:5233420"
     mRNA            complement(<1068011..>1071736)
                     /gene="DOT1"
                     /locus_tag="PVL30_003554"
                     /old_locus_tag="LELG_02705"
                     /product="Nucleosomal histone H3-Lys79 methylase"
                     /transcript_id="XM_001526097.1"
                     /db_xref="GeneID:5233420"
     CDS             complement(1068011..1071736)
                     /gene="DOT1"
                     /locus_tag="PVL30_003554"
                     /old_locus_tag="LELG_02705"
                     /codon_start=1
                     /transl_table=12
                     /product="Nucleosomal histone H3-Lys79 methylase"
                     /protein_id="XP_001526147.2"
                     /db_xref="GeneID:5233420"
                     /db_xref="PFAM:PF08123"
                     /translation="MMYHPSESFTAMTQETQELTSHSGDNQIRSSPPPSSSSSSSSSS
                     SSSSSSFSNWSTTDLELLKQQLISSTLSMSDIVNNFKQYHWRDVIKQAISISNDVIDN
                     KDASLVAKEKIYVYQLFYNSKEQFRDNDLAEKTQKDLSMITDIFKRLNWNNKDIEKVI
                     SISHQDLTKTGLTKQFPQMDSNDLIRDLKLSTKNYAYPMSIKELELIKHRQENVYEEC
                     FLRSRASIEELLSHSHSSFNGDHSSREEILKNFSRRASPEFYDNSDKSAFNEFMQKNK
                     TEFALLKSCVQSDLTLKTLTEYFPQYNISEIADYIKDNNLNTNENELTGGEKKTMREF
                     ITLGKQYEEILHEFPLRSESCIANWYKRLSYACSRQVTFKNKTEKLIYESGMALTTSR
                     RASRRSKAVDFDELQRLAESAQNIKVAKKVLTEEEKQARAERKLEREQEKERKRLERL
                     EQRAKNPPKPKPSEHKTDQRVSKMALEKLIEATKHFQSVTGDRQILKEGVKRKIIPAT
                     FYTPETKVVKKTRNRQEKKNELRKKLKEEREKKKKNLKSKSKSKSKSKQQKTTKRTYK
                     RRKLTSLAKVPGVTEYEDSDLHSKLTSGMNIGMESEEEEGEKEEEEEDEEEEEVEEEE
                     ETSEHISPFDPPDINSDTLVDLHGRKFFVKEFYSDFPRVPELNFQDQDEKEVDNKEKD
                     PKDSMTRDDDTIPYIDELGAHVIGSHEKCYRDMPISFPQYSNKNGNPNHSHAVKVRFL
                     LYPEHYESYILAEPKDNELDPVHEIMKIFLLHYALYFSHSENIKEIITGYCQKLERAV
                     EENDFAEFMFVVDKWNLLMLYLSPNTASVEKVLNRNVDINANAKECLNISEIKNPQLD
                     DLDLETFYGEICFEITSPFYQPVEIIKEGLEIKYKKETGDENENKKNLDNNQNETKEI
                     IIDDAADISINNVEPPLNISEATSRHRPRNYISDFFTRLQLKSSISRYAVHQILCRVY
                     ARVVSTDSRKLRSYKAFTAEVYGELLPSFTSEVLEKVGLKPGQKFYDLGSGVGNTTFQ
                     AALEFGAISGGCELMKHASKLTKLQDNLIRRHLAILGIRELDLKFALSQSFVANEQVR
                     RDCLECDVLIINNYLFDGELNASVGKLLLGLKPGTKIISLRNFISPRYRAQFDTVFDY
                     LSVVKEEMSDLMSVSWTANKVPYYISTVEATIRPEYLRGDNGMTLEYYNDCSKSTSPL
                     NNIREESPHSPMRNSLNADGASTPPTEHNSDPEFEKS"
     gene            complement(<1072433..>1075333)
                     /locus_tag="PVL30_003555"
                     /old_locus_tag="LELG_02706"
                     /db_xref="GeneID:5233131"
     mRNA            complement(<1072433..>1075333)
                     /locus_tag="PVL30_003555"
                     /old_locus_tag="LELG_02706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526098.1"
                     /db_xref="GeneID:5233131"
     CDS             complement(1072433..1075333)
                     /locus_tag="PVL30_003555"
                     /old_locus_tag="LELG_02706"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526148.2"
                     /db_xref="GeneID:5233131"
                     /translation="MSNITSTLFGFWNRLDETKPEQEPNPSTTSTTSIENNNNNTDNN
                     TDNNKNNNSNHNETAVDTTKTATMVSPRSKRTSDISVQNKMSPSKKNKNAEFAGQMPQ
                     QKQQQLPLSSQKYSGLANSENKKPALSPNAAKSSTSWLGWKKDQGTSIWSLKGNGNGN
                     GKGEEENIEEEHTRNDVDDEHSTFDDDEVEGTSGDDVVEDDSGDEVDDHVKDTNSGKR
                     GLSWLWSGNNRNVTNPNHDNTGVGINTNNNNNTNNNNNTKNNNDTNTNNNNDTNTNNN
                     TNNNYSNLQNTDTNSESSQNKDTSKEANKRETALIVANTIVNSTAPLPLKQELIDDNK
                     RTPSQQKGDDAVLYKPHDKNSQFKKINTRKNEDLKENTIVPDWDGCLPAAHEGIFFHN
                     SSTSNQNNASQTIRTDLNNWKHFLNQISTKFGFSAGTIPDSTENQASKTSKVENEMGL
                     LYEKSYKLYGKSLAILPLHKRACLPSFNKYYTEVGSPQQQSEPTQYEDDQSDPNSISV
                     TNDAMGNILINNKGNKKRALHRALNAEIVNYKAGPLKKIKKILIIGVHGFFPTKMIRP
                     LIGAPQGTSLKFANEAEKAVIRYCVENNLISDEKSEISIQKIALEKEGKIFDRVNFFT
                     EILQKWEAELNNADFIFIASHSQGCVVSIILLARLIRMGILRSPIDKRIGLLGMAGIN
                     NGPFYGADKTFFMKAYSTIEHDSLNELFELTKFDSTQSVVYKESIQTIINVNVKICFI
                     GSINDQLVPLYSALASHIFHPNIYRACYIDYSSFTPKFVEKLVSMCTNLLNLGFFDNN
                     VIKELSTSLAGPMTAGGHSKIYNDGKVYDLGIKFFLDTDDLVIPHEGTIDYDNFENSE
                     LPVSNQVYIKEYNVGKIGTNPYILPWCLRGFLFNVEKNWPDAINRAAYDDGDNDEHEY
                     REESRGIACNRLGRNGAEEIHELYEIFEHWKPETKIYKDLKFRLNGFRASKL"
     gene            complement(<1075966..>1076961)
                     /gene="CHA1_2"
                     /locus_tag="PVL30_003556"
                     /old_locus_tag="LELG_02707"
                     /db_xref="GeneID:5233644"
     mRNA            complement(<1075966..>1076961)
                     /gene="CHA1_2"
                     /locus_tag="PVL30_003556"
                     /old_locus_tag="LELG_02707"
                     /product="catabolic L-serine/threonine dehydratase"
                     /transcript_id="XM_001526099.1"
                     /db_xref="GeneID:5233644"
     CDS             complement(1075966..1076961)
                     /gene="CHA1_2"
                     /locus_tag="PVL30_003556"
                     /old_locus_tag="LELG_02707"
                     /codon_start=1
                     /transl_table=12
                     /product="catabolic L-serine/threonine dehydratase"
                     /protein_id="XP_001526149.1"
                     /db_xref="GeneID:5233644"
                     /db_xref="PFAM:PF00291"
                     /translation="MKLPSIKTSFVEVTDKINSAPCRIFFKNELEQPSGSFKLRGIGY
                     LVARKIEEAEKSNKKSIIVFSSSGGNAGLAAAYAARFFNVKCTVVLPKVSKANVIAKL
                     EELGATVIIHGEHWGEADQHLRETIIKSVGDDVEAIYCHPFDDPLIWEGHSKIVSEIL
                     LENQLPNFDKVKGVICSVGGGGLYNGVVEGLRSYNVPVLAMETKQAPTFNETVMNGQV
                     VHLKSVKTLASSLGSPYLSAKAWENYKAHKTYLGLIDDLDAIQGTLDLYDTLGYQVEP
                     ACGAAVATVFQRKEFLNYFQGLEKDDIIIVIVCGGSGINEEIIKQYRQMTRNSTK"
     gene            <1077504..>1078229
                     /locus_tag="PVL30_003557"
                     /old_locus_tag="LELG_02708"
                     /db_xref="GeneID:5233282"
     mRNA            <1077504..>1078229
                     /locus_tag="PVL30_003557"
                     /old_locus_tag="LELG_02708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526100.1"
                     /db_xref="GeneID:5233282"
     CDS             1077504..1078229
                     /locus_tag="PVL30_003557"
                     /old_locus_tag="LELG_02708"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526150.2"
                     /db_xref="GeneID:5233282"
                     /db_xref="PFAM:PF08730"
                     /translation="MTPKRKKGQFALSGSYSSVDPELEDEILEVYTNYMDSQMDLKEV
                     EQDLALRDLPQMFSMLNIPSCFTKDIEAAIDYYYDIMKSKKSSMIDRTNRKQNITMYM
                     IEAYTITPSSVKVVDDVLDIVDIDKLINNLNRLLKFRNNYSHIRASWALFFADGADYY
                     NANHENYKLDLPGLKAVKTKLGLDNDLSNGGMISDSFLIDMLGCSQHDSKDRLLNFDF
                     DQRGACVTIKDFAEILGRIGEYD"
     gene            <1080101..>1082353
                     /locus_tag="PVL30_003558"
                     /old_locus_tag="LELG_02709"
                     /db_xref="GeneID:5233291"
     mRNA            <1080101..>1082353
                     /locus_tag="PVL30_003558"
                     /old_locus_tag="LELG_02709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526101.1"
                     /db_xref="GeneID:5233291"
     CDS             1080101..1082353
                     /locus_tag="PVL30_003558"
                     /old_locus_tag="LELG_02709"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526151.2"
                     /db_xref="GeneID:5233291"
                     /translation="MLSLELYKQLQTSFIDCVIPDLKEDSINLNKFALLDDLLTVLEA
                     SFKVEFNTAFFYRASNSKNDSQQNSQYFPSTNVMHILFTLASRSDKCNWTVTQSYTKN
                     GISESLSQVKQSNAYYRKLSYKSSLSCRSLALLKQYVAKAIENPIDNTQLYQLLMDVI
                     SDLVMRPSFKSQFPHKKISDFYKTAKRNYQDDNVTGEDGKNILKKRRKSYTNRSKEEI
                     ETDDLVLSDSQEDSDTEIRIARCTLDGNKPIQGKQILTDMGRKSHQQEHEEHEEHEEH
                     EEHEEHGEQMEQLNHDAQVGNLPTIEKVTTRPLEAWNGLRVYDEPLLKDKLIIDNGFN
                     IWKLINWTFYCAGLSSNYYYGVESNCSSIYKAEARLLDTIFDFLEANLVMELKRLMHS
                     EDPYLQLSKLTTGEKKMMISHVENSSNILFSKLIKTLGHFRSSYYDRIVEYVFNGLAA
                     RSTGMPDACYQHEAALVKKEARAKNTQQSKNSSDYRRCKVNDNLDSMNLRFKMSLVTH
                     HWSLIFTETIVIEKKDKLNINQRHSPLESNNFLGYLSEKLSTLDFKYFEAFYFASYYE
                     SKITKTYKDFFLMQLSCKFLSDALSSSNNDYNLKHRSFCNDNASLIEDENLNTILDWI
                     QDTATYSSVTENELWRSFGEFYQMWLKVNFVLEWLILWVIQDFKQQTSHQIFLKRLNT
                     LEEAFTASDHLRQKEFFKFVKLCTKSKERKSSNSKTKLRFDINEADASFYKANFSKCD
                     TFTSILKRFV"
     gene            complement(<1082515..>1083168)
                     /gene="ERV25"
                     /locus_tag="PVL30_003559"
                     /old_locus_tag="LELG_02710"
                     /db_xref="GeneID:5233553"
     mRNA            complement(<1082515..>1083168)
                     /gene="ERV25"
                     /locus_tag="PVL30_003559"
                     /old_locus_tag="LELG_02710"
                     /product="vesicle coat component"
                     /transcript_id="XM_001526102.1"
                     /db_xref="GeneID:5233553"
     CDS             complement(1082515..1083168)
                     /gene="ERV25"
                     /locus_tag="PVL30_003559"
                     /old_locus_tag="LELG_02710"
                     /codon_start=1
                     /transl_table=12
                     /product="vesicle coat component"
                     /protein_id="XP_001526152.2"
                     /db_xref="GeneID:5233553"
                     /db_xref="PFAM:PF01105"
                     /translation="MYSVLNLTYILVLFASFANALHMEVPALPNPTPVCIRDFVQGDQ
                     MVVVNVFTDGYKGDGQRLDMRVTDSLGNLYATRKNVVGETKVAFTSHNNAAVDICFTN
                     HQEQEWKKHGSRESSIRSVELEIESGAAARDWNALQASEKLKPNEVDLKKIESLTGEI
                     IQELQYLKAREERMRDTNESTNSRVKNFSIVIIASLVGFGVWQISYLRHYFKVKHII"
     gene            <1083794..>1084006
                     /locus_tag="PVL30_003560"
                     /old_locus_tag="LELG_02711"
                     /db_xref="GeneID:5232922"
     mRNA            <1083794..>1084006
                     /locus_tag="PVL30_003560"
                     /old_locus_tag="LELG_02711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526103.1"
                     /db_xref="GeneID:5232922"
     CDS             1083794..1084006
                     /locus_tag="PVL30_003560"
                     /old_locus_tag="LELG_02711"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526153.1"
                     /db_xref="GeneID:5232922"
                     /translation="MAKGRADSTMIKMVSTALTGYEKWFRIPRSSRKLHLILYDPRAK
                     RHCLFEEDRKRKIAEVPPKDYTRSHR"
     gene            complement(<1084346..>1087522)
                     /gene="CYM1"
                     /locus_tag="PVL30_003561"
                     /old_locus_tag="LELG_02712"
                     /db_xref="GeneID:5233355"
     mRNA            complement(<1084346..>1087522)
                     /gene="CYM1"
                     /locus_tag="PVL30_003561"
                     /old_locus_tag="LELG_02712"
                     /product="Mitochondrial presequence protease"
                     /transcript_id="XM_001526104.1"
                     /db_xref="GeneID:5233355"
     CDS             complement(1084346..1087522)
                     /gene="CYM1"
                     /locus_tag="PVL30_003561"
                     /old_locus_tag="LELG_02712"
                     /note="MEROPS:MER0025036"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial presequence protease"
                     /protein_id="XP_001526154.2"
                     /db_xref="GeneID:5233355"
                     /db_xref="PFAM:PF00675"
                     /db_xref="PFAM:PF05193"
                     /db_xref="PFAM:PF08367"
                     /translation="MLTRNIANHSRNLCVRRYASTDLSLVSKKYPIGSKLHGFEIQNT
                     RLVPEFSLVAVLLKHEASGAQHLHLDSPNDHNNVFSIAFKTNAPDATGVPHILEHTTL
                     CGSSKFPVRDPFFKMTNRSLSNFMNAMTGHDYTFYPFATTNSKDFDNLLDVYLSSVFQ
                     PLLTSNDFLQEGWRLENSDVQDINSKLEFKGVVFNEMKGQYSNSMYYFYIKFLESIYP
                     SLNNSGGDPLNITDLTHQQLLEFHSKNYTPSNAKSFTYGNLGLDNHLRHINLYYTQYT
                     SHGKNMPLSNHKREKQSETDIKLPIFETKKQLNYDVIVKGPVDTMSNKPVAEQFHSSI
                     TWYLGNPLKANMQFKVFKWKVLGSLLFDGHNSPLYQELIETGYSEDFSANSGLDSTSA
                     LFSFTIGLNFLTKAKADALTSKVEDIIQRKVLPELRNTSSSYHKRVSALLHQFEIGLK
                     KHKPDFGFGLLSSIVSSWTNGVDPIESLKVEEILTLFKNEFESRGLSMFEDLLNESIL
                     NKNSQTFKFTMEPDLNFNKNLANLESKNLEQKISQLTDKDRNELYNRNIGLVEYQRQE
                     EDVSVLPTLTIQDIPQQGDSYPLINTKNNEGLSISRRVVDTNGLVYISGLKSLDSLPI
                     EWYKYLPIFSSCLTNLAGTARTPITDLETVIQTYTGGLSFGAKIAADPYNINKMKLQY
                     SISGVALEKNAPRIYDLWHEILSETRFTDDNDVLEKLTTLVRNLGQNQINNIADRGHS
                     FACGESNSRLTPAKFAAEQMNGITQVQLIMEMNKSLDAHGAEYLKNELLPILRKIQSF
                     VLAGQFKYRIVGNKDIVTENESLITKFDERISTYDPISVATKGDGSVSGADIGIVNLM
                     NHKFDSYNPNLEKVLVNLPFQVGYSSLAKTGAPYSSRDGAALQILSQLYTFKNLHSKI
                     RESNGAYGGGLNYDGLGGILDFYSYRDPNPIKSIETFQSSFAYGLDANWDSKDLTEAK
                     LRIFQSVDAPINVASQGATEFYEGISDTLRQERRDNFLDINNQDLMNVTEKYLLNSRD
                     AITVIANNDTLKVGEDWNVKNLQNLEGT"
     gene            <1088081..>1089133
                     /gene="OAC1"
                     /locus_tag="PVL30_003562"
                     /old_locus_tag="LELG_02713"
                     /db_xref="GeneID:5232954"
     mRNA            <1088081..>1089133
                     /gene="OAC1"
                     /locus_tag="PVL30_003562"
                     /old_locus_tag="LELG_02713"
                     /product="Mitochondrial oxaloacetate carrier protein"
                     /transcript_id="XM_001526105.1"
                     /db_xref="GeneID:5232954"
     CDS             1088081..1089133
                     /gene="OAC1"
                     /locus_tag="PVL30_003562"
                     /old_locus_tag="LELG_02713"
                     /note="BUSCO:EOG09263OCO"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial oxaloacetate carrier protein"
                     /protein_id="XP_001526155.2"
                     /db_xref="GeneID:5232954"
                     /db_xref="PFAM:PF00153"
                     /translation="MSESNEKALLAFSARPQKSGSKKSDDIIKNSTPVNNAQKVSSVG
                     GFIAGGLAACGAVTFTNPIELIKTRMQLQGELSRTEKGQVKLYKNPFQAFKVIYQHEG
                     IRGLQQGLLCGYYYQLGLNGCRIGLYEPSRYYFTKLLYPSNIKNGVVSENMLINVLSG
                     FTSGAAGAVLASPFFLIKTRMQSFSKTGAVGQQTHYESAWDGIKQIYRHEGFKGLYRG
                     VDAAILRTGAGSSAQLPIYYYTKNFVLKHDIVKDNSLMLHFLSASMAGLGVSIVMNPW
                     DVVLTRMYNQKGNLYTSPLDCFKKIIAIEGPLALYKGFWAQLFRVAPHSILTLMFMEQ
                     CMKVMVKVEDGLHRFF"
     gene            <1090216..>1092645
                     /locus_tag="PVL30_003563"
                     /old_locus_tag="LELG_02714"
                     /db_xref="GeneID:5233374"
     mRNA            <1090216..>1092645
                     /locus_tag="PVL30_003563"
                     /old_locus_tag="LELG_02714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526106.1"
                     /db_xref="GeneID:5233374"
     CDS             1090216..1092645
                     /locus_tag="PVL30_003563"
                     /old_locus_tag="LELG_02714"
                     /note="BUSCO:EOG09260H6E"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526156.2"
                     /db_xref="GeneID:5233374"
                     /db_xref="PFAM:PF01753"
                     /translation="MRDSNFRAVSGNKAAVTITTSLYDRRALDVTSDKPLVNSLNYLT
                     YLVSSSAKVRETLSVDGGIERLIDILQECHNGDLHTDNFTEEKKLLVAWKWTLAFQCI
                     VLVGTRGTEKVRQKVVKAGVLPIIATVLDNYLSLHEGTFRHMHANSTTYSDDNGISPA
                     ENVFQSNQPGQSINQNLRNLRSRSTDGITSRYGGTTASSNDFNTYRLVARETSNSNTT
                     ISDTNLFGDHNSPNSLNMASLTIDDYENTSVEQLFNLLRSIEWTNKYTFTNGNNNSNN
                     NSNNNNNNNNNNNNNNNNNKISNSNANSTTDSSLLLNESAESAVDADLKRAFVILNIL
                     IRLRETKEAEISKPGFVDDCEFDMDSNLSFLSVLYARDMEINSANAKIAVRNFTDTGV
                     VIPKDDDIVWSLQLLAYISKYPYLKESIQHTHLDLNMSIRSKLVKLYIEQEIKQESKR
                     NPILLIRQSSTPNPQGADNHIENTNHSIGTGLERFDPSASNSPQMVKALTDDNLILNE
                     DNFSLSVPSLKCKGRYVGESTDAMDSASAASAASAASAAIASREDSFGKDEYCAENEE
                     DPDEYEETVSETSGSLVDAASTHSFDYILSFYEALFECEQIQDKFERNIRSYQLLSKL
                     KLYIEMERDKLCDAVIECRLKQKTDLEKRWNYETYNYFSVDDFDEDKDDRLSACKEVD
                     LFPLVEKFTFLSGSDMYYWAGVIMRNSCRRNELKGGIRQCGNLECGKWEKYPREFSKC
                     RRCKRTKYCSRDCQMKSWHCHRNWCIPSASSSSASSSTTTGNTISIHGNQQHHTHPHN
                     QETANFDEGGD"
     gene            <1093122..>1094093
                     /locus_tag="PVL30_003564"
                     /old_locus_tag="LELG_02715"
                     /db_xref="GeneID:5233384"
     mRNA            <1093122..>1094093
                     /locus_tag="PVL30_003564"
                     /old_locus_tag="LELG_02715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526107.1"
                     /db_xref="GeneID:5233384"
     CDS             1093122..1094093
                     /locus_tag="PVL30_003564"
                     /old_locus_tag="LELG_02715"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526157.1"
                     /db_xref="GeneID:5233384"
                     /db_xref="PFAM:PF11789"
                     /translation="MPYSINTDNASNIAAAAAATTTTTTTPVAAVSDHYLPQDLSLPD
                     YVPLKRSLHREFLNIFSSNIATDPIKPALKQHQEVTNNYLQHILSNEALEFDIDSLRN
                     YLNGYKNLFYAFSRQERFSKLTQEPEMVAVTERDEGDVDLNSLDEFHMMQGKSFVDQI
                     KQHVERANEVTNTTGSDRLLRKDKFYQLLKNIIFVIENPEEPIPDDIEHFRVHENDIG
                     NEDAGDIDSDGDNDELNVSGGKISLKDPMTMNFFVKPKKSTRCGHTYEESSILELFRS
                     GQKNCPISGCKQQVDLECLEDDVLMLIRVRTALRSDKTAKKDLDLVA"
     gene            <1098704..>1115308
                     /locus_tag="PVL30_003565"
                     /old_locus_tag="LELG_02716"
                     /db_xref="GeneID:5233375"
     mRNA            <1098704..>1115308
                     /locus_tag="PVL30_003565"
                     /old_locus_tag="LELG_02716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526108.2"
                     /db_xref="GeneID:5233375"
     CDS             1098704..1115308
                     /locus_tag="PVL30_003565"
                     /old_locus_tag="LELG_02716"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526158.2"
                     /db_xref="GeneID:5233375"
                     /db_xref="PFAM:PF11766"
                     /db_xref="PFAM:PF15789"
                     /translation="MITLILRFLTLLALIQAAQVSNVFKSFDKIQYVQAGLYDYKVPA
                     FAYWKSTLSWNIDGQNVKPGDTFTLHMPCTYRFYSSQSTIQLSFAGKAYADCTLFSGE
                     DLVTFSELQCTATSLVNEDTNVAGSIDLPLIFNQGGGGSKNDLECSTFYKGGTNTITF
                     SDGGEPLSTTVNFELRNYYVTQSPENYLLMNSRYSSNLQRLYIRLTGADCPNGISSGV
                     YTIDNLYTTIDCSHVATYIATSFNGWKNPTEAEPFDMRVTCTRNSVSISYNNIPAGYR
                     PLFEVTFNLGLGQQARANVYNDFQCVGQSAKSNSEPFGWQPASVGNVNVNEGYEIDYI
                     TSTYDMQSTRVTTLPFRTGIDKTKTIVVEVPYHTTTVTEHYCGKSVKYSTETEGGVVK
                     IEEMQPDNDLCTPTQYTTTWVTTTDDGKEITQSGIVSEQGEITSTITTFPPPFTTEYT
                     TTWTTTDEEGNEVTESGIVSQSDESLTTITTFPRPFTTEYTTTWTTTDEEGNEVTESG
                     IVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLTTITTFPH
                     PFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLTTVTTFPHPFTTEYTTTWTTTDEEG
                     NEVTESGIVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLT
                     TVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYT
                     TTWTTTDEEGNEVTESGIVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEGNEVTESG
                     IVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLTTVTTFPR
                     PFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEG
                     NEVTESGIVSQSDESLTTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDESLT
                     TVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPRPFTTEYTTTW
                     TTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSG
                     IVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPG
                     PLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTD
                     EEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDS
                     SLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTT
                     EYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGN
                     EVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTT
                     ITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTT
                     TWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGI
                     VSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPI
                     ASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDE
                     EGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSS
                     LTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTE
                     YTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTE
                     SGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTV
                     TTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTT
                     TDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIV
                     TQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPL
                     TTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEE
                     GNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSL
                     TTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEY
                     TTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTES
                     GIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFP
                     PIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTT
                     DEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSD
                     SSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFT
                     TEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEV
                     TESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLS
                     TVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTW
                     TTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSG
                     IVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPG
                     PLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTD
                     EEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDT
                     SLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTT
                     EYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVT
                     ESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITT
                     FPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWT
                     TTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQ
                     SDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRP
                     FTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGN
                     EVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTT
                     ITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTT
                     TWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGI
                     VSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTF
                     PRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTT
                     TDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQS
                     DTSLTTITTFPGPLTTEYTTTWTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDF
                     TTEYTTTWTTTDEEGNEVTDSGIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNE
                     VTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDSGIVTQSGESL
                     STVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFPGPLTTEYTTT
                     WTTTDEEGNEVTESGIVSQSDSSLTTITTFPPIASDFTTEYTTTWTTTDEEGNEVTDS
                     GIVTQSGESLSTVTTFPRPFTTEYTTTWTTTDEEGNEVTESGIVSQSDTSLTTITTFP
                     GPLTTEYTTTWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPEVSEGDVTTEYTATW
                     TKTDEEGNEVTESGIVSVSGDSETTITTFPQPEVSEGDVTTEYTATWTKTDEEGNEVT
                     ESGIVSVSGDSETTITTFPQPEVSEGDVTTEYTATWTKTDEEGNEVTESGIVSVSGDS
                     ETTITTFPQPEVSEGDVTTEYTATWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPE
                     VSEGDVTTEYTATWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPEVSEGDVTTEYT
                     ATWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPEVSEGDVTTEYTATWTKTDEEGN
                     EVTESGIVSVSGDSETTITTFPQPEVSEGDVTTEYTATWTKTDEEGNEVTESGIVSVS
                     GDSETTITTFPQPEVSEGDVTTEYTATWTKTDEEGNEVTESGIVSVSGDSETTITTFP
                     QPEVSEGDVTTEYTATWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPEVSEGDVTT
                     EYTATWTKTDEEGNEVTESGIVSVSGDSETTITTFPQPEESTDEFTVTWTRTNEDGSE
                     VTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYE
                     TTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSEGDVT
                     TEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDG
                     SEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGD
                     YETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSEGD
                     VTTEYTVTWTRTNEDGTEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNE
                     DGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGTEVTESGIVSKS
                     GDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSE
                     GDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRT
                     NEDGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGTEVTESGIVS
                     KSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPP
                     SEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWT
                     RTNEDGSEVTESGIVSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGI
                     VSKSGDYETTITTFPPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGDYETTITTF
                     PPSEGDVTTEYTVTWTRTNEDGSEVTESGIVSKSGLSISTISTFKHASSVIESRTRPT
                     VSPSSVATSSLVPVEAAGSSIQVSFVLFIFTAIFTVLF"
     gene            <1120742..>1125232
                     /locus_tag="PVL30_003566"
                     /old_locus_tag="LELG_02721"
                     /db_xref="GeneID:5232953"
     mRNA            join(<1120742..1120850,1121199..>1125232)
                     /locus_tag="PVL30_003566"
                     /old_locus_tag="LELG_02721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526113.2"
                     /db_xref="GeneID:5232953"
     CDS             join(1120742..1120850,1121199..1125232)
                     /locus_tag="PVL30_003566"
                     /old_locus_tag="LELG_02721"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526163.2"
                     /db_xref="GeneID:5232953"
                     /db_xref="PFAM:PF11766"
                     /translation="MLLSHSMRSQILPPQNATSYAFVVVDYFAHQLDIPTLLVVLSIA
                     KAAQVSNVFQSFDSLTWQNGASYPYRTPAAPNWIAQLSWKILGSNVQAGDSFTLHMPC
                     VFKFTTTSTGVSLAVGDTVYATCNFAPGDLVVAYSELQCVATSNVKASTNAYGSVSFP
                     LTFNTGGSANAVDLQDSKCFTEGTNTVTFTDGGNPLSIQTNFQGGSNTNAQLGIGTDS
                     IIYSNRVVPSLNKQQLYLVAGNCPSGYTSGTLGVSVTSGSIDCSTIHAAISNSFNAWF
                     LPTSASSFQYTTSCNSNGYSIRYSNVPAGYRPYIDLLASVATGSRLRTVFTNQYRCSN
                     SLFTTDNSRTVTWSPYNNDQVGSNGEEVVVTTETYYGSTTAVTTLPFSSGIDKTKTIV
                     VDVPIPTTTAFEKICASAKSFETIKATPGATATIIEYDPDVSLCPLASSSSEEPTTSE
                     EPSSSEEPTTSEEPSSSEESTSSEEPSSSEEPTTSEEPSSTEESSSSEEPTTSEEPSS
                     SEKSTSSEEPSSSEEPTTSEEPSSTEESSSSEEPTTSEEPTTSEEPSSSEEPTTSEEP
                     SSSEEPTTSEEPTTSEEPTSSEEPSSSEQPATSEEPSSTEEPTTSEEPTTSEEPTTSE
                     EPSSSEEPTTSEEPTTSEEPTTSEEPTTSEEPTTSEEPTTSEEPTTSEEPTTSEEPSS
                     TEEPSSSEEPSSSEEPTTSEEPSSTEEPSSSEEPSSTEEPSSTEEPSSTEEPSSTEEP
                     TTSEKPTSSEEPTTSEEPTTSESSISSSSIVPPYQNSTVPESSSFNTDTGTEIPPTGT
                     DTNVPPTGTNTGVPPTGTDTNVPPTGTDTNVSPTGTDTNAPPTGTNTGVPPTGTDTNV
                     PPTGTGTNVPPTGTDTNVPPTDTNTGVPPTGTDTNVPPTGTNTGVPPTGTDTNVPPTG
                     TDTNVPPTGTNTGVPPTGTDTNVPPTGTDTNVPPTGTDTNVPPTGTNTGVPPTGTDTN
                     VPPTGTDTNVPPTGTNTGVPPTGTDTNVPPTGTNTGVPPTGTDTNVPPTGTNTGVPPT
                     GTDTGVPPTGTDTGVPPTGTNTGVPPTGTDTNVPPTGTNTGVPPTGTDTGVPPTGTDT
                     NIPPTGIDTNVPPTGTDTNVPPTGTNTGVPPTGTATGVPTTGTDTIIPPTGTDTNVPP
                     TGTNTNVPPTGTNTGVPPTGTDTGVPTTGTDTNVPPTGTDTIIPPTGTNTGVPPTGTD
                     TNVPPTGTDTNVPPTGTNTGVPPTGTDTGVPPTGTDTNVPPTGTETGTSSSGTNVELA
                     PPIETGNGTGSQLSESSTNAQPTGSNSDNGGQSNEQTNGNNSAQPSEFYGSGSGPKAS
                     GEETAVASLTTIATQSAPSVSESAIINVPTASAFEGAAAPQFVKHSSLLTGCIFLITI
                     LI"
     gene            <1126635..>1127270
                     /gene="CPR2"
                     /locus_tag="PVL30_003567"
                     /old_locus_tag="LELG_02723"
                     /db_xref="GeneID:5233041"
     mRNA            <1126635..>1127270
                     /gene="CPR2"
                     /locus_tag="PVL30_003567"
                     /old_locus_tag="LELG_02723"
                     /product="Peptidyl-prolyl cis-trans isomerase B"
                     /transcript_id="XM_001526115.1"
                     /db_xref="GeneID:5233041"
     CDS             1126635..1127270
                     /gene="CPR2"
                     /locus_tag="PVL30_003567"
                     /old_locus_tag="LELG_02723"
                     /codon_start=1
                     /transl_table=12
                     /product="Peptidyl-prolyl cis-trans isomerase B"
                     /protein_id="XP_001526165.1"
                     /db_xref="GeneID:5233041"
                     /db_xref="PFAM:PF00160"
                     /translation="MMKILTSLALVASLLFFFFNTARAAAAKDLPENPPVTDTVYFDI
                     EEEGNSIGRITIGLFGTIVPKTVENFRTIAASTDPKQQYTNSVFHRVIKNFMIQGGDY
                     EYGQGYGGQSIFGKKFEDENFQLKHDRKYRLSMANAGKNTNGSQFFITTAVTSWLDGK
                     HVVFGEVLDGQDVVDYIESVKTARGDRPVKEIKISKAGVIKAKEDLKKDEL"
     gene            complement(<1127436..>1128311)
                     /gene="MED6"
                     /locus_tag="PVL30_003568"
                     /old_locus_tag="LELG_02724"
                     /db_xref="GeneID:5232937"
     mRNA            complement(<1127436..>1128311)
                     /gene="MED6"
                     /locus_tag="PVL30_003568"
                     /old_locus_tag="LELG_02724"
                     /product="Mediator of RNA polymerase II transcription
                     subunit 6"
                     /transcript_id="XM_001526116.1"
                     /db_xref="GeneID:5232937"
     CDS             complement(1127436..1128311)
                     /gene="MED6"
                     /locus_tag="PVL30_003568"
                     /old_locus_tag="LELG_02724"
                     /note="BUSCO:EOG09264S40"
                     /codon_start=1
                     /transl_table=12
                     /product="Mediator of RNA polymerase II transcription
                     subunit 6"
                     /protein_id="XP_001526166.2"
                     /db_xref="GeneID:5232937"
                     /db_xref="PFAM:PF04934"
                     /translation="MEALDEIQWKSPEFIQTRGLNTTNVLEYFSLSPFYDRTSNNQVL
                     MMQFQYQQVQIPPRMTFHQYFQNRLQEMTGVEFVIALVREPDFWIIRKQRRISPTSTN
                     TLQDYYIVGANVYQAPRIYDVLSSRMLASVLALKKSAKTMNEMTSYHISDGGHSFNNS
                     IHGGEADKLASNISSNSLEPQPMQPNSETPAPFKESPGLESSAINTVSPNLAQAQNQP
                     SSTNSTTATATATATNGGAANNTISFSSSTFDALLGEVTKEKDIEEAIYLKDKPLYGP
                     GSIVDQLGVRTNIVD"
     gene            complement(<1128578..>1129225)
                     /gene="HNT2"
                     /locus_tag="PVL30_003569"
                     /old_locus_tag="LELG_02725"
                     /db_xref="GeneID:5232963"
     mRNA            complement(<1128578..>1129225)
                     /gene="HNT2"
                     /locus_tag="PVL30_003569"
                     /old_locus_tag="LELG_02725"
                     /product="Dinucleoside triphosphate hydrolase"
                     /transcript_id="XM_001526117.1"
                     /db_xref="GeneID:5232963"
     CDS             complement(1128578..1129225)
                     /gene="HNT2"
                     /locus_tag="PVL30_003569"
                     /old_locus_tag="LELG_02725"
                     /codon_start=1
                     /transl_table=12
                     /product="Dinucleoside triphosphate hydrolase"
                     /protein_id="XP_001526167.2"
                     /db_xref="GeneID:5232963"
                     /db_xref="PFAM:PF01230"
                     /translation="MGSTHDVYFFRYLVNKQVFFRSRLTYALVNLKPLVPGHVLVVPL
                     RTSVLRFSDLIPDESVDYMNTLQLIHKFIIKHYKADSLNIAIQDGPESGQSIPHLHTH
                     IIPRYKTDGFGDSIYEKLEKFDLDTRYQDFEKRKQIAIQVREQQETNELNQDDSQRIE
                     RSEDVMAEEAKELAKALTSFMDEDGATDKFANITRRQEHHHQHSNSNSNSSKNIA"
     gene            <1131278..>1131868
                     /gene="TSA1"
                     /locus_tag="PVL30_003570"
                     /old_locus_tag="LELG_02726"
                     /db_xref="GeneID:5233034"
     mRNA            <1131278..>1131868
                     /gene="TSA1"
                     /locus_tag="PVL30_003570"
                     /old_locus_tag="LELG_02726"
                     /product="cTPxI"
                     /transcript_id="XM_001526118.1"
                     /db_xref="GeneID:5233034"
     CDS             1131278..1131868
                     /gene="TSA1"
                     /locus_tag="PVL30_003570"
                     /old_locus_tag="LELG_02726"
                     /codon_start=1
                     /transl_table=12
                     /product="cTPxI"
                     /protein_id="XP_001526168.1"
                     /db_xref="GeneID:5233034"
                     /db_xref="PFAM:PF00578"
                     /db_xref="PFAM:PF08534"
                     /db_xref="PFAM:PF10417"
                     /translation="MAPVIQKPAPSFKKTAVVDGVFEEVSLEQYKGKWVLLAFFPLAW
                     TFVCPTEIIAYSEAFKKFADKDAVVLFASTDSEYTLLSWTNAARKDGGLGQLNIPLIA
                     DTNHSLSKDYGVLIPEEGVALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQ
                     FTEKYGEVCPANWQPGSETIKATPNDSKEYFSKVNK"
     gene            complement(<1133254..>1134420)
                     /locus_tag="PVL30_003571"
                     /old_locus_tag="LELG_02727"
                     /db_xref="GeneID:5233255"
     mRNA            complement(<1133254..>1134420)
                     /locus_tag="PVL30_003571"
                     /old_locus_tag="LELG_02727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526119.2"
                     /db_xref="GeneID:5233255"
     CDS             complement(1133254..1134420)
                     /locus_tag="PVL30_003571"
                     /old_locus_tag="LELG_02727"
                     /note="BUSCO:EOG09263C4C"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526169.2"
                     /db_xref="GeneID:5233255"
                     /db_xref="PFAM:PF04000"
                     /translation="MSEIDLLLKSVMSSAESTRYAVDELTAHIKENRDNLPDFINKLL
                     QKSNQKEPEGISLLSLKNDALASYINNLSLVVLSQLDRLEGGNSTHGLDHNNNSGDVD
                     YRTEVSKQRDEAIARTIVQRVTLEKGVKPLERKINYQMENLVKAYNKTEAQQKEQERK
                     DEKEGEEGSSSSISSGGGGDRNASNKSVASSSDDDDDEEDDDDDDDDDELAYRPDATA
                     LAKLAPKATKSKSSASAFASASSSSSTEKYKPPKISAVAPPSSIREPTAKPDKTKRLQ
                     SMEEYLQEQSDLPIAEANIGSTIVGHGRGGVKTQHDRRKEKEIQAYEESNFTRLPATQ
                     TKKSFREKQRDMANQFAGEDWSIFENRDRNMSEGTSRKKRPASSWDRAKKRRSK"
     gene            <1134880..>1135665
                     /gene="NSA2"
                     /locus_tag="PVL30_003572"
                     /old_locus_tag="LELG_02728"
                     /db_xref="GeneID:5233526"
     mRNA            <1134880..>1135665
                     /gene="NSA2"
                     /locus_tag="PVL30_003572"
                     /old_locus_tag="LELG_02728"
                     /product="Ribosome biogenesis protein"
                     /transcript_id="XM_001526120.1"
                     /db_xref="GeneID:5233526"
     CDS             1134880..1135665
                     /gene="NSA2"
                     /locus_tag="PVL30_003572"
                     /old_locus_tag="LELG_02728"
                     /note="BUSCO:EOG09263ZBF"
                     /codon_start=1
                     /transl_table=12
                     /product="Ribosome biogenesis protein"
                     /protein_id="XP_001526170.1"
                     /db_xref="GeneID:5233526"
                     /db_xref="PFAM:PF01201"
                     /translation="MPQNEYIEQHIKQHGRRLDHEERKRKKEAREGHRVAKDAQTLKG
                     WRAKQFAKKRYSEKVSMRKKIKAHQESKVKGPSTPKQDEGEALPTYLLDRQTNNTAKA
                     LSSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVIKTGKSKTKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPAALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGLVTAGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     gene            complement(<1136097..>1139609)
                     /locus_tag="PVL30_003573"
                     /old_locus_tag="LELG_02729"
                     /db_xref="GeneID:5233265"
     mRNA            complement(<1136097..>1139609)
                     /locus_tag="PVL30_003573"
                     /old_locus_tag="LELG_02729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526121.2"
                     /db_xref="GeneID:5233265"
     CDS             complement(1136097..1139609)
                     /locus_tag="PVL30_003573"
                     /old_locus_tag="LELG_02729"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526171.2"
                     /db_xref="GeneID:5233265"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF04082"
                     /translation="MSTSSTGSTPLDFEDANHNNSAAPSSVANITTTNTTKKKKKRSL
                     GTFPCQHCDKVFSRSDHLARHNLNHEPKEVFVCDFPVEMGEASGNGNGSRGVGGGTTK
                     CGKTFVRKDLKERHVRRHYELMNEASGTAATSPAKSDNNNGRTGGKRDIKRKKYGSSS
                     SIATLATDTGISHQPGNGMQISNLIDTAERRVSYPNVHTPNGRERHSSLNSSHSNHFP
                     PTHPTQSLLEQQHQQHQQHQNIHHHLQHQQTHDNNQLAHTPISGAPPIPPTIDSSPSY
                     PLTTNLGYPNTNNFDTLLKNYGTTLPQNDILNWLFNDYQQTSVPYQVQPASTIPQHHQ
                     QQQQQQQKVSQIQAVPSFQQQHSQQSNTINFGLGQNTPNIPSPYVMSPQMTSNGQSNI
                     SQSVQPPYDSANILHNGIMDANVFSNESNPLDEFFTTNYNNMASKTARRSITEENARF
                     PNQVYNTDTTTTSPTSTADSVAESVPALSDITLTEEGKYMHFSERYNIGKYRNYYLDT
                     QLVNSIFQSLGINRLDIAKLGEANNKLENKLESKLESKLENRFAYYLSSYWSHFHPQF
                     SIVHKPSFDTKTANPLLLASMIIVGAQYSFPGTAEQLSQQRKKSLEWEISNALAQPLR
                     FALFQHEDFKSPVKVWILQCLNMLEWVEKNFLSRRLHERAHLHHGTTAQLLRRSAMMG
                     GNPAKINKKSTSAPSSAGEESETNEAEDSRGEENNDENKDQVLFDQWVESESLKRATF
                     MTFYLDIIDYVKFRHNPQILFYQLQLLNIPCNEETIWESTEINGSFKKLVKRLKKLQD
                     AGNKKKVPKKESFLSAVKKLLKSGGGSGLGGMKFEELKAESPFYKKILLAGLISLMYQ
                     MQQVELQTHSSLLTGNHLSSNSKIWREMLSRVFDTWYFQIMDNAKPTATTGVSVYNTP
                     KVNVSLPIFYLTQIIAMPDLTNYDIAIYCGSPANQSVAASMKDHHIVQRKMINLWGSK
                     NKSVESLRSIVYCLVFLWNVFLGEENEPLDWNSNCDYHDSAAPLSLAILVLWSFCFVT
                     CGLESNRYPEIEHMNETSSDSNRYEEQLATLSAENGYQYLIRIKEEFLTNLRKQNLHK
                     EYSIHPYSGTKHHDVINKYCEILPLISNKQNISGLCFLIGSKLVRSQWEIMREHGKLI
                     INCGLRSIGKKNILCSDLFDNEFQ"
     gene            complement(<1140752..>1142014)
                     /locus_tag="PVL30_003574"
                     /old_locus_tag="LELG_02730"
                     /db_xref="GeneID:5233259"
     mRNA            complement(<1140752..>1142014)
                     /locus_tag="PVL30_003574"
                     /old_locus_tag="LELG_02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526122.2"
                     /db_xref="GeneID:5233259"
     CDS             complement(1140752..1142014)
                     /locus_tag="PVL30_003574"
                     /old_locus_tag="LELG_02730"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526172.2"
                     /db_xref="GeneID:5233259"
                     /translation="MGGADSKRKILEQRFPFSTCNNPHLFETRALIQHGINLTIQFGL
                     IDFHNFKETTCEEGIDIHSTKKHCSDQPRIIDDDDNNNNNNNNNNNNNNNNNSDEEDE
                     DSLMEFEHVPPSPILVPLDTPKSSFKRGSFSRRGSYEADFRDISMVMCYQKIDGWIKE
                     FFPPDSVGNQSLYANIKNYIINSIIQKEDNIDIFLGRIVNHRYKNELSDIIKAIFIEK
                     YEEIKLENLIDHFHLFLNHRLAGCSYQKLENPKFYDKYYTIWKLDSRDYKHYDEEYFF
                     DYFNNGGKSATTMEHIILQNGFLANYRRFVASFASDAKNYNNDTDVEDEDLQDREDNS
                     NNAIDFNVSEGNVSTNGSYATVAIANDPIHLANNDAQSIANSFSLVDASMHQPKKLRF
                     SDDDNVININRYLPVDHVLYKQMNEKLL"
     gene            <1143530..>1145443
                     /gene="GDA1"
                     /locus_tag="PVL30_003575"
                     /old_locus_tag="LELG_02731"
                     /db_xref="GeneID:5233432"
     mRNA            <1143530..>1145443
                     /gene="GDA1"
                     /locus_tag="PVL30_003575"
                     /old_locus_tag="LELG_02731"
                     /product="Guanosine-diphosphatase"
                     /transcript_id="XM_001526123.1"
                     /db_xref="GeneID:5233432"
     CDS             1143530..1145443
                     /gene="GDA1"
                     /locus_tag="PVL30_003575"
                     /old_locus_tag="LELG_02731"
                     /note="BUSCO:EOG09261EAB"
                     /codon_start=1
                     /transl_table=12
                     /product="Guanosine-diphosphatase"
                     /protein_id="XP_001526173.2"
                     /db_xref="GeneID:5233432"
                     /db_xref="PFAM:PF01150"
                     /translation="MLNTRNLRLVVAVLAIFGIVAFFVSSQNSAGSSVGRVNKEILKS
                     NNNAGGGIQKGTSNDQSNLIQPPVIEDEEEKEQQQQQQQQQSPSQQKTEGKKEKGTNQ
                     QDLEKEDSKNTLQGTPHSGTKPPYEKDDKPKKNIAEKIGGNPGDSIADSNGNIKETES
                     ETESGNESENKDENVNDVEKITDPKKVNMNSECNEVKYVVMIDAGSTGSRVHVYEFNT
                     CTQPPKLLSEEFMMLEPGLSSFDTDTVGAAKSLDPLLEKALEKVPKDKQGCTPVAVKA
                     TAGLRLLGEEKSNAILAEVRKHLEEDYPFAVVKGDGISILDGKDEGVYAWVTANYLLG
                     NIGNKDKLPTAAVFDLGGGSTQIVFEPEYKDDVPVEGETKYKFTFGDHDFTLYQFSHL
                     GFGLMQGRNKINKLVLDNYKKSKDAKELTLYTSKKEAKEAVAEVDIINPCIPPKSIAK
                     NVAVEVADGEIYVVNMKGSSEATGSQCRFLAEQILNKDQACESKPCSFNGVHQPSLVR
                     AFNKDSDMYVFSFFYDRTNPIGMPSSFTVEELRDLTKSVCQGESLWNNVFLGEHVDNL
                     SKEPQWCLDLSFITAMLHTGYDIPLHRELRTAKKIDNNELGWCLGASLPLLDSTSSNW
                     ECKKPKKTSFENI"
     gene            <1146749..>1148743
                     /gene="UTR1"
                     /locus_tag="PVL30_003576"
                     /old_locus_tag="LELG_02732"
                     /db_xref="GeneID:5233491"
     mRNA            <1146749..>1148743
                     /gene="UTR1"
                     /locus_tag="PVL30_003576"
                     /old_locus_tag="LELG_02732"
                     /product="NAD(+) kinase"
                     /transcript_id="XM_001526124.2"
                     /db_xref="GeneID:5233491"
     CDS             1146749..1148743
                     /gene="UTR1"
                     /locus_tag="PVL30_003576"
                     /old_locus_tag="LELG_02732"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD(+) kinase"
                     /protein_id="XP_001526174.2"
                     /db_xref="GeneID:5233491"
                     /db_xref="PFAM:PF01513"
                     /db_xref="PFAM:PF20143"
                     /translation="MDLQQLRESRKNGISHVSSSSSISSLATEVQPDGTNIPEPSHAE
                     SQARQIPQPQQRKQNHSINDHPLVSPQPQFPHHHQHQHQHQHQHPQTQTQTQTPQQPQ
                     PSSFRRKNSIQRFNRSLLNSSTTSMASSYNGVGSFTNSAANSGLNSGVNSGSVSALHS
                     MSSSPKDSFIRETPRIHSKLYCEEVAGGAKTAKEVLSRLSTDELRSVRTHTELAETAN
                     GVRMLAKNLSRATIQLNVKSIMIITKARDNALVYLTREVVEWLFSEHEDMTIYVDAKL
                     QASKRFNCDAIIQEYPVAAKQLKFWNKKLTMKSPELFDLVVTLGGDGTVLFVSNLFQR
                     IVPPVLSFALGSLGFLTNFKFDDYKSRLDHCINSGVKANLRMRFTCRVHTNEGKLICE
                     QQVLNELVVDRGPSPFVTQLELYGDGSLLTIAQADGLIIATPTGSTAYSLSAGGSLVH
                     PGVSAISVTPICPHTLSFRPILLPDGMFLKIKVPSTSRSTAWCSFDGRVRTELAKGYY
                     VTVQASPFPFPTVISSKNEYIDSVSRNLHWNIREQQKPFSSYLKPEMRRMIADNPEDQ
                     GTFDKLNSGATGAEDETEEEEFDIDYGDQDVKEEKHIATSGGQGGSQDASETNSEDML
                     FIPPGGGTQTPQNANYLNSDERSCYAHPHAKIHLSGNGDL"
     gene            <1149770..>1151764
                     /gene="DED1"
                     /locus_tag="PVL30_003577"
                     /old_locus_tag="LELG_02733"
                     /db_xref="GeneID:5233527"
     mRNA            <1149770..>1151764
                     /gene="DED1"
                     /locus_tag="PVL30_003577"
                     /old_locus_tag="LELG_02733"
                     /product="DEAD-box ATP-dependent RNA helicase"
                     /transcript_id="XM_001526125.1"
                     /db_xref="GeneID:5233527"
     CDS             1149770..1151764
                     /gene="DED1"
                     /locus_tag="PVL30_003577"
                     /old_locus_tag="LELG_02733"
                     /codon_start=1
                     /transl_table=12
                     /product="DEAD-box ATP-dependent RNA helicase"
                     /protein_id="XP_001526175.2"
                     /db_xref="GeneID:5233527"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /translation="MSDISQQMNNLSVQDNNKPNGNGYSGQPQQQSGRRQYVPPHLRN
                     RSSHQPSSNGANGDIPFGGSRRSDYGGGRGGFGFGGGSNGGGSGPSGGYRNGGARGGS
                     RGGFGGGRYQRPTPGVGRWVDGKHEPAPRNDRLELELFGVAEDTSFQSSGINFDNYDD
                     IPVEASGEGVPEPINSFTAPPLDELLVENIKLSRFTKPTPVQKYSVPIVAAGRDLMAC
                     AQTGSGKTGGFLFPVLSESYMNGPAPIPESTGAFSSHKVYPTILVMAPTRELVSQIYD
                     ESKKFAYRSWVRPCVVYGGADIGNQIRQLDRGCDLLVATPGRLKDLLERGRVSLANIK
                     YLVLDEADRMLDMGFEPQIRHIVQECDMPDVQDRQTLMFSATFPRDIQMLARDFLKDY
                     IFLSVGRVGSTSENITQKVLYVEDEEKKSVILDLLNANSEGLTIVFTETKRMADNLAD
                     FLYDQGFPATAIHGDRSQYEREKALAAFKSGQAPILVATAVAARGLDIPNVSHVINYD
                     LPSDIDDYVHRIGRTGRAGNVGIATAFFNRNNKNIVKGMLDLLTEANQEVPDFLNKIA
                     RESAFGRPGRGSSRGGGAGGFGGSRGGANRDFRRAGGASGSSSSGWGNSSSSGWGGSG
                     NSGWGNSNGYSNGGGSYGGSRSSFNDNSSYGNPSSQNSWW"
     gene            <1152768..>1153940
                     /gene="OCH1"
                     /locus_tag="PVL30_003578"
                     /old_locus_tag="LELG_02734"
                     /db_xref="GeneID:5233175"
     mRNA            <1152768..>1153940
                     /gene="OCH1"
                     /locus_tag="PVL30_003578"
                     /old_locus_tag="LELG_02734"
                     /product="membrane-bound alpha-1,6- mannosyltransferase
                     Initiation-specific"
                     /transcript_id="XM_001526126.1"
                     /db_xref="GeneID:5233175"
     CDS             1152768..1153940
                     /gene="OCH1"
                     /locus_tag="PVL30_003578"
                     /old_locus_tag="LELG_02734"
                     /note="CAZy:GT32"
                     /codon_start=1
                     /transl_table=12
                     /product="membrane-bound alpha-1,6- mannosyltransferase
                     Initiation-specific"
                     /protein_id="XP_001526176.2"
                     /db_xref="GeneID:5233175"
                     /db_xref="PFAM:PF04488"
                     /translation="MGRRNYRNYILGTAILISFYYFYLFFNTTKSSASKTDYNLPKFQ
                     LLRELESHTDWRTRGLNFQPKYTSPASLESQVQQQLASAYPYDRESAFPKLIWQTWKI
                     GLDDPSFPKRYVNYQETWNDKNPEYKHYVVPDEQCDLLIEELYSTVPEVAEAYKLLPK
                     SIMKADFFRYLILFARGGVYTDIDTVGLKPVDSWISNAVETPKYLDSANTAGFVVGIE
                     ADPDRPDWNDWYARRIQFCQWTIQSKRGHPLLLHLISKITELTLTRRDKSQLNKVLGK
                     DQGGDIMDWTGPGVFTDAVFEYVNRLMQKGGDTTKNVISKKKSKSKKREMIEKIVDWK
                     LFTGMEQPILIDDVMVLPITSFSPDVNQMGAKSSGDPMAYAKHMFSGSWKDDQVAN"
     gene            <1154916..>1156199
                     /locus_tag="PVL30_003579"
                     /old_locus_tag="LELG_02735"
                     /db_xref="GeneID:5233462"
     mRNA            <1154916..>1156199
                     /locus_tag="PVL30_003579"
                     /old_locus_tag="LELG_02735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526127.1"
                     /db_xref="GeneID:5233462"
     CDS             1154916..1156199
                     /locus_tag="PVL30_003579"
                     /old_locus_tag="LELG_02735"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526177.1"
                     /db_xref="GeneID:5233462"
                     /db_xref="PFAM:PF03069"
                     /translation="MPAEPIRYVTTVDLDKPGDVQPQVHNRWHPDVPFTETIKPGETV
                     KLECLDWTGNQIKNNDFADDILNVDLSRIHYLSGPYNIEGAEPGDAILVEIKDVQPLE
                     RQPWGYCGVFHKSNGGGFLDKFYPEAAKAIFDFEGIHATSRHLPHTKFTGLIHPGIIG
                     TAPSEQVLKEWNSRETGLITEIQHLHDTPVAQAPLVKNAHGGKATGEVLKRIAKEGAR
                     TIPGRPENGGNCDIKNLSRGSKCYLPVYVAGAKLSIGDLHFSQGDGEISFCGAIEMAG
                     VITINVKLIKQGVEKLSLKSPMFIPGDVQNHYGSSRYLTFEGFSVDEDGKQGFLCATT
                     AYRQSCIRAIEYLRGFGYNDYQIYLLLSSAPIEGHIAGIVDVPNACTTLGLPMDIFDF
                     DISPESKLEKSGDLDLDMGNCAFVKGANHRVTYEF"
     gene            <1157461..>1158588
                     /gene="ERG6"
                     /locus_tag="PVL30_003580"
                     /old_locus_tag="LELG_02736"
                     /db_xref="GeneID:5233525"
     mRNA            <1157461..>1158588
                     /gene="ERG6"
                     /locus_tag="PVL30_003580"
                     /old_locus_tag="LELG_02736"
                     /product="Delta(24)-sterol C-methyltransferase"
                     /transcript_id="XM_001526128.1"
                     /db_xref="GeneID:5233525"
     CDS             1157461..1158588
                     /gene="ERG6"
                     /locus_tag="PVL30_003580"
                     /old_locus_tag="LELG_02736"
                     /codon_start=1
                     /transl_table=12
                     /product="Delta(24)-sterol C-methyltransferase"
                     /protein_id="XP_001526178.1"
                     /db_xref="GeneID:5233525"
                     /db_xref="PFAM:PF02353"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF08498"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MSPVQLAEKNFERDEKFTKALHGDSHKKQGLFALMAKSKDAASV
                     ANEGYFKHWDGGVTEDDEKKRLGDYSQLTHHYYNLVTDFYEYGWGSSFHFSRYYKGEA
                     FRQATARHEHYLAHKMNLNENMKVLDVGCGVGGPGREITRFTDCEIVGLNNNDYQIER
                     ANHYAKKYKLDHKLSYVKGDFMQMDFEPETFDAVYAIEATVHAPVLEGVYSEIYKVLK
                     PGGVFGVYEWVMTDEYDETNEEHRKIAYGIEVGDGIPKMYKREVAEQALKNVGFEIEY
                     EKDLADVDDEIPWYYPLAGDLKYCQSLGDLYTVFRTSRLGRFITTEAVGLMEKVGIAP
                     KGSKQVTFALEDAAVNLVEGGRKKLFTPMMLYIARKPENKE"
     gene            <1159552..>1160748
                     /locus_tag="PVL30_003581"
                     /old_locus_tag="LELG_02737"
                     /db_xref="GeneID:5232936"
     mRNA            <1159552..>1160748
                     /locus_tag="PVL30_003581"
                     /old_locus_tag="LELG_02737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526129.1"
                     /db_xref="GeneID:5232936"
     CDS             1159552..1160748
                     /locus_tag="PVL30_003581"
                     /old_locus_tag="LELG_02737"
                     /note="CAZy:GH76"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526179.2"
                     /db_xref="GeneID:5232936"
                     /db_xref="PFAM:PF03663"
                     /translation="MAPLENPNLEGYHVARQMWLEYYNPKAGTYIAKKKCSGCYNDEK
                     FVVWAVSVADQAIVDAARIYPEFKPLIQPAIAIFEKYKNRSKKGFSAAEGGDNDIYYD
                     DDAQVCSAMLTAYEVTGDKTYLDQGRELTRFLMSGWNDNPNAVTKGGVHWHISKKLLN
                     ACTTAEVAKACLQCSKFIPSEAQVYVDFAAKCIDWQIKVLQDPGDKLIMDGIGEDGDK
                     PDAAKWSYNTGTTLSAAAHLYQITKDQKWLKIATELAEAGINHNSFFYDRDFPNDKRY
                     WRDPSYFNQLLIEGLADYLLYVGQDVPEGLAQRIHDEVRRHLIMFYEFMKDPRDGGYI
                     QSFEPHNTYREVYDAKYHQWFGDGKGWGLKGEDKDGEGNPQKCLMGLGSAARIFFQGA
                     RIVPKI"
     gene            complement(<1161157..>1163490)
                     /gene="UTP4"
                     /locus_tag="PVL30_003582"
                     /old_locus_tag="LELG_02738"
                     /db_xref="GeneID:5233377"
     mRNA            complement(<1161157..>1163490)
                     /gene="UTP4"
                     /locus_tag="PVL30_003582"
                     /old_locus_tag="LELG_02738"
                     /product="U3 small nucleolar RNA-associated protein"
                     /transcript_id="XM_001526130.1"
                     /db_xref="GeneID:5233377"
     CDS             complement(1161157..1163490)
                     /gene="UTP4"
                     /locus_tag="PVL30_003582"
                     /old_locus_tag="LELG_02738"
                     /note="BUSCO:EOG09260VEY"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar RNA-associated protein"
                     /protein_id="XP_001526180.2"
                     /db_xref="GeneID:5233377"
                     /translation="MEVHRCRFVDYTPHTITSLAFSTRSTLDDNKPTPLDLRLAVGRS
                     NGDIEIWNPRHNWTHELTLAGSSGRSVEGLCWVTTYSSSHPSTTGASRKVESSRLFSI
                     GGSTYITEWNLATGQPLINYDCNAGVIWTIDVNSTGDKLAVGCDDGSVVVVDISGGKG
                     SLEHDIICQRQDARVLSLKWNKNEQIIGGCADGRIRVWSFQPETKGRIMATMRVDKSK
                     TESTLVWSLDVLKNKHQFISGDSTGHVKIWDLRYFTLVQSFKIHDADVLSIVCNLKED
                     KFYSSGIDRKIHQFDLLNTKTSSKWVHSYNRLLHSNDIRAMAIYESKNLNVLVSGGVE
                     RAIVIQNLQSFHDGKYKKLLINQQKSNVVVDDDADNNDNRLIALWSDQTVKIWKVCDS
                     SKQKLVSKLTLSDDENITSVDLKNNVLVVAKMSSVKVYELFEVAEDKYKVSKIRDENF
                     DSLVSGAKIVKLLNDAQFLVVTPDEEIYRFKINFDDKDDGEATITLEEEVELFENDND
                     DKNNGSFSYSINHLTITPDSQTLIISRFNGSIEIYPLFNNDKIQNPYTLTKLSLSPHL
                     IACRNSERLVVLTEENKLFEFNIGTQEQGQGQGQGQGQGLTAWSKRNSEYLPRQFTAL
                     EDKPQGMFVQSDKVWIYGTTWICFFDLTKNIPINKMYKNLSIGRKRNRSGLTINDADY
                     LDGEEASVHQIEQGMKQSGLDKMRQHIKDEGEDEEQLEAGDAEINASDKKAFWMTEKY
                     RPIMKVANFGENALVVIERPYFALPTTPAFDLPKLRV"
     gene            complement(<1164506..>1165782)
                     /locus_tag="PVL30_003583"
                     /old_locus_tag="LELG_02739"
                     /db_xref="GeneID:5233272"
     mRNA            complement(join(<1164506..1165686,1165767..>1165782))
                     /locus_tag="PVL30_003583"
                     /old_locus_tag="LELG_02739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526131.2"
                     /db_xref="GeneID:5233272"
     CDS             complement(join(1164506..1165686,1165767..1165782))
                     /locus_tag="PVL30_003583"
                     /old_locus_tag="LELG_02739"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526181.2"
                     /db_xref="GeneID:5233272"
                     /db_xref="PFAM:PF00887"
                     /translation="MSDSVDRVFVKAIATIRALSSRSNYGSLPRPPAENRVKLYGLYK
                     QATEGDVKGIMPRPVGFTPEDEGAKKKWDAWKREEGLHKTEAKKRYIAYLIETMKVYA
                     SGTHEARELLSELEYLWEQIKDMPNSDEEYNPHHHHIQLPSQSPSFSQTDRLSNRTPS
                     VGGGGGLRGQVQAGGGGGGGIGGGVSTLSNIYSHARRNTALSINDYVQQQRMHTHSQN
                     QGTGIGIGADIGAGLDINSQVAGFGGPGSITSLPPRVGTNNVIEDFKNWQSDVNAIIN
                     KLTREFVNSRKERSPSGHEEEEQSDAELDELEITKRRILRIVKIVGVNALKFLKNFAV
                     SLIAILFLVWLLKKNVVVKNTIVKHANTKGKDKKELVINMVLNTDENKWFIRLLNFIN
                     SFVGFV"
     gene            complement(<1166744..>1167241)
                     /gene="RPL12A"
                     /locus_tag="PVL30_003584"
                     /old_locus_tag="LELG_02740"
                     /db_xref="GeneID:5233083"
     mRNA            complement(<1166744..>1167241)
                     /gene="RPL12A"
                     /locus_tag="PVL30_003584"
                     /old_locus_tag="LELG_02740"
                     /product="60S ribosomal protein L12A"
                     /transcript_id="XM_001526132.1"
                     /db_xref="GeneID:5233083"
     CDS             complement(1166744..1167241)
                     /gene="RPL12A"
                     /locus_tag="PVL30_003584"
                     /old_locus_tag="LELG_02740"
                     /note="BUSCO:EOG092651LN"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L12A"
                     /protein_id="XP_001526182.1"
                     /db_xref="GeneID:5233083"
                     /db_xref="PFAM:PF00298"
                     /db_xref="PFAM:PF03946"
                     /translation="MPPKFDPSEVKFLYLRAVGGEVGASSALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPVRDRKKEKNVKHSG
                     NIALDEIYEIARKMQDKSFGKNLASVTKEILGTAQSVGCRVDGKNPHDIIDAINAGEI
                     DVPAN"
     gene            complement(<1167723..>1169360)
                     /gene="STE50"
                     /locus_tag="PVL30_003585"
                     /old_locus_tag="LELG_02741"
                     /db_xref="GeneID:5233613"
     mRNA            complement(<1167723..>1169360)
                     /gene="STE50"
                     /locus_tag="PVL30_003585"
                     /old_locus_tag="LELG_02741"
                     /product="Adaptor for signal transduction"
                     /transcript_id="XM_001526133.1"
                     /db_xref="GeneID:5233613"
     CDS             complement(1167723..1169360)
                     /gene="STE50"
                     /locus_tag="PVL30_003585"
                     /old_locus_tag="LELG_02741"
                     /note="BUSCO:EOG09263CAC"
                     /codon_start=1
                     /transl_table=12
                     /product="Adaptor for signal transduction"
                     /protein_id="XP_001526183.2"
                     /db_xref="GeneID:5233613"
                     /db_xref="PFAM:PF00788"
                     /db_xref="PFAM:PF07647"
                     /translation="MTESFLKWDPAQVATYINSLVEKDDDKRHGAAFLDNNIDGSLLP
                     FITTEHLKEIGIDSLMLRLSIKKGISLLIADHYKKYPPKSLTDMEKYSLNNVDINNNH
                     ITLESLALTTNLIQDSVQKFNSDLLQGVLTESPISPTNDEIKKLSESFTKLKTDLIPI
                     TKLLKESKPLPTPTLDPGSATVESPSYLSYLHEHDANSEKRLSKEDSTPDTPTTTSTT
                     ASAGAGKGAGIGATAGLTTTPLSRDPSFTSSPASNRFSSGTLLSMGTGKIISQSVSRF
                     ADLKNAADFKLQKVGIQKSNSSKSIESQSVPVTASVPAVVRAKLGDHISTSPTNVGDI
                     QMQEQQISHDVGKLASAAGQTGFSTAPFISTYPGPSTTNTTTTTSMIPPPPPHPPQST
                     TAAKSLGTTAVSTALNNSSGSTVPVHPSESRPPLSSSNSKSSQVSKHDANEPLKQLRA
                     STDDSCLKILQQAMKRHHIPRDDWSKYVLVICYGDKERILKLAEKPVVIFKKLQESGR
                     HPAIMLRQLADATPVVDSDGSLYEDSRISSDIPGGYL"
     gene            <1171378..>1172532
                     /locus_tag="PVL30_003586"
                     /old_locus_tag="LELG_02742"
                     /db_xref="GeneID:5233177"
     mRNA            <1171378..>1172532
                     /locus_tag="PVL30_003586"
                     /old_locus_tag="LELG_02742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526134.1"
                     /db_xref="GeneID:5233177"
     CDS             1171378..1172532
                     /locus_tag="PVL30_003586"
                     /old_locus_tag="LELG_02742"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526184.1"
                     /db_xref="GeneID:5233177"
                     /db_xref="PFAM:PF02668"
                     /translation="MPARYVKVPSALTGESNLKSDAKGKVVVGESTIAKLSKESLPYL
                     PTWDKNEKYEPYTFQEHHDNALKADKSFPDLFKGDDYVTTNLSPKLGTEIRGIQLSEL
                     NDAGRDQVALLASQRGVLVFRDQDLIDKGPENLVEYVSHYGTPHIHPTSGAPKGHPDI
                     HSVLTGDTKEDAFSTRNNLVVWHSDVSYELNPTAVSFLAVTNIPKAGGGDTVFADNRE
                     AYNRLSPLFKEKIDNLKAVHSAVDQANLAVVKGGVVKRHPVENIHPVVRTTPSGQKVL
                     YVNSGFTRRIVDLKGEESDFLLKFLLQHIASSQDFQVRVNWQPGTVAIFDNRIVSHSA
                     ILDFDTSDGRLIIRAAARGERPVHDLEDLNKPDENLVYEGPEYIGNHREV"
     gene            <1173048..>1177367
                     /gene="YCG1"
                     /locus_tag="PVL30_003587"
                     /old_locus_tag="LELG_02743"
                     /db_xref="GeneID:5233321"
     mRNA            <1173048..>1177367
                     /gene="YCG1"
                     /locus_tag="PVL30_003587"
                     /old_locus_tag="LELG_02743"
                     /product="chromosome condensation complex Condensin,
                     subunit G"
                     /transcript_id="XM_001526135.1"
                     /db_xref="GeneID:5233321"
     CDS             1173048..1177367
                     /gene="YCG1"
                     /locus_tag="PVL30_003587"
                     /old_locus_tag="LELG_02743"
                     /note="BUSCO:EOG09260LRX"
                     /codon_start=1
                     /transl_table=12
                     /product="chromosome condensation complex Condensin,
                     subunit G"
                     /protein_id="XP_001526185.2"
                     /db_xref="GeneID:5233321"
                     /db_xref="PFAM:PF12719"
                     /translation="MSRPPKPTLASIKKAERIKDLDAGMMHVFYDCQFTTYSHRKLLV
                     IMKNIYYRAIDLGHQEYFAMRFTQLLNHSLKYKKGEPNSDRIAKFVAHFVRVISDDSK
                     RDDEENKDENEENKEQIKEQNEDNTEDQNMDNNLQKESANQSLYVTEFTSYLIKHLLR
                     GIEAADKSVRYRVTQLLAMLTKHIGEMDRETFEALIVSLSSRLRDRETPIRMQAILAL
                     SSFQDFNLNFDALAGDAGSEAKDNEWLTELLVQSLRYDESPEVRRTVMMNLDKDANTI
                     QYLWERAKDLNNINRRIVYSKITPEIGGMKNMRHEHREFLLRWGLNDRDESVMQAATK
                     LLCHTWFDSCDNDINEFLEYLNVTESSMAEKAMDMVFSERADLVQNFKADRTFWKALD
                     VHKSFLWRTFFRHCYQHKLYNLIEINFPDGLELSDILKKYMSLRKDFVSASFDCCKKQ
                     DDLRKDVQLLDQQYFVIERELIRTNREWENLSRHIKIAEESRRSRSEDRAYEEMLKSR
                     ESLEEKQAELQHHLIQRNETKRHKIEEVYSDPDFVKFVETQRDFNFIVNQLLMICIDF
                     DFSDEIARRAMLSVIRSELYEKSMEDDMIRNCLKILKKISINEKDFVSMTVEIITDLR
                     DMGDDEADDDDDDDDDDDDDDDDDDDDDDEDDDDEDKEKETKAMEDGIGGSNDRIKNK
                     RQAKQKKNNKNNNHQNYSNEDINVDKELNSDLGEEGKEEEEEEEEEEVNESQSRRTKK
                     RKIEPAMPDDDVIVRCLKMTCQVLELIEEELDNHLSLSSIQSGIVNYSLSQVDKPLLF
                     MTGLKCLGLFALIDKKTAIDSLPIFFRAIKSSGEQVQIIGVEAVVDVFAKYGRDVIDF
                     EGRRTFIRLFYKLLKRESNKVQAVMAEGLIKLFLADIFSIKVPSLSVAEVDDSIQDTV
                     ASTGEGEENDGEDNDPEVEIFEALLLSYFNPATAGNHELRQILAFCIPVYCYSHPKHQ
                     LGLAFTTGSFLLQASKLQQGHQPTKMVPQLIAWSDPQYLVHVAEIEQEKSPSRILQAA
                     RMLGVFGEEELSKDYRRAIINNISKISISSKVGSEYLAAFVELIEQVENSIDENKDRF
                     EFQLDRSTLKNLSNLHEAAFAALSEAKEMESKEEAESSIGVKSRSVSAVPDFNEDGVQ
                     IVKENIEIKDEKIDNINTPKTNFIDSDEKDEENAKERGNEVGVEDSSVDHVLDNEPNS
                     IGEPYRVSVKKEYASILDVANAERRTLLDIHSIDDTTNSATIDDNDKEANLTKQNEGG
                     GSGEGGEKEREKEKEEEEIRGEKNKRNRNVTTEVTDHNSGILQVDDILVEGDETVQTA
                     EKNKTKDGFYGIEDKKGGGDKENGDANNDYSSDVILADEDVVHDVSIAGIESRLDTES
                     KNEDILRDVVEDITALVVSTKLASPKKPILDAPIDDSILDTVTSDSDEEEEEELDSDI
                     IFN"
     gene            complement(<1177675..>1179480)
                     /gene="YAP1"
                     /locus_tag="PVL30_003588"
                     /old_locus_tag="LELG_02745"
                     /db_xref="GeneID:5233368"
     mRNA            complement(<1177675..>1179480)
                     /gene="YAP1"
                     /locus_tag="PVL30_003588"
                     /old_locus_tag="LELG_02745"
                     /product="DNA-binding transcription factor yap1"
                     /transcript_id="XM_001526137.2"
                     /db_xref="GeneID:5233368"
     CDS             complement(1177675..1179480)
                     /gene="YAP1"
                     /locus_tag="PVL30_003588"
                     /old_locus_tag="LELG_02745"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription factor yap1"
                     /protein_id="XP_001526187.2"
                     /db_xref="GeneID:5233368"
                     /db_xref="PFAM:PF00170"
                     /translation="MTDVKRNYSDIVSPPVDNADSDSGNDLKKLHTKPGRKQIETEPK
                     SKRTAQNRAAQRAYRERKERKMQELEEKVKMLEDENVRATTETDFLQAQVNILKNELA
                     KYRGTTDFSDLNLPTTVGHLSHPHTNKEYSAAAAAASQQQQQQAKDQNVGSGRANSAS
                     SRSSGLDRASSNSSISTSSPNFSFGLPWSKENLKYLKQQQEKSSQVHQTHQKQQKQPR
                     ADATKPASDSSYNTCPDLVSGSSTSTTPLDDNILVSPDSNSSSIGSNRPNINFAEKFE
                     EEIDPFCSKLNEACGTRANPIPKQQQQQQQQQQQYQKQQHSHPSTSSIPGQSVNSTMH
                     SQYNSPLSYLLPSSTTNSAHNVNTPHNTTSIAPDQSKNNYMNDAFFNNLSGLDDPEFN
                     FNILDNKYSTDDPLSFLNDMNGTPHTSNDGNYNNSIVNNNNNIPSFDAALAFDDSFKP
                     HQTATSEREIDPMSFLTTEESMYDFTNKVGGQNDINTNFNFNDFIKDSIPERKDSTPR
                     TGPGVESYNGNSVGNSNINNDDDEDDEENDIVPAPQQTMKCSEIWDRITSHPRYTELD
                     IDGLCSELKSKAKCSEKGVVINTTDVNELLGKSAK"
     gene            complement(<1180895..>1182031)
                     /gene="DYS1"
                     /locus_tag="PVL30_003589"
                     /old_locus_tag="LELG_02746"
                     /db_xref="GeneID:5233119"
     mRNA            complement(<1180895..>1182031)
                     /gene="DYS1"
                     /locus_tag="PVL30_003589"
                     /old_locus_tag="LELG_02746"
                     /product="Deoxyhypusine synthase"
                     /transcript_id="XM_001526138.1"
                     /db_xref="GeneID:5233119"
     CDS             complement(1180895..1182031)
                     /gene="DYS1"
                     /locus_tag="PVL30_003589"
                     /old_locus_tag="LELG_02746"
                     /note="BUSCO:EOG09263H5H"
                     /codon_start=1
                     /transl_table=12
                     /product="Deoxyhypusine synthase"
                     /protein_id="XP_001526188.2"
                     /db_xref="GeneID:5233119"
                     /db_xref="PFAM:PF01916"
                     /translation="MSDSGKLPNLASDAVLKQSVPVPDDFVEVSGIDYSKDSAYNMTA
                     KDLISSMSRMGFQASSLAQACNIIDEMRSWRGKHKSELPEHEQVGEFDDEGRQKTTVF
                     LGYTSNLISSGLRDTLRFLVQHKMVSGIVATAGAVEEDLIKCLAPTYMGDFTLPGKGL
                     RDQGMNRIGNLLVPNDNYCKFEEWIVPIFDRLLEEQQEAVKKEGDGVLDAGSSAILTP
                     SKIIDRLGKEINDETSVLYWAHKNQIPIFSPGLTDGSIGDMLFFHTFKASPHQLRLDI
                     VADIRKINSMAMSASRAGMIILGGGLIKHHICNACLMRNGADYAVYINTGQEFDGSDA
                     GARPDEAISWGKIKADARSVKVYADVTLVFPLIVAATFASEKGK"
     gene            complement(<1183101..>1183523)
                     /gene="NUO17"
                     /locus_tag="PVL30_003590"
                     /old_locus_tag="LELG_02747"
                     /db_xref="GeneID:5233615"
     mRNA            complement(<1183101..>1183523)
                     /gene="NUO17"
                     /locus_tag="PVL30_003590"
                     /old_locus_tag="LELG_02747"
                     /product="NADH:ubiquinone oxidoreductase, B17.2 subunit"
                     /transcript_id="XM_001526139.1"
                     /db_xref="GeneID:5233615"
     CDS             complement(1183101..1183523)
                     /gene="NUO17"
                     /locus_tag="PVL30_003590"
                     /old_locus_tag="LELG_02747"
                     /codon_start=1
                     /transl_table=12
                     /product="NADH:ubiquinone oxidoreductase, B17.2 subunit"
                     /protein_id="XP_001526189.1"
                     /db_xref="GeneID:5233615"
                     /db_xref="PFAM:PF05071"
                     /translation="MSTSIGRFVKNAYKSGIKRAAWQLQFHNDLKSGWLVGEDDFGNK
                     FYETDAPEEIHMRTRWVEYNSWHPDMSQVEPGWHYWLGYGTNTPPNALPEDQKVHRAY
                     PLPAKHKPNYTNTAGAYVTYNTAKPKCQSWTPEVSERV"
     gene            complement(<1184139..>1186757)
                     /gene="MAK10"
                     /locus_tag="PVL30_003591"
                     /old_locus_tag="LELG_02748"
                     /db_xref="GeneID:5233095"
     mRNA            complement(join(<1184139..1186501,1186739..>1186757))
                     /gene="MAK10"
                     /locus_tag="PVL30_003591"
                     /old_locus_tag="LELG_02748"
                     /product="N-alpha-acetyltransferase, non-catalitic
                     subunit"
                     /transcript_id="XM_001526140.2"
                     /db_xref="GeneID:5233095"
     CDS             complement(join(1184139..1186501,1186739..1186757))
                     /gene="MAK10"
                     /locus_tag="PVL30_003591"
                     /old_locus_tag="LELG_02748"
                     /note="BUSCO:EOG09261IFQ"
                     /codon_start=1
                     /transl_table=12
                     /product="N-alpha-acetyltransferase, non-catalitic
                     subunit"
                     /protein_id="XP_001526190.2"
                     /db_xref="GeneID:5233095"
                     /db_xref="PFAM:PF04112"
                     /translation="MSYPHINSLSLNDRDTELVDITDDVYASLAQIKNNKVIKSPLFE
                     LLEGTRALEVLNTKLDTGIIYLNTYDIKFDCAAPQEVDSIINVQTHLLCQLVNWLENN
                     SLPVSVLSCRYVQTLLVNHSQSRFHNLKTGCAFRDSRIGEQVYQKNFKYWAVHKILKT
                     FVRALCKFIGFMLDISRKFLYDEEDIMTRAMDLDFLSDVSPLSIIEEIDTTIEWILGN
                     DIVENGGILISQLKIVQSLNRFEECVLSSSVPFMDKDASLKGNEELCRSFSFCKDVEM
                     HLERVRAFQYDEETIPKGAFSRFIQADLDNPNIPVDVAKINISHSLDHISEIFRASFQ
                     LVTQVSEIKSISQLQDYLHYNIRYPSTDFSVFTRALFQQYFIRDDKSIFGSSSTDLTK
                     LTTDIVENVIGDNTIMLHNLNTRVAQLKDSMKREILERHSQVMQDLEGAIYHNLCIYG
                     ANPGRSQQLVSKGLVIWDTLQVSWQTFERQLYDSFQIYDPLEAGIPSLSVTMFIYFQK
                     VQMMLDLLLNGIDLELYKPFEIYMVYLYADTLLNHLINHIKTPLRKIVLAKIDEIEIN
                     MPKKIKKLKNGPKKDALKTQHNYGVDVTIPRLLHTIKYQDYMVDHYTCMDKLVTCYSK
                     FCAVLAKLRLIDFSRGPTKNMSSMEHLYYLRMKPWSSIGVPEFPSYAQYQHELIATRP
                     DANNRVNLTQCLKLLTEIKSALHEVEKGVKSILNYVSRNGDVDFIKQSKIKEWYERLA
                     EAGNEMSSEVSSLGKIISEHNDDLLEIPKQYRLVVERGKHAYFLSMKTVTKNE"
     gene            <1188120..>1189691
                     /gene="APE1"
                     /locus_tag="PVL30_003592"
                     /old_locus_tag="LELG_02749"
                     /db_xref="GeneID:5233097"
     mRNA            <1188120..>1189691
                     /gene="APE1"
                     /locus_tag="PVL30_003592"
                     /old_locus_tag="LELG_02749"
                     /product="metalloaminopeptidase ape1"
                     /transcript_id="XM_001526141.1"
                     /db_xref="GeneID:5233097"
     CDS             1188120..1189691
                     /gene="APE1"
                     /locus_tag="PVL30_003592"
                     /old_locus_tag="LELG_02749"
                     /note="MEROPS:MER0001255"
                     /codon_start=1
                     /transl_table=12
                     /product="metalloaminopeptidase ape1"
                     /protein_id="XP_001526191.1"
                     /db_xref="GeneID:5233097"
                     /db_xref="PFAM:PF02127"
                     /translation="MSTVNIDDILKGISDSLSKLQEQQARQKELSLAAKDSPNNISCD
                     LASVNSQSKYTSEYYEAIAKDYIEFTYKNPTIYHVVNHFASQLENNGFKYKSEKDSWL
                     DIKPGKYYTTRNGSSLAAFVVGKDWSPEKGVGAIGSHIDALTTVLKPNSTKEKVDGYE
                     LLGVAPYAGTLGNIWWDRDLGIGGRLLVKDSKGKITQKLVDSSPSPIAHIPSLAPHFG
                     LPANDLNKETKAVPVVGFSSKTQKEDEPTEAEKNAPLFGKHSLKLLRYIAKLANVKVE
                     SISQWDLQLYDVQKGTFGGLDKEFVFAPRVDDRVCSYAALNAIIDASNENLLKSDSLT
                     VVGLYDNEEVGSLTRAGAKGGILELVVERVLASEYFNPNQSGIQDALRVTYANSIILS
                     ADVNHLFNPNFNEVYLEHHKPVPNTGITISLDPNGHMATDSIGLSLLEDLAKQNDDKV
                     QYFQIRNDSRSGGTIGPSISTQTGARTIDVGIPQLSMHSIRATLGSKDIGLGIKFFTG
                     FFNNWRKTYDNYVDL"
     gene            <1190412..>1193520
                     /gene="PSP2"
                     /locus_tag="PVL30_003593"
                     /old_locus_tag="LELG_02750"
                     /db_xref="GeneID:5233392"
     mRNA            join(<1190412..1190415,1190723..>1193520)
                     /gene="PSP2"
                     /locus_tag="PVL30_003593"
                     /old_locus_tag="LELG_02750"
                     /product="polymerase suppressor"
                     /transcript_id="XM_001526142.2"
                     /db_xref="GeneID:5233392"
     CDS             join(1190412..1190415,1190723..1193520)
                     /gene="PSP2"
                     /locus_tag="PVL30_003593"
                     /old_locus_tag="LELG_02750"
                     /codon_start=1
                     /transl_table=12
                     /product="polymerase suppressor"
                     /protein_id="XP_001526192.2"
                     /db_xref="GeneID:5233392"
                     /translation="MAFGGSWADTEVDMASISVPIEKPYGYNDGYSRSPGLGGAGNVG
                     LGGGAFQGGIGPPYIVKLLNLPVTANDAFVQDLFQSRFTPFVKFKILTDPSSNILETH
                     IIKQVAFVELESAQDAQKALKWHDLYYKGTRRVIVEVADFNDFRHCIQFNQEHADEIH
                     RIQQEFLLQKQQSRQPRHMALLDELDKRGPRAGFSAVHGHGYQQHQHQHQHQHQHQHQ
                     HQYPSSHNQPPAHYNQHQYPLRDIGGPRSPERTYNSSHHSQNQSFDTQFPAHKPGLAQ
                     PTLSQLHDKTQLNSHTSTEAHKSKPNPFGAAKPVDTVTKQIEIEKKLINLNKTTVQTL
                     GDDSDIDVESTIKQFHESALHPRRESFNRRMSNERRHSVSILRRQSQESAPATNQHQN
                     HSQTAQSNNGGEKQSETTAKYTAAPSPRNEFIANGTGKSLAQLLSEQSDLVTKSSGKS
                     TPNNITPKPATAKPVILKKKSVLSPQPQKLEINSQEGNITTQKIAEAGKESVSSQKEK
                     QSFTNVDGGNDNSSSLAEIGDARSSTLRKQEDFSKPQKQEGPSWRLRQSGTQGQEKQE
                     QEEQSKELERTQTLSLAEPASDKGQVYHSRKPLRASKSKRGDDDRPNFKNLDFLVQKS
                     TQRKNASTPFHTTKESNLQSNNSSYDTKGSSSFEKQQPTIAGHASQQPFEDDFNLPMQ
                     DVDTGSVSNEEHIPRKFRSYQQQSDQSQRQTQSASATPAISSTSFSTSGDTVPNTRAV
                     SAEVTLSNVDNLAANPKSSPTHTEVSTVDRTINTNGEQEHKAGEVDGNFPKTNADSEE
                     KEHLEYANGVPRSPYRGRGRGSGRSRGPGRGRGRGSGIVFDDNIHSNTTGRGGFVRRG
                     SDDQGASTISGEESREVERSNEETWSRGRGSGRGGRGWRGGRGRGRGRTGARGRGRGH
                     GGMGSEGPVTELSTDAGSR"
     gene            complement(<1194044..>1195663)
                     /gene="GPA2"
                     /locus_tag="PVL30_003594"
                     /old_locus_tag="LELG_02751"
                     /db_xref="GeneID:5233161"
     mRNA            complement(<1194044..>1195663)
                     /gene="GPA2"
                     /locus_tag="PVL30_003594"
                     /old_locus_tag="LELG_02751"
                     /product="Guanine nucleotide-binding protein alpha-2
                     subunit"
                     /transcript_id="XM_001526143.1"
                     /db_xref="GeneID:5233161"
     CDS             complement(1194044..1195663)
                     /gene="GPA2"
                     /locus_tag="PVL30_003594"
                     /old_locus_tag="LELG_02751"
                     /codon_start=1
                     /transl_table=12
                     /product="Guanine nucleotide-binding protein alpha-2
                     subunit"
                     /protein_id="XP_001526193.2"
                     /db_xref="GeneID:5233161"
                     /db_xref="PFAM:PF00503"
                     /translation="MGLCSSKDASEKNTPHSQQTTQSKRQEQRSALQQQQQQQNQQTS
                     PQQLSQPENSNHIAPKHEAIGSGSDVDHSNGSTLSTGDPLSTTTANGNDRHLQQQQQQ
                     QQQQQQQQYVQEQQVSTPKINQSKKSNDATVTSTLNGSRSSTNQNPVDIAARSNTLKE
                     VKILLLGSGESGKSTVVKQMKILHQEGFSVEELYEYKPFVYKNIMDCIKNVINAIIEL
                     QPELIKPNAKIDDVNGVANGEVGNGHADAAAMTGASNGTTTISNKINNNIENTTAVQP
                     HMHVLDYDALQEVLNYEIILDGTNDTTFDAEIASKIEAIYNHPEVKEFMIHKQGQFYL
                     IDSTEYFLTNLHRIVQPDYIPSTTDILHTRKKTSGIFDFNFDMGNGLNIHLFDVGGQR
                     SERKKWIHCFDNVTLIIFCVALSEYDQVLLEENNQNRLEESLALFDSVVNSRWFARTS
                     IVLFLNKIDVFAEKLQYSPLEAHFPDYTGGNNINKAAKYILWRFNQVNRSGLNIYPHV
                     TQATDTSNIKLVMAAVKETIMENSLKDSGII"
     gene            complement(<1197868..>1200162)
                     /gene="LSK1"
                     /locus_tag="PVL30_003595"
                     /old_locus_tag="LELG_02752"
                     /db_xref="GeneID:5233345"
     mRNA            complement(<1197868..>1200162)
                     /gene="LSK1"
                     /locus_tag="PVL30_003595"
                     /old_locus_tag="LELG_02752"
                     /product="serine/threonine protein kinase, CMGC, CDC2/CDK
                     sub"
                     /transcript_id="XM_001526144.1"
                     /db_xref="GeneID:5233345"
     CDS             complement(1197868..1200162)
                     /gene="LSK1"
                     /locus_tag="PVL30_003595"
                     /old_locus_tag="LELG_02752"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine protein kinase, CMGC, CDC2/CDK
                     sub"
                     /protein_id="XP_001526194.2"
                     /db_xref="GeneID:5233345"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSDRSRPKGPKSSSTSSRDFQANHSSSSSSSSSSYVPTKSDSYN
                     RDHERSSYVPSKSRGQPSRDEYRKEPSRGSSRGSNRELNRGTSRPPPSGPASRPPPSG
                     PRRQQLHQNFPTSPPPPPPPSSSSSRQQQQQQQQQQHSQPSRGPPPHQQDRDDSMNSQ
                     SRNSSHSKSNNSQTSSYSSGSKRPLPSGPSSASNSHKRRNINEPNRPRKSPQGPKSMT
                     SKDKDGDREGRERERDGDRGKRRGGGGGGGGGPRGKGAGSGIRVGAAGTTAERRGRRS
                     KESRVGRRVLESGPAVGPGYRDNKKYISVPKGPRHGDHTDQHSSFVQSPSISRTTSAP
                     IATRLSVNQIYCIKAIKKGLPPYERVQQVGEGTYGKVYKAKNSTTGEYVALKRLRLEQ
                     EREGFPITAIREIKLLQSFEHRNIVGLLEMMVDHNQIYMIFDYLDHDLTGLLTHPDLN
                     LEEGYRKFLFKQLMEGLDYLHKMRIIHRDIKGSNILLDSEGNLKIADFGLARTMKILA
                     EGEKADFTNRVITIWYRPPELLLGATDYGREVDIWGVGCLLVELYSKMAVFRGMDEIS
                     QLAKIYNIMGTPTYEQWPQVDQLPWFEMLKPKINVAPKFQQKYAEIMTHDAFFLAEKL
                     LSLNPKSRPTAEEALQDAYFIKDPQPEPLTFLKELKGEWHEFETKKRRREERKRIKDE
                     EDAELAASKKRLNNGGDEKSKDRGGEVARGGGGEGLVGVVRAGEEGAEVEHSNAGNGL
                     SLGANLSEKTSPDMSSTGVYSSKI"
     gene            <1201826..>1202041
                     /locus_tag="PVL30_003596"
                     /db_xref="GeneID:85890374"
     mRNA            <1201826..>1202041
                     /locus_tag="PVL30_003596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119493.1"
                     /db_xref="GeneID:85890374"
     CDS             1201826..1202041
                     /locus_tag="PVL30_003596"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975476.1"
                     /db_xref="GeneID:85890374"
                     /db_xref="PFAM:PF08520"
                     /translation="MIGRVAHIGVDLVLISAFFAGLKRSTGVQPNLDLIENKDVRTYA
                     GKFLNFGDSVLDSSAAFLGSSGYFTRK"
     gene            complement(<1202371..>1204914)
                     /gene="GFA1"
                     /locus_tag="PVL30_003597"
                     /old_locus_tag="LELG_02753"
                     /db_xref="GeneID:5233155"
     mRNA            complement(join(<1202371..1204573,1204910..>1204914))
                     /gene="GFA1"
                     /locus_tag="PVL30_003597"
                     /old_locus_tag="LELG_02753"
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing)"
                     /transcript_id="XM_001526145.2"
                     /db_xref="GeneID:5233155"
     CDS             complement(join(1202371..1204573,1204910..1204914))
                     /gene="GFA1"
                     /locus_tag="PVL30_003597"
                     /old_locus_tag="LELG_02753"
                     /note="BUSCO:EOG09260SRF; MEROPS:MER0012158"
                     /codon_start=1
                     /transl_table=12
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing)"
                     /protein_id="XP_001526195.2"
                     /db_xref="GeneID:5233155"
                     /db_xref="PFAM:PF01380"
                     /db_xref="PFAM:PF13522"
                     /db_xref="PFAM:PF13537"
                     /translation="MCGIFGYINFLVDKSRGEIIDNLIEGLQRLEYRGYDSAGLAVDG
                     HLVRDGDEEYMNSIIVKTPGKVKVLKQKIIDDKIDRSAVFDNHVGIAHTRWATHGQPK
                     VENCHPHRSDASRAEFIVVHNGIITNYAALRKYLLSKGHQFESETDTECIAKLFKHFY
                     DLNLKAGVSPDFNELTKQVLHELEGSYGLLVKSYHFPGEVCGTRKGSPLLVGVKTEKK
                     LKVDFVDVEFESNAAAAAQQQQQQQHQQQQQQQQQQQSNGGNLSLSNGAGAAGASGVP
                     DLGFIPVVPGDLRTSQSRAFLSEDDLPMPVEFFLSSDPASVVQHTKKVLFLEDDDIAH
                     IYDGELHIHRASTKSAGESTVRPIQTLEMELNEIMKGPYKHFMQKEIFEQPDSTFNTM
                     RGRIDFENHTVTLGGLKAFLPTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSV
                     ELASDFLDRKSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSR
                     QTHCGVHINAGPEIGVASTKAYTSQYIALVMVALSLSNDSISKAKRHEEIIEGLQKIP
                     EQIKQVLNLESKIKQLCNDNLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVL
                     AGELKHGVLALVDDKLPIIAFATRDSLFPKTMSAIEQVTARDGRPIVICNEGDAIVSN
                     DKVHTTLEVPQTVDCLQGLLNVIPVQLISYWLAVNRGIDVDFPRNLAKSVTVE"
     gene            <1208413..>1209687
                     /locus_tag="PVL30_003598"
                     /old_locus_tag="LELG_02754"
                     /db_xref="GeneID:5233399"
     mRNA            <1208413..>1209687
                     /locus_tag="PVL30_003598"
                     /old_locus_tag="LELG_02754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526146.1"
                     /db_xref="GeneID:5233399"
     CDS             1208413..1209687
                     /locus_tag="PVL30_003598"
                     /old_locus_tag="LELG_02754"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526196.2"
                     /db_xref="GeneID:5233399"
                     /translation="MPDNYLTYTGSNSTETIESSTSSNINGANSQSLSPSSLVINIQK
                     SSSPITLLNDDILNLILRQLNQIDVINLSLTHRHFCSACKRRLHATIYVYYDTNGNGS
                     LLKHHVPRNWYGPPFVGQTVLSNTNFKKYLRSPNAFTCLNNLVIFNHSMVDDEMLRFM
                     QRTLNCRILTDRLGGGGSDINETVALQQELNKELKQPHCSILFDFQSPLLGNEDYEFT
                     CDNFQIMDWRQFIPNKRFHATSLGIMGFEKQASSKLFEINLGCLKSLTIAGFMGKPFP
                     ELNDIENFASKLTSLKCLHLHIGKKSWFEFCRAIRQNSLRELAVPISVTNSCDFSFEL
                     LNSLQLQSKSLKRLVLRTPPYIPDATFFTAGTPERELEYFFIFPNLEEIVDKMELYTL
                     DRVYTTMNTIDFHRGSLCDPRTCNGLHITEQE"
     gene            complement(<1209950..>1211074)
                     /locus_tag="PVL30_003599"
                     /old_locus_tag="LELG_02755"
                     /db_xref="GeneID:5233544"
     mRNA            complement(<1209950..>1211074)
                     /locus_tag="PVL30_003599"
                     /old_locus_tag="LELG_02755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526147.1"
                     /db_xref="GeneID:5233544"
     CDS             complement(1209950..1211074)
                     /locus_tag="PVL30_003599"
                     /old_locus_tag="LELG_02755"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526197.1"
                     /db_xref="GeneID:5233544"
                     /db_xref="PFAM:PF08577"
                     /translation="MTIDNYFQLTFELVTEYIGQIYPESNHYKVVGTTNENKLKQVEL
                     YHYDEKFLILSFTAISDVQSLVNLLNLDGRLDNALINWEWFDLDTIEFPIAGTSQLPR
                     ELVEKFQKKFRGVVDNEKVSSIFPSSTQSEKEHQQQQQQQQQQQQHVQKDDLKQGQQE
                     QSQPIVEEHTDTESNYAKSPTPEEPYHPTNPVFTGGNPSASAPQSSQPRVQNAAFKRP
                     SDMPDFEDEYQIRDPGQPTHDTLGQSSHLPPIGSDDLNPPGLPKDPTLKGYLDPLQGS
                     SQGPLGSGGMHPDANHPIFHPGQGGESRGIGSGTSGYSGYSGRKGVPPGARFDDPYSE
                     ENLDALGQGLPDGGLRGPGGPGFGGNFGNFGNFGPPGGGF"
     gene            <1213895..>1215175
                     /gene="SOL1"
                     /locus_tag="PVL30_003600"
                     /old_locus_tag="LELG_02756"
                     /db_xref="GeneID:5233590"
     mRNA            <1213895..>1215175
                     /gene="SOL1"
                     /locus_tag="PVL30_003600"
                     /old_locus_tag="LELG_02756"
                     /product="suppressor of los1-1"
                     /transcript_id="XM_001526148.1"
                     /db_xref="GeneID:5233590"
     CDS             1213895..1215175
                     /gene="SOL1"
                     /locus_tag="PVL30_003600"
                     /old_locus_tag="LELG_02756"
                     /codon_start=1
                     /transl_table=12
                     /product="suppressor of los1-1"
                     /protein_id="XP_001526198.2"
                     /db_xref="GeneID:5233590"
                     /db_xref="PFAM:PF01182"
                     /translation="MTTTVPLIYSFPEFLGVADAVADLIISAQNQTLYNTTDAKQIEM
                     IKSGQMKRPSMTKTNSSLSVAMAMNGANNNSNNSNSNHNLISSSSNTINNTVNNTNNN
                     NNNNNNNNNNSGSSTYIAHSSGNGISPLSHPSTGTNTGASSTTNSPSLSQSQSVTNIA
                     SGASSTNLQQNNKIKKEKKIMKKQEIRFKIAISGGSLIKILSQGLMHEQQYIEWDKWD
                     IYFADERLVPFESQDSNYGQAEREIFSLIKGDKKPRIFHIDESLIDDPQEAADDYEKQ
                     LIQNFAKKDSVKLPMFDLLLLGCAPDGHIASLFPNQGEALREKLAWCIPVSKAPSGPE
                     NRITLTIPVICHAARVVFVVEGLTKAPIIKTIMERPEKGLPSSIVNETAVGKVSWFVD
                     DAALNDLYDITKKKYKYLSIPEPDHSKDKQEEQV"
     gene            complement(<1215578..>1216669)
                     /gene="tum1"
                     /locus_tag="PVL30_003601"
                     /old_locus_tag="LELG_02757"
                     /db_xref="GeneID:5233591"
     mRNA            complement(<1215578..>1216669)
                     /gene="tum1"
                     /locus_tag="PVL30_003601"
                     /old_locus_tag="LELG_02757"
                     /product="sulfurtransferase"
                     /transcript_id="XM_001526149.1"
                     /db_xref="GeneID:5233591"
     CDS             complement(1215578..1216669)
                     /gene="tum1"
                     /locus_tag="PVL30_003601"
                     /old_locus_tag="LELG_02757"
                     /note="BUSCO:EOG09263FGN"
                     /codon_start=1
                     /transl_table=12
                     /product="sulfurtransferase"
                     /protein_id="XP_001526199.2"
                     /db_xref="GeneID:5233591"
                     /db_xref="PFAM:PF00581"
                     /translation="MSKPKSFLSIIKPSSFRTLLQASASSASPASNAPADNAQETAND
                     RQTVPIDATWFMPNSPRNALEEYQNERIPHARFFDLDKCSRDSPYPHMLPTQQIMAKT
                     IEQLGKGHIKPSDNLVVYDKVGNFSSPRVAFTLKLFGYDRVYLLDNYLNYKNYDYPLD
                     LNLIKTELIESETNVENKQSQNQTKVHAQAETQEQDIDDKHLPLTAEEFEERYDREVI
                     EYEELVNLIEEDHIHEYLVLDARSPDRFSGSAPEPRPGLSSGHIPTAKNLPFTKFLDQ
                     EQNNQYKSRDELESIVKEAVGVEQLDEIATKYPKGIIVMCGTGVTACVLKLGLENVLK
                     LQNVNVRLYDGSWTEWAMRAPEELIVKDV"
     gene            <1220144..>1221727
                     /gene="CSH1"
                     /locus_tag="PVL30_003602"
                     /old_locus_tag="LELG_02758"
                     /db_xref="GeneID:5233349"
     mRNA            <1220144..>1221727
                     /gene="CSH1"
                     /locus_tag="PVL30_003602"
                     /old_locus_tag="LELG_02758"
                     /product="CSG1/SUR1-like protein"
                     /transcript_id="XM_001526150.1"
                     /db_xref="GeneID:5233349"
     CDS             1220144..1221727
                     /gene="CSH1"
                     /locus_tag="PVL30_003602"
                     /old_locus_tag="LELG_02758"
                     /note="CAZy:GT32"
                     /codon_start=1
                     /transl_table=12
                     /product="CSG1/SUR1-like protein"
                     /protein_id="XP_001526200.2"
                     /db_xref="GeneID:5233349"
                     /db_xref="PFAM:PF04488"
                     /translation="MRKELKYILWAHVALVIYLIYLSFDLITLLHDDTYSDALIDFEL
                     NPSKNSGQLNKPALIPKIIHQTYKSENIPDIWKAGQQACIDLHEDYQYILWTDEMARE
                     FISEEFPWFLKTWDNYKYNIQRADAIRYFALYHYGGIYIDLDDGCEKKLDPLLTVPAF
                     VRKTIPTGISNDVMGSVPNHPFFLKAIESLKNYQRNWLVPYITIMISTGPLFLSVIWK
                     QYKRWGVPEAGKVRILMPENYKGYNNSFFAIAPGSSWHMGDANFIKSLANHLVLAVIG
                     GCLIAVAILAIEYLFYSFIISTFFKKFTAKIGNFFMWTITKILRFFNLDKFIESSEAL
                     KQYKLVGLGEDEERTFCAITEKFKQQEQLPLHVQQQHQQQQQQQQSLQSQDKDQQLHK
                     QKHPHIAQDNQNKKNGINLMQFLKNSNVKRRSRKDSNLPFNIEMMEQLAQDTTIVIAD
                     DTSSLPNTKQHHQQQQQQQQQQQKDGAQEHIVYLSTNDDTDVDPDNETDQAFFSDGNN
                     DADISANDEFNDDYNDNIV"
     gene            complement(<1222187..>1223212)
                     /gene="RRP45"
                     /locus_tag="PVL30_003603"
                     /old_locus_tag="LELG_02759"
                     /db_xref="GeneID:5233048"
     mRNA            complement(<1222187..>1223212)
                     /gene="RRP45"
                     /locus_tag="PVL30_003603"
                     /old_locus_tag="LELG_02759"
                     /product="3'-5'-exoribonuclease"
                     /transcript_id="XM_001526151.1"
                     /db_xref="GeneID:5233048"
     CDS             complement(1222187..1223212)
                     /gene="RRP45"
                     /locus_tag="PVL30_003603"
                     /old_locus_tag="LELG_02759"
                     /note="BUSCO:EOG09264398"
                     /codon_start=1
                     /transl_table=12
                     /product="3'-5'-exoribonuclease"
                     /protein_id="XP_001526201.1"
                     /db_xref="GeneID:5233048"
                     /db_xref="PFAM:PF01138"
                     /db_xref="PFAM:PF03725"
                     /translation="MSRHVELTANEKHFLHTALKSQLRLNGRSLMQLRDISIYLSPTE
                     YGYVEVSFGSTKLSVRISASITKPYEDRPFEGIFVINSEISPMASLKFDTTRSQQQDE
                     VLISRIIEKSIRRSNALDLENLCIIAGEQCWEITADLNFWNYDGGMIDIGCFATMLAL
                     SHFKKPDVSITHGGFGGSGNGGVNGVIIHDVNERQPVGLSILHIPICLTYSFFNLGSK
                     EMNIKGDDDIDNDNDGDLYGEGQVQGEKEQGEVREVCILDADAMEEQLRDGSITITMN
                     KNREIIQLSKNGGVPIDAQKLVEICHDSMQHIDKLTDLITKKIKESEEKRYNKENFKL
                     LESSANR"
     gene            <1223887..>1224900
                     /gene="SLP2"
                     /locus_tag="PVL30_003604"
                     /old_locus_tag="LELG_02760"
                     /db_xref="GeneID:5232952"
     mRNA            <1223887..>1224900
                     /gene="SLP2"
                     /locus_tag="PVL30_003604"
                     /old_locus_tag="LELG_02760"
                     /product="Synaptotagmin-like protein 2"
                     /transcript_id="XM_001526152.2"
                     /db_xref="GeneID:5232952"
     CDS             1223887..1224900
                     /gene="SLP2"
                     /locus_tag="PVL30_003604"
                     /old_locus_tag="LELG_02760"
                     /note="MEROPS:MER0192051"
                     /codon_start=1
                     /transl_table=12
                     /product="Synaptotagmin-like protein 2"
                     /protein_id="XP_001526202.2"
                     /db_xref="GeneID:5232952"
                     /db_xref="PFAM:PF01145"
                     /db_xref="PFAM:PF16200"
                     /translation="MSRTLRAQQHLPLFTRSFTNGGNSPPSPLNYFQSRSLPSNTIIK
                     FVPQQQAWIVERMGKFNRILPPGLAFLVPVIDKITYVQSLKETAIEIPTQSAITSDNV
                     SLELDGVLYVKVNDPYKASYGVEDFQFAISQLAQTTMRSEIGNLTLDSVLKERQALNN
                     NINQIINEAANDNWGVECLRYEIRDIHPPNEVLEAMHRQVSAERSKRAEILESEGNRQ
                     SKINISEGEKQSVILQSEANKIQQINEAQGEAEQIKLKAEATAKGLKIIADAIKNTEG
                     GQEAINLQIAQEYIKEFGKLAKESNTLVVPSDVGDISSFMAQGLSIYKSLNQKAEIGQ
                     KEK"
     gene            complement(<1225221..>1226219)
                     /locus_tag="PVL30_003605"
                     /old_locus_tag="LELG_02761"
                     /db_xref="GeneID:5232907"
     mRNA            complement(<1225221..>1226219)
                     /locus_tag="PVL30_003605"
                     /old_locus_tag="LELG_02761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526153.1"
                     /db_xref="GeneID:5232907"
     CDS             complement(1225221..1226219)
                     /locus_tag="PVL30_003605"
                     /old_locus_tag="LELG_02761"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526203.2"
                     /db_xref="GeneID:5232907"
                     /db_xref="PFAM:PF09468"
                     /db_xref="PFAM:PF17745"
                     /translation="MNIDKTSKVIILPAQTKSECSIEYKIINLPTSNLTSTKPYLVDS
                     DSIYELNTILGNNTAYQLPTSGDAVKSYIFEPEDPSVEGGLLQSSKTIITSPFNFTYL
                     LISIFHTHQEKFRNTFKTIDDIRDSLESLGEYTWVYDVPERIYLSSLDSICESIIEGN
                     QERFYKYSVNKAMDWVNGKVIALSNFIFEEKGNSIMRRIQSELNDPTSIEGHINEEVL
                     QNTVMCCAIDYVCFSYLCKGVREVLVENLKYDFTKMETYLAEIKKKQRDLQIVDANMN
                     EVNQTTSNANKTNIKDHNQNRNRNQSKNAQQSKRKKPVQKVAVGKGALDGFFKKKT"
     gene            complement(<1226696..>1228534)
                     /locus_tag="PVL30_003606"
                     /old_locus_tag="LELG_02762"
                     /db_xref="GeneID:5233005"
     mRNA            complement(<1226696..>1228534)
                     /locus_tag="PVL30_003606"
                     /old_locus_tag="LELG_02762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526154.2"
                     /db_xref="GeneID:5233005"
     CDS             complement(1226696..1228534)
                     /locus_tag="PVL30_003606"
                     /old_locus_tag="LELG_02762"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526204.2"
                     /db_xref="GeneID:5233005"
                     /db_xref="PFAM:PF04172"
                     /translation="MIILYGFNVLLTDVFKIKFPCSVLGLLINLVWLCVLSIIADMSH
                     NENENKYKTHLRTGASWVLTNYLTLIKPSMNFTLKWINVFFIPSFIILPLSDPITFIE
                     CLKIAGVFVVGMIILVLLDVYFIAFLKMSLGKLGIFKEEKEFIEKEESLELQSIENVE
                     SIFSRQGSNLFTSMRDDITTIDLNRLKSVHKIQTAPPTIAASAVLHENPFEHKVQLSE
                     PEPIYNKDHVAPLQQHYSTTEIQQTKPAVSAPSFVPSTPISTQPHTEARISSSLPSSS
                     SSALSATVAYDQFVEKPTELSPITVLVSKYIDWILYTTLFIISLPFYYISTIHTFLPY
                     HLGVTVIAYYIALLIPQHYPQTKKFAHPILVSTAIILFVCFIGSLIYHHNPKGFLEDL
                     KFYKTGKNYLNLFSNKTMNDNSKSTTPPTDDFTSTPQWPGCGDFLSSLMDVSIVALSL
                     PMFTHRRDFIKNFWILMPTILISVAATFFIYPIFCHTIGIQAERSIGFIGRSVTLALG
                     TPLINALGGSVSLMAVCTILSGIIGVLINEPLFKVLRVAKQDYLTRGVTLGINCGAIA
                     TAHLLNVDPRAASMSSLSFSVFGTVMVIMAAIGAIRDLIHSWVGLS"
     gene            complement(<1229465..>1230013)
                     /locus_tag="PVL30_003607"
                     /old_locus_tag="LELG_02763"
                     /db_xref="GeneID:5232978"
     mRNA            complement(<1229465..>1230013)
                     /locus_tag="PVL30_003607"
                     /old_locus_tag="LELG_02763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526155.1"
                     /db_xref="GeneID:5232978"
     CDS             complement(1229465..1230013)
                     /locus_tag="PVL30_003607"
                     /old_locus_tag="LELG_02763"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526205.1"
                     /db_xref="GeneID:5232978"
                     /db_xref="PFAM:PF10276"
                     /translation="MMLRISRCKTLNLKTLTASSASRSIVSKRFESNTPSQATPTPSV
                     AEPKASQLTKKDLQNNEFAKQAPNRETTWSQSQEERIEVISKFPYRFTQRNLEQQPRP
                     HAAIDLIAQEPVRYLTAEQGNIAVCDGNKGSTVQGHPKVFINLDQPKPATCGYCGLRY
                     AKEEFKELIEGESEGPQQAQQA"
     gene            complement(<1230692..>1231651)
                     /gene="CCC1"
                     /locus_tag="PVL30_003608"
                     /old_locus_tag="LELG_02764"
                     /db_xref="GeneID:5232898"
     mRNA            complement(<1230692..>1231651)
                     /gene="CCC1"
                     /locus_tag="PVL30_003608"
                     /old_locus_tag="LELG_02764"
                     /product="Protein ccc1"
                     /transcript_id="XM_001526156.1"
                     /db_xref="GeneID:5232898"
     CDS             complement(1230692..1231651)
                     /gene="CCC1"
                     /locus_tag="PVL30_003608"
                     /old_locus_tag="LELG_02764"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein ccc1"
                     /protein_id="XP_001526206.1"
                     /db_xref="GeneID:5232898"
                     /db_xref="PFAM:PF01988"
                     /translation="MSLVALKNGVASLLNHKNKSDEEINRVNRLLENNQGPYGSTDND
                     ATLTPQDDRAAEVARQEAVMNAAESVASSSDNKEDEEVDANFLTKFFSRFDPRVMSDI
                     IIGLSDGLTVPFALTAGLSSLGDSKLVITGGMAELVSGAISMGLGGYLAAKSESEYYT
                     SQVKKEKLDFFKRPESINQDAAEILFELGASEATIISFLKDLDSQPKNLIDFVIRFGK
                     GLEEPAEGREFTSALTIGLSYFFGGFVPLLPYFFTHVVKTGLLISVIVMLITLFIFGY
                     IKTQISLGDDCGNRKKIAEGFQMVAVGSVAAGAAWGLVYFIDN"
     gene            <1234053..>1234757
                     /locus_tag="PVL30_003609"
                     /old_locus_tag="LELG_02765"
                     /db_xref="GeneID:5232926"
     mRNA            <1234053..>1234757
                     /locus_tag="PVL30_003609"
                     /old_locus_tag="LELG_02765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526157.1"
                     /db_xref="GeneID:5232926"
     CDS             1234053..1234757
                     /locus_tag="PVL30_003609"
                     /old_locus_tag="LELG_02765"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526207.1"
                     /db_xref="GeneID:5232926"
                     /db_xref="PFAM:PF00076"
                     /translation="MSSEPKRTIYLNNLNDKVSINKLRSNLATLLQPYNPTNIIVAKT
                     LRLKGQAFITFQDVTNAQAAINQLNNKQLFSKSMRASFAHLENDAVLSPKEQQEQYSR
                     RYTGKIERNKVAKLSRGKPGNQRASTKTRKGDAVVEGQREKNNIDVSMWKNLPPNHIL
                     LLQNISSTQVSKETIEALFTNFEGFENTRFVKVRNLAFIEFENEEFAKQCLAAMDDTV
                     LKEKFGNDIIFSYAKK"
     gene            complement(<1234907..>1238188)
                     /gene="CTA4"
                     /locus_tag="PVL30_003610"
                     /old_locus_tag="LELG_02766"
                     /db_xref="GeneID:5233031"
     mRNA            complement(<1234907..>1238188)
                     /gene="CTA4"
                     /locus_tag="PVL30_003610"
                     /old_locus_tag="LELG_02766"
                     /product="Fungal transcriptional regulatory protein"
                     /transcript_id="XM_001526158.1"
                     /db_xref="GeneID:5233031"
     CDS             complement(1234907..1238188)
                     /gene="CTA4"
                     /locus_tag="PVL30_003610"
                     /old_locus_tag="LELG_02766"
                     /codon_start=1
                     /transl_table=12
                     /product="Fungal transcriptional regulatory protein"
                     /protein_id="XP_001526208.2"
                     /db_xref="GeneID:5233031"
                     /db_xref="PFAM:PF00172"
                     /translation="MPEGGGVVKKQRRKPSNTCDLCKRKKIRCNRQLPCSSCVKINMG
                     YACTYDTKWRPVKTGGSDRSVNSPTALSFQHFNNTGKFQQQPISPSVEPVSTANILLQ
                     NSENENRILKQRIAELENLIIHKDKNQQNLDSLASNSTRGSSPTSLKPYIRKSPILPP
                     THSTFPNPEVGDDEILNFYEGYTSVKVEGNVKRINHGPLSAIALLKRDPALTILWAST
                     CKRGYLKIMDVDRPFLVHSHNADSNKIVHNNVNNFTNNINDTNGENNGSCSTDIRISE
                     KLDNAFKTRYLEVEGYDEYTPYKSRMKKEKIIMQHQKSSSHLEEDMNRLEEDTNMSNI
                     LAESQSRMTFTQISIAKTLFDGRVNPELHLIEKIKQILPQKKVFWTLIDLFFSDIYPY
                     VPYVDEVAFRQDLQKLFGPADYTMEPFTKVTFIKKLDLATIAICFVILRLTYYSLYSN
                     RDCVNQAIVNSKADTMKKFLLANPITTTLIDVANSCIYCFDITRKANFTVFQALLFMR
                     VYRNCAFEEGDSIEGSDSQIGTALLVQMAHSLGLNREPDNLDVFHDEKINHLGRKIWY
                     YLVHTDIAHCFNAGYPTSIHPYHFDVVRPFMTDSNSNSKDVAMEAEIVEMFGFLGTHL
                     TLLRRLSNYALDITRGVKMNVINNDLHSLEVLLKTQFDIVQKKRLKDVQHNALELRCM
                     FRVFMGLRTSLISYYYHIYLHYEKKLDSEMAFFYLCKLMHISTYDVMPQVGDVIYGYM
                     SEMALFINPNLQLALSRVNELTLSCLVRVRYNLRAMEQKPQHMEMLKHDVEYKRHHEI
                     LKSILQNLNHAGLLLLSLLERLGTRYYYAWRISKAKNVLFQKSTDSGFYDKQNSGLKK
                     IRAFQFTPSQLDYFNSLAKLLADTSARIVNYKDSIENPTPDFSPRVNSQSNFANYTTE
                     PLANTFGTKQEKLGSYISNDNTDGLVDGKSKRVQMNGGASTNSFTAPYESNGAIANSE
                     IANANRDDTDQMWLQLTAMNYGNNYDAVESWMPNLQFLDQALQNSNNQNDEREDGTAN
                     GTANGSENKPVANGPENGIASFEEYPYHALERPSLFRDPGSSIYIDQNFDLAYKYKYT
                     YDQIL"
     gene            <1240591..>1242351
                     /locus_tag="PVL30_003611"
                     /db_xref="GeneID:85890375"
     mRNA            <1240591..>1242351
                     /locus_tag="PVL30_003611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119494.1"
                     /db_xref="GeneID:85890375"
     CDS             1240591..1242351
                     /locus_tag="PVL30_003611"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975477.1"
                     /db_xref="GeneID:85890375"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPTSRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKKYLRITN
                     TSHLAQETWISIFKTLFERMGSVMDQIIMYMTPEVKIEKPGRTGPIVTFEDASIIKIG
                     LGLLKNKPNDKIIQGVKSYDLTFERIWDAVNATFQTRMHLISDDEEKDAGTTSVSKGD
                     KSQKTTKCNFCGKYRHTVDSCHLLVTALDEKLVKKVDGKYYLANGEPLVMDFYKCPLL
                     KHSSLKSLSSNARHRTPPTK"
     gene            complement(<1248553..>1252290)
                     /gene="MRR1"
                     /locus_tag="PVL30_003612"
                     /old_locus_tag="LELG_02768"
                     /db_xref="GeneID:5233632"
     mRNA            complement(<1248553..>1252290)
                     /gene="MRR1"
                     /locus_tag="PVL30_003612"
                     /old_locus_tag="LELG_02768"
                     /product="Citrinin biosynthesis cluster MFS transporter
                     mrr1"
                     /transcript_id="XM_001526160.1"
                     /db_xref="GeneID:5233632"
     CDS             complement(1248553..1252290)
                     /gene="MRR1"
                     /locus_tag="PVL30_003612"
                     /old_locus_tag="LELG_02768"
                     /codon_start=1
                     /transl_table=12
                     /product="Citrinin biosynthesis cluster MFS transporter
                     mrr1"
                     /protein_id="XP_001526210.2"
                     /db_xref="GeneID:5233632"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MSIDMQNQKQETSTPTQVEHVSKPKPGTESEASETTSERKKRSS
                     NVCQNCRIRKIRCSRTWPCTNCLKSRRKIPCVYENESPITNERTQNDSSNSQNPPILS
                     YQRSASQPIQFMNFNTANMGGKTSHNANSNKRKREKTNGVSSTDTSTGSGTRGNSSST
                     TSSSMGSGSEISHPNKVSKPNDVDVDASLQELKALKEKLASIESTLSSAQPTLSNNLS
                     NTGSDFRSSYGSSYGGRTGSEFGFKSGSDAVLSFGCETMPPLSTAAPRLPNPPISQSP
                     RFLQTRPVQPFGSSHPIGITSQPQFTTTQRLSNARDRSPGTTGIQLPPINFREQSSSY
                     NSFSNANTETSHASPGYSPHSNMSNSKQKSLIDVNPYLNDTETINFYENYTSVLCKDF
                     RRISYGPFAWSSLMNKDAALRALWKFIAKQKESTSFVFSPGSNEVTQENTQLVTSEPK
                     ESELHFKKTMLQKGGYADVVPYNILREKMKRDLNKEMLPLGLTLYEGQFSCELQLLVR
                     IRQMLPKKKVVWKLIDRFFAWCYPFMPILDQHDFVEWVEKIIGPRSYEDIKIEDVKIE
                     RRLDLAIFGTLLVVMRLSYLSLFSNKLSVNEERLNSTDPSEKAQDTKYLMQNPIDINV
                     VDIATSCLYQFDVLRRTSIFVLQLALFIKLYYMFAPEDGDDGEGADTNAMGGLVLQMA
                     YSLGLNREPNKFPGELENKRMNHLGRKIWYLLVSSDVHSAYSYGSQMLISPDSYDTEL
                     PFNEEGNENLYDKELDRYVTNIWYGSGAKLNNHLKEILTLILSVKARIKVSDLCNLLT
                     KYEAIFSQSFTSLKDCLVVKDPQKHIVARNFPAKYFISIKSFFVSVYFHLFLHYEHKD
                     VQLSFFYLKKILKIAATEIMPHYFELMGNSEAICDMFINPKLQQIIHKSNQIFIAMII
                     RVNLSIYFLKSQLDHKDKCSADNQYYEYYRELCKFSSCLTRCAEVSIAAVSKLSTRYF
                     YAWKLTKSHTFLLKVITTMDFYKHPAHLNSENLRLPEFSTHQLSEMVEMCEVALRTLG
                     KVSIQGHEFCDHVSCSSFKHQYSVSSLSSAPESMGTSSTSHGQNSASESGGYSTPASN
                     LSVDAKTFANEFGLDLVNSEEIDKIWLQMLSIKNDVKQQQPPQVASQSPFPSTSTNSG
                     ANAGDDVTIQPGTPYNGHNLPGWSRQPSNAGIHGSTLTASSQGQHDHLASHTGLTPMV
                     IENPLTPGFSNAQGAMGLGGYEDYGGLDFFADLPFDQMFNL"
     gene            complement(<1253184..>1257185)
                     /locus_tag="PVL30_003613"
                     /old_locus_tag="LELG_02769"
                     /db_xref="GeneID:5233439"
     mRNA            complement(<1253184..>1257185)
                     /locus_tag="PVL30_003613"
                     /old_locus_tag="LELG_02769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526161.1"
                     /db_xref="GeneID:5233439"
     CDS             complement(1253184..1257185)
                     /locus_tag="PVL30_003613"
                     /old_locus_tag="LELG_02769"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526211.2"
                     /db_xref="GeneID:5233439"
                     /db_xref="PFAM:PF00172"
                     /translation="MYQNPEPNQQHDEFTIPGQNSHTDANPNPDLVTNTNSVTHKTRN
                     RASLSCFPCRRRKVKCSRGKPCDTCQKKGIVDQCQYDERLNKKQKRKSLKKEGISAES
                     DRKRTKTLVETLPITSISGASYEGEVATKIEDNFLESTPRERSPDVCVLIGKSQLEAL
                     QAKVKAYESQFKEQLVKPQGNNNKVIHLQSAKPADLVYNKSINTYRHVIFSAHEESRP
                     GYVPLENVTTDTVLEYSTDMSVTSELRLSELSRPERSLLGINPYLRSDETIELQSEKS
                     HYNDLNKPKMFSPLSWSYLLRISPTMRALRSYASEQKELENIKRASIGITYDPLRKLM
                     LPKDARIKSTLLMDGENLSIFEAKTEENQNETIGEGEKERKSGDTTAVTKKANTTPST
                     TAPSSSSSSSSSFLSSPPPPPPPLADAATTTPFKDVQNPSGKLNVTTFALGLSVQTGA
                     KERESNLIEQIQSVIPKKRVIWLLFKRFLKLLYPMMPFIIESQFVSAIENIIGPELYQ
                     EVKPQIRISSRIDFANLGILLVILRLSYLSLFHNRGFHNEKVLTDPAPTGEVAEKKYL
                     LLNPVNIDTADIASACYHHLEKLGQVCIPTLQCAIYLRLYRTYAPEEGDGRDGGDSHI
                     KTCNLIAMSYMLGLNREPDKVTVSKDEKLKNLYRKMWYFMVSAEQSLTCAYGWPMSIR
                     KESYDTKRPYYTEQNSNLENKEIDKTCYFYFAFITALIRGPVRMLTQLYLDVEGKVKV
                     MELTNHLNHLEQGVKLLLGNLSNYMSALEEKELGYRTSKMMKVQALLKMNAFLMINYR
                     YLCNHYEKSNKDLCFFYLRKQFELAFLEDLPYSFALITKSQEIFGEGADLFINPSIIQ
                     IIVKISDLCLTAIVVSNVSLLRLSNDENATTNKTKVQHDPDFQKLLDETSTLITLMEK
                     SCRVCLAALSMLSSRYYLAWEAVKTQNYYLQIATSPKFYKAKHKEAVNFPTPNYRRLQ
                     QLNNIASSGLEILQKLVFTYCEEVDLPGIFKMGDPARENHRNNNKSTCLSTGTEQRQQ
                     FPTSSERIEKTGKTGKARETGEARETKETSKTERTRETKETSKTERTRETEKFGKTEK
                     LSTVSSQTIETNSGETVDEVSPLSGTDPKGLFFAGFEDMTFDNSAEIDSIWLQMLSLK
                     SNNSNGFLEQGYNRRDMSNPYHLRSNSQVSSIGNYNIPTDGINYASSSQMYPMSANGV
                     QSAHLQTQSQSIEGEPRRQMQSPFPSLNSFQPPQQFSPSLQNQSQSQTQSQSQFHSHS
                     QFQPRSQSHLAHQPKPQPQPHPSTRHQPQSQPQPPDLNQAGPSHPYSYPPPNIFNYTD
                     LFEDLPLEKLFDL"
     gene            complement(<1257617..>1258792)
                     /gene="RTC2"
                     /locus_tag="PVL30_003614"
                     /old_locus_tag="LELG_02770"
                     /db_xref="GeneID:5233142"
     mRNA            complement(<1257617..>1258792)
                     /gene="RTC2"
                     /locus_tag="PVL30_003614"
                     /old_locus_tag="LELG_02770"
                     /product="Putative vacuolar membrane transporter for
                     cationic amino acids"
                     /transcript_id="XM_001526162.2"
                     /db_xref="GeneID:5233142"
     CDS             complement(1257617..1258792)
                     /gene="RTC2"
                     /locus_tag="PVL30_003614"
                     /old_locus_tag="LELG_02770"
                     /codon_start=1
                     /transl_table=12
                     /product="Putative vacuolar membrane transporter for
                     cationic amino acids"
                     /protein_id="XP_001526212.2"
                     /db_xref="GeneID:5233142"
                     /db_xref="PFAM:PF04193"
                     /translation="MIPPPAPIILDAQAISGITGSISLACWIIVFAPQIYENFTRKSS
                     EGLSLTFIILWLAGDVFNVLGAVLQGVLPTMIVLAVYYTLADIVLLWQCLIYGNGTSN
                     VADEAKNKPDLYHLSPANPMNENLPEHHHHHHHHHNHNANGSARASSDMRQEDLEAAN
                     TQLLAPPPPAPPAASSSTSLSLSSSSSVSTPPKSSNTSTFLLNSLMVAIVIVSGIVGW
                     YISYLKDQDHQRKHPGEIHKPQDLVYDPLAQTFGWLCAILYLVSRVPQIVLNYERKSC
                     EGISFMFFLFACLGNLTYVISILSIDMSWHYLWVNSSWLAGSLGTLGLDFTIFIQFFL
                     YNKDFANDDEGDEESSLCNSACVNAGISRPSSASEPLLNNSQGDVNTTSYGANRNIE"
     gene            complement(<1259725..>1261983)
                     /gene="FAA2_3"
                     /locus_tag="PVL30_003615"
                     /old_locus_tag="LELG_02771"
                     /db_xref="GeneID:5233494"
     mRNA            complement(<1259725..>1261983)
                     /gene="FAA2_3"
                     /locus_tag="PVL30_003615"
                     /old_locus_tag="LELG_02771"
                     /product="medium-chain fatty acid-CoA ligase faa2"
                     /transcript_id="XM_001526163.1"
                     /db_xref="GeneID:5233494"
     CDS             complement(1259725..1261983)
                     /gene="FAA2_3"
                     /locus_tag="PVL30_003615"
                     /old_locus_tag="LELG_02771"
                     /codon_start=1
                     /transl_table=12
                     /product="medium-chain fatty acid-CoA ligase faa2"
                     /protein_id="XP_001526213.2"
                     /db_xref="GeneID:5233494"
                     /db_xref="PFAM:PF00501"
                     /translation="MGSLYSGHDFTADLAISQLPFKQDIHNSVSNPQLHHDSTNYSKT
                     FRNKVIPNRMIATIHPELDTHAKYFNYAAKKYGNRPCLSARPYNYQQKQSGDQFEAYT
                     YDEVWQRKNNLGAGILRSLLNNPYLNDKLESHRKIKNHMRDWSGYGIPNYLCNNKDQV
                     IEKSCSFILSIFAVNRLEWVLTDLATSSYAITNTALYDTLGPDVSQYILHLTQSPIVV
                     CTSDKVDVLLNLKEKYPKETEALISIVTMDPISTVSEVALSKANALGIQVQDLQQVEQ
                     LGQEQPINELSPSPDALFTLSFTSGTTGSKPKGVMIPHRCAAAYISFLTAYQPQAQLG
                     DKAFILLPLTHLYERETCAFAWTNGYHLGFPQTTVGQTKINTFTNMIEDLKIFKPTYM
                     SIVPRLLTKIETLIKEEIKQLTAKEQETVNDIIKYKIEQQGKADGSTGFHTKFDSFPP
                     YANLRKSIGFDQMRWVQTASAPVAASTLIYLKASLSMGVRQLYGLTESGAAITCTDAY
                     EAKPGTCGSISPTGEFRLRAVPDMGYDINKLQGEIMLRGPQMFKGYYYNQEETDKAID
                     KEGWFHTGDIATVDSNGRITIIDRVKNFFKMQQGEYVSPEKVENRYLSNNPSISQLYV
                     HGNSLKPYLIGVVGIEYEQGLKFLNENFGLNKIGMSPKEMLEKMNSVEAKTKFLNHLN
                     SNVRQHLNGFELLHNIHIEINPLTVERDVVTPTFKLRRPIAQRFFADVFHKLYEIEQS
                     LIHGAKHQAARL"
     gene            complement(<1264400..>1264851)
                     /gene="SGF11"
                     /locus_tag="PVL30_003616"
                     /old_locus_tag="LELG_02772"
                     /db_xref="GeneID:5233317"
     mRNA            complement(join(<1264400..1264693,1264819..>1264851))
                     /gene="SGF11"
                     /locus_tag="PVL30_003616"
                     /old_locus_tag="LELG_02772"
                     /product="SAGA-associated factor"
                     /transcript_id="XM_001526164.2"
                     /db_xref="GeneID:5233317"
     CDS             complement(join(1264400..1264693,1264819..1264851))
                     /gene="SGF11"
                     /locus_tag="PVL30_003616"
                     /old_locus_tag="LELG_02772"
                     /codon_start=1
                     /transl_table=12
                     /product="SAGA-associated factor"
                     /protein_id="XP_001526214.2"
                     /db_xref="GeneID:5233317"
                     /db_xref="PFAM:PF08209"
                     /translation="MANENVTYGMVANSLLDDMINNIIRNQVVTHFADHACMAQATVS
                     IPELDKLATNLQSADTNKDIFGQDRSKLKGIEASRYFSCDNCGRKIAGGRFAQHINKC
                     LDRKRK"
     gene            <1265195..>1266643
                     /gene="SEN54"
                     /locus_tag="PVL30_003617"
                     /old_locus_tag="LELG_02773"
                     /db_xref="GeneID:5233571"
     mRNA            <1265195..>1266643
                     /gene="SEN54"
                     /locus_tag="PVL30_003617"
                     /old_locus_tag="LELG_02773"
                     /product="tRNA-splicing endonuclease subunit sen54"
                     /transcript_id="XM_001526165.1"
                     /db_xref="GeneID:5233571"
     CDS             1265195..1266643
                     /gene="SEN54"
                     /locus_tag="PVL30_003617"
                     /old_locus_tag="LELG_02773"
                     /note="BUSCO:EOG09263AZP"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA-splicing endonuclease subunit sen54"
                     /protein_id="XP_001526215.2"
                     /db_xref="GeneID:5233571"
                     /db_xref="PFAM:PF12928"
                     /translation="MSHNVYNNDYDADDDDDGSQIRPSKVILEDDDEVQDWKLLGQPQ
                     NRGPQASICKSSSITTTTKTTTNATAAIATATAAAPSASSSIPRRGEKEFEPDGTQVQ
                     ISSLEESQNAMFNALSNTRGHHLRQKLVGVWSMRLQECLIFNIRGKFFQDMGAAKGSV
                     VYLNAVETVYLCERGSLVVYLSNDEFDLWLTGSMEPEDFDVETKLMALDLEFLYCLTK
                     INLSKYLVYSHLKRLGYIVLEHHNEIKSASEFDIKEETELEDVSFWKLPRKWGVLSYP
                     ALHNRHMSTANYFKYTPIFKAIAIQHLKIAESKNSSQHSKLQLTYNVWKPTPSFSKKN
                     PPKPDFQLVVVDAEKTPMYLSYAQINNLQQQLAQIEVSDKSQTNKNPKPSVKKKEPRV
                     ESKKQIQAKRNAERQSKLDISIQERNTYLRKRDESWKNGFDKVIAAVVNQGLISFVQL
                     SSGNFRCLESDAKKVLDSIYPERDHSLVYNEI"
     gene            complement(<1267022..>1269541)
                     /gene="KRE6_3"
                     /locus_tag="PVL30_003618"
                     /old_locus_tag="LELG_02774"
                     /db_xref="GeneID:5233538"
     mRNA            complement(<1267022..>1269541)
                     /gene="KRE6_3"
                     /locus_tag="PVL30_003618"
                     /old_locus_tag="LELG_02774"
                     /product="beta-glucan synthesis-associated protein"
                     /transcript_id="XM_001526166.1"
                     /db_xref="GeneID:5233538"
     CDS             complement(1267022..1269541)
                     /gene="KRE6_3"
                     /locus_tag="PVL30_003618"
                     /old_locus_tag="LELG_02774"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-glucan synthesis-associated protein"
                     /protein_id="XP_001526216.2"
                     /db_xref="GeneID:5233538"
                     /db_xref="PFAM:PF03935"
                     /translation="MRRNLTPGTTPVINLTNEDGVSFSHKSSGQSNPNNNNYEHQYDQ
                     FQNQKNGPYTSQSHSQSHSQSQSSSSQEQNPFADQQQEDIYNDGYPSQYNSHSRPISN
                     TDSESVYYTRPSDNQNQLTYSQYQQQQSPKNHQHFSSSIPHNNSFQNLSYNSHNYQTQ
                     NNPPQDFYSRSYRSELDIESDPNSESGSGSGSDSDPLNSSPNTLSHLPLNHHYGSSNT
                     YNSSLRRSTATSIMGNSNNNINNNNNNNSNSNSNNNTTSAYTVGGGSSGGSACGAQQY
                     DRYPKEAFFGYANHSSQASASNLLLDDNASSSTFNYASSPNPISNNSSYDYEFSPFGG
                     YPASQFPLSIDEKEPDDYLHNPDPVKDAEYDENRFMSDLKNMDRRSFGGLVALIMMLI
                     AAILVFVLLPVLTFTNNVQPAQPRVYEILTRYKYPMLSAIRQSLVDPDTPESALTNIG
                     QDGRVWKLVFSDEFNVEGRTFYDGDDQFFTAPDLHYAATQDLEWYDPDAVTTRNGTLE
                     LTLDAFENHNLHYRSGMVQSWNKMCYTQGKLEFSAMLPGYGSVSGLWPGLWSMGNLGR
                     PGYLATTEGVWPYTYNSCDAGITPNQSSPDGISYLPGQRLNKCTCPGESHPNPGVGRG
                     APEIDALEGEIHGTTGRVSQSLQIAPYDIWYMPDYNFIELHNSTVTLMNTYAGGPFQQ
                     AVSGVTMLNRTWYEKGEGLGHHFQKYGYEFLNNDDDGYITWFVGNEPTFTMFSTALHP
                     NGNIGWRQIPKEPISIIMNLGISNSWAYIDWPSLSFPSKMRVDYVRVYQPEDEVNMGC
                     DPDDYPTYDYIQDHLNIYMNTNFTTFEKGGYKFPKNKLTGC"
     gene            <1274884..>1277124
                     /gene="KRE6_4"
                     /locus_tag="PVL30_003619"
                     /old_locus_tag="LELG_02775"
                     /db_xref="GeneID:5233150"
     mRNA            <1274884..>1277124
                     /gene="KRE6_4"
                     /locus_tag="PVL30_003619"
                     /old_locus_tag="LELG_02775"
                     /product="beta-glucan synthesis-associated protein"
                     /transcript_id="XM_001526167.1"
                     /db_xref="GeneID:5233150"
     CDS             1274884..1277124
                     /gene="KRE6_4"
                     /locus_tag="PVL30_003619"
                     /old_locus_tag="LELG_02775"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-glucan synthesis-associated protein"
                     /protein_id="XP_001526217.2"
                     /db_xref="GeneID:5233150"
                     /db_xref="PFAM:PF03935"
                     /translation="MSSQRDLTFNTPKLSVNDANTHDEHGEHASPEFQAHNPFADDEA
                     DISSFSSSSQNHQQQHQHQNQQHQNQHQHQYQPYNQEDDSSFTQQDAAEYERPFNNTY
                     SGYHSNAGSSNYLINDNSDAEDTSRFLNRDYSNQNNNIVDVQARAPSSRYADSPHLQT
                     SSPAEFDRYPSVAGSRKVSSTSLSSHFYQNNEKAKSAQSRDRYISHSSSTNSMDDTSS
                     RKSTTPFTEDLSPFGGYPASSFPLSIDEKEPDDYLHNPDPVKDAEYEKNRFVYDMKNL
                     DRRSLGGLIGLIVMALGALCVFVVLPALTYSGATEHYKPESYEVLTRYSYPMLSAIRQ
                     SLIDPDTPSDAMSKKSKSGDTWPLVFSDEFNVEGRTFYDGDDQFFTAPDLHYDATKDL
                     EWYDPDAVTTANGTLKLRMDAFKNHNLYYRSGMVQSWNKFCFTEGRIEISARLPNYGN
                     ITGLWPGLWTMGNLGRPGYLASTEGVWPYSYNSCDAGITPNQSSPDGISYLPGQRLNK
                     CTCTGESHPNPGVGRGAPEIDVIEGEVMTDSSGDKANNGVASQSLQLAPMDIWYMPDY
                     DFIEIYNNSVTTMNTYAGGPFQQAFSATTTLNVTWYEKGDHAHNYQNYGFEYLNDDDT
                     GYLRWFVGQDPTLTVYSTALHADGNIGARTLSKEPMSIIMNLGISNNWAYIDWNAIHF
                     PVTMQIDYVRLYQPEDSINVGCDPDDYPTYDYIQDHLDIYENVNLTSFEDAGYTFPKN
                     KLTGCS"
     gene            <1278211..>1280001
                     /locus_tag="PVL30_003620"
                     /old_locus_tag="LELG_02776"
                     /db_xref="GeneID:5233124"
     mRNA            <1278211..>1280001
                     /locus_tag="PVL30_003620"
                     /old_locus_tag="LELG_02776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526168.1"
                     /db_xref="GeneID:5233124"
     CDS             1278211..1280001
                     /locus_tag="PVL30_003620"
                     /old_locus_tag="LELG_02776"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526218.2"
                     /db_xref="GeneID:5233124"
                     /translation="MTVEIPNIKSIAIIGAGPGGLASLYEFLHTNKDGTSTIRDPKSH
                     TAPSPGNYPKAADPAFDKIVVFEQKDHPGGIWAPATLEADLPVPPQEILDAENYNDPR
                     YVRPRTEVPEGVKGATVDKPFVTKGEPNTKSGNFKVRKQAEVPETEVNKSEGEQLIDE
                     LQWKRTGIFPFLFTNIPQRFTRFSYLPDEEEFHNKQRKIYPFLTHQELSQKFTDFVEQ
                     ENLLEYIRLNSAVENVAKDKDTGKWIITVRHPQQNGDNLWYQEEFDAVVVSNGHYTVP
                     YFPHINGLAEYNANFPNQLIHAKSFRDLEDFKDKDVLVVGGSISTANLLQYIVPVAKS
                     VTNSKRGKHLVFAYINDALVSKGIDPRPEISYIDPKSGEFYFTDGTSGKYDKVLFTTG
                     YHYHFPFFNPQDNYLSLVNPGNLSRVGGLYLHTIDQKDPTLGTVGIIVSHLNFHTIEA
                     SAAALAGVWSGASSLPNVDPEQKKWEDDLVNTRGNSLFFHFYDNHGAKEIIDDLEQYF
                     AKGRYNPLIRDGEFVDEIDKGSDYLEKLFYGLKDKTIAIEETNDWKNETGKGEITKTE
                     KSTKQDSEIPSLQKGVAGISVAEVPTTVPA"
     gene            <1281723..>1283408
                     /locus_tag="PVL30_003621"
                     /old_locus_tag="LELG_02777"
                     /db_xref="GeneID:5233575"
     mRNA            <1281723..>1283408
                     /locus_tag="PVL30_003621"
                     /old_locus_tag="LELG_02777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526169.1"
                     /db_xref="GeneID:5233575"
     CDS             1281723..1283408
                     /locus_tag="PVL30_003621"
                     /old_locus_tag="LELG_02777"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526219.2"
                     /db_xref="GeneID:5233575"
                     /translation="MTSDKPFNIKNVAIIGAGPAGLASLYEFLHTNKDGSSTISNPKL
                     PQSNLNYPQSQDPAFEKIVVFEQKNQPGGIWAPSNFEADYPVPPQSIMDKEQYHNPEQ
                     IRPRNTIPEEIKGATYEKPFIEEKKNIDKNHLQGSSKIGDTEFVEKQRKLINELQWSR
                     SGIFSFLFTNIPQRITRYSYMKDEPEYHDKTRKIYPFMTHQELTNRFTNFIEQEDLLK
                     YIRLSTSVENVHKNIKTGKWVVTARQRGSSTDGLDTWYQEEFDAVVISNGHFNIPFIP
                     HIKGLAQYNANFPNRILHAKNFRDPKEFTNKDVLIIGGGVSTTNVLQYVVPVAKSVAN
                     SKRGEQKVFKFINKALVSKGIEPKPPVEYVDPITGLFHFQDGTSAEFDKVIFSTGYHY
                     YFPFLDSSEYLSLNNPGNYSRVGGLFLHTFCQKDPTLGTVGVCHSQFNFHTIEASAAA
                     LAGVWSGATHLPDINQQRKWEEDLLKEKGNNISFHIYNHYNAKVFVDLVKPYFPKGRY
                     DPLIFDGEFASDVDIGFDHLEKLFYGLKDGTITIEETNDWDLSNGVSKANFHG"
     gene            <1284061..>1285878
                     /gene="FYV10"
                     /locus_tag="PVL30_003622"
                     /old_locus_tag="LELG_02778"
                     /db_xref="GeneID:5233631"
     mRNA            <1284061..>1285878
                     /gene="FYV10"
                     /locus_tag="PVL30_003622"
                     /old_locus_tag="LELG_02778"
                     /product="GID complex subunit containing RING finger
                     motif"
                     /transcript_id="XM_001526170.1"
                     /db_xref="GeneID:5233631"
     CDS             1284061..1285878
                     /gene="FYV10"
                     /locus_tag="PVL30_003622"
                     /old_locus_tag="LELG_02778"
                     /note="BUSCO:EOG09261O7R"
                     /codon_start=1
                     /transl_table=12
                     /product="GID complex subunit containing RING finger
                     motif"
                     /protein_id="XP_001526220.2"
                     /db_xref="GeneID:5233631"
                     /db_xref="PFAM:PF10607"
                     /translation="MTEPTIAFHLQTHQTQFKIPTELIKKNFKNIQKLIEKQKKQLTD
                     DILKIKKNDKMPTQIKLEMIRKLIKNFELFRKKLLVLVRKDEEYRGRMIARLENIAEL
                     VSYCKSNGDSTTNGTKNGTGGGIKNSFSDQTSSQAIGEHEENKGKVTEMELDFKNADL
                     IMWYRDQANLLIIDYLIKSNQSLTKDQNAGIVFLESLSKTNPNLKKLIDYDVLLEFNT
                     IFLSIVKKHDLTQIVAWFSENKSQLKKNISNLEFEINYCKFLSLIESGKIDEAIKYSR
                     ESLSGYGNQENYSTSMNDTINHTKNLEKLKGLGGLLVFKSMNDFDLKSKSSGNLNGVG
                     YANDIETGIENQSIHHQHPYYREYKRLLSNERWESLGQCFIDNFIQLYGIPKTYPLFI
                     YLSAGLSSLKTKSCYCNYENTIFKDASSGRENVVPVGEHSNAINENTNTMNANNGSSS
                     SDHFIHFAFNHGNMTNIHVTSEGTGAGIISQISASTIPINNDQQVLSGLSKEPTDTKL
                     RGPDQYYKLLGKVNNCPVCTPELFHLSKNLPFAQLITSVPPEPFRLPNGNIYPFQKLL
                     NPNDDYNSIQNDLVRQGSIKDPLTKEVFPIDHCRRVYPV"
     gene            complement(<1285998..>1287219)
                     /locus_tag="PVL30_003623"
                     /old_locus_tag="LELG_02779"
                     /db_xref="GeneID:5233394"
     mRNA            complement(join(<1285998..1287062,1287214..>1287219))
                     /locus_tag="PVL30_003623"
                     /old_locus_tag="LELG_02779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526171.2"
                     /db_xref="GeneID:5233394"
     CDS             complement(join(1285998..1287062,1287214..1287219))
                     /locus_tag="PVL30_003623"
                     /old_locus_tag="LELG_02779"
                     /note="BUSCO:EOG09263W48"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526221.2"
                     /db_xref="GeneID:5233394"
                     /db_xref="PFAM:PF10354"
                     /translation="MNNKGKALGSKGLKAALARHQVQDTLKQKALKNAQVESQNQLNK
                     AKSMKITKKAKQNNGLALAKQSRGYLPFTEEDTVLLVGEGDFSFAKSLILQNYVRPEN
                     LVATSLDSQEEVMAKYPDVDKTLVELQDSGVRVMHDVDATDLAKTLKIAPNSKQRRTG
                     SKASALRLFTPGSSSHTELDYIMFNFPHTGKGIKDQDRNIRDHQKLILEYFKNCNTVF
                     DLVNENNKVHDDFAGYRHKNGKSNNKGSSNDDSYQGKIILSVFEGEPYSSWGIKIIGK
                     EQGYKVMKSGKFDWSMFPQYHHKRTNGIRDTTKPASERDARLYVFEKNTQLSKTADSN
                     KKRNEKRNGNFGFDSDSDSDEN"
     gene            complement(<1287418..>1289799)
                     /gene="UBP1"
                     /locus_tag="PVL30_003624"
                     /old_locus_tag="LELG_02780"
                     /db_xref="GeneID:5233337"
     mRNA            complement(<1287418..>1289799)
                     /gene="UBP1"
                     /locus_tag="PVL30_003624"
                     /old_locus_tag="LELG_02780"
                     /product="ubiquitin-specific protease ubp1"
                     /transcript_id="XM_001526172.1"
                     /db_xref="GeneID:5233337"
     CDS             complement(1287418..1289799)
                     /gene="UBP1"
                     /locus_tag="PVL30_003624"
                     /old_locus_tag="LELG_02780"
                     /note="MEROPS:MER0000864"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-specific protease ubp1"
                     /protein_id="XP_001526222.2"
                     /db_xref="GeneID:5233337"
                     /db_xref="PFAM:PF00443"
                     /translation="MYIAKKTTVLFILLNFTLFIQIIKVSFLNSNKLTATISTSLLVI
                     ASVYYISTQYIIPKLTEITNNNNNPNNSDNSNYQSNNILPFNIPQLLHKMINSKYGRI
                     GSDRFRSKKSKEHRFAMKNGGELGGISNDGNTCFMNSVIQSLASSRQLMKFIDSYLYA
                     EIEIDTNKTSGEKITMKSNQPRPELTFTNALKLLLDNVNGKYGSRGKEFTTKQLLNKM
                     PNGPKQNFFSGYNQEDAQEFYQLIMGLLEKEFKKMSLSRLPTPEPEENSSSSKKETKF
                     IDVRNLKEVISGCKKLGKLGTVYVPAMQIDPNIDDAEHKVVPLQLITPVDGITAERVG
                     CLTCGESGGIRYAVNSGLSLNLPTGGHQSSSYHHSGFTLAQLLDEWIKPETIDDVNCN
                     RCGLVQTREFLLRKLDELKGADESLLSKLQVRITDIERELAKYQVTDEAFEKLTTKNQ
                     IKKSKKTKQIFLDRPPPLLSIHINRSQFDPRTYMVIKNPSNVTFPAVLDLNRYIVEPN
                     DINMDARLHMRKQDEIHQNILRSKQKANENSWIQDGKDGVGEDKELSASNSESSASSL
                     TASYNEKVIDTDGSPITTLDTSIPTPADTATSDSRLFYNLKAVIVHYGTHNYGHYICY
                     RKLRGTWWRISDESVYVVTEDEVLNGQGTFMLFYEFDDGFKEVLQNVTDDEEEQEERL
                     ESGQVDGQKGNQERGAEGIPNADENDHGDLKSNKNNNNNSISNGVTNNVSSASEESDV
                     EESDRAVSEDSEYHISRSDVDMEDEDAKEPSKEEPVQEREDAFFNVAEAQVHL"
     gene            complement(<1290524..>1292329)
                     /gene="PUB1"
                     /locus_tag="PVL30_003625"
                     /old_locus_tag="LELG_02781"
                     /db_xref="GeneID:5233586"
     mRNA            complement(<1290524..>1292329)
                     /gene="PUB1"
                     /locus_tag="PVL30_003625"
                     /old_locus_tag="LELG_02781"
                     /product="E3 ubiquitin-protein ligase pub1"
                     /transcript_id="XM_001526173.1"
                     /db_xref="GeneID:5233586"
     CDS             complement(1290524..1292329)
                     /gene="PUB1"
                     /locus_tag="PVL30_003625"
                     /old_locus_tag="LELG_02781"
                     /codon_start=1
                     /transl_table=12
                     /product="E3 ubiquitin-protein ligase pub1"
                     /protein_id="XP_001526223.2"
                     /db_xref="GeneID:5233586"
                     /db_xref="PFAM:PF00076"
                     /translation="MSQVANTQSNSSNSVENQIPASINESEASHTPNENKDTDNNNDK
                     AERDQEIISTNSPSQDPPSSTGSCPSPKESETQLESEESTVAPASAVNGGREISNKIL
                     YVGNLAKSASEEQINEIFSSVSNPIKSIKLLNDKNKLGFNYAFIEFNESEDAEKALNS
                     LNGKDVNGSDIKVNWAYQSAAIAGGSTPEEPSYNIFVGDLSSEVNDEALKKAFTKFGS
                     LKQAHVMWDMQTSRSRGYGFVTFGKQEDAENALQSMNGEWLGGRAIRCNWASHKSHIN
                     NSNTNNNNNNNNNNINNTNGNAIYGHTQQFAYGDNPFKASNQQQQQQHQQQGFNRFSN
                     NNRTNRSNYNNNNSNNNNNNNNGNNKRHYNNANNNIHTPQFPPQFMGGQITQVNGQAL
                     PQQSPNLNGLMLHNFGSNPNLVPFNQNNTFNANNGQGPVPVSNMNQQTQQDSTHTNNH
                     NNNNNNNNNNNNNNSNSNSNNTNTNSINNNAGNVAMVSPQTYDIVLRQTPSWQTTVYI
                     GNIAHFTQSHEMIPLLQSFGFIVDFKFHPERGCAFVKYDSHERAALAIIQLAGFNLNG
                     RPLKCGWGKERPQQYQSRVGGHVAGEVEHPSYGQN"
     gene            <1293757..>1295004
                     /gene="TRM12"
                     /locus_tag="PVL30_003626"
                     /old_locus_tag="LELG_02782"
                     /db_xref="GeneID:5233301"
     mRNA            <1293757..>1295004
                     /gene="TRM12"
                     /locus_tag="PVL30_003626"
                     /old_locus_tag="LELG_02782"
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /transcript_id="XM_001526174.2"
                     /db_xref="GeneID:5233301"
     CDS             1293757..1295004
                     /gene="TRM12"
                     /locus_tag="PVL30_003626"
                     /old_locus_tag="LELG_02782"
                     /codon_start=1
                     /transl_table=12
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /protein_id="XP_001526224.2"
                     /db_xref="GeneID:5233301"
                     /translation="MIKLIIRDRTHIKHVKNILEEHKWLNKSKKIDSHQGIFTIYTTL
                     TLLPTILSGYEYGEYEETPNQEGTGKKTLQFIVEEYCVRNGIDVLEFPKRWSLYPPML
                     LFNSSLTFSSNTNTNTNTNTNTNLNGDISLPSELCEELLKNQLDLFGTCNITHIAINK
                     PIIESDIMRRPHNIVPLYGDFGPRLPLEDYRPTAKDFQNAFWCHVVQNGIWQTWAPLY
                     TMFSRGNIKEKKRILDNYKTLQGTVVMDLYCGIGYFSLSYLRNGAKLLCWELNPWSVE
                     GFCRAMEHAGYKYRLFQETDTFDIIALNDVDACVFLESNEKVLNRLQNVQRHSLRISH
                     INLGLLPTSQPSWPIVNEVVHIYSNTDPLVHVHENVHVEDFEKLGKKIEANFTRGEVI
                     HQEKVKTFAPDVWHVVYDVRVRK"
     gene            <1297142..>1299763
                     /gene="CRZ1_2"
                     /locus_tag="PVL30_003627"
                     /old_locus_tag="LELG_02783"
                     /db_xref="GeneID:5233200"
     mRNA            <1297142..>1299763
                     /gene="CRZ1_2"
                     /locus_tag="PVL30_003627"
                     /old_locus_tag="LELG_02783"
                     /product="DNA-binding transcription factor"
                     /transcript_id="XM_001526175.1"
                     /db_xref="GeneID:5233200"
     CDS             1297142..1299763
                     /gene="CRZ1_2"
                     /locus_tag="PVL30_003627"
                     /old_locus_tag="LELG_02783"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription factor"
                     /protein_id="XP_001526225.2"
                     /db_xref="GeneID:5233200"
                     /db_xref="PFAM:PF00096"
                     /db_xref="PFAM:PF13912"
                     /translation="MSTHLQGSQEDEELYNILNLSPPVINVADYQSESILGQQQGFIK
                     PNYNHNNNNNNNNNNNNNNNNNLNHQHNNQFENSIRRSVELTLETSNMPQFADEEFLS
                     PHSQISQHSQHSQDWSSPNNLQLATGENRNDVGNSFGNNIGNNIGNGSGSGSGHGFLR
                     VDSPQGYLNPHSPGSHSVYSSHSAYSEVSSHPASPYLDAMSQFSNTNLAPPEVPTAYS
                     DVGSNYGDDVNYPNNYSNENNDSSSNNKNDNIFHDYRNSNLMPGHFDSFGFNSRDGEI
                     PLGGSVSSANLLSMYQQQQQQQQQQQQQQQQQQQQQQQQQQQQEDSPLKQTQNLNLLQ
                     EQSSVFPRGDINFQDMDEVHNQQFQPMDGLELDPNSQPPQHHNQQQNQQQNYQHQHQQ
                     QHQHQHQQQQHQQHQQQQHQQQQQHGQFHYDNNNNDIVHEQYSFANPQMNFELDITIT
                     PPQQSDQIFPHQQPQHTSSTALDSLDNNASPENSKQLLTENNLSHYYTQIKKEFVEED
                     SPNIVISIHQAPEDVAAKTPSLFSNSSANSPGNALSRISSNNEEDRVKTDSSNFVSND
                     QLMPSSSSTNNNNQSEAKDLLNPEYQSIKRGRRKSHASKSASASPRSRSRSTRSRNSS
                     RSRSRSRSKDGDGDGDEAIDDENEANDSDGGNTYENEDMSEHDGDHDGSHSKNDGTSQ
                     ISSREKMLELASPNQTSKRTQKHPSVYACHLCDKRFTRPYNLKSHLRTHTDERPFICS
                     QCGKAFARQHDKKRHEDLHTGEKKYQCKGFLKNGEPYGCGRKFARADALRRHFQTDAG
                     KECIRLLIEEEERDGGLQGSSLRANEIADTIVNDKTDALNMAQAGNSNSGVNGDDNIN
                     ADSNHNRVPQVLISPSQ"
     gene            <1300266..>1301876
                     /gene="SAM50"
                     /locus_tag="PVL30_003628"
                     /old_locus_tag="LELG_02785"
                     /db_xref="GeneID:5233550"
     mRNA            <1300266..>1301876
                     /gene="SAM50"
                     /locus_tag="PVL30_003628"
                     /old_locus_tag="LELG_02785"
                     /product="sam50-like protein"
                     /transcript_id="XM_001526177.1"
                     /db_xref="GeneID:5233550"
     CDS             1300266..1301876
                     /gene="SAM50"
                     /locus_tag="PVL30_003628"
                     /old_locus_tag="LELG_02785"
                     /note="BUSCO:EOG09263DQH"
                     /codon_start=1
                     /transl_table=12
                     /product="sam50-like protein"
                     /protein_id="XP_001526227.2"
                     /db_xref="GeneID:5233550"
                     /db_xref="PFAM:PF01103"
                     /translation="MSIVSQDEEFMESMKFQPHNQSTAGSNQSTEEKQLLELQTLKQE
                     QLIKQNQQFLNDLFHDNSTQPIKVRNVQITNGDQFRDSFVAAQFAPLLEEGTVMSLRN
                     YLDVVDNISKGFLKLGIVENIMCSTHQVNAVQPKRSPFPFVTGGARGNAGAIGAINVV
                     PVFNALPVKRFFAKTGTNIGNGEGDGYIQFQLRNIFGGGENLVFDAVTGTKTQSSYLL
                     NYNQPVWNNPNFIWENQFSINSRKLDWIQSVVQSKSIVNKIYTQFHHTKVNHELVMEN
                     TVRNLSNNASRSFEVMQQSGQSIKSSVAYNISYDSRDNKHLPFSGRYIQCGVEYNGLL
                     GSLNAFPYVKTASQAQQAWNLPFLNSHLLATVKCGLLYPLLAERKSGISSSMSSSSSS
                     SSLSISPSPFSSSLLDRFYIGGPNDVRSFMLNGLGPKNQNSYIGGDMFMNGGLSLFTD
                     IPRYKDSNFKLHNFVNWGRIASMSKDQSLVDNLKKMSHSYCLSCGFGILYNHPMARFE
                     LNFVLPLIVNERDLVRKGIQYGIGVSFL"
     gene            complement(<1302011..>1303048)
                     /gene="CAB2"
                     /locus_tag="PVL30_003629"
                     /old_locus_tag="LELG_02786"
                     /db_xref="GeneID:5233516"
     mRNA            complement(<1302011..>1303048)
                     /gene="CAB2"
                     /locus_tag="PVL30_003629"
                     /old_locus_tag="LELG_02786"
                     /product="Phosphopantothenate--cysteine ligase cab2"
                     /transcript_id="XM_001526178.1"
                     /db_xref="GeneID:5233516"
     CDS             complement(1302011..1303048)
                     /gene="CAB2"
                     /locus_tag="PVL30_003629"
                     /old_locus_tag="LELG_02786"
                     /note="BUSCO:EOG09263YFX"
                     /codon_start=1
                     /transl_table=12
                     /product="Phosphopantothenate--cysteine ligase cab2"
                     /protein_id="XP_001526228.1"
                     /db_xref="GeneID:5233516"
                     /translation="MTPAHQKNFHTSNPEEATAINREIPEFAAAQISDEDKYFANHKP
                     PSYLPEIKEELDKFIKYHLENTGKRIALVTSGGTTVPLENNTVRFIDNFSAGTRGATS
                     AEYFLENGYAVIFLHREFSLLPYSRHYSHSTNCFLDYMTEVNGKIEIDPKYSEQMLHV
                     YRKYHEAQDSNSLLLIPYTTVNQYLYTLKLISEELKPCTNKALFYLAAAVSDFFIPQS
                     RMPQHKIQSSAATDGELVIRLAQVPKFLSRLVENWSSGAMIISFKLETDSSILIKKAK
                     SALERYHHQLVIGNLLQTRKKEVVFVDLEHDDHWVRLTDEEVANGKEIESEMIPAVIT
                     LHNEWIKKSLA"
     gene            <1304438..>1304686
                     /locus_tag="PVL30_003630"
                     /db_xref="GeneID:85890376"
     mRNA            <1304438..>1304686
                     /locus_tag="PVL30_003630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119495.1"
                     /db_xref="GeneID:85890376"
     CDS             1304438..1304686
                     /locus_tag="PVL30_003630"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975478.1"
                     /db_xref="GeneID:85890376"
                     /translation="MQFKYIVAFSCILLTSASALFIPTNLDEFEAITETTNVKALLKK
                     YPKGKVFDDISDSNEKIFVYDVDKALSWNVKKPEFKWE"
     gene            <1305581..>1306888
                     /gene="SSN8"
                     /locus_tag="PVL30_003631"
                     /old_locus_tag="LELG_02787"
                     /db_xref="GeneID:5233336"
     mRNA            <1305581..>1306888
                     /gene="SSN8"
                     /locus_tag="PVL30_003631"
                     /old_locus_tag="LELG_02787"
                     /product="RNA polymerase II holoenzyme cyclin-like
                     subunit"
                     /transcript_id="XM_001526179.1"
                     /db_xref="GeneID:5233336"
     CDS             1305581..1306888
                     /gene="SSN8"
                     /locus_tag="PVL30_003631"
                     /old_locus_tag="LELG_02787"
                     /note="BUSCO:EOG09262K8C"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II holoenzyme cyclin-like
                     subunit"
                     /protein_id="XP_001526229.2"
                     /db_xref="GeneID:5233336"
                     /db_xref="PFAM:PF00134"
                     /translation="MSADYWNSSQRSRWQFTRYSLLEARRKLLFLERRMIQNGLIRDY
                     PNIVYDYNMRIYLHNLLLKLGRRMNVRQIAIATAEVYLSRFLTRVSLKEINVYLLVTT
                     CLYVACKIEECPQHIRLILSEARNIWSEYIPHDVTKLAEFEFYLIEEMDSYMVLHHPY
                     KSLIQLRDFLETKYEVYGFKLSEEEMQNSWSLINDSYITDLHLLVPPHIIAVAAIYIT
                     VVLKKNLAQLRNKTSPSGISSSMSTMVTSTKNNTLDNSGAGSYSTKGVSQNSITPEML
                     NSLTDGVESGTGSGLGLGESEGGGLSNEGTGVAGVGDSGVNVKNLQIDKGNKTTPSPT
                     ILSDHHLSADSLQAAGHKQEPRSQLPKAKGMSNSDFVNFEVDILDEDTINIHKFMNFL
                     EHSHINLDEVVEAVQDMVGTYVLWNRYNEQGVKKALQIMLLRR"
     gene            <1307598..>1309091
                     /gene="lag1"
                     /locus_tag="PVL30_003632"
                     /old_locus_tag="LELG_02788"
                     /db_xref="GeneID:5233141"
     mRNA            <1307598..>1309091
                     /gene="lag1"
                     /locus_tag="PVL30_003632"
                     /old_locus_tag="LELG_02788"
                     /product="Sphingosine N-acyltransferase lag1"
                     /transcript_id="XM_001526180.1"
                     /db_xref="GeneID:5233141"
     CDS             1307598..1309091
                     /gene="lag1"
                     /locus_tag="PVL30_003632"
                     /old_locus_tag="LELG_02788"
                     /codon_start=1
                     /transl_table=12
                     /product="Sphingosine N-acyltransferase lag1"
                     /protein_id="XP_001526230.2"
                     /db_xref="GeneID:5233141"
                     /db_xref="PFAM:PF03798"
                     /db_xref="PFAM:PF08390"
                     /translation="MATRTRTRTKTRRSEEEDEESGKLHHEHHQQQQQQQQQQQQQQQ
                     QQQQFQQQKQKHKLNTYKSSPSTSSTTIDQEQEEEFDSMVDVAPVKSKDDEYHESFLA
                     TIERNQIPISRNLMILLYSLHFLSSNPKIVSYTHKFIHLQNQVGTNPAGKAIYDIDID
                     DAYFVINWVITVTFLRSALMKYCFEPFAAKFCDIHSRKAKTKFAEQSWSFVYWGVSFI
                     YGVYLYLDAPYFNDLDQIYINWPNFYMQGNFKSYYLISMAFWIQQIFVLHVEKPRKDH
                     YQMFSHHIITCLLIIGSYYYYFFRIGHLILMIMDSVDIFLAGAKMLKYAGFNRACDAM
                     FILFLLSWIGLRHGVYNFIFHHAWSKSVHLMSDGQCVVGEAQKRCWTPTIINVFMGLL
                     GGLQIITCIWMYLILKVAYKVIIGVGAEDVRSDEDDTDVELEENHEADDEKEVQMGKN
                     IELKVESSWASTDKHNVEQQNDFIKDTYNSTATKAAAPVPVPETRER"
     gene            <1309939..>1312719
                     /gene="KIP3"
                     /locus_tag="PVL30_003633"
                     /old_locus_tag="LELG_02789"
                     /db_xref="GeneID:5233519"
     mRNA            <1309939..>1312719
                     /gene="KIP3"
                     /locus_tag="PVL30_003633"
                     /old_locus_tag="LELG_02789"
                     /product="tubulin-dependent ATPase kip3"
                     /transcript_id="XM_001526181.1"
                     /db_xref="GeneID:5233519"
     CDS             1309939..1312719
                     /gene="KIP3"
                     /locus_tag="PVL30_003633"
                     /old_locus_tag="LELG_02789"
                     /note="BUSCO:EOG09260BRA"
                     /codon_start=1
                     /transl_table=12
                     /product="tubulin-dependent ATPase kip3"
                     /protein_id="XP_001526231.2"
                     /db_xref="GeneID:5233519"
                     /db_xref="PFAM:PF00225"
                     /db_xref="PFAM:PF16796"
                     /translation="MADKTVSAATSFSSAVSTAKVATASTSSTTSITETPASTPLSAF
                     VAPSAKQSSISVAVRVRPFTTNENNKLIRNDDDEMLMGDGCLSTPTSQQQSSSSQKKV
                     FAPIGLRKIIKVVDDRMLIFDPPETNPIAKMQKNAFPNSFKGSRIREHKFVFDRLFDE
                     DTAQDEVYHNTTKPLLDSVLDGYNATVFAYGATGCGKTHTISGTPEQPGVIFLTMKEL
                     YEKINELKDTKIIDVSLSYLEIYNETIRDLLTPETDFKKLIIREDSNQKISVSNLSTH
                     RPNSVDEVMELILRGNMNRTSSPTEANATSSRSHAVLQINVVQKNRTGDITEDHTFAT
                     LSIIDLAGSERAAATKNRGARLNEGANINKSLLALGNCINALCDPRRRNHVPYRDSKL
                     TRLLKFSLGGNCKTVMIVCVSPSSQHYDETLNTLKYADRAKEIKTKVMRNQQSLDRHV
                     GSYLKMITEQKLEIEELRAREGKVIEIDREKQEKLRHEAFVLLQEQIATIKRNLYKNT
                     QERCKKCLLLAKRKLLLLQKVQVEQLLLNANSGMLESNQESTIRDLCEQIVSKLNSQI
                     PEIEEQYSQQYEVDYILGDSAMQGLSKLQNEKGWTEYHTTIYMQQLENLSKEVQIDQL
                     VKSSALFDQLIRSMYEFIYLGIEGEIVNVLQNLVNGNFETALQYHASEYIRERLWYQQ
                     PLNNSAQHPLQQHDSNSLSSLPLKKLRGFKNNTHSSSNKTSPTRTSPLKTSPTRASPT
                     RSSPMKPPLKRIKSSQNRKAKKVFRWGEGAQTTENVAPNTKAPDGPQQLHHQHQSRQQ
                     RQMDSSFDDTVVNTSASAMLDTLEQGSPTIDHVLDLDLSFNPVLESPQSPQPPQLQST
                     NLFAKSPLSEKSSKNISCPNTIGDERNKAEQKMEQSSGSLVNRRLNASLIESRRPLLN
                     TSAASRLTQTED"
     gene            complement(<1312997..>1313719)
                     /locus_tag="PVL30_003634"
                     /old_locus_tag="LELG_02790"
                     /db_xref="GeneID:5233090"
     mRNA            complement(<1312997..>1313719)
                     /locus_tag="PVL30_003634"
                     /old_locus_tag="LELG_02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526182.1"
                     /db_xref="GeneID:5233090"
     CDS             complement(1312997..1313719)
                     /locus_tag="PVL30_003634"
                     /old_locus_tag="LELG_02790"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526232.1"
                     /db_xref="GeneID:5233090"
                     /translation="MSANDFYSSGDQSQYDPKQSTQSRNNNNNNSNGGQGGDQDRGFL
                     ATVAGGALGGYGGHELGGQSHGKLGSVLGAIGGAIGANKLEDEYKEHRQEGKHHGGRA
                     EEGGHGGSLGSYSASQEDRYNDRQSGRNDNYGGRNDNYGGDRRDDFGGRREDNFGGRG
                     EGFGGQGGYNTGYGNRMESGPGGHGPHGGRGEGRYESDYGNRMEGGPGGFGRQGGRDE
                     GRYENDYGNRMEGGRGGRQGGW"
     gene            complement(<1315715..>1318093)
                     /gene="CHS4"
                     /locus_tag="PVL30_003635"
                     /old_locus_tag="LELG_02791"
                     /db_xref="GeneID:5233108"
     mRNA            complement(<1315715..>1318093)
                     /gene="CHS4"
                     /locus_tag="PVL30_003635"
                     /old_locus_tag="LELG_02791"
                     /product="Chitin synthase 4"
                     /transcript_id="XM_001526183.1"
                     /db_xref="GeneID:5233108"
     CDS             complement(1315715..1318093)
                     /gene="CHS4"
                     /locus_tag="PVL30_003635"
                     /old_locus_tag="LELG_02791"
                     /codon_start=1
                     /transl_table=12
                     /product="Chitin synthase 4"
                     /protein_id="XP_001526233.2"
                     /db_xref="GeneID:5233108"
                     /db_xref="PFAM:PF08238"
                     /translation="MSTTSQHPYRQVSGSSSSAPPYPVSDFNVTNSQSDRSDSSPSMT
                     EVTSGLEDMHMTSTYNKGSNHSQSQLQQQQQQEQEQQYQQQQQQQQPYRSLLAVNEPP
                     PSQQQQQRNASAGAFSQYSGSNINFPPHLVPNLSQTQQAPQLPTSDHYIPQQQQQQQQ
                     QQQQQQPAQISPVRTQTFEQTAPFNHSPKIGSTVNVKSPTMPYPMYETSSTPPPVFGN
                     SKDSIVVSPPSNPLSTASSVTNLNLNTNNTTASNQNNLSLDNQMFSRSENNLSMPSPM
                     GKFGHSRSVSSTSSFFYERNDNASMVDFNQNVIQQYLGSNSQHLMPRIKTLELYRKNA
                     KKSNDANVLFQYAQYMLQTALLLGQDINNSTNANAAGNTAANTNTNTNTNTTLSSQSS
                     GENTPSYNNSPRKGPMDAKDRDSKAHKKNKSIDFSNIELEGNEKKLKKSLLKEAVFYL
                     KKLSDKGYVEAQYLLGDAYSSGALEKIDNREAFILFQSAAKHGHVESAYRTSYCYEEG
                     LGTGRDARKAVEYLKIAAAKNHPAAMYKLGVYSFYSRMGLPNDMNTKKMGIKWLTRAT
                     NVATELTAAAPFELGKLYYNGFEDIIITDRKYALELYAQAAALGHTQSAAILGSHYEY
                     GDDIIPQDSNLSIHYYTQAALGGDAHSMLSMCAWYLVGADPFLPKDEAEAFEWAKRAA
                     SCNLPKAQFALANFFEKGIGCVKNVAEAQMWYRKAAENGDEKSLARLTDRELAKNIQK
                     KLKKSGKFASANNYGQPSYNGVGASSNGQSTRAGTGDAGAAGAQKKRDCVIM"
     gene            complement(<1321124..>1321960)
                     /gene="UBC6"
                     /locus_tag="PVL30_003636"
                     /old_locus_tag="LELG_02792"
                     /db_xref="GeneID:5233277"
     mRNA            complement(<1321124..>1321960)
                     /gene="UBC6"
                     /locus_tag="PVL30_003636"
                     /old_locus_tag="LELG_02792"
                     /product="Ubiquitin-conjugating enzyme E2 6"
                     /transcript_id="XM_001526184.1"
                     /db_xref="GeneID:5233277"
     CDS             complement(1321124..1321960)
                     /gene="UBC6"
                     /locus_tag="PVL30_003636"
                     /old_locus_tag="LELG_02792"
                     /codon_start=1
                     /transl_table=12
                     /product="Ubiquitin-conjugating enzyme E2 6"
                     /protein_id="XP_001526234.2"
                     /db_xref="GeneID:5233277"
                     /db_xref="PFAM:PF00179"
                     /translation="MASRQSQRRLSKEYKSIQATPPPYIMAKPNDENILEWHYIITGP
                     KNTVYEEGQYHGILRFPVEYPFKPPSISMITPNGRFQTNTRLCLSMSDYHPDTWNPAW
                     SVATILTGLLSFMTGNESTTGSINTSENVKRKLARESLKWNTKENPRFVRQFPDVVKS
                     NKEELIRRAEKEEEEIRRRKRLEAEAGNGENGDGAQNGGKEKPLDFKDLDKLDPEDRA
                     RILVEHERKMALNERNAAKNGGAGGLGLLKNLLSGGGVTALAGVVVAAFLAAYFSILK
                     RG"
     gene            complement(<1322519..>1323487)
                     /locus_tag="PVL30_003637"
                     /old_locus_tag="LELG_02793"
                     /db_xref="GeneID:5233447"
     mRNA            complement(<1322519..>1323487)
                     /locus_tag="PVL30_003637"
                     /old_locus_tag="LELG_02793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526185.1"
                     /db_xref="GeneID:5233447"
     CDS             complement(1322519..1323487)
                     /locus_tag="PVL30_003637"
                     /old_locus_tag="LELG_02793"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526235.1"
                     /db_xref="GeneID:5233447"
                     /db_xref="PFAM:PF01209"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MTNTLHQDAVQANKDSFNEDFARKYEQRESQRILSLLFLKHILE
                     MDISTAPIERKSEQESAKILGDASLPFNGFTKENTLPNPKTYLTNYPNTIFRPGMKLL
                     DFACGTGMITELFVSYLTGHAGEKSEIVGIDIGPTFLKYFNERAAKYSSENISMRSYE
                     YDILDSSISKELNKFDSFFDAIVCTISYHHIHNYEQVTKKLATFLKPGGWLFIIDFYN
                     EDVENSSGSKEAGNGSAKAVQHMGGLKKDKLNHTLGDISGLKNVSSAREFRTQIYQPK
                     EFIVNHCPEEITKRLERGELKERKGLEGEVDYLVEVSLIYAIGQKP"
     gene            <1325248..>1326603
                     /locus_tag="PVL30_003638"
                     /old_locus_tag="LELG_02794"
                     /db_xref="GeneID:5233326"
     mRNA            <1325248..>1326603
                     /locus_tag="PVL30_003638"
                     /old_locus_tag="LELG_02794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526186.1"
                     /db_xref="GeneID:5233326"
     CDS             1325248..1326603
                     /locus_tag="PVL30_003638"
                     /old_locus_tag="LELG_02794"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526236.1"
                     /db_xref="GeneID:5233326"
                     /translation="MTSVTAIPQVVLEGNIHKVIPQSTYESQISPSRSKLATASTIKF
                     EPFVHLQYYASQQGKDNYDATRRLTLSQLGISQETATKRGAISNIGVSDPFPLFTQEA
                     IDIMRNEVLQRETFLKYARYSFNSTSGMDCCIRGYVKTTNNDGANSGTTTDANVELDM
                     INCPFIYEAWNHPETMRLISQMAGVELEVVMDYEIAHVNVSLKSEAEAEEERMAHSLS
                     KKCEQEEEKEEEEDVANPVDIHRKQTGARSMSETNGDDIKAVVGWHYDSYPFVCVLML
                     SDTTDMIGGETCLRMGHENTSTSPLSSDAENSSFGKVAIIPGPKLGSASVLQGRLIQH
                     IAPQPRGLSERITMVTSYRARNPELQDTSILSTVKPEVNFGSRYNDFYPEWVRYRCDL
                     MCEKLNLAKEKCVTKDGKFDKAEAKKRLQEVEMYLRKTYEEMEVTDVEANKMMRKASV
                     F"
     gene            complement(<1326890..>1328587)
                     /gene="YCK2"
                     /locus_tag="PVL30_003639"
                     /old_locus_tag="LELG_02795"
                     /db_xref="GeneID:5233191"
     mRNA            complement(join(<1326890..1327186,1327307..>1328587))
                     /gene="YCK2"
                     /locus_tag="PVL30_003639"
                     /old_locus_tag="LELG_02795"
                     /product="Palmitoylated plasma membrane-bound casein
                     kinase"
                     /transcript_id="XM_001526187.2"
                     /db_xref="GeneID:5233191"
     CDS             complement(join(1326890..1327186,1327307..1328587))
                     /gene="YCK2"
                     /locus_tag="PVL30_003639"
                     /old_locus_tag="LELG_02795"
                     /codon_start=1
                     /transl_table=12
                     /product="Palmitoylated plasma membrane-bound casein
                     kinase"
                     /protein_id="XP_001526237.2"
                     /db_xref="GeneID:5233191"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSNRISTTTNNPAAVAAAQASHSNPIISSSKQNSALGGMNQHHL
                     HSSNNIINSNNKNNMVNNNLTSSSASHQAANAASNSNSSVVGLHYKIGKKIGEGSFGV
                     IFEGTNIINGVPVGIKFEPRKTEAPQLRDEYRTYKHLQGCPGIPNAYYFGQEGLHNIL
                     VIDLLGPSLEDLFDWCGRRFSVKTVVQVAIQMITLVEEVHRHDLIYRDIKPDNFLIGR
                     QGMPDENNVHLIDFGMAKQYRDPRTKQHIPYREKKSLSGTARYMSINTHLGREQSRRD
                     DLEALGHVFFYFLRGQLPWQGLKAPTNKQKYEKIGDKKRTTPAVTLCDGLPNQFAEYL
                     DSVRSLPFDAEPPYEEYRMLLVSILDDLGQSCDGDYDWMHLNGGKGWDASINKKPNLH
                     GYGHPNPPNERERRHRDQKRSRQQQQQQQAQQAQQSQQQLSAAQLHQQKLQHLVNRPL
                     PPIKQESMSGGGQNDFLNGGVGAVGTTGGLDQGGKYEGYNMNNYPQQQQQHHQQQQQY
                     DEDAEESKGFFSKLCCH"
     gene            complement(<1330828..>1333200)
                     /gene="HDA2"
                     /locus_tag="PVL30_003640"
                     /old_locus_tag="LELG_02796"
                     /db_xref="GeneID:5233289"
     mRNA            complement(<1330828..>1333200)
                     /gene="HDA2"
                     /locus_tag="PVL30_003640"
                     /old_locus_tag="LELG_02796"
                     /product="histone deacetylase"
                     /transcript_id="XM_001526188.1"
                     /db_xref="GeneID:5233289"
     CDS             complement(1330828..1333200)
                     /gene="HDA2"
                     /locus_tag="PVL30_003640"
                     /old_locus_tag="LELG_02796"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase"
                     /protein_id="XP_001526238.2"
                     /db_xref="GeneID:5233289"
                     /db_xref="PFAM:PF11496"
                     /translation="MNLMDILSADPPSSIYGSMEDLGQNGGSGQGLNTLADTVIQDQF
                     HNSSQEAEDQTVAAAAAAAVAVGGDDQQLNFSQQQLQQHQAHNPTRHNSSGVYHIPTQ
                     LSKLQIALTKILLHLISEPLINQSISKEKKKNTIDSLLEVSTMQSTLSLSPDNGHQNA
                     NDGGSRDLYKLFAFCFEKLCVINNHPSLLVDHFMPRKLLLSEPNESQISMSGKLELFN
                     KIVDGIIDAHRHRSRNDRDQEKEEEKKKEKEQRKNKEKTQGKQKQLVSILVVAKSNKE
                     LELIEGMIIGKDLQYHNSSNMRLYDDKRKRPFLRKKDDKERGRAGGADEHENNDDSDN
                     DGDDNDNDDNDQHHDKGVHASLFINLIQTRQLYNNYMNSSTSSIGNYKFIFSFDFDID
                     PSNPSIEMLRSSHNCPIYVPVPIFSIEHLKLCIPEPRHSNFDDGGDELHRWRLKVLNT
                     MVVNMYNLESGKYSFRETFYRDIYGIKMSKYVAEVARNPIEFSNRLGQFDEELTLNFS
                     LEKLKRKLESMYNIKVNGVYYDNGRVLTVENIKSQLVEAIQLEYLRIRDELDRIEHKE
                     VPLKRSLETARQVHFDEDEDSIQASYKKLRKLNEQASILDKRLARFENDIDKNQEKLY
                     ELECKEDELIRNTSGEDSKEGFEQVLLNQRELLSRLEKELGDLQTEMKKVSDDADDAR
                     QDYQQNSSQAVLELKKLEKIKEQRNKLYKKINGPGMAQLPDLIRRDTLINYEQRLTRL
                     VAQNKFLNSFYDGKIDRIYVERQHILENNGGPSGSSSRPSNRISRDSTPF"
     gene            complement(<1333744..>1336392)
                     /gene="IRS4"
                     /locus_tag="PVL30_003641"
                     /old_locus_tag="LELG_02797"
                     /db_xref="GeneID:5233038"
     mRNA            complement(<1333744..>1336392)
                     /gene="IRS4"
                     /locus_tag="PVL30_003641"
                     /old_locus_tag="LELG_02797"
                     /product="Increased rDNA silencing protein"
                     /transcript_id="XM_001526189.1"
                     /db_xref="GeneID:5233038"
     CDS             complement(1333744..1336392)
                     /gene="IRS4"
                     /locus_tag="PVL30_003641"
                     /old_locus_tag="LELG_02797"
                     /codon_start=1
                     /transl_table=12
                     /product="Increased rDNA silencing protein"
                     /protein_id="XP_001526239.2"
                     /db_xref="GeneID:5233038"
                     /translation="MASGTAANAAALAAFNAGKKRDDGWKQNNEGNNKSSKYVCAPAV
                     KSQNNKVKPAAPAAPAALAGAVNTNTTNTTNTVTTTSASTTPKPKSNHAVHRDTTPTS
                     MVNQQYSQNNDRIMTKSPRPVLNVNTDSSKQGSYSSAASKNNHDNKGLDYFNLGSATS
                     GRSDTFKSPRYSPHTPKDMINNVKSSIEAKNIANDPSSRRLSANYSPQQMLKNLKTSL
                     NEKSKAPAPPKASENDKGRQILSDMRERLDTSRKIAADQAATRGLAPGFDFEEDGDKE
                     DKGYEDYTWNSTDRKKPVSSNRSAKSFKSFKSVKSTNSNKTVNSIAKNVVTKAGENDQ
                     LGTTESNISTPERHGICIDVTYHDSDVEDDCLKNENGNKCANGIGHENGHGTQNENNV
                     ENGIRNENQHDNESDIGDQVMVPIKLYNSDKSSISSKSKVRRKPPPSLSQEEYGSSST
                     ELLSTDLKHIMALHAKSSDTFSSGDNFNQSDDQISIAENDAGQPNVGTTAAATLVRRG
                     DTKFPQFPEIKKKHYHSRNIFGLKRHDHRNQNSVIWSDPDSDVEAEGEGLGGEAKYVR
                     GVNRKSAGEDDELEEEEEEEQDGEEEEEEEEEGNEVEENEESEFSDASAIANNFNHGN
                     TKNGVRRLGPQSRPQQAHVQQQQPQQSQQQPVQFRTTMRTTNKRKDRKSKFDEYKPWK
                     NHSDLNYLTDQERKRYEGVWVSNKGNYTNLVVVKLHGVDYSTVKDGKVNLEHIDDSMR
                     AALISTNAYPSSKQEEQESMKSNNGTGIKVNSDGSVYNSAIEVPSQANNQSRPERVEL
                     SQLILGAVVKRIWSRSGLPDETLEQIWNLVDFRRDGTLTKNEFIVGMWLVDQCLYGRK
                     LPKKVESIVWESLGGIGVNINTKKMR"
     gene            complement(<1336980..>1338437)
                     /gene="nob1"
                     /locus_tag="PVL30_003642"
                     /old_locus_tag="LELG_02798"
                     /db_xref="GeneID:5232902"
     mRNA            complement(<1336980..>1338437)
                     /gene="nob1"
                     /locus_tag="PVL30_003642"
                     /old_locus_tag="LELG_02798"
                     /product="20S-pre-rRNA D-site endonuclease nob1"
                     /transcript_id="XM_001526190.1"
                     /db_xref="GeneID:5232902"
     CDS             complement(1336980..1338437)
                     /gene="nob1"
                     /locus_tag="PVL30_003642"
                     /old_locus_tag="LELG_02798"
                     /note="BUSCO:EOG092620U5"
                     /codon_start=1
                     /transl_table=12
                     /product="20S-pre-rRNA D-site endonuclease nob1"
                     /protein_id="XP_001526240.2"
                     /db_xref="GeneID:5232902"
                     /db_xref="PFAM:PF08772"
                     /db_xref="PFAM:PF17146"
                     /translation="MHSTKHVETVILDAGPLITQPASSLQQFANSFYTTPGVHSELKD
                     DYVRQQLVLWGDSLKIKQPKQEYIDKVIKFAKLTGDYSVLSVNDLHIIALAYELEIES
                     GGKLRSFPGEILESPKPDFAVQNNAANLTDSDGFAVVKKKGRKRGGKRQREKREAEMK
                     RLQEEKETAQNGTDDGDERNVSAQIASKHPENLVDKDQDVPTVHDASKDLAKKSTQES
                     TQKPVQEPVQDNTRKVEENPPFVEEEYNDSDDDGEWITPENVQEEMLKDQNEQIQDSG
                     SNSHLVKVALATGDFACQNVAMQLGINLLNTMSGKQIKRVRNYMYRCHACFRLTPINK
                     DGRPKHFCPKCGGDTLIRCAVSVDNKTGKITPHLKANFQWIKRGEKYSLPSPLSKNQQ
                     RLQGKGGYQHNKQNRHKTQQAPLILREDQKEYAQALKNDDWERRQNEKLLQDWIGGGS
                     ADNYVSPFGTVNTIRPSGVRVGKGRYVNSSRGKKK"
     gene            <1339301..>1340059
                     /locus_tag="PVL30_003643"
                     /old_locus_tag="LELG_02799"
                     /db_xref="GeneID:5233352"
     mRNA            <1339301..>1340059
                     /locus_tag="PVL30_003643"
                     /old_locus_tag="LELG_02799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526191.1"
                     /db_xref="GeneID:5233352"
     CDS             1339301..1340059
                     /locus_tag="PVL30_003643"
                     /old_locus_tag="LELG_02799"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526241.1"
                     /db_xref="GeneID:5233352"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13409"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MVQQDRIVLHWLDQSRSQRVVWLLEELGVEYEIVYYKRDSNHRA
                     PPELNNVHPLGKSPVLEIFQPNGETVKLAESGWIFQYLINKYDTANKLKGTNETESNQ
                     INYFLHYSEGTLQPLLVGLLINHLARTRPMLPIRMLMGPCVGGINNSYYKPELLKNVK
                     YLNDIVKQQYNKHSKYLVGGQLSAADIILSFPIQSAINRGEMLINQSLENEYPELNEY
                     YQHIIKQPGWKAAVQKVKDFEKVLGDKQQPNQVD"
     gene            complement(<1340434..>1341263)
                     /gene="GTT1_1"
                     /locus_tag="PVL30_003644"
                     /old_locus_tag="LELG_02800"
                     /db_xref="GeneID:5233135"
     mRNA            complement(join(<1340434..1341151,1341229..>1341263))
                     /gene="GTT1_1"
                     /locus_tag="PVL30_003644"
                     /old_locus_tag="LELG_02800"
                     /product="bifunctional glutathione transferase/peroxidase"
                     /transcript_id="XM_001526192.2"
                     /db_xref="GeneID:5233135"
     CDS             complement(join(1340434..1341151,1341229..1341263))
                     /gene="GTT1_1"
                     /locus_tag="PVL30_003644"
                     /old_locus_tag="LELG_02800"
                     /codon_start=1
                     /transl_table=12
                     /product="bifunctional glutathione transferase/peroxidase"
                     /protein_id="XP_001526242.2"
                     /db_xref="GeneID:5233135"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13409"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MSTESDKIILHWLDYSRSQRIVWLLEELNLPFELKTYAREKDFR
                     APKSLEKIHPLGKSPVIEIVKPNGDRQVIAETGHIINHILQYYDPNHILTPEEPLERD
                     EVDYFLHYSEGTLQPNLVALLVHSFAKKQAPFGTRTLMGLLVKGIDDQFYFPETKKNL
                     DFLDAILAKQKQSGSKYFVGKKLTGADIILSFPLLTNIFGSKESAQKMGFGNIDKLWP
                     NISAWAENISKEPKFIKANDLVASFEVSKPNI"
     gene            <1343297..>1344254
                     /gene="GTT1_2"
                     /locus_tag="PVL30_003645"
                     /old_locus_tag="LELG_02801"
                     /db_xref="GeneID:5233197"
     mRNA            join(<1343297..1343349,1343492..>1344254)
                     /gene="GTT1_2"
                     /locus_tag="PVL30_003645"
                     /old_locus_tag="LELG_02801"
                     /product="bifunctional glutathione transferase/peroxidase"
                     /transcript_id="XM_001526193.2"
                     /db_xref="GeneID:5233197"
     CDS             join(1343297..1343349,1343492..1344254)
                     /gene="GTT1_2"
                     /locus_tag="PVL30_003645"
                     /old_locus_tag="LELG_02801"
                     /codon_start=1
                     /transl_table=12
                     /product="bifunctional glutathione transferase/peroxidase"
                     /protein_id="XP_001526243.2"
                     /db_xref="GeneID:5233197"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MPMLQEQKVPEDRFILHWLDDSRAQRILWLLEILELDYEVRIYL
                     RHPQTWRGPTQLFDAHPLGRAPILEIIHGDGRPPMKLAESGFIMSYILKNYDPNYILT
                     PTDPNEQLEVEYWLHYSEGSLQHLQMALLINSVAKHIAPVGLKSVANLVAKGLNNGYY
                     VHEWRLHMQYCNDRLEQNGTGFFVGNKLTAADIMLSFPIYENIFDNLEGVKDCTRDKR
                     DLRKVWPFLDKWCRMIKNIPSYKKVNQMMDEEVEDLIALNPRFDYAKGEANKP"
     gene            <1345191..>1346570
                     /locus_tag="PVL30_003646"
                     /old_locus_tag="LELG_02802"
                     /db_xref="GeneID:5233017"
     mRNA            <1345191..>1346570
                     /locus_tag="PVL30_003646"
                     /old_locus_tag="LELG_02802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526194.1"
                     /db_xref="GeneID:5233017"
     CDS             1345191..1346570
                     /locus_tag="PVL30_003646"
                     /old_locus_tag="LELG_02802"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526244.1"
                     /db_xref="GeneID:5233017"
                     /db_xref="PFAM:PF02668"
                     /translation="MAPTSIVKNPEETQTQAEAQAQAKAKAPLKGNINKKDTTATNFT
                     LQEDEVNELIQKLASIKPIGWAQAKTVASTGYDTEWVNKLPATAKERYTKHGVDISKG
                     YPYIPTIDKIPKFVDEAFAIRNEEYPFIERGKNADPEKKALFGAAKDVINLTPYVGTE
                     IVGLQLADLDDKQKDELALLIAERVVVFFKDQDLSPKKQLELGKYWGQVEVHPQVPRV
                     GPDYDGITVIWQDYQNQRNGIGLSFQNSKKGNSTWHSDLVHEFQTAGITHLHIDSIPD
                     VGGDTIWSSTYGAYDKLSPAFKEFLDGKTAIYKSAHLYLNRENPLKGPKHVEREHPIV
                     RTHPATGWKYLFVNRAMTDRIVGLLPEESDAILNYLFSVIENNRDIQVTFKWQQKLPG
                     LKSPSDAHKTYRGTSALWDNRIANHNVIHTNESIKGRHGTRVTSLADTGYFDPESKSQ
                     REALGLSLN"
     gene            <1346879..>1348692
                     /locus_tag="PVL30_003647"
                     /old_locus_tag="LELG_02803"
                     /db_xref="GeneID:5233492"
     mRNA            join(<1346879..1346884,1347349..>1348692)
                     /locus_tag="PVL30_003647"
                     /old_locus_tag="LELG_02803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526195.2"
                     /db_xref="GeneID:5233492"
     CDS             join(1346879..1346884,1347349..1348692)
                     /locus_tag="PVL30_003647"
                     /old_locus_tag="LELG_02803"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526245.2"
                     /db_xref="GeneID:5233492"
                     /db_xref="PFAM:PF02668"
                     /translation="MQIKANNSEIKRMAPTSIIDETKASVQQLPLDKKLDEQEVQNLI
                     QKLASIGPVGSAQHNTKGRTGYDTEWVNKIPETTRQRYEKYGIDVSKGYPYIPTIDKI
                     PKFVDEAFAIRNEEYPFIERGKNADPEKKALFGAAKDVINLTPYVGTEIVGLQLADLD
                     DKQKDELALLIAERVVVFFKDQDLSPKKQLELGKYWGQVEVHPQANRIGPDYDGITVI
                     WQDYFNEKGGLGLSFQRSRQGTSRWHGDLSHEFQTAGITHLHQDSIPDAGGETIWSST
                     YGAYDKLSPAFKEFLDGKTAIFKSAHVYLSRENPLKGPKHVEREHPIVRTHPATGWKY
                     LFVNRSYTTRIVGLLPEESDAILNYLFSVIENNRDIQVTFSWQQKLPGLKSPSDAHKT
                     YRGTSALWDNRIANHNVIHTNESIKGRHGTRVASLADAGYFDPDSKSQREALGLSLD"
     gene            <1349455..>1351209
                     /gene="DPL1"
                     /locus_tag="PVL30_003648"
                     /old_locus_tag="LELG_02804"
                     /db_xref="GeneID:5232909"
     mRNA            <1349455..>1351209
                     /gene="DPL1"
                     /locus_tag="PVL30_003648"
                     /old_locus_tag="LELG_02804"
                     /product="Dihydrosphingosine phosphate lyase"
                     /transcript_id="XM_001526196.1"
                     /db_xref="GeneID:5232909"
     CDS             1349455..1351209
                     /gene="DPL1"
                     /locus_tag="PVL30_003648"
                     /old_locus_tag="LELG_02804"
                     /codon_start=1
                     /transl_table=12
                     /product="Dihydrosphingosine phosphate lyase"
                     /protein_id="XP_001526246.2"
                     /db_xref="GeneID:5232909"
                     /db_xref="PFAM:PF00282"
                     /translation="MPPVEITFAWPTSLNEIPESLIKLHHQVELYILINYYASNDLLW
                     GSIFLIRDLTFIYIVYSYFTRTLRRVRGYGPVGSLKRLYTKTSVAISSRVMSLPFIRN
                     KIDKELNSTIKMIEKELMKNSDDLQQFKELPLHGLSHDDVSSELVKLQDLKHSDWTNG
                     RVSGAVYHGGDTLLKLQSEAYHQYSVANQLHPDVFPGVRKMEAEVVAMVLEIFNAPDG
                     ACGSTTSGGTESLLLTGLAAREYGRKYKGIVKPEVIAPVTIHAGIEKACYYFGMKLHK
                     VDLDPKTFQVNLSKVRKLINKNTVLLCGSAPNYPHGIIDDIEGLSKLAVKYKIPLHVD
                     ACLGSFIVSFLESSKVHGDKKLPLFDFRLPGVTSISCDTHKYGFAPKGSSIIMYRSPK
                     LRECQYYISSDWTGGMYGSPTLAGSRPGALMVGCWATLVNIGKDGYRQSCFDIVSTML
                     KVKKAIEKDSTLSEYLEIIGNPIGSVVSFKVKTSKKKELSIYELGDLLTKKGWHFATL
                     QNPAALHFAFTRLTTPVVDELIDDLVGCTKEAIELTKKTGKKQSDTAALYGIAGSVHT
                     AGLADKIIVAFLDTLYKT"
     gene            <1351861..>1352796
                     /locus_tag="PVL30_003649"
                     /old_locus_tag="LELG_02805"
                     /db_xref="GeneID:5233014"
     mRNA            <1351861..>1352796
                     /locus_tag="PVL30_003649"
                     /old_locus_tag="LELG_02805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526197.1"
                     /db_xref="GeneID:5233014"
     CDS             1351861..1352796
                     /locus_tag="PVL30_003649"
                     /old_locus_tag="LELG_02805"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526247.2"
                     /db_xref="GeneID:5233014"
                     /db_xref="PFAM:PF04193"
                     /translation="MRDSCLGWISHVSSSFSFISGLSWVFAQLPQIVTNYKLKSADGI
                     SPSFLLLWFLGDFLSFTSCLLNDATLNFQLYLSIFFLCNDITLCFQYYYYNSVYPRTT
                     AFESYTPVDISPQPVVIHKDSDEHGEEREIRQLHEQSSSDESAPSSYNSTDENKSIMK
                     NLAGTIAVHAGRANAFANDAMLDKAQSYTLKDSVGLALAWGCTIVYCASRCPQLYKNY
                     KRKSVDGISPLLFGAALLGNLTYTLSILTSCSFIFGDDRSEFFYKELPYILGSSGTIL
                     FDLAYFYQKRLYNNSKKQTNTFRLQPWSDIESNSA"
     gene            <1353277..>1355504
                     /locus_tag="PVL30_003650"
                     /old_locus_tag="LELG_02806"
                     /db_xref="GeneID:5233072"
     mRNA            join(<1353277..1353305,1353362..>1355504)
                     /locus_tag="PVL30_003650"
                     /old_locus_tag="LELG_02806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119496.1"
                     /db_xref="GeneID:5233072"
     CDS             join(1353277..1353305,1353362..1355504)
                     /locus_tag="PVL30_003650"
                     /old_locus_tag="LELG_02806"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975479.1"
                     /db_xref="GeneID:5233072"
                     /translation="MQHLARPNLIFANSTSPLEQLKRSKQPKLEEKINRTMLKHGKKK
                     VARGEHYLTVSQDTYPHPFTTMGKEEVSSLTYKELLYLNTFQFQSVEERKKVCNSLAS
                     FIGDELLANTKLASRIYTSVQKDDMKLEITSQLLDRFAKDSFSTSIIQFMAQSTHSDT
                     RELFCKNIKAIVEEKSTVLSNTDAKSRYLMSYLYKLAQTQVINEKTIYIGNDLFSKIL
                     QLVPSSQYGDLYSYMVHINVRPQNSELIDKLRKILLKGTERSRFIARTGFLHPVWHDL
                     NKTSFSELHSARVIEHFDMKEFLRNTFSFVNRKEHTLSIWSLKCMEAKFEKLCAAETS
                     NRMMRQHLSYMLVTAFHVVTELKDVKSGLPILQYMTTNNIGVTFSRYHTILRKLRRSS
                     LYDEFSTVLNGMDLKSLTREEKLIVAEEILRLIKRRYPTSPKVLLGYVGAMFGKCESG
                     TTLDVLNEMGLLSWPYEKTHYSKISSTNVVELANVDEALGGLDLNCTTLGHLYEVVFR
                     SLKEHTGYQLDASILMKYYLLFEKCLTNHPQINFSDRPITVFIDHLIRAQDPLSESYK
                     ISKLNYNCVKRVFEFYSNFSINLKSEHIDCRNFEKLIETAIFQFSDLSFATKVIQYSS
                     SKGKLSFKQIYPFVSYYFENGNMEETKKWFQILNDGGYSATSRHIKSLIHISQSLGTE
                     SVFGQHYKSSHFSKKRANRRLLETFELQSVPVSFAEEPDIE"
     gene            <1355971..>1358868
                     /gene="ASE1"
                     /locus_tag="PVL30_003651"
                     /old_locus_tag="LELG_02807"
                     /db_xref="GeneID:5233295"
     mRNA            <1355971..>1358868
                     /gene="ASE1"
                     /locus_tag="PVL30_003651"
                     /old_locus_tag="LELG_02807"
                     /product="Microtubule bundling protein"
                     /transcript_id="XM_001526199.1"
                     /db_xref="GeneID:5233295"
     CDS             1355971..1358868
                     /gene="ASE1"
                     /locus_tag="PVL30_003651"
                     /old_locus_tag="LELG_02807"
                     /note="BUSCO:EOG092628LW"
                     /codon_start=1
                     /transl_table=12
                     /product="Microtubule bundling protein"
                     /protein_id="XP_001526249.2"
                     /db_xref="GeneID:5233295"
                     /db_xref="PFAM:PF03999"
                     /translation="MESNLHNHISFIQSAIKPTTTAGLDTFTKSQMEFEHSLHSTPKQ
                     SVSDIDNNIKTKSSRNHYESRHTPIKQHDPSSFQKQASSPTFISEHEMPTDDDLMHNL
                     GAIESNVSEALNELSSTYKTIGYSSREIASKKTEIFTAIHTTINNFAESLQREQTTIE
                     NECEWLRQQILIILAMINDQKGDKSLNLLQRGLVFANEEQYSDGYKQDILTKLSNSNY
                     FLPVSKEEKGHDDGQELTIEQQYDYMTQNIPKLTLIEQRSQLNDVFIAVLKLFVAKFK
                     KFNALNMEYANYTDIMGDGELELMGDMHDSIPSKRDAEMHYSVITEFEEQVKIAMPAK
                     SATGPSSANLFILASPHKSHHLQQHQQQQQQQSSAHEDSLEIDNSRIDRLRELNYQLV
                     RIIRSLKITKISNELMLNLKEHTETIRELIEQRKALMQSLAQTSLDCLNLLQLSDDQF
                     VGLQKSHISSPLPSHLPITVQGLRSITKNPQSYGMHTDQVRYLEKIEDFLKEKLDHRQ
                     KQWTMYSEKCSRLWEKLGETQEYIDEFIQRNNSLSEYAMRNFALELNRLMIQRSEYIE
                     TFITDARKEIDQLWDKMFYSQEMRMEFQFYSYDADLDDTDKETVLNCHEEEIVKLKQE
                     YDSKASVFKLYNELGDLIKDQKFLQESSKNSSRLLDKNSCKILLNEEKLRKKINKNMP
                     TVIASLKQAISSYNRSASLNGSKPLMMNGKDFFEEILLIESEQQRSGVRMRPRTSASP
                     QKRVSSARNSPEKRNNSNQFRVPSNTRLRINKSPVYSRPPSYSQTKLQNLNQNQNQNQ
                     NQNQNQRRSPSNDKNHISISNQNQNQNQNQSTTQSRASSGATTRHFSNPLKNSIINSS
                     SITMSLSPEKSSRSNSQFGSPPIKDIGQPLRSPLKIRDLNSKPPGLKPDYSPGLKSET
                     TLHFQPTTIQSHFFEQNQSNVTSSNVNDSSTLIGDDYNNWREEKIRELREM"
     gene            complement(<1359083..>1360765)
                     /gene="SIS2"
                     /locus_tag="PVL30_003652"
                     /old_locus_tag="LELG_02808"
                     /db_xref="GeneID:5233376"
     mRNA            complement(<1359083..>1360765)
                     /gene="SIS2"
                     /locus_tag="PVL30_003652"
                     /old_locus_tag="LELG_02808"
                     /product="Protein phosphatase 1 negative regulatory
                     subunit"
                     /transcript_id="XM_001526200.1"
                     /db_xref="GeneID:5233376"
     CDS             complement(1359083..1360765)
                     /gene="SIS2"
                     /locus_tag="PVL30_003652"
                     /old_locus_tag="LELG_02808"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein phosphatase 1 negative regulatory
                     subunit"
                     /protein_id="XP_001526250.2"
                     /db_xref="GeneID:5233376"
                     /db_xref="PFAM:PF02441"
                     /translation="MTSEVALKEKKLQLQAKSDDAEMPPSILAKNTTPQTSSSTNHPG
                     KSSANASAQSLPLSTFSNEGAPSVDANRKDVVMAGGAYLKDRLNSDSLIQKLNSLEKP
                     PSSLLATATTKNNSTSSIDYTVNPPAEPQHHKSPSVHAHFFVDETLRPNKLGNRSRSG
                     SGSSSGINAHSLVFSRDGSKSQESIKEGVNGIPSSTTTATAGTASHLLAPPASATAVD
                     PTSTNKQPSNANQNAEQNANIDPRLPQDDGKIHVLLGVCGALSTGKIKLIISKLFEIY
                     TQDKITIQLIMTKSSENFLFQESLNVLENKGVRIWRDSDEWTTWKARSDPVLHIELRR
                     WADILVICPLTANTLSKISTGLCDNLLTNVIRAWNTSYPILLAPAMGSYSYNAITTKR
                     QLRLIAEEMPWIEVLKPSEKVFGSYGDIGMGGMMDWNEVVNRIVMKLGGYPEEEDDDD
                     DDEEEEEDDERCIDDEKTGLKKDKNSAIVDDDDDEDEDEDDDEDDEDDEDEDEDEDED
                     EDEDEDEDDDGDDDDNDGYIDNKSGEINKDNYHGAKETLRIKVEKGIKDLDL"
     gene            complement(<1361613..>1364036)
                     /locus_tag="PVL30_003653"
                     /old_locus_tag="LELG_02809"
                     /db_xref="GeneID:5233547"
     mRNA            complement(<1361613..>1364036)
                     /locus_tag="PVL30_003653"
                     /old_locus_tag="LELG_02809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526201.1"
                     /db_xref="GeneID:5233547"
     CDS             complement(1361613..1364036)
                     /locus_tag="PVL30_003653"
                     /old_locus_tag="LELG_02809"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526251.2"
                     /db_xref="GeneID:5233547"
                     /translation="MGEPQTEENPELSASLGNKLDGKVELSNEQQNTKTSDMYKSSNF
                     SVEKRGEVREETGADTEEGIEQKTEKGVGKEETGDDYDEDAAIQLQNAKPSSSRLLDK
                     HTSSLSPGNSRITPKPYMIRIANIANGVSEVVLNDFLQSHIDNSTFKIVKLSKNEPWW
                     AVVKVENLRLCNILIEKLDQSFYKGQKLALEMENGIEEKSINGRRQSANHTLQFNKSF
                     VPAQTPQRGISHTESGFAQRNFSSTTSSSTSSSTSSSLSHALGVRSRRSNTSLASSRA
                     DSVFSHRSNARGSSASSLGTHDSLSQKQPVPSFIMNMVQNRQFSRDVGAKESKTETKT
                     ESKTETELEATQPEQSHSESLQFQSNHKGKQSHEATPDTIQVEVGEGKNPEQLINVNP
                     TRLFIGNVPYTSNWASLKKFLSERASEIEPGNSISILRVEIPIQQVSVDGSFLMYRHM
                     GPQILTKSRGFAIVTTKDQHSSEKIIKYFDNVEFEGRQLTVRYDRFPHYSNYALQQIK
                     PAHLSLQPHSLPVPVSNASGFQSTISGSRNIMPLAPQGPYNHAPLVTNAPQMFANEYM
                     PQVSPSIYAQQQQQRQQSQQQQQQQQQQQQQQQQQLQQPHPSNSSLLSNLAFERNSLQ
                     QKIYYGRGPRTHPKSIPQNYQISQSPQMPQTSQGAQNALASQGSQVPQPFIPQSQVPF
                     QATQFATPANTNSFNGPGYYPIPFFYHPSASGIAYATYQPPPALLPHHAYPAPPTSYP
                     MKNFKQPIAVAQPASSSNFEEENYSPPPMAPEGSEKLEQSLNEADRAHELFQDLSLDH
                     DKSQQPTRL"
     gene            <1368658..>1370757
                     /locus_tag="PVL30_003654"
                     /old_locus_tag="LELG_02810"
                     /db_xref="GeneID:5233554"
     mRNA            <1368658..>1370757
                     /locus_tag="PVL30_003654"
                     /old_locus_tag="LELG_02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526202.1"
                     /db_xref="GeneID:5233554"
     CDS             1368658..1370757
                     /locus_tag="PVL30_003654"
                     /old_locus_tag="LELG_02810"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526252.2"
                     /db_xref="GeneID:5233554"
                     /db_xref="PFAM:PF00172"
                     /translation="MPRRRLDSSIRRSRTRSGCITCRDRHIKCDEQQPICKNCLRSNR
                     ECLKGTRLNFRQYIFHDPEEDPTTSRYLKMLELKSKSKSESGSESKSKSGSGSESKSR
                     PSSSSSSQSYRILDHSITVAALYDHVSRYQQYLPLHSLDDLKESDMNFHDDGFGAFNQ
                     PYTKLEKDAEIEATTEEEEEETAAAAEVEKEMTIGMYAADINMLETSNTSYMRSCSTS
                     NYFAIQQMSQAHGLPSDQPVYSNMAGHINAGFPTMPTSFEKINHDARLYNATHPQNQM
                     VPLPQHSQPQVQQPQPQVQQLLLSSVPDFYSTQQSPSQLPPSPPPLLQPPPLPPPSHS
                     LWFLDLTNDAEIWSTIIPRLCRQSSDTFLPDCLQAACSPSIDIKYLSLTTRQFKRWSL
                     IESALVNQQNITMFETLLISICLILYTIYTKNEKYKLNDLQQMILNSESKLFESILEK
                     ITSFLVSVETPASAIIVSSIQSITILRFFINKFQDLTFNKRDQKQRKKMKKKIDLETI
                     DKQGVEAGLATTTEPGGVDLSHFLKLNPYEIGFLNSSYRGIDRNSFARVSGSQPTSRQ
                     PSLNPTFTLPESQKISSLLWYLIKLDYITNNPLEANNFIFRETYQFENMFEIDAQPWP
                     LADKSKLARIVLEKFTMKLLNIRNDNLVSNMNWGLNNIFASINQSTTWSATTKSQWSN
                     YFEWTIRYVNPPEPRAK"
     gene            <1371242..>1372735
                     /gene="TEF4_1"
                     /locus_tag="PVL30_003655"
                     /old_locus_tag="LELG_02811"
                     /db_xref="GeneID:5232964"
     mRNA            join(<1371242..1371440,1371687..>1372735)
                     /gene="TEF4_1"
                     /locus_tag="PVL30_003655"
                     /old_locus_tag="LELG_02811"
                     /product="elongation factor EF-1 gamma subunit"
                     /transcript_id="XM_001526203.1"
                     /db_xref="GeneID:5232964"
     CDS             join(1371242..1371440,1371687..1372735)
                     /gene="TEF4_1"
                     /locus_tag="PVL30_003655"
                     /old_locus_tag="LELG_02811"
                     /codon_start=1
                     /transl_table=12
                     /product="elongation factor EF-1 gamma subunit"
                     /protein_id="XP_001526253.1"
                     /db_xref="GeneID:5232964"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF00647"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13410"
                     /db_xref="PFAM:PF14497"
                     /translation="MSQGTLYITQQIRSLAPKALIKHFNLDVKLADKDATFEKYFPLN
                     KIPAFVGPKGFRLTEVIAICIYLINLADAESPLLGKNAAAYAQVLRWLSFANSELLPK
                     EASAFRPLTGADPYNRKQVEESLAYLKKVNGVFEERLSNFTYLVGERITLADIFAATV
                     YVRGFEYLYGEQWRKEYPSITRWFKTLIASPYLKEFVGDFKFIEKPVEYTPPKKEKKE
                     KAAQAPAAKKEASAPKAAAAAAASEPAEPAPAPKPKHPLEALGKPKAALDEWKRVYSN
                     EETRETAIPWFWKNQYDPEEWSLWKVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYM
                     FGCMVVYGENNNNGITGAFLVRGQDYVPAFDVAPDWESYEFTKLDGSKEEVQKFVNNM
                     LAWDEPVEVNGEKREIADGKVFK"
     gene            <1375027..>1375260
                     /locus_tag="PVL30_003656"
                     /db_xref="GeneID:85890377"
     mRNA            <1375027..>1375260
                     /locus_tag="PVL30_003656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119497.1"
                     /db_xref="GeneID:85890377"
     CDS             1375027..1375260
                     /locus_tag="PVL30_003656"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975480.1"
                     /db_xref="GeneID:85890377"
                     /translation="MSNPENTKPTENKVQPDKPYTHVPTPDRADLRQTLHSNSTIEDE
                     DTSSIGDNVKSIVQELVKPSRADVTLKKPVTIN"
     gene            <1375294..>1376202
                     /locus_tag="PVL30_003657"
                     /old_locus_tag="LELG_02812"
                     /db_xref="GeneID:5233451"
     mRNA            <1375294..>1376202
                     /locus_tag="PVL30_003657"
                     /old_locus_tag="LELG_02812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526204.1"
                     /db_xref="GeneID:5233451"
     CDS             1375294..1376202
                     /locus_tag="PVL30_003657"
                     /old_locus_tag="LELG_02812"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526254.2"
                     /db_xref="GeneID:5233451"
                     /translation="MTRIEQSLSNLTTMLTGISKGFQTHSSEPENKSRMSEQPVQSTP
                     TMGSNLCNSPARTIPLYNESLDIQGGLQPSTIYDRTSYTSQSRPDGIMVKGYEETCEY
                     INEIRRRFIDDSKVEEIPYIMHPNSAVEKTFMAYYNALAANLNRTPSDELALKRYNVR
                     KFPPMRVKDIDGFHYWLRSMVWYKHTYFIPDYLIRDTIIATAKEVDDPTLTRTVQTSC
                     KKIDKALYSPIKYNLIFKDWRKSNNDEKPTDIIREVDEIFKLNIHPQSVMVNVQGEIE
                     NYLESNHVNALPVVDGSEYPRCYMRD"
     gene            <1376232..>1376690
                     /locus_tag="PVL30_003658"
                     /old_locus_tag="LELG_02813"
                     /db_xref="GeneID:5233085"
     mRNA            <1376232..>1376690
                     /locus_tag="PVL30_003658"
                     /old_locus_tag="LELG_02813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526205.2"
                     /db_xref="GeneID:5233085"
     CDS             1376232..1376690
                     /locus_tag="PVL30_003658"
                     /old_locus_tag="LELG_02813"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526255.2"
                     /db_xref="GeneID:5233085"
                     /translation="MSPDIKVVKVNEKGLNYEITLNGFEIRHHLYSLKMGSLKQLLDV
                     EGEVPYNDIWDAVITTYDDNMSRIHVVESTLKMKQTKGDLCQVCGKIGHELAKCYRAK
                     EAEKRGTILMKNRRVFTPDGTELIISGKETMMRKYPDLFTSAEGRHSYKE"
     gene            <1378172..>1379305
                     /gene="MNN9"
                     /locus_tag="PVL30_003659"
                     /old_locus_tag="LELG_02814"
                     /db_xref="GeneID:5233411"
     mRNA            <1378172..>1379305
                     /gene="MNN9"
                     /locus_tag="PVL30_003659"
                     /old_locus_tag="LELG_02814"
                     /product="Golgi mannosyltransferase complex subunit"
                     /transcript_id="XM_001526206.2"
                     /db_xref="GeneID:5233411"
     CDS             1378172..1379305
                     /gene="MNN9"
                     /locus_tag="PVL30_003659"
                     /old_locus_tag="LELG_02814"
                     /note="CAZy:GT62"
                     /codon_start=1
                     /transl_table=12
                     /product="Golgi mannosyltransferase complex subunit"
                     /protein_id="XP_001526256.2"
                     /db_xref="GeneID:5233411"
                     /db_xref="PFAM:PF03452"
                     /translation="MVYYRNPYINYIRRKPLALLAPLTLLVIIYLFFFSSSSSTGSGS
                     ALTKGQNKYSYTKKTKGWFNSNPNKDSVIIKDLPKNRISHHDLNKLTTSPDALAKREE
                     LLILTPMSKFLPEFWQNLNKLTYDHSLVSLGFIFPRTEEGDVALKGVEHALKEAKAKG
                     TLNWKKVTLLRQDSGSLESQLEKDRHAFNVQKERRSMMAIARNSLLFTTISTKTSWVL
                     WLDSDIVETPPTLVQDMTAHNKPVLSANVYQRYYDEDLKKNSIRPYDFNNWIESEEGL
                     KIANEMADDEIIVEGYAEIATYRPLMAHFYDAKGDANTEMALDGVGGGAVLVKADVHR
                     DGAMFPSFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVFHHNE"
     gene            <1379782..>1381734
                     /gene="NOG1"
                     /locus_tag="PVL30_003660"
                     /old_locus_tag="LELG_02815"
                     /db_xref="GeneID:5232968"
     mRNA            <1379782..>1381734
                     /gene="NOG1"
                     /locus_tag="PVL30_003660"
                     /old_locus_tag="LELG_02815"
                     /product="Nucleolar GTP-binding protein 1"
                     /transcript_id="XM_001526207.1"
                     /db_xref="GeneID:5232968"
     CDS             1379782..1381734
                     /gene="NOG1"
                     /locus_tag="PVL30_003660"
                     /old_locus_tag="LELG_02815"
                     /note="BUSCO:EOG092619NK"
                     /codon_start=1
                     /transl_table=12
                     /product="Nucleolar GTP-binding protein 1"
                     /protein_id="XP_001526257.1"
                     /db_xref="GeneID:5232968"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF02421"
                     /db_xref="PFAM:PF06858"
                     /db_xref="PFAM:PF08155"
                     /db_xref="PFAM:PF17835"
                     /translation="MQLSWKDIPPVPTSNDMLDIILNRTQRKTPTVIRPGFKITRIRA
                     FYMRKVKFTAEGFVEKFNDLLSGFPNINDVHPFHRDLMDTLYEKNHYKVSLAAVSRAK
                     TLIEQVARDYNRLLKFGQSLYQCKQLKRAALGRMATITKKLKDPFVYLEQVRQHLGRL
                     PSIDPNTRTLVICGYPNVGKSSFLKSITKADVEVQPYAFTTKSLYVGHFDYKYLRFQA
                     IDTPGILDRPTEEMNNIEMQSIYAIAHLRSCVLYFMDLSEQCGFSIEAQVKLFHSIKP
                     LFANKSVLIVMNKSDIIKIEDLDKANQELLETLKVVPGVEIMQTSCYEEDGVMQVRNH
                     ACEKLLTARIEQKLKGTARVNNVLNKIHVARPQQRDDVERLPFIPEGAKDLLNYDAED
                     PNRRKLARDYEAENGGAGVFNINLKDKYILDEEEWKQDTMPEFLNGKNVYDYLDPDIA
                     AKLQALEEEEERLEQEGFYDSDDGEDEDNMEDAEDIADIRAKAQWIRNKQKTMIIEGR
                     NRKSLKNKAIMPRDQIKKSIGDMEEHMYNIGHDTEKLRETINKKRKADGDSGKMSGVD
                     VLRRDQGIKARKLTKKKHALTQSDRLNDGVSDGAMRSQAERLAKIQRRERNRMARQGE
                     GDRHSTAALPKHLFSGKRGIGSNDRR"
     gene            <1383839..>1385752
                     /locus_tag="PVL30_003661"
                     /old_locus_tag="LELG_02817"
                     /db_xref="GeneID:5233463"
     mRNA            join(<1383839..1385151,1385182..>1385752)
                     /locus_tag="PVL30_003661"
                     /old_locus_tag="LELG_02817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526209.2"
                     /db_xref="GeneID:5233463"
     CDS             join(1383839..1385151,1385182..1385752)
                     /locus_tag="PVL30_003661"
                     /old_locus_tag="LELG_02817"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526259.2"
                     /db_xref="GeneID:5233463"
                     /db_xref="PFAM:PF00642"
                     /db_xref="PFAM:PF14608"
                     /db_xref="PFAM:PF18044"
                     /translation="MSAQPEQYYSNNIKSSIGNNLHSSGPPMSPYAPLVGSGINSSVN
                     NDTKSHQATRSSTSSIHAIQAFEFGELSKHLPPNTGPPGTVPVTNGSSSTNNKNLSHV
                     PCKFFRQGTCQAGDSCPFSHNIEGSLSAEKIPCKYFLRGNCKFGMKCALAHYLPDGTI
                     VNAKNLAQKGSSNGNGGSNVTLGQNHYHNHNQNQNQNQNQNQNQNTNQNTNHNTNSNS
                     YNYTITNGQNHDYRRYSSGNDQYYQADSISSSPSYLNEHFHYSNENGFHSQSLMGTGS
                     SIGIVSSTPSQESQNPNKNFPASVFSNHQSKLTSQSQAPQSLDSIQGRQGLLRSNSMV
                     KNGHSRSSSMQFEPHSHFLSSSLEHNKQWQYHTPAPLQSSPFQMPIKSASYQRYPTTS
                     ATHGFFDNDNSTHAVKSQFVKLPETCEANESVFGPEDIGHTAELDGEEQQQQQQQQQQ
                     QQQQQEQVNWGIPYQTPVSVKNVHNLESQPAWVHASADSRISFDIGQATPYDMTTILN
                     TGDSSLLDGTHDVARPVLGQNHDFQNIEEDEAVSSYENKSDSDCSVFDEDFLPSSLAD
                     EILTPQQSKRRSSRSQSGTLSLRPNIKEEAIHRLTIKDHTTISGKEDGKYLVQQEDLF
                     FMD"
     gene            complement(<1386223..>1387017)
                     /locus_tag="PVL30_003662"
                     /old_locus_tag="LELG_02818"
                     /db_xref="GeneID:5233501"
     mRNA            complement(<1386223..>1387017)
                     /locus_tag="PVL30_003662"
                     /old_locus_tag="LELG_02818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526210.2"
                     /db_xref="GeneID:5233501"
     CDS             complement(1386223..1387017)
                     /locus_tag="PVL30_003662"
                     /old_locus_tag="LELG_02818"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526260.2"
                     /db_xref="GeneID:5233501"
                     /db_xref="PFAM:PF07961"
                     /translation="MSISQVPISVIGVMSDHYIPPKLTSVSITRWPRVLLNRFLLFGF
                     NTYNILKFKREINKPLQFNDWKDQAIETYVRTNKVFAQACNNFTTSPSSTIYKFITSK
                     LDQSCGKHLNEVLTNRAVTFRQQPNIELSWDLVSIDKNPKVSVFTTIPDEDGIGVYVQ
                     FVMNLKTTQKLTISDKRDSGKIIQQTETKVNDYLVYTMNPWDGRILLVGKLFESDAYR
                     GLKSELDVFDTKTMGDFLNEAADIYREDPRLFTRSVEGSDKNVNKD"
     gene            <1387901..>1389550
                     /gene="ELP3"
                     /locus_tag="PVL30_003663"
                     /old_locus_tag="LELG_02819"
                     /db_xref="GeneID:5233482"
     mRNA            <1387901..>1389550
                     /gene="ELP3"
                     /locus_tag="PVL30_003663"
                     /old_locus_tag="LELG_02819"
                     /product="Elongator subunit"
                     /transcript_id="XM_001526211.1"
                     /db_xref="GeneID:5233482"
     CDS             1387901..1389550
                     /gene="ELP3"
                     /locus_tag="PVL30_003663"
                     /old_locus_tag="LELG_02819"
                     /note="BUSCO:EOG09261VI3"
                     /codon_start=1
                     /transl_table=12
                     /product="Elongator subunit"
                     /protein_id="XP_001526261.2"
                     /db_xref="GeneID:5233482"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF04055"
                     /db_xref="PFAM:PF16199"
                     /translation="MPSQTKTKQKPEKERFIQCCADISLELVASLKSSKDINLNGLII
                     RYAKKHKLKAQPRLTDIISSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPH
                     IAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRKLG
                     HSIDKVEYIIMGGTFMSLPIDYRENFITQLHNALTGFNGKNIDEAIEFSQQSQTKCVG
                     ITIETRPDYCTETHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAK
                     DAGYKVVSHMMPDLPNVGMERDLEQFKEYFENPDFRTDGLKLYPTLVIRGTGLYELWK
                     QGLYKSYNANALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARM
                     KDLGTSCRDVRTREVGIQEVHHKVVPDQVELIRRDYYANGGWETFLSYEDPKQDILIG
                     LLRLRKASKKYTYRKEFTKQQTSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEA
                     ARIAKEEHGSSKISVISGVGVRNYYAKLGYELDGPFMSKAL"
     gene            complement(<1389756..>1392059)
                     /gene="wis1"
                     /locus_tag="PVL30_003664"
                     /old_locus_tag="LELG_02820"
                     /db_xref="GeneID:5233325"
     mRNA            complement(<1389756..>1392059)
                     /gene="wis1"
                     /locus_tag="PVL30_003664"
                     /old_locus_tag="LELG_02820"
                     /product="MAP kinase kinase Wis1"
                     /transcript_id="XM_001526212.1"
                     /db_xref="GeneID:5233325"
     CDS             complement(1389756..1392059)
                     /gene="wis1"
                     /locus_tag="PVL30_003664"
                     /old_locus_tag="LELG_02820"
                     /codon_start=1
                     /transl_table=12
                     /product="MAP kinase kinase Wis1"
                     /protein_id="XP_001526262.2"
                     /db_xref="GeneID:5233325"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MSLNDSASSDAHTVDSKLSELNLNNDQQNDPHTTTNNNSANQQQ
                     NESKSDLKNSSGNAPEGLASPPTPTPRLPTSLSASNHPLLNSDMQARLMAFQQRRSKP
                     ASEPVNAFDPNLLQPPAPQSTAGSNSDSILETVVHNTTVETMAPSAAVDNAAKNSSTL
                     NTENTNTGINNDNDSSNNNNNNSNNHTANTNDYNNSTVTNSSQAPPSIAPPSLNMPDR
                     SNPVASKSKSVNNVPVAASLGKKPSLSQRRGMKLNTSAMPFNNPLGSPSNLSPGASTN
                     KPINSTGVSPREESNSPFAMSMGKQFGQNELSRRLSERKKKPNFKLNLSDSSSSTPSR
                     NNSLGKSATPLSSDTSQRSSASSADSKEEPQLQGLFANYSKYIDIKSGQLNFAGKASL
                     HSKGIDFSSGSSFRVSLEEFEYLEELGRGNYGSVSKVLHKPTKVLMAMKEVRLELDET
                     KFTQILMELDILHKCVSPYIVDFYGAFFVEGAVYMCIEYMDGGSLDQIFGNNIGIKDE
                     AVLAYITESVTRGLRELKDNHNIIHRDVKPTNILVNSAGKVKLCDFGVSGNLVASMAK
                     TNIGCQSYMAPERIKSTRPDDATYSVQSDVWSLGLTILEIACGHYPYPAETYGNIFSQ
                     LSAIVDGEPPNLDPQVFSKQAQFFVKSCLNKNPDLRPSYGALLQNPWLVEYRDKKTHL
                     DELVQNRINELKAEKKGGNKTSATGGGAASADSIGSAGNSNKNAAAIPAKAANSENVS
                     SLLKGKVRAPALHRGGLQSVNRSFLNR"
     gene            <1395316..>1401261
                     /gene="REV3"
                     /locus_tag="PVL30_003665"
                     /old_locus_tag="LELG_02821"
                     /db_xref="GeneID:5233378"
     mRNA            join(<1395316..1395321,1395811..>1401261)
                     /gene="REV3"
                     /locus_tag="PVL30_003665"
                     /old_locus_tag="LELG_02821"
                     /product="DNA polymerase zeta"
                     /transcript_id="XM_001526213.2"
                     /db_xref="GeneID:5233378"
     CDS             join(1395316..1395321,1395811..1401261)
                     /gene="REV3"
                     /locus_tag="PVL30_003665"
                     /old_locus_tag="LELG_02821"
                     /note="BUSCO:EOG092602FH"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA polymerase zeta"
                     /protein_id="XP_001526263.2"
                     /db_xref="GeneID:5233378"
                     /db_xref="PFAM:PF00136"
                     /db_xref="PFAM:PF03104"
                     /db_xref="PFAM:PF14260"
                     /translation="MWASALSINCIHVFFMNSSHNDSTYDPAHDVSSIVWSNHSASSL
                     SNLKIQINDYDTYQASPTKLDQLYTQVSQVPIIRIYGSIPISNDDVNMKSSVQNSPLK
                     KTSKNGKDLASDFITNSATNATPTTITNNITNNITNATAKIATRGSSSVFNVIVHIHN
                     FYPYFYVDCHETDYEKLQSPTYITQVINYLETMMQLSFKSRKGRKGTEEQELDDDSII
                     PEEDNDEGRAIPRAPRMRKYVAKVSICKAVPIYGFQLGYKLFYKISLLSPLYKTRLAK
                     LFQENKISLVDFDKPPQPSSHASGAAQGDKKTKKRYSYTYEVHIPFLLQFLTDFNLFG
                     CGWLFVDRDTVNDGSQTRGLYFRSPLFTETHKNVYTTSQLRCLTKYLQRYILPDNVLV
                     DSTYQNFARIGKSMLEIDITTSSIVNRRWLSARELHDDFTEREAFNDYQADIKLFGRP
                     KHGYKHELDGSPKIYLSSLKHIYNDLKYQCRLKNSSFDVSVDVLESSTRCYFGTGSTT
                     WSNQKQLDELLNYMIYINGKSAFNFEKYSKKVIKNRNSQKFYKDDIMNKFPTSFALVD
                     LEKITETHSMKMKFGDDIVIWGEFNDLFKLAHSASFVMSEEDGKFLSIENNESKQTVE
                     NKVADTVNGWNNDKESDVDLAEEVDFDLDEEIDESGSENNFDYGETSPNHGKRGKAIS
                     AFDELGNIEVQQSFSDNEMKHSPINACNSSKESGDKLLEDEIDEKYDSAKEFDIAMKR
                     SMTQAKTQKYTAEQSPVISLSLESFTFTPTPTPTSTPTSTTTQIGTQVQTQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQGPHPKLGLKNLLINKNSYEVVIPENLCKRTFKDEFEN
                     TGTLEINYNDPFYSEKEDVPAKPFIFANQKMVVPVKNKHTIPSLDIIQNKEVKPNSNQ
                     TPRYTNFLFNRWQYLPEPPTKKSVANWVKEEEQKNINKRQRYRSQIDSGKTQLYDFKF
                     SYNSEKVTRKPDEFNYLTSFHLEIHASPPNSKLVADPLRDPILMIFYSFDDENCMFEQ
                     CNYKSGVLIFNNLGLNPHLFDRLGNSLGQRFEIYDDEQEMIMRLVELVNIFDPDILSG
                     YEVNSMSWGYIIERCRSVFETTIMSDLSRGTQRSNGKFGDRWGYTHTANIEINGRHIL
                     NVWRILKSDLSLTSYTLENVCYHLLHVSVPRYSAHQLSQWWQSGNFQNLYVVASYYMR
                     RIELTMKIIFVQELITRNVEHSRLIGIEFNSNFYRGSQYKVESILARITKPESLLLNS
                     PSKYQVHEMRPIECIPLVMEPKSSFYKSPLIVLDFQSLYPTIMIAYNYCFSTLIGKLH
                     NFKPKKNNVGYLKNLDLPPGMIDLLKNDDAINVSPNGFAFVKSHVRKSVLAKMLEEIL
                     NIRIKTKSVMKMFGDDTELKKLYNSRQTALKLIANVTYGYASATFSGRMPNPDIADAI
                     VSSGREILGKSIELIENGGYGAKVVYGDTDSLFVYFPGKSKAEAFKSGREIAKLVTDY
                     FPDPIKLQFEKVYHPCVLLAKKRYVGYSYETENQVNPKFDAKGIETVRRDGIPAQQKI
                     TERALRILFETQNLSKVKEFTVKQFYKIMANKISINDFCFAKEVKYGNYKDERYLPPG
                     AVLASKAVEDDPRSEPQYKERIPYLVIRDPLKERIKDRVIFPEDFIKSFSTSNPLMLD
                     YEYYITRVLIPPLERIFNLMGADVRGWYREMPKTLGLTDNITNPFNDTCLTCGGRLDG
                     QMYVCSKCRYSPQQLANNIVMTCKSAQQKITMNENTCRNCVHGVFLPGGIMSQYLDNC
                     SNRDCSIYFQKVKHEQETKLLLNKKDKIMGEIDW"
     gene            <1401816..>1403360
                     /gene="ALG8"
                     /locus_tag="PVL30_003666"
                     /old_locus_tag="LELG_02822"
                     /db_xref="GeneID:5233286"
     mRNA            <1401816..>1403360
                     /gene="ALG8"
                     /locus_tag="PVL30_003666"
                     /old_locus_tag="LELG_02822"
                     /product="glycosyl transferase"
                     /transcript_id="XM_001526214.2"
                     /db_xref="GeneID:5233286"
     CDS             1401816..1403360
                     /gene="ALG8"
                     /locus_tag="PVL30_003666"
                     /old_locus_tag="LELG_02822"
                     /note="CAZy:GT57"
                     /codon_start=1
                     /transl_table=12
                     /product="glycosyl transferase"
                     /protein_id="XP_001526264.2"
                     /db_xref="GeneID:5233286"
                     /db_xref="PFAM:PF03155"
                     /translation="MVGYHSTDFDVHRNWLAVTHNLPLSQWYTENTSQWTLDYPPFFA
                     FFEWVLSQFVPSRVEKDGCLDIVEVGQYGLPTVYFQRITVIVSELVLFAALQWIIDTS
                     SNYELRRRMYVATASLALSPGLLLIDHIHFQYNGMMYGFLLLCFNSARLNRYLLCGFW
                     FALLLCFKHIYLYLAPAVFVFLLRSYCLNLHWDKKMNVFSNLCKLVKWRNLLKLGSVV
                     VLVFGIAFVPFYKALPQLLSRLFPFSRGLTHAYWAPNMWALYSFFDRFFIQVYKRVPM
                     TRYFLERTFRFDAAALGNDALLQTSTRGLIGDIEFFILPEITPRLTFLLTLFYQIMAL
                     IPLFIQPSYRKFIGATTLCGYASFLFGWHVHEKAILLVIFPMTLIVARDRRLLPAYNL
                     LVACGYGSLFPLIFTSNEWLLKVVYTFLWYIIFYFNFRKVVRVSKTVDRSGNVDRLVN
                     AYLLLFILIVTFTTTVDILKGKFPILKQFEFLNLMIYSVYCGIGVVGSWNIFSWLYFV
                     DETIWE"
     gene            <1404617..>1406353
                     /locus_tag="PVL30_003667"
                     /old_locus_tag="LELG_02823"
                     /db_xref="GeneID:5233219"
     mRNA            <1404617..>1406353
                     /locus_tag="PVL30_003667"
                     /old_locus_tag="LELG_02823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526215.1"
                     /db_xref="GeneID:5233219"
     CDS             1404617..1406353
                     /locus_tag="PVL30_003667"
                     /old_locus_tag="LELG_02823"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526265.2"
                     /db_xref="GeneID:5233219"
                     /db_xref="PFAM:PF00205"
                     /db_xref="PFAM:PF02775"
                     /db_xref="PFAM:PF02776"
                     /translation="MSDDQITLGQYLFERLNQPPINIKNVFGVPGDFNLVLLDKINEV
                     KGMKWVGSVNELNAGYATDGYSRVKNGFTAEGSSIGCLVTTFGVGELSAVNAIAGAYS
                     EHVGLVHVVGVPSTESQKKELLLHHTLGNGDFTVFGKISSYISATTAILDDPSRATKE
                     IDRVIESAFINQRPTYLAFPSNFFNMKVSKSLLDKPLNLTPPPNNEEIQNEVLNEILS
                     MISKAKNPVVIIDACCGRHNSTYEASKLIELTNFNFAVTPMAKGSRDIDENDPRYVGV
                     YLGDLSYPKSKELVESSDLVLSLGAVLSDFNTGAFSYSLPSSKVVEFHSDYTKIRNAQ
                     YPGIRMKELLAKLVKSPELKKIVEGYKPRASSLDLIRPVELPDDHKLTQAWLWSNLGS
                     WLKEGDVIITETGTSNFGIVQTKFPKNVIGISQVLWGSIGYSVGAASGAVIAAEEVDP
                     NRRVILFVGDGSLQLTVQEISTMARHHNNIYIFVLNNSGFTIERLIHGMEASYNEIQE
                     WEYTDLLKTFKATNYETFSVGKVGELSKLFKDKDFAVNNKTRLVEIKLDTFDAPENLV
                     KQAEMSSKTNDA"
     gene            complement(<1406544..>1408868)
                     /locus_tag="PVL30_003668"
                     /old_locus_tag="LELG_02824"
                     /db_xref="GeneID:5233511"
     mRNA            complement(<1406544..>1408868)
                     /locus_tag="PVL30_003668"
                     /old_locus_tag="LELG_02824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526216.1"
                     /db_xref="GeneID:5233511"
     CDS             complement(1406544..1408868)
                     /locus_tag="PVL30_003668"
                     /old_locus_tag="LELG_02824"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526266.2"
                     /db_xref="GeneID:5233511"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF04082"
                     /translation="MPQASKRRLSDNEATSMSPSSSSNSSSGNKLSVSTNKTTPAPKK
                     LSCQRCRLRKMRCDFNNPCSNCKTVGVECIETTQDMRKKRPPATYVKSLEAQVQSIKS
                     FIQSFRKLKNTNDQIKYLQNTDILTDVLQMEQKNGSIPSSMGVDSPLPHPHDPHDPHD
                     HHDHHDEIEENKAIYGPTSVYGNSIITNNRNNSNATSSTSKRETEVSVINTMNKDPEI
                     LQCLHLFFTWQYPDHNMFIFREAFLIDFFNPTPTSLYCSKVLVLSICALGSRMAIDEK
                     IHHKSKQYYRESKTLLLNTMSQPSITSLQSFLLLAFFDICNGSNSSGWMLSGNAMRMG
                     FDIGFQLNPEVWFVKSKESLNKLDVEIRSRIYWGCFMADHFISLVLGRPSILKLSDAS
                     IPVTSDLPDLEWIDDFTYNGYLKNKEKEGNLKRKKLEVIPSTATKAVSYISDPLNQII
                     NLINISDNMLNDIFTKSDLENERTNNFNSNSNSNSNSSNSSNGGNATDDLDLTSRLGK
                     VFDYNWQIMQWKEKLPSDLQWDRESLVNTGENPTYSGIRYYYYILILCLNRPFIGLES
                     ESFPTNNHLSPLPICLNAIDDLYASIQKFELEHGYKRASIFIVYASILSISIILLTNS
                     SISQTNEHSERLQFFMGVLRGCSRTWKLAEKSYNMIKEKLKQSYDSDDLKGVKNQSEE
                     LFRTTMKNEIEDVENPMPNSEMHYAPLVENSDSIDRQISPTSSAETQNFSNADMLLAD
                     NIDFFGGPPVLMTSDLFNEDWEQLFPDYIFHSRN"
     gene            complement(<1409244..>1411499)
                     /locus_tag="PVL30_003669"
                     /old_locus_tag="LELG_02825"
                     /db_xref="GeneID:5233239"
     mRNA            complement(<1409244..>1411499)
                     /locus_tag="PVL30_003669"
                     /old_locus_tag="LELG_02825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526217.1"
                     /db_xref="GeneID:5233239"
     CDS             complement(1409244..1411499)
                     /locus_tag="PVL30_003669"
                     /old_locus_tag="LELG_02825"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526267.2"
                     /db_xref="GeneID:5233239"
                     /db_xref="PFAM:PF01490"
                     /translation="MTSSNQNSKFHRDTQSSNDEYPTVANRNPGSPSLRSPTASFSSP
                     RLGSGTGTGAGDPRILHPDATHLHSNSNSNSQTNLSTFGRHNSQTSHNANDSASSLAN
                     LSPQESYDDHISQLNTTSNSKTIDLKTISKHLVSPEESLKQQGGDITRRLYHQMENVS
                     DSPGLENAEGSLHGVGGTNIGNPKRRARSTSFSYLEEARRGSTASDINVPGGFRREFI
                     IQKSLKKNQPPPNFLTSNFMEFLSIYGHFAGEDLNDDDDDDDDTEGKRGGGGGDDYND
                     DDDGNNNDYEDVFDEDSSLLSSTGTSAVGGGERRSYGAVHHLPRQLPPRVKAPPKGTA
                     TVAKTFFLVFKALVGSGVLFLPKAFYNGGLLFSIITLSVFGFVTFFCYIILIQSKQVL
                     KLTSFGELGFKTYGKPLKYSILISILLSQIGFVATYILFTAENMIAFVEQFISTRPQW
                     LNRANVVVIQCLLLIPLVLIRNLTKLSVVSLISSGFIVVGLLIIFWFSGLKIYFEGVG
                     PNIQSFNPNSWTMLIGVAVTAFEGIGLILPIEASMAEPEKFPMVLSVSMTVITSIFVA
                     IGAIGYTAFGDKVKTIVILNLPQDNIAVQSILLLYSVAVFLSAPLQLFPAIKIGESVL
                     FRHPGKGKHPRGSGGNTSSEGKLYHHSGKYNPQVKWLKNLFRALAVVLISSIAYLNAD
                     NIDKFVSFNGCFACIPLVYIYPPMIHLRSMKKKEHYTVADHWLPFCDYLLIVAGISIV
                     LYSSYQIIYLN"
     gene            <1419574..>1420542
                     /locus_tag="PVL30_003670"
                     /old_locus_tag="LELG_02826"
                     /db_xref="GeneID:5233452"
     mRNA            <1419574..>1420542
                     /locus_tag="PVL30_003670"
                     /old_locus_tag="LELG_02826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526218.2"
                     /db_xref="GeneID:5233452"
     CDS             1419574..1420542
                     /locus_tag="PVL30_003670"
                     /old_locus_tag="LELG_02826"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526268.2"
                     /db_xref="GeneID:5233452"
                     /translation="MYYYHSLDDMVLGTSNNTSYINTEFTQNIDYLEYVPPSTTRTHH
                     LQDNTNLTNFIKYMNSNPDYVYHNKFLYMRLHNICWRRIFKNHKNIPELNPLAINWDK
                     NSDITWLFGPKIEQPASSVPSYPFANAQQQSQQTQQTVSLLSSSSSPTQAKAAEAQAQ
                     ESNVMIFRNESSLDDLDNAIEDGVEDDRMSVSSYESDSDSSSICLQFDQDFIPTLSAA
                     SRKDSTTSTSTTSTSVTSLMELAATAEATKEIKSILKQHHNKTNNNSNNSNSNSNNNN
                     NNVEKQGGREVYNQPNKSVSFNYIISTREIIDNIALDYSFLDRNCL"
     gene            <1423683..>1425074
                     /gene="AIM23"
                     /locus_tag="PVL30_003671"
                     /old_locus_tag="LELG_02827"
                     /db_xref="GeneID:5232919"
     mRNA            <1423683..>1425074
                     /gene="AIM23"
                     /locus_tag="PVL30_003671"
                     /old_locus_tag="LELG_02827"
                     /product="Altered inheritance of mitochondria protein 23,
                     mitochondrial"
                     /transcript_id="XM_001526219.1"
                     /db_xref="GeneID:5232919"
     CDS             1423683..1425074
                     /gene="AIM23"
                     /locus_tag="PVL30_003671"
                     /old_locus_tag="LELG_02827"
                     /codon_start=1
                     /transl_table=12
                     /product="Altered inheritance of mitochondria protein 23,
                     mitochondrial"
                     /protein_id="XP_001526269.2"
                     /db_xref="GeneID:5232919"
                     /db_xref="PFAM:PF14877"
                     /translation="MKSHTRTLLAPSTRFFSSTSIHRALNRPHRPHSPTHAQSKPQHE
                     SRFQPRTGSNLSPRQTRFGNNNERYGSASGKQSGQNDRYRGDFAPKRYNNHNNNSNNN
                     NNGGYPSSNVNSRNAAPPNQKSNINHFANDKFAKDGYYTRRDLYELQEILESSTESTR
                     DAIRSLLNQLVDIAPDRFVNLVTDQGLKETDIKFVIKNLDLKKEGISIHSSSRKADSK
                     TEDGADKGASTKPQLPIVRIRPIRDMIQAYSEEKAKLKELELISMGSKKALRQMDKKL
                     KTAQKQSSEKSIQFTWGISMNDLKNQKFNELKNRLSGSKGSNKVNLYLIHDQRRADWS
                     VYDIYKKDQSGEQVKLELKRRQLVKKTVEEMLNNEELGWTWTSEGDVETKLVYSITKK
                     PTTGGTNSTSTIKQTDKNRDGTIRDKKKEKLGSAVSASISSQQAEPKPPAKEKKKLTD
                     EDLDALYSFKIDD"
     gene            complement(<1427719..>1429509)
                     /locus_tag="PVL30_003672"
                     /old_locus_tag="LELG_02829"
                     /db_xref="GeneID:5233454"
     mRNA            complement(<1427719..>1429509)
                     /locus_tag="PVL30_003672"
                     /old_locus_tag="LELG_02829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526221.2"
                     /db_xref="GeneID:5233454"
     CDS             complement(1427719..1429509)
                     /locus_tag="PVL30_003672"
                     /old_locus_tag="LELG_02829"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526271.2"
                     /db_xref="GeneID:5233454"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MPFKNLFSSSSTSLTDDQKSTSSSSHRSLLRKQQPSSRSVSPSL
                     SSSKSETSILRSNQQHQPSQMSNAARQGPNQGQFQHYQQQNQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQHQQQQHQQQQSNHAPHHTSTNSTVIRNNGSSASLNHNINQNNSNSPSA
                     SIVSEKEHKHHSPLRRFLKKLKPSESRSKHTSKLGKPEPIHPKADIFKKYGQPGKLLG
                     TGASGSVNLLTSKTDPSKIYAVKKFRSRLPAEQEADYKTKVLNEYKVGEFLTHQNLIH
                     TFELLEDYSHTNSKIVDPDYFIVMEYCPYDFFNLVMSGLMELNEVSCYFKQIVNGVHF
                     LHENGLAHRDLKLDNCVVSNTGILKLIDFGSAVQFRKEVPSGYFVTEDDIMLSPKHKL
                     IKARGVVGSDPYLSPEVLEPVGTGYDPRTADVWSVAIIYCCMILKRFPWKLPKLSDPS
                     YRSFAGPQLVNPQNGTSSIEDGMNNMNLGEHSGNGNGNGNSIGHGRHNHHANIGPDRL
                     LRLLPHDSRTVIKHMLTLDPKKRYLMPDVIKDSWVQSVHECKIIGQPGVDEHTISSEN
                     HQHHLVTEDDLKKISQEKESMRKLKEQGLA"
     gene            complement(<1431403..>1433769)
                     /gene="MAM3"
                     /locus_tag="PVL30_003673"
                     /old_locus_tag="LELG_02831"
                     /db_xref="GeneID:5233460"
     mRNA            complement(<1431403..>1433769)
                     /gene="MAM3"
                     /locus_tag="PVL30_003673"
                     /old_locus_tag="LELG_02831"
                     /product="cell agglutination protein Mam3"
                     /transcript_id="XM_001526223.1"
                     /db_xref="GeneID:5233460"
     CDS             complement(1431403..1433769)
                     /gene="MAM3"
                     /locus_tag="PVL30_003673"
                     /old_locus_tag="LELG_02831"
                     /codon_start=1
                     /transl_table=12
                     /product="cell agglutination protein Mam3"
                     /protein_id="XP_001526273.2"
                     /db_xref="GeneID:5233460"
                     /db_xref="PFAM:PF01595"
                     /translation="MSKTKHSIPRYNGSTVSINGTGSAAKLILVISNLFKLVHSLPIH
                     ATGSSTGVEASKETELTPNEYWTNLFISMMLVLLGGVFAGLTLGLMGQDEVYLKVIST
                     SGDKNERKYAQKVLRLIGRGKHWVLVTLLLSNVITNETLPIVLDRCLGGGWPAVVTST
                     VSIVIFGEIIPQSICVRYGLQVGALFAPFVLMLMYIMYPVAYPCALLLDHILGEDHGT
                     VYKKSGLKTLVTLHKTMGVERLNQDEVTIISAVLDLKEKSVSTIMTPMDRVYTMSADT
                     LLDEKTVEEIFNAGFSRIPIHLPNEPNNFIGMLLVRVLISYDPEDALPVASFPLATLP
                     ETGVDTSCLNILNYFQEGKSHMIIVSETPGEATGALGVLTLEDVIEELIGEEIVDESD
                     VYVDINKNIKRKHPGPLSKRNLTSYLHNLYQRGGSAAASKRNSLESSERPDLKERLSG
                     TGSSEAKSISYTPNHRNHKNENGELSASQKGNSLTGNNGTGASANSAVATAAAAAAAG
                     GGGSKFKIKNPALNPLETSKSFVHIKRPDQGTIHSVAKAASPAPIHPETTGEHLSPHK
                     TGELYPTEHGAINEAKRRSVELNSPTPKMLDLSKDGAKGLKEEEGKQGGKDEQEEVDV
                     TDHHRHDHHDDGHIDIPVGNRSFNNGGNGFLDLERQESRSYRTGGIIESVVNVDGVHK
                     TIIENVSDGDLELENGEDDLVIDDAMSNREQNKRNKKKKSSSTGGRKRKSRQGSTSSR
                     SNSFSMNKFSDEDEEEHQSLLNGHSNGDVGSLHSSVSSSITGNGAGRR"
     gene            <1436374..>1438799
                     /gene="gpi1"
                     /locus_tag="PVL30_003674"
                     /old_locus_tag="LELG_02832"
                     /db_xref="GeneID:5233361"
     mRNA            join(<1436374..1436379,1436682..>1438799)
                     /gene="gpi1"
                     /locus_tag="PVL30_003674"
                     /old_locus_tag="LELG_02832"
                     /product="pig-Q"
                     /transcript_id="XM_001526224.2"
                     /db_xref="GeneID:5233361"
     CDS             join(1436374..1436379,1436682..1438799)
                     /gene="gpi1"
                     /locus_tag="PVL30_003674"
                     /old_locus_tag="LELG_02832"
                     /codon_start=1
                     /transl_table=12
                     /product="pig-Q"
                     /protein_id="XP_001526274.2"
                     /db_xref="GeneID:5233361"
                     /db_xref="PFAM:PF05024"
                     /translation="MMWHPLSTTRLLCHTRANIMINEKNDDMVSTTQIYFPNDLRIHL
                     CESNVMVIGYEMSNIYIVFDCLLNDKVVHDFKLDDPELKVIGYINQHLPTSYPHSTHK
                     TLQMWFDQKTNELNINCRSTIIYFDPPNFRNLEYFSIQPILLQSMEANNSSKETTNNN
                     TFNHSAKENKLKFYEPLNNKILMSNGMPQKFISDSDVLDKINQLFRIRLKFRNPATAG
                     VGTRMFQFFQHCLYVILVPIVQILQQLLIMAIDIINQPIIFSTSLVKISRVFRQADLR
                     LQQLNYFPIQFLCYYNKRILYDKSDSLVITKLKIPVLNNDLNINNSNYINFYNSIWLI
                     LNDILLGHSIYNLIQTHQNQIFYFFNSTILQKYLFQDLTSLITWISTKHPAGFKLNTN
                     LGTFLGDLYIWTIHFWKSVMDSMSFPGSNSNLNLNSNLNSNYNTTLVMLAIKYICFTG
                     GCSFLIAFLTDIVYLITFHIYASYYCAAKLYKKQIGAIKSLFQLIRGKKYNVLRNRID
                     NLNNYENASQSDFGTGTGTGTGSGAGYRSGDGPQLRVGTFTGFELDQLLVGTLLFMIL
                     IFLLPTVFAFYLLFSILHILTLMTHNLLENLQIVLNFTPLFVIMLKLKNSKRLQGGIT
                     FSLIRCSKGVTELRMSNKSLTYHEVFTNFFRLFKRAKNFRDSILKNMINGNVISIRYD
                     YNLKFLYLMLPEEYRETTSVWKYVK"
     gene            <1439719..>1440937
                     /gene="RPS0"
                     /locus_tag="PVL30_003675"
                     /old_locus_tag="LELG_02833"
                     /db_xref="GeneID:5233170"
     mRNA            join(<1439719..1439808,1440242..>1440937)
                     /gene="RPS0"
                     /locus_tag="PVL30_003675"
                     /old_locus_tag="LELG_02833"
                     /product="structural constituent of ribosome"
                     /transcript_id="XM_001526225.1"
                     /db_xref="GeneID:5233170"
     CDS             join(1439719..1439808,1440242..1440937)
                     /gene="RPS0"
                     /locus_tag="PVL30_003675"
                     /old_locus_tag="LELG_02833"
                     /codon_start=1
                     /transl_table=12
                     /product="structural constituent of ribosome"
                     /protein_id="XP_001526275.1"
                     /db_xref="GeneID:5233170"
                     /translation="MSLPASFDLTPEDAKLLLAANVHLGSKNVQVHNKPYVYKTRPDG
                     VNIINIGKTWEKIVLAARIIAAVPNSSDVAVCSSRTFGQRAVLKFAAHTGATAIAGRF
                     TPGNFTNYITRSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAI
                     PCNNKGKHSIGLIWWLLAREVLRLRGIIADRTTEWSVMPDLYFYRDPEEIEQNATEDV
                     QGEEVEEVQAAEAETEWTGETEEVDWAESGATPAAEDAAASNW"
     gene            <1443138..>1444883
                     /gene="SMI1_2"
                     /locus_tag="PVL30_003676"
                     /old_locus_tag="LELG_02834"
                     /db_xref="GeneID:5233114"
     mRNA            <1443138..>1444883
                     /gene="SMI1_2"
                     /locus_tag="PVL30_003676"
                     /old_locus_tag="LELG_02834"
                     /product="Cell wall assembly regulator"
                     /transcript_id="XM_001526226.1"
                     /db_xref="GeneID:5233114"
     CDS             1443138..1444883
                     /gene="SMI1_2"
                     /locus_tag="PVL30_003676"
                     /old_locus_tag="LELG_02834"
                     /codon_start=1
                     /transl_table=12
                     /product="Cell wall assembly regulator"
                     /protein_id="XP_001526276.2"
                     /db_xref="GeneID:5233114"
                     /db_xref="PFAM:PF09346"
                     /translation="MTLGQKLRELIYLLSTDDKYSEYDSRKSFNRVNKPDTENLLGGA
                     SGRGVNTNYATGSHGSENSSSSGGSFEMASNLASGQENNNPDAGVHEMKLAWRHIKHW
                     LHKNAPDINSSLSSKCTSDDLRDFQKDLNITLPNCVVAFFKLTDGQSNFGSSLNIETN
                     GLIFGLKLMSLDEIMVQTENWRKVSDYINNEARLENYKSNNLSKLPTSHANNGQYQKK
                     IGLGVGVNTSSTTNLININNNNNNSSNNNNNNNNSNNNINNNNSNNNNINTSEMSSRR
                     TSFDLSQVESRSSTSTTSHDASNIETATKKHKTKKMPRQRAIPPGTIHETFAHPMWIP
                     MVTDEVGNYIGIDLCPASQGVMGQVILFGRDFDFKFQIAETWGDFLLIFANDLEMGNW
                     DIKINKKNNYGDLFIGSEGDLVFVDKESSLEIPYLEILKRRAVKKWMSSLDLEKNIKI
                     QNEGASKESDKGANNELVRELKEHEQSILTLSNKNYQSIDTFINKNLDIIDNMKKSEV
                     EQPIEIFTSKSSKQNKDNNIRPASLGKEKVSGKSPLSQEVTLEVNEADPVRVKGNNTS
                     ATASEQILENIDIKD"
     gene            complement(<1445072..>1446421)
                     /gene="ALG10"
                     /locus_tag="PVL30_003677"
                     /old_locus_tag="LELG_02835"
                     /db_xref="GeneID:5233165"
     mRNA            complement(<1445072..>1446421)
                     /gene="ALG10"
                     /locus_tag="PVL30_003677"
                     /old_locus_tag="LELG_02835"
                     /product="glucosyltransferase"
                     /transcript_id="XM_001526227.2"
                     /db_xref="GeneID:5233165"
     CDS             complement(1445072..1446421)
                     /gene="ALG10"
                     /locus_tag="PVL30_003677"
                     /old_locus_tag="LELG_02835"
                     /note="CAZy:GT59; BUSCO:EOG0926300R"
                     /codon_start=1
                     /transl_table=12
                     /product="glucosyltransferase"
                     /protein_id="XP_001526277.2"
                     /db_xref="GeneID:5233165"
                     /db_xref="PFAM:PF04922"
                     /translation="MQRRLAKVKVLCTLAFYLFVGYIFLLTTKHLQDPFIDEIFHLRQ
                     CQVYCAYNFSIWDNKITTPPGLYILGLIYTKLLEFITMTHGLCQNDNVLRSLNLSGGL
                     LALPFIAKKIKQSNVNRFWTVNIIAQPLLFTYYSLFYTDVWSTVLVLGSLAFVTTRSK
                     QHPIWSAQLGFASLWLRQTNIVWLAFIATVYIDRQIVRDSGVCNRIIQFVKTTFKSHL
                     QLLGYIVNFALFALFIKYNGGITFGDKDNHKVQLHLVQIFYCFTFVNFFTWPIWLSKK
                     TLSLYIKFLVGNYGINLVFNMLASWAIFYIINNFTIVHPFLLADNRHYTFYIFRRLLN
                     TKYSTYLAVPVYHFVTYNCVATIYRAGHQFGLSPISILGFITATILTITPSPLFEPRY
                     YIVPLLIFRLFIAPSTGYANLLEFIWLNIINAITSLVFFNYTFTWWSEPGKIQRIIW"
     gene            <1447190..>1448921
                     /locus_tag="PVL30_003678"
                     /old_locus_tag="LELG_02836"
                     /db_xref="GeneID:5233168"
     mRNA            join(<1447190..1448147,1448320..>1448921)
                     /locus_tag="PVL30_003678"
                     /old_locus_tag="LELG_02836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526228.2"
                     /db_xref="GeneID:5233168"
     CDS             join(1447190..1448147,1448320..1448921)
                     /locus_tag="PVL30_003678"
                     /old_locus_tag="LELG_02836"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526278.2"
                     /db_xref="GeneID:5233168"
                     /translation="MNSPESMLADDRFIPATTSPQAYKSFSPLFEPVNNIENSSLRRA
                     DLSTRDDAFYSRSLEQQDPESSITSNNSYSSSGTALSSPEFSSIFLSIRDLHQEVVAE
                     TLGFTQDTKVFQFKKSYTHRPDNQLHIEERLGLRPNICQDQDRISNIILKSKMTKKEK
                     DTQLKTILANDILQAPGLRNDYYSNLVSWSSCTNRIIVGLGSRVYIWGGDDYIKLVDY
                     DNDELITAISCSPSGVLVLVAFANGKLAVIDQNEDTNEVLCEYHMNNGHCIFCLTWFN
                     DEQLFLAGDDSGKVYTFEIIVDPFGNMEIDEFNNFQCHQQQICGIVLNSKNNELAVGA
                     NDNCCTVWDVSCLKAPVLKFVLPHNAAIKALAYCPWATSLLATGGGSKDRKIRFWHTL
                     SGTLLNEFYTDGQITSLIWSRYKKEIVATFGFGGSTKSNLMRVYSYPAMKPIVEVNAT
                     CNLRILSAATSPDFCSICVAANDSTIRIYELWKVSSEIASNPSCRAPGAYGSEIIELV
                     EGVDKLGPVIR"
     gene            <1449522..>1450448
                     /gene="PIN3"
                     /locus_tag="PVL30_003679"
                     /old_locus_tag="LELG_02837"
                     /db_xref="GeneID:5233639"
     mRNA            <1449522..>1450448
                     /gene="PIN3"
                     /locus_tag="PVL30_003679"
                     /old_locus_tag="LELG_02837"
                     /product="protein that induces appearance of [PIN+] prion
                     when overproduced"
                     /transcript_id="XM_001526229.1"
                     /db_xref="GeneID:5233639"
     CDS             1449522..1450448
                     /gene="PIN3"
                     /locus_tag="PVL30_003679"
                     /old_locus_tag="LELG_02837"
                     /codon_start=1
                     /transl_table=12
                     /product="protein that induces appearance of [PIN+] prion
                     when overproduced"
                     /protein_id="XP_001526279.1"
                     /db_xref="GeneID:5233639"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF07653"
                     /db_xref="PFAM:PF14604"
                     /translation="MSAALVNRSLTTVRTELEFLKDSEVITEALYDKLVAALPTKYKK
                     DEKPWDVDALQNNADSSSNYTNGNSYNSTEKFTVGAVKVATEQQKLPPSNPDTEPAPS
                     YNDKVNQISESLSKTNLKPPAYPPSDPSPVGYCMASYDYKAQEPDDISLTKGDKIAVT
                     EHLSEDWWKGYKAGTGRDKAGVFPSNYVKVISEQEFKFSHKDAAAPPSPNPYSSYGPP
                     APYGQPSPYNQPSPMPQQPSYGGGYGFPPPQQYQQQYQVAPQAAPQQVQQVQQQPSGR
                     NEAFKKYGSRFGEAALFGAGASVGANIVNSIL"
     gene            complement(<1450773..>1451684)
                     /gene="PHB2"
                     /locus_tag="PVL30_003680"
                     /old_locus_tag="LELG_02838"
                     /db_xref="GeneID:5233548"
     mRNA            complement(<1450773..>1451684)
                     /gene="PHB2"
                     /locus_tag="PVL30_003680"
                     /old_locus_tag="LELG_02838"
                     /product="Prohibitin-2, subunit of the prohibitin complex
                     (Phb1p-Phb2p)"
                     /transcript_id="XM_001526230.1"
                     /db_xref="GeneID:5233548"
     CDS             complement(1450773..1451684)
                     /gene="PHB2"
                     /locus_tag="PVL30_003680"
                     /old_locus_tag="LELG_02838"
                     /codon_start=1
                     /transl_table=12
                     /product="Prohibitin-2, subunit of the prohibitin complex
                     (Phb1p-Phb2p)"
                     /protein_id="XP_001526280.1"
                     /db_xref="GeneID:5233548"
                     /db_xref="PFAM:PF01145"
                     /translation="MNNPDWKSLSNELRRRAQQAGGSKRPKTPFGIFGGIGGVLLLGG
                     VVLFAENALFNVEGGQRGILYSRLNGVQQKIYPEGTHFVIPWFQRPIIYDVRAKPKEI
                     ASLTGTKDLQMVNITCRVLYKPEVLKLPKIFVSLGLNYEEKVLPSIVNEVLKSVVAQF
                     NAAQLITQREKVSRLVRENLVRRAAKFDIALDDVSLTYMTFSPEFSAAVEAKQIAQQD
                     AQRAAFIVDKAIQEKQQLVVKAQGEAKSAELIGEAIKKSRDYVELKRLDTAREIANIL
                     SASPNRILLDNDTLLLNTVVDSRNNRK"
     gene            complement(<1457336..>1459096)
                     /locus_tag="PVL30_003681"
                     /old_locus_tag="LELG_02840"
                     /db_xref="GeneID:85890378"
     mRNA            complement(<1457336..>1459096)
                     /locus_tag="PVL30_003681"
                     /old_locus_tag="LELG_02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119498.1"
                     /db_xref="GeneID:85890378"
     CDS             complement(1457336..1459096)
                     /locus_tag="PVL30_003681"
                     /old_locus_tag="LELG_02840"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975481.1"
                     /db_xref="GeneID:85890378"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPTSRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKKYLRITN
                     TSHLAQETWISIFKTLFERMGSVMDQIIMYMTPEVKIEKPGRTGPIVTFEDASIIKIG
                     LGLLKNKPNDKIIQGVKSYDLTFERIWDAVNATFQTRMHLISDDEEKDAGTTSVSKGD
                     KSQKTTKCNFCGKYRHTVDSCHLLVTALDEKLVKKVDGKYYLANGEPLVMDFYKCPLL
                     KHSSLKSLSSNARHRTPPTK"
     gene            complement(<1460869..>1462719)
                     /gene="MTC6"
                     /locus_tag="PVL30_003682"
                     /old_locus_tag="LELG_02841"
                     /db_xref="GeneID:5233371"
     mRNA            complement(<1460869..>1462719)
                     /gene="MTC6"
                     /locus_tag="PVL30_003682"
                     /old_locus_tag="LELG_02841"
                     /product="Maintenance of telomere capping protein 6"
                     /transcript_id="XM_001526233.1"
                     /db_xref="GeneID:5233371"
     CDS             complement(1460869..1462719)
                     /gene="MTC6"
                     /locus_tag="PVL30_003682"
                     /old_locus_tag="LELG_02841"
                     /codon_start=1
                     /transl_table=12
                     /product="Maintenance of telomere capping protein 6"
                     /protein_id="XP_001526283.2"
                     /db_xref="GeneID:5233371"
                     /translation="MFNLIKIFFLVSLLSKWVFCDESNNSNYNTNTSNTTSNTTSSSI
                     SASTINITESINTDVINVAVRTQRDVSKPIPIDQVGVAGISLNSVFDNQGYTADSLAE
                     LTNLLQLGTQVVSLTLYWNEFTSVWQLCPAPFPQNVTYYSNSLVNVTWNNNTYLCEYG
                     FTTNDIMDTIFEYLQSSNTVFNVYFMHLLLNLKSIHYEKSNKTIDLENIYAPNSRTNI
                     IGNTTLYDTVAPLSPYIFTPDVLESYQNSEANSTQSNYQQFYAQSNYTFPSLDSVLFS
                     EVKRLLVNVVNNDLVDSRRVYSITSRDRSNIFFNNTMPSTTLDTAEADAFCDRVLNSA
                     NDIETFNNLSLYTHFRYVTDNNKKRFTMKGVRRYVKCGLSPVFNASSYQVTNDSFAQT
                     SNQSYYPTANESLSDVEVAFEAFIPYNFWSFAPGQPIMNETTRGNVSSSDANVAYKCV
                     AMNPDGWTVEDCYTEYQYACKNITSPNDWFISTRSRRSYFDIDNDACPDGYNFSLPRS
                     SIEMAALYNVIKKENAEYPVWIDLNDITISTCFVSGGPYAQCPYQKTVTTKKFIRMIA
                     PSSIVALVILFLIFLENLFRKNQLQTNRKKYWKKVLSEHYAKHEQEGVPS"
     gene            <1463804..>1466623
                     /gene="srs2"
                     /locus_tag="PVL30_003683"
                     /old_locus_tag="LELG_02842"
                     /db_xref="GeneID:5233509"
     mRNA            <1463804..>1466623
                     /gene="srs2"
                     /locus_tag="PVL30_003683"
                     /old_locus_tag="LELG_02842"
                     /product="ATP-dependent DNA helicase srs2"
                     /transcript_id="XM_001526234.1"
                     /db_xref="GeneID:5233509"
     CDS             1463804..1466623
                     /gene="srs2"
                     /locus_tag="PVL30_003683"
                     /old_locus_tag="LELG_02842"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent DNA helicase srs2"
                     /protein_id="XP_001526284.2"
                     /db_xref="GeneID:5233509"
                     /db_xref="PFAM:PF00580"
                     /db_xref="PFAM:PF13245"
                     /db_xref="PFAM:PF13361"
                     /translation="MSEGSTDSTPEIEMFLRGLNANQRIAVTSPANGRLQIIAGPGTG
                     KTKVLISRVAYLLLHERIKPEHIIVTTFTKKAANEMVDRLGKMLGNTGDGTGVVPGTS
                     IELDKLLIGTFHSICFRIIKKFGHKVGLGGFTIADERDKDILIKEMFEKNLSDTVISH
                     LKSKLKEDAPFLMSNKPNEKYFGVDIPSFKRQIGKLKARGYLPETYLRSRDYNQTMGL
                     LYRAYQNKLSDERKLDFDDCLLSCYKLVTRIPVLHHVRHVLVDEFQDTNEIQLQLMYE
                     FAKGDPLNSQYQHNVTLVGDPDQSIYAFREAQSNNFHKMKEHYTTQDLSCSVVSLTEN
                     YRSTKDILDFSERVMTQQPDRILKNLNSQCPHSFKPVYSNLSSAAQEASWIAYQIDFL
                     QQLPHNPIKYDEISILVRAAYQTRAIEAELVRKRIPYIMVRGKAFWERKEVTAIMDYL
                     RVCGEPNDRIAILQTLNYPKRGFGAVTLEAIDRAITTAITSSNATSINTSTTTTTVVD
                     DLNNVNNTITVKDANNTFINKRTKKSARDVLRGLLESNNQYGVKLPSKAKESLKGYIK
                     MIDQAQVMLDNLEKEEQIDPLKVARLFDQIYTDSGLKKEYESEEKEEVRLNVEEVKTQ
                     FCEFTPQSDLFMEEVTLDEIEESNNGKTDLINSTNDDLGENFIRKFVESVGLYEDDKT
                     GDEKKKKKVGVAISTIHGSKGLEWPVVFVPGLSEGLLPAGFALTTDDPNSLNEERRCF
                     YVASTRAKTLLFISSYIEKEYSGSSWRKPIDTVSRFLKAIDERGSFVKSLQFLAKDGN
                     LEALYTLLGKELVIQSQFDKEAMFSAYKSNWLKQHETSMANFEIKFASEWSKGSLQNQ
                     KYRQKFDEYGDDYTDGADLYKSNARLLPHNQERKSTLSKSINHLSSVIISNSSGTKRS
                     KAPTYIPDRKPSKKKFKSLHTPKLK"
     gene            complement(<1466879..>1467493)
                     /gene="RDI1"
                     /locus_tag="PVL30_003684"
                     /old_locus_tag="LELG_02843"
                     /db_xref="GeneID:5232996"
     mRNA            complement(<1466879..>1467493)
                     /gene="RDI1"
                     /locus_tag="PVL30_003684"
                     /old_locus_tag="LELG_02843"
                     /product="rho GDP dissociation inhibitor"
                     /transcript_id="XM_001526235.1"
                     /db_xref="GeneID:5232996"
     CDS             complement(1466879..1467493)
                     /gene="RDI1"
                     /locus_tag="PVL30_003684"
                     /old_locus_tag="LELG_02843"
                     /note="BUSCO:EOG09264KK7"
                     /codon_start=1
                     /transl_table=12
                     /product="rho GDP dissociation inhibitor"
                     /protein_id="XP_001526285.1"
                     /db_xref="GeneID:5232996"
                     /db_xref="PFAM:PF02115"
                     /translation="MSNPHLDDDLVPEQVEGYTVAEKKTIDEYNKLDAEDESLAKWKA
                     SLGLGSADSAPYPVQPGDNRKVVVVELALEFPEQPELEPIRINLEDDQGKTIVGKEIK
                     FSIKEKSVYQLVVKFRVQHEIITGLKYLHSVKRGGLRVEKLEEPLGSYAPNTQDKPYY
                     ERKFTEVEAPSGMIARGTYSAVSKFVDDDKNVHLTVPWSFSIVK"
     gene            complement(<1468388..>1470190)
                     /locus_tag="PVL30_003685"
                     /old_locus_tag="LELG_02845"
                     /db_xref="GeneID:5233105"
     mRNA            complement(<1468388..>1470190)
                     /locus_tag="PVL30_003685"
                     /old_locus_tag="LELG_02845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001526237.2"
                     /db_xref="GeneID:5233105"
     CDS             complement(1468388..1470190)
                     /locus_tag="PVL30_003685"
                     /old_locus_tag="LELG_02845"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001526287.2"
                     /db_xref="GeneID:5233105"
                     /translation="MSENNNIPKSIITALTRHQDRPFILYLEKDLIKFIKNSILGNIK
                     QPEYVIQAQYLKNSYYRLLSHQLCQYYNLQHWNNQQSEIVVTPIPDYDYQSFKELLDE
                     DNESSDFVKVADVASQYQAEHSPPSSPTHASNHYSRGNNYHSQSHNPNYNQNQNQNHT
                     SNHNHHSMNKPQHYQQQRAFSPRYHSQYNNPYHLQQMNYNVYSPINNHAFNPSRGPRP
                     QNLSSEGLLDNLNNNDNSHNSTSTSTTTNSKPKFIVKKIINKPSPQAPSEETKDDGVK
                     SLSESLSNLNVDVSATELPGSAESESTSASETTKSTIESQRASKEALYRKLREEIFLK
                     EDEDQNDDDDEEEEDDDEEEEEEEEANDEEEEDDDEEEEEEEEANDEGEDSEVERKEN
                     EDEFKNGGTMSPSEIHEKTENFSKSKHQRHDGNYRAQYKPRQPPYNRQQSQTNIASQS
                     MGYGFYQNQHHVQMQIPMQAPYQQIIAPNGMPGLVPQTPGGAVPVFFNPYFAAQQPMV
                     SQAYGYPAGYLNIPPHSQLPPIPQPPPPYDKETERRLLNNPYIIIPGDERQSNGKTGK
                     PQRGKRMPSNYKSRNGSGTSVNQNGHAKGSNQHS"
     gene            <1471155..>1474556
                     /gene="UFD2"
                     /locus_tag="PVL30_003686"
                     /old_locus_tag="LELG_02846"
                     /db_xref="GeneID:5233078"
     mRNA            join(<1471155..1471172,1471290..>1474556)
                     /gene="UFD2"
                     /locus_tag="PVL30_003686"
                     /old_locus_tag="LELG_02846"
                     /product="Ubiquitin conjugation factor E4"
                     /transcript_id="XM_001526238.2"
                     /db_xref="GeneID:5233078"
     CDS             join(1471155..1471172,1471290..1474556)
                     /gene="UFD2"
                     /locus_tag="PVL30_003686"
                     /old_locus_tag="LELG_02846"
                     /note="BUSCO:EOG09260NWN"
                     /codon_start=1
                     /transl_table=12
                     /product="Ubiquitin conjugation factor E4"
                     /protein_id="XP_001526288.2"
                     /db_xref="GeneID:5233078"
                     /db_xref="PFAM:PF04564"
                     /db_xref="PFAM:PF10408"
                     /translation="MSSADEIRAKRLAKLAARSTSSEQTNSSSSEEKLPLQQQTQGPS
                     SSLPKQDVERHRNQTILDQEKRQKTTADNTIKKQENVSSRSATPTAHASPQPTTNAGP
                     RQNQPITSSNWVGDNIDKIFQLKSNSSDISKTAHTITDNEIGKLDENYFDEIFMEILN
                     LPSKYPEPISYLYSIYDRTYSLKRELPLKAKFFEEKNSFFSLILKHAVRYSNMALQFP
                     DMFATSNLQKSIGYIIDDFARISPFVTQLIEEATEDDSLLSLLNYIIPSLSVRLTQRD
                     AIGTSKHLGYLIMFESLVSLKPVAAIFSQVNGFFPNSRKEGLEYEWHSLLGPVFRVSP
                     LGMSSHTYFGEDPKSMSTPQLNTAFELAQGELKTVLNHLFVIVDKLIRGSAKTREDTL
                     RWFAELINLSHLRRGSHADFTKLASDGIMFNITMVLIKLSQPFLDFPLYTKIDKIDVD
                     YFAKSNLLDISEESRVNSSIEDASQYVEKKRQAWADANADADAGEGGSRGGGGGVVST
                     PNFISDCFNLTLAYVHYGMGGIYIKYDRIQSQIKQYNERLSMLESGQSLPGMNPMQAN
                     ALRAGLPRMKKALGVLVAEKYAIRAVFSLRDLQLDIFDFVVGATTFITRMIDPNHAYP
                     QQKITIPIYKITSVSQLDDHDFLKTKTPEPWKYYPEFLLEGLINYCKFCVNFNGCPLV
                     RNEEKLLTFVQFTTILLRCPELIGNPHMKANLVEILFIGTLPGANGQEGMIAPIYRGD
                     RLVMKHLLYALLDFYVMVEKTGASSQFYDKFNSRYYISVIIEELWKTSEYRSQLLDYS
                     QNNVDFFIRFIARMLNDTTYLLDESFSLLNSIHDYQVELKRRLRGEPENEELGSTDEL
                     NENLNTAEKRATSLMGLSNKTMELFKLFTKEVPNGFVLPEIVDRLAGMLDYNLSILVG
                     PKCSNLKVESPEKYHFEPKKLLSDLCEVYVNLALQKGFVIAVSRDGRSFDISYFQKAE
                     KILTTRTFINNKIIDQLRLFAQKAEENRQSEQTEELELGEVPDEFLDPLMFTLMEDPV
                     ILPSSKVSIDRSTIKAHLLSDATDPFNRMPLKLEDVTEDVELKAKIADFKRQKKEERL
                     NGEVAK"
     gene            complement(<1474855..>1475864)
                     /gene="RPL35A"
                     /locus_tag="PVL30_003687"
                     /old_locus_tag="LELG_02847"
                     /db_xref="GeneID:5232918"
     mRNA            complement(join(<1474855..1475214,1475862..>1475864))
                     /gene="RPL35A"
                     /locus_tag="PVL30_003687"
                     /old_locus_tag="LELG_02847"
                     /product="60S ribosomal protein L35A"
                     /transcript_id="XM_001526239.1"
                     /db_xref="GeneID:5232918"
     CDS             complement(join(1474855..1475214,1475862..1475864))
                     /gene="RPL35A"
                     /locus_tag="PVL30_003687"
                     /old_locus_tag="LELG_02847"
                     /note="BUSCO:EOG09265FTY"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L35A"
                     /protein_id="XP_001526289.1"
                     /db_xref="GeneID:5232918"
                     /db_xref="PFAM:PF00831"
                     /translation="MVAVKSFELRTKSKEQLENQLVELKKELANLKVQKLQRPSLPRI
                     HIVRKNIARVLTVININQRENVKAFYAGKKYQPKDLRAKKTRALRRKLTKFERSQETD
                     KARKQRITFPQRKFAIKA"
     gene            complement(<1477435..>1477980)
                     /gene="ARF1"
                     /locus_tag="PVL30_003688"
                     /old_locus_tag="LELG_02848"
                     /db_xref="GeneID:5232890"
     mRNA            complement(<1477435..>1477980)
                     /gene="ARF1"
                     /locus_tag="PVL30_003688"
                     /old_locus_tag="LELG_02848"
                     /product="Arf GTPase arf1"
                     /transcript_id="XM_001526240.1"
                     /db_xref="GeneID:5232890"
     CDS             complement(1477435..1477980)
                     /gene="ARF1"
                     /locus_tag="PVL30_003688"
                     /old_locus_tag="LELG_02848"
                     /codon_start=1
                     /transl_table=12
                     /product="Arf GTPase arf1"