GenomeNet

Database: RefSeq
Entry: NC_083677
LinkDB: NC_083677
Original site: NC_083677 
LOCUS       NC_083677            1762506 bp    DNA     linear   CON 21-NOV-2023
DEFINITION  Lodderomyces elongisporus chromosome 5, complete sequence.
ACCESSION   NC_083677
VERSION     NC_083677.1
DBLINK      BioProject: PRJNA1043637
            BioSample: SAMN33325380
            Assembly: GCF_030384665.1
KEYWORDS    RefSeq.
SOURCE      Lodderomyces elongisporus
  ORGANISM  Lodderomyces elongisporus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Lodderomyces.
REFERENCE   1  (bases 1 to 1762506)
  AUTHORS   Hpyer,L.L., Hogan,E.K., Freeman,B.A., Walden,K.K.O. and
            Hernandez,A.G.
  TITLE     A Lodderomyces elongisporus NRRL YB-4239 Genome Assembly
            Substantiated by its Electrophoretic Karyotype
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1762506)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1762506)
  AUTHORS   Hoyer,L.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-AUG-2023) Pathobiology, University of Illinois
            Urbana-Champaign, 2001 S. Lincoln Avenue, Urbana, IL 61802, USA
  REMARK    Annotation added by submtiter
REFERENCE   4  (bases 1 to 1762506)
  AUTHORS   Hoyer,L.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2023) Pathobiology, University of Illinois
            Urbana-Champaign, 2001 S. Lincoln Avenue, Urbana, IL 61802, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP128570.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: filtlong v. v0.2.1; hifiasm v. v0.16.1
            Assembly Name          :: UIUC_Lelong_1.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 645.0x
            Sequencing Technology  :: PacBio Sequel IIe
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1762506
                     /organism="Lodderomyces elongisporus"
                     /mol_type="genomic DNA"
                     /strain="NRRL YB-4239"
                     /isolation_source="Concentrated orange juice"
                     /culture_collection="ATCC:11503"
                     /culture_collection="NRRL:YB-4239"
                     /type_material="culture from holotype of Saccharomyces
                     elongisporus"
                     /db_xref="taxon:36914"
                     /chromosome="5"
                     /country="USA: California"
     gene            <1137..>2258
                     /locus_tag="PVL30_003880"
                     /db_xref="GeneID:85890384"
     mRNA            <1137..>2258
                     /locus_tag="PVL30_003880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119506.1"
                     /db_xref="GeneID:85890384"
     CDS             1137..2258
                     /locus_tag="PVL30_003880"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975489.1"
                     /db_xref="GeneID:85890384"
                     /translation="MLPLARFSTQLSFRAREISKRIQKALQELAENIHRERTQQQQQF
                     VPKPQPALVPVPVRNRSGPFIRQFSTYSHASFAYQPSWSHAKVRTSWVNKYMFNNLRK
                     PVKSNLLRLLNRGFVYHNFSQAYQNKFRLKLHQSNLRYTYRFLMTRLREKYQVYPIKS
                     QNVERKNLHVRLNASNTPQNHRLILDLARTESSESKIAPRSMGSYIDYPIHFDLSIPE
                     ETILTGEIVDEMLHSIKSFEKKLQELKRDLTNLFDLGELPIKYLSKTNVLRIHFPNCD
                     RERLEKLCIEKGIVGGVVLEEAAAANNAKTKSPAQVYESDVLSSYGDESLNTCSSGVL
                     STESSDLVEHLEDQVVVRPWQELAPLQQVISVNEDYYFA"
     gene            <3378..>5006
                     /locus_tag="PVL30_003881"
                     /old_locus_tag="LELG_05771"
                     /db_xref="GeneID:5236027"
     mRNA            <3378..>5006
                     /locus_tag="PVL30_003881"
                     /old_locus_tag="LELG_05771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001528780.2"
                     /db_xref="GeneID:5236027"
     CDS             3378..5006
                     /locus_tag="PVL30_003881"
                     /old_locus_tag="LELG_05771"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001528830.2"
                     /db_xref="GeneID:5236027"
                     /db_xref="PFAM:PF12757"
                     /translation="MPGTVPQSRSKLRKIIPSSTAWITSFKRPVLDKEQSNTENNVNK
                     SYQQSKEENELDATESTEYDHHPVLETSNKRESKENRLEEREKIGANKSVSSISTSSA
                     FSKDHGTAYNAKITSVENPIECDKTGKDKSFHKRLSTYSKDNVKTETGDKLKNSLSTA
                     KQEPITHTVVEESLKDKPVLLKHYRELNKTAAGALEPHIDDPNKEYDLGSGLKMKQVQ
                     LMKIAAERVKPILTLIDNEVAKTREEDEIKRQQDLEFKVSKHKGKLENELKRHKSRLE
                     KNKDTFDQEIDRKLASIETLKNDSVAKRNEYKETIETEISNAKEEYKQREEKAITQHA
                     FDKKTLEKNHEELLATKVQALEETKFDQEKVLHEIGDLQERKAALACENEVVLHSIEQ
                     LGAIVNEKNTKLDDLITNYQVQQDWVKANDAKIDDFNAKVDAIYNSLNVKKFQEKALA
                     NKVKELEISLAKYQTKLNELHFDAKQNAERLVDAKQKMKVWQAEKDKLAEEEARKHER
                     ERVIATQEFETRRHLEALEKKFGKEVKEGKKEEQ"
     gene            5438..5509
                     /locus_tag="PVL30_003882"
                     /old_locus_tag="LELG_06105"
                     /db_xref="GeneID:5236032"
     tRNA            5438..5509
                     /locus_tag="PVL30_003882"
                     /old_locus_tag="LELG_06105"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:5236032"
     gene            <5825..>7381
                     /gene="CCA1"
                     /locus_tag="PVL30_003883"
                     /old_locus_tag="LELG_05760"
                     /db_xref="GeneID:5236045"
     mRNA            <5825..>7381
                     /gene="CCA1"
                     /locus_tag="PVL30_003883"
                     /old_locus_tag="LELG_05760"
                     /product="CCA tRNA nucleotidyltransferase, mitochondrial"
                     /transcript_id="XM_001528800.2"
                     /db_xref="GeneID:5236045"
     CDS             5825..7381
                     /gene="CCA1"
                     /locus_tag="PVL30_003883"
                     /old_locus_tag="LELG_05760"
                     /codon_start=1
                     /transl_table=12
                     /product="CCA tRNA nucleotidyltransferase, mitochondrial"
                     /protein_id="XP_001528850.2"
                     /db_xref="GeneID:5236045"
                     /db_xref="PFAM:PF01743"
                     /db_xref="PFAM:PF12627"
                     /translation="MKQHTISLNDSEQKIRNLLVGYCDYYRNQGGKPLTLRITGGWVR
                     DKLLCNESQDIDIAIDHLSGVDFVNGLQNYLIEQDPEMSMRHVHTIKMNPSKSKHLET
                     CTTKLYDIDLDFVNLRSEEYTEESRVPVIEFGTPKEDAMRRDATLNALFYNLNEQKIE
                     DFTGKGLQDLQDGVLRTPLSPVKTFLDDPLRILRLIRFACKFDFKIEKKTLEAMMELH
                     NQKALSTKISKERIEIELRKALVSKNPSYGLRLIYHCNLVKSIFYVDGLGFDETAMKH
                     SVKRIPHHLLAASAIYPYFEQQIHKSTIHMSRALEIFDDDSKFNFWLSMILHPYSTVP
                     RVKNKDVYDQFLRVGLKCKKSDINKISAINLVSRTTIDQFLEAPQSVKRSDLGLYLRE
                     FPDFASLNLLVQCFIDCIHNVHVDGSLLLPPPPSPTTADLSLRNKKLINETIAKYESL
                     FSHINQLGLEDVHIMKPLLEGRTIAKELEKKPGPWMKPVTDEVLKWQLDNPSGSAEEC
                     MMYIKSKVTL"
     gene            <7629..>12284
                     /gene="ARO1"
                     /locus_tag="PVL30_003884"
                     /old_locus_tag="LELG_05773"
                     /db_xref="GeneID:5236029"
     mRNA            <7629..>12284
                     /gene="ARO1"
                     /locus_tag="PVL30_003884"
                     /old_locus_tag="LELG_05773"
                     /product="3-dehydroquinate dehydratase (3-dehydroquinase)"
                     /transcript_id="XM_001528799.1"
                     /db_xref="GeneID:5236029"
     CDS             7629..12284
                     /gene="ARO1"
                     /locus_tag="PVL30_003884"
                     /old_locus_tag="LELG_05773"
                     /codon_start=1
                     /transl_table=12
                     /product="3-dehydroquinate dehydratase (3-dehydroquinase)"
                     /protein_id="XP_001528849.2"
                     /db_xref="GeneID:5236029"
                     /db_xref="PFAM:PF00275"
                     /db_xref="PFAM:PF01202"
                     /db_xref="PFAM:PF01487"
                     /db_xref="PFAM:PF01761"
                     /db_xref="PFAM:PF08501"
                     /db_xref="PFAM:PF13685"
                     /db_xref="PFAM:PF18317"
                     /translation="MSIEKVSILGKESIHVGYGIQSHIVEETIKCLASSTYVIISDTN
                     MSKTPTYEKLQDSFQKELAKQRPQSRLLTYLIPPGENHKNRETKAEVEDFLLQQGCTR
                     DTVILAVGGGVIGDMIGFVAATFMRGVRVVQVPTTLLSMVDSSVGGKTAIDTELGKNF
                     IGAFHQPEFVFCDVSFLQTLPKRQLINGMAEVVKTAAIWDETEFTRLEGFAKRFLAEI
                     SAPTPNLESIKDELIKTVLGSVRVKAFVVSADEKEGGLRNLLNFGHTIGHAIEAILTP
                     EALHGECVSIGMIKEAELSRYLGILPPSAVARLSKCLAAYGLPISVDEKIFSKIIGAK
                     KNNLKIDSLIKKMLIDKKNDGSKIRCVLLESIGKCYESKAHQIFKEDIQVVMTDEVFV
                     HPFANRHPESVSITPPGSKSISNRALILAALGEGTTRIKNLLHSDDTKHMLDAVVLMK
                     GATVSFEDSGDTVVVQGHGGKLFACKEEIYLGNAGTASRFLTAVAALVNSTQDEKSVT
                     LTGNARMQERPIAALVDALTTNGSKVDYLNKQGSLPLKIEAGNGFKGGRIELAATTSS
                     QYVSAILMCAPYAEKEVTLSLVGGKPISQLYIDMTIAMMKDFGVDVTKSETEEYTYHI
                     PKAVYQNPQEYVVESDASSATYPLAFAALTNSSCTIPNIGSSSLQGDARFAVDVLKPM
                     GCTVEQTSKSTTVTGPPIGTLKALPEIDMEPMTDAFLTASVVAAVSQGTTTISGIANQ
                     RVKECNRIKAMVDELAKFGVSADETEDGISIHGVQLKDLKTPGGRGVKTYDDHRVAMS
                     FSLLAGLCKDPVLIQERSTTGKTWPGWWDVLHSKFNAKLEGHEYIRQRSGSLRNGDRS
                     IVIIGMRAAGKTTLSRWLAEHLNFKLLDLDQYLEKKLAVDIKLLVKEKGWDYFREKET
                     EVLNECLEKFGKGHILATGGGIVEGEKPREALKNYTKSGGIVLHLHRDLKETVNFLSK
                     DPTRPAYSDDIEEVWKRREKWYHECSNYHFYSTHCTSEAEFANLKLVFAKFVSKITGD
                     DTFVLPATRSTFVTLTYPDLRKVPSLIKDVSETSNAVELRVDLLANQETAYIAEQIGL
                     LRSVATDLPILYTVRTKSQCGQYPDEDEEGMRKLLMFGLKMGVDIIDLQLISSPSTIA
                     EVISKRGHTKIIASHHDFTGDLKWDNVEWKNKYAQGVSIDADFVKLVGMAKTFDDNLL
                     LENFRRQNTEKPLIGINMGPQGKLSRVLNKVLTPVTHELITDKPIGVGQLSLKEINQA
                     LFQIGGLLEKEFWVVGFPVSHSRSPALHNAAYAALGLPYKFDIFETDDAEKVYTQLMQ
                     KPTFGGLAVTIPLKLDIKKYCTELSESAKLIGAVNTVTPIADGRKGFLGDNTDWIGIA
                     NSFKKADFALASGVTNGLVVGGGGTSRAAIFALHSLGCQKIYLLNRTESKLQDLVDSF
                     PDYDLEILSEKNASSVSIGLVVSCVPGDKALDETLMKKLDGVLSNNKGDKQTRPLLLE
                     AAYKPRVTPIMELAKEKYDWTVIPGVEMLVNQGEAQFKLHTGYTAPYKVIHSAVLNE"
     gene            <15281..>17041
                     /locus_tag="PVL30_003885"
                     /old_locus_tag="LELG_05757"
                     /db_xref="GeneID:5236048"
     mRNA            <15281..>17041
                     /locus_tag="PVL30_003885"
                     /old_locus_tag="LELG_05757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001528798.1"
                     /db_xref="GeneID:5236048"
     CDS             15281..17041
                     /locus_tag="PVL30_003885"
                     /old_locus_tag="LELG_05757"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001528848.2"
                     /db_xref="GeneID:5236048"
                     /translation="MSTVAKDSKNSNSTPRSINPGPSKPDLAGVDSSSISGQSVSTSG
                     RAYVSEGETDSPKSQITRLTSENQHIKDHVARIESGMLSMQEQMHQLTMMFKQAMPQV
                     TPQGSTVQPIGGVSTNPGYASGEFNTTPHSTGEQMKAQPDERTFRPESNFPSSGTRSL
                     ASPLPIHSHQSGTPRSYGSSRSIASYDGILYRGEVVHDGFWVEGHEAACEIINEARQK
                     YPHGEDVEVIPYIRVPNLLVEKAFMAYYNKLVAKQGRTQNDIIALGQYDISKRVPMKF
                     SDVDGFMFWLKEVLWHKHIYGIPDKLIINELKTAANVTKSKALIAMIDTECKSDDPFE
                     QPMISYLPILHTRKVAPVQNQVFDIIGKINDTLKEDFEVKMKMTIIGIAIKKNMNANK
                     STKLSSETWINIFKTLFEKMGKVMSMIIQYMHKQITVEYIGENGIMSSRVEDATDIKQ
                     GLTLLRDNSTDQIMYGMKFYDLTFERIWEVVNVTFRDTLPMIGIEEAKNHKPVQSEKS
                     EKSQKTTSCHFCGGGRHKLDKCYTMTAALEEGLVKKKDGKYYLADDKPLNIDGKQPAV
                     QRYPDLKNLKTNARHRTPPN"
     gene            <22566..>23819
                     /locus_tag="PVL30_003886"
                     /old_locus_tag="LELG_05774"
                     /db_xref="GeneID:5236030"
     mRNA            join(<22566..22569,22765..>23819)
                     /locus_tag="PVL30_003886"
                     /old_locus_tag="LELG_05774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119507.1"
                     /db_xref="GeneID:5236030"
     CDS             join(22566..22569,22765..23819)
                     /locus_tag="PVL30_003886"
                     /old_locus_tag="LELG_05774"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975490.1"
                     /db_xref="GeneID:5236030"
                     /db_xref="PFAM:PF13672"
                     /translation="MRARNFFLGFNEPEEDRGPVDESIPYVKYPLFTREQLKSIAKDK
                     FKFDFGYASFGFHSDSIVPSINSLSDLTDPTQLNSLLPRRRPHGSPSDTLSIKAGDDT
                     MLVSPSVLAIADGVSGWETDGALADSGIWSRSIVETFSRLMTEYKISHTPHHLKRRDI
                     EEILDDSFLHTSHLMDLQKLKGSSTLILGMLSGDRFLMISIGDSKIFIIRDNEIILTN
                     EESGDGLCPTQIGTNTMARMPSDFAWIESFKLKENDYVLVCSDGITDNLYEWEILNYL
                     NEFINTKKNNMKTVANKLLIKAKEVAFDDYAYTPYNEKVNKALSKGTSGKGSHHHSSG
                     GKVDDMSIVVAKVVKNTN"
     gene            complement(<24049..>39132)
                     /gene="MDN1"
                     /locus_tag="PVL30_003887"
                     /old_locus_tag="LELG_05775"
                     /db_xref="GeneID:5236031"
     mRNA            complement(<24049..>39132)
                     /gene="MDN1"
                     /locus_tag="PVL30_003887"
                     /old_locus_tag="LELG_05775"
                     /product="AAA ATPase midasin"
                     /transcript_id="XM_001528784.2"
                     /db_xref="GeneID:5236031"
     CDS             complement(24049..39132)
                     /gene="MDN1"
                     /locus_tag="PVL30_003887"
                     /old_locus_tag="LELG_05775"
                     /note="BUSCO:EOG0926004Z"
                     /codon_start=1
                     /transl_table=12
                     /product="AAA ATPase midasin"
                     /protein_id="XP_001528834.2"
                     /db_xref="GeneID:5236031"
                     /db_xref="PFAM:PF00092"
                     /db_xref="PFAM:PF07726"
                     /db_xref="PFAM:PF07728"
                     /db_xref="PFAM:PF17865"
                     /db_xref="PFAM:PF17867"
                     /translation="MENNHSSVFLNTTKINQKYNVYKLNYPGKSFPKDEWFKYDFNIS
                     ASDNLNNLALTALENPLLAYYCYKPIFLDLIARWIQSPGAFEQEYNKYKKETNKVKGS
                     IILQVLSKLLHLCDECISLFELFLQRQDICNAMVEAQPGTLELEQILLSFYRLLQYDA
                     DKFKRYINPDVLYKMVKSKGEAQENEQNVSGATSQVSKYLIVQILALYLSASESSKNK
                     MLQEYTNASTELDSFYEGETVNYYYLPLLEAKRIANFKNLPTIEEEEEQEEKEKEKIE
                     KIENNGELETKVSDFNNEASSTSNLIEIDASALTTNFITSICGVLVPRLISDSIPNVS
                     LSSQFVPTSHAVSVLRSIAKQLQKSHPVMLVGAAGSSKSFFIEKLAHDMCYTDSIVKI
                     HLGEQTDAKLLLGTYASGEKPGSFRWNKGVLTTAVETGKWVLIEDIDQAPTEILSVLL
                     MLLEKRQLNIPSRGETVYAKNGFQLFATIRNSAGHGSTRDRSIIPDMIGSRFWKIIEL
                     AAPSDEELRVILFAKYPLLSNLLDSFLKCYSAVLDFYSQRSFISLSKGQSIRAISLKD
                     LMKFCSRCSRLLEQRGVRDSNEPLDSSIYDEIFAEAIACFGSTIAEPRASTLLINYVG
                     EQLGVPSSRVNQYLSKIKPRFLNDLNTLRVGRATVQKSTGQQLLSSRGHSSSVSSFAR
                     TNHALHLMEEVGVAISMAEPVLLVGETGTGKTTVVQEIAKLVGKKLTVINVSQQTESG
                     DLLGGYKPVNVKSLAIQVQELFGSIFMATFSEKKNERFNKILTRSFNNGQWKNVLRLW
                     QEAYKMAVAYLEKSVNKANTENSEDGAPRKKQRSHQIDPNFLLKRWHEFQDMVKEFEI
                     RSSMSENSFIFDFVEGSLIKAIRDGDWLLLDEINLASPDTLESITDLLNEQLSQRSIL
                     LTDRGDTEPIKAHPEFRIFGCMNPSTDVGKRDLPISIRSQFTEIYVQSPDRDLEDLLS
                     IIDKYIGRYSVGDEWVVNDVAELYMKAKVLSESNQIVDGANQRPHFSIRTLSRTLTYV
                     SDIIPIYGLRRSLFEGFSMTFLTLLDVNSASILKPIIEKYTINRLKNAKSVMSSIPAC
                     PSSSNSGSYIQFQHYWMKRGPYEIQEQPDYILTPYVKSNLLNLVRATSGRRFPVLIQG
                     PTSAGKTSMIRYLASITGHKFMRINNHEHTDLQEYLGTYVSDSSGKLVFQEGVLVEAL
                     RNGYWLVLDELNLAPTDVLEALNRLLDDNRELFIPETQKVIKPHPDFMLFATQNPPGL
                     YGGRKVLSRAFRNRFLELHFDDIPQNELETILHLRCQIAPSYAKKIVDVYRELSVQRQ
                     STRLFEQKNSFATLRDLFRWASREAVGYEQLAINGYMLLAERVRKLEEKREVQSVIEK
                     VMKVKLDMEKFYDEFDISSVAQKGAQQVIWTKAMRRLAVLVLSSMQNNEPVLLVGETG
                     CGKTTICQVIADAQRKKLIALNAHQNTETGDLIGSQRPARNRAALQSKLRTELLEFLT
                     SIGLENVQSLSLETQIKHFRSQKDNIPQGFEELAQSIEDTLCKSAVLFQWNDGPLVEA
                     MKSGDYFLLDEISLADDSVLERLNSVLEPERTILLAEKGSDDAAVTAAEAFKFFATMN
                     PGGDYGKKELSPALRNRFTEIWVPSMEDYADVQQIVQARLKTKQLADAIVQFSEWYGL
                     EFGGGSTNNGVISLRDILAWVEFVNSCEPKLDSLTALYHGASMVFIDALGTNNTAFLA
                     ENQSSLESAKSKCLVKLANLTGAEFESGELDGKTIVQVNETAFQAGPFAIPIANQDDD
                     GNSKHTLGFSLEAPTTASNAMKVVRAMQVNKPILLEGSPGVGKTSLVSALAKATGNEL
                     VRINLSEQTDLVDLFGSDAPVEDGAAGEFVWRDAPFLRAMQRGDWVLLDEMNLASQAV
                     LEGLNACLDHRGEAYIPELDRSFKKHADFRIFAAQNPQYQGGGRKGLPKSFVNRFSVV
                     YVDILKAEDLHLILQHLYPQIPKEDGVKLIKFMSQIEYEVVKHKRWGHLGSPWEFNLR
                     DSLRWLTLYTSRSINQEIGLSAFIDMIICQRFRTQEDRDRALRLFEDVFGSSTKRDNY
                     FNITQDTVQFGDTLSVRDELFQYDNGKDLLPLQCNFKVLETALRSVAHNIPLILTGPT
                     SSGKTSLVRYLANLLGAKLEEFSMNSEVDAMDILGGYEQSDIVRQFHSFLAELSNILN
                     EQIITSIRDGATHAPSSIVIEAALKLIADISSSLITLEQTDVLISRMESVKQFLSNEV
                     FDSVLRFKHEMGKTTLKFEWFDGQLIQAIENGHWIVLDNANLCPPSVLDRLNSLLETN
                     GTLSINECTNSDGEPRVVKPHPNFRLFLTVNPKYGELSRAMRNRGIEVYMASLEDRMT
                     KFDSRVLGNLAIGENIVQKSAKPPTAIYSFDRNTNMRNLSLVFDTILSAASDVENTSI
                     WSLLSLRSLNEFESVLQLVNSCSEFVDESNAFKQISESVALFLKLGLSSVVETLYGKV
                     DTVSSEVVNQAVNYAQDQSLHPLVNLALVSTFSQEFPLVQSSESTLLYEVVNEVQKLA
                     VTMSRIEMNSLNKKIDELSYLERSAAIIQGRNIKFDSKRDDTFVVLQKVVEFIFAVLS
                     KSDFQFKTLIFAPVHNLLSIALLMIETSYQNNLAKAKVLKDLIVDWCECNEEIVDISD
                     NSGLVVSATNNSSMVSLSSARGFAMDKVWDRFRGQYPSTLQGWTLMQALYRTMKSLDE
                     VAKFQSYDEAPMIAALAGSIEDLYKTILRGDYEYTAIESIIAKSTSTLESLKQNVSLY
                     QDLPQRLLSDQFTYICDVLESTGEKSKLLQFYVSSDRSLKSLIGATDEHRPYPRILSS
                     LFDTASDKVGVNELFTSSMVTSALQRVGALPNVAVGQYQNIIKDISLLGYSVVDASPS
                     ILTSQVNVFKKVLLDWVKNVLSSLGIVEELDSKSSFGASHGLESQVHDVVTKFIIPAI
                     NLANESTATSLGKAWIFFSYAMTLLYVPNTPNDPAIKEYIEWKLYTNHNQFVIKLLAS
                     WQSAREVISGDEQLFLETTIQPLASALKVPERPKVYRSEESIDAIFEEWNAIVESSLD
                     LNTIEDLLHGLSSNNNKSDGDRSTASSKLALMQNNISKFVSRLNQNYPMYADLNDILI
                     GYLYGLNFGLSLVAVEQNELSKHSLHKDWLVNTSEILKPSAVITEYAKAQDYIKTLDV
                     NNSTAESILVYFLQLGLVHHETCDDVILGATKSLYYRWSLRKLKSDQAKQEEGSWFKY
                     KDADENYEDDFKNMFPDYEDVVTLAAENDSNGSGSGSGSGSGSSAVEKFEKLYSQLAQ
                     LYISHFHSELNTSDFPLKLTKMGCDLLNILSGDDLRQGSTSASAVAALVNSMALSKNP
                     NSDSVQNDNTSFHFYRDSNPTEVQKAAQTIQSVYLKVKYLLEEWPDHATLKSIASACR
                     EFSSFPIGLPLGRFLQKVEQIYYFIAEWQKYSSKQTSLEVQYNQLTELIVSWRKLELS
                     TWNSLFKFEEESLGQKVGLWWFHLLEVIIIPIIEGDADKDHAVKLTAALNTFLSNMTM
                     GEFSSRLSLLQAFRNHAKTLQNSKITVDALSNCIDFYVQFGSTIAEKLSAGRALLQKE
                     ISEVILLASWKDVNIDALKQSARKSHTALFKIVRKYRSLLSEPVQPLVETGLSLETSN
                     KSAHVNKLHRIEQSVPIMEGAKLADISSWTQRPARLQNLNVVIHNLGIYTNKAESSSF
                     PPFLEFANDLHEKMEALRKETPKQLTENNKKIVAALKNQKRKLLSDTLRDVRRCGLKL
                     SFRSDIQATQGSVTLILANSTSFNDTCLVGCDTDFFRLMDLLPRLRSSASNPAEDVPI
                     TDVDKGLAAIENLIHMLVVKRLPLNSYATEYAKLNEVYSNLLVCARMAANRQQFVPKG
                     HRRSLLKNKQTAINETKTWLEQLVKYAKSTLNSINYFNHKANTNAFDQILVKINELSN
                     SNTNSAILTDEVEEAIVNYENFLVNIREVLNTWKQEHLSFAFVADVILDWMNQEFSSG
                     ISLKIEDGSISAGYETTIEDCEREFRDLSSMILVSCQKICQVSDTEISEEDDNWLLLK
                     QEKVASFIKSSHIKSIISKLSKCLESVTSIAPSDSDMVSHLCAFTSPLVENYVKLCSI
                     VLQKSAENYTDLAKTTYHLASALYTLATKGFCSPEPPSEQKQDQNLQDGTGLGDGEGV
                     QNNSKDVEEDEDLLEDAQKPNDDQKDNDDGDEDDNNDAVDMEGDMAGELENLSDQSDE
                     EGDDKDGDDQDEEELDDEIDDIDDLDPNSVDEKMWDEEAKNEKEKESDKLPENSTNDD
                     NMEANESGAEDDEKKDSNQAGDDKENEPDKDGDNEEEEGDEEGDEEEDVGEQEDEVDN
                     NQGDKMEDHVPESEVLDLPEDMNLDGDDDDEMDVDSDDEDVEENGLEDKLDLEDDDVQ
                     AENDDQEKEDSSDVVDEQADGENESDVEDAEQENAETNDTAVDEEPREDEAAPEESEE
                     QTDEKDEKDEKEKKNEEFEKAERGDAGEDAGAEQDTVDKDSATNQSMGESGEGAENVE
                     ENNGEDQGVLGGEAQKDKQEEKEKDENDENAVKDEAREAAKESLKELGDSLKEFHRRH
                     QDILEAQLEDQEDVDEKAGEDMNELQHDPVSSNDKDLQALGSANQDQAQKVDDNMAID
                     DEDEDDNGDDKDIQNERPFNEKEQPEDQAAEGDEDNEGDDDDADVGGENEANDLDGGE
                     QAIKLEEDSSDDLEKIDPSQMDIDEELSDDDEDEEIGEHQLQKFNQEPQLPPIPLEEA
                     RELWKSSELATQELASGLCEQLRLILEPTLSTKLRGDYKTGKRLNMKRIIPYIASDFK
                     KDKIWLRRTKPSKRQYQIMIAVDDSKSMSESNSDKLAFHSIALVSKALSQLESGGLSI
                     VRFGEDVKVVHPFDKPFNANSENGAKVFQWFDFKQSKTDIKALCKKSLKIFEAQSFEN
                     KADLWQLQIILSDGVCESHDSILQMVRKARDEKIMMVFVVIDGINSKESIMDMQQVKY
                     EADPTTGELKLKVDKYLDSFPFEFYVVVKNINELPEMLSTILRQYFAEISSTV"
     gene            <39972..>41264
                     /locus_tag="PVL30_003888"
                     /old_locus_tag="LELG_04161"
                     /db_xref="GeneID:5231705"
     mRNA            <39972..>41264
                     /locus_tag="PVL30_003888"
                     /old_locus_tag="LELG_04161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524141.2"
                     /db_xref="GeneID:5231705"
     CDS             39972..41264
                     /locus_tag="PVL30_003888"
                     /old_locus_tag="LELG_04161"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524191.2"
                     /db_xref="GeneID:5231705"
                     /db_xref="PFAM:PF00781"
                     /translation="MSSSSYTSSFQIYIKSKSIRIELAESESIYYFNHDEHISPNKSE
                     NESDLIIDTPPKFLTTNKVYIIDSVSSGTGRPKQKDFHELVLAPLLHALGVEFTYIKT
                     TSPDSIENFAHSLPHKDSFVFFLSGDTSVNEFINKLNQNPEENKSIVLFPIPMGTGNS
                     FALSLGITNPLKSLVQLLAATAKPAPLNLYNVLLPHGSYKLVQNEKSPLPSNSLQFLV
                     VFSWAFHASLVADSDTPELRKHGLERFKMAAESNLKRPQIYNGETTFYKEKENKENEE
                     NEENEENVGKESDDKERRQTGKYKEISIPGPYAYWLVTPAQKFEPTFEISPNGNILDD
                     SLYLIAFKSKPKDDSYIMDIMMQVYDKGKHTLNPDVQYTRIERKDYLRLSISGASDTL
                     QRRFCIDGAILVVPEKSEIVIKSTGNHFHGWELQTIQI"
     gene            complement(<41329..>44466)
                     /gene="RAT1"
                     /locus_tag="PVL30_003889"
                     /old_locus_tag="LELG_04162"
                     /db_xref="GeneID:5231754"
     mRNA            complement(<41329..>44466)
                     /gene="RAT1"
                     /locus_tag="PVL30_003889"
                     /old_locus_tag="LELG_04162"
                     /product="5'-3' exoribonuclease 2"
                     /transcript_id="XM_001524142.2"
                     /db_xref="GeneID:5231754"
     CDS             complement(41329..44466)
                     /gene="RAT1"
                     /locus_tag="PVL30_003889"
                     /old_locus_tag="LELG_04162"
                     /codon_start=1
                     /transl_table=12
                     /product="5'-3' exoribonuclease 2"
                     /protein_id="XP_001524192.2"
                     /db_xref="GeneID:5231754"
                     /db_xref="PFAM:PF03159"
                     /db_xref="PFAM:PF17846"
                     /translation="MGVPALFRWLSRKYPKIISPVVEEDQNEIGGAKYEDPNPNGEID
                     NLYLDMNGIVHPCSHPEHKKAPETEDEMFLDIFTYTDRVLMMARPRKVLMIAVDGVAP
                     RAKMNQQRARRFRSAQDAKIKDEAIAKEIADKEFRGELIDNAVKVKKSWDSNAITPGT
                     PFMDRLAEALRYWVAYKLANDPGWANLQVIISDATVPGEGEHKLMSFIRSQRSDPQYD
                     PNTKHCIYGLDADLIFLGLATHEPHFRVLREDVFANQEKRMTISDHVAMNKDQADSIE
                     ERDRKKPFLWLHVNVLREYLAVELHNPNMSFPFDLERAIDDWVFICFFAGNDFLPHLP
                     SLDVRDNGIDTLVNCWKRCVPRLRDYVTSDGKLNLDSVEVLMADLAIKEDEIFRNRFR
                     IEQRKEEGRKRRKLAEEQDKALKSVYLSQVSKGKEKAPMEANVNMPLMDTSGNVVDGF
                     APLSNKDIVHNRDAITLAGMANQDAAAALKKLIDSKKKSMIEQERSSGVAGASGASGD
                     SPSESSEAVATPSAANTDSEDTINGKETKKRSYQQDESIEDEDRLRLHEPGYQKRYYE
                     VKFHCTSDEEIEETRRNVVRSYIEGISWVALYYYQGCPSWNWFYPYHYAPFAADMTNL
                     RDLFPEGVKFELGKPFRPYEQLMSVLPAASKHALPDAFHGLMTDPKSEVIDFYPEDFE
                     IDMNGKKMSWQGIPLLPFIEEERLLKAVQAKYSELSEYELSRNVNKEAELFISNQNKN
                     YALFKEEFYDKQNTEVSFKFARSGLSGVVIKFSGFQPNGFLRFPLDQGEMPDVDKREY
                     LQAEYHFPAKRKGKSMLLNGFIAPTPALTVNDVNEILYKLNSQDSRGMGGNYRNDFKA
                     VSDYVNRGPAGKEVYKSYGMRIGGYRSYLHAIKNGQPNIQENRPHAQGYSNQGYSNTG
                     GYGNQRYSQQQQHQHNYSQPYGQNQRQGGYNNSNYNNNYNSGYNNHNNYSNHNHNNYN
                     SGYYNSYNNGYNNNYNNGYNNNGNNNDYNSGYNNNHHNSYSNNNHSSRGGANSRASFL
                     PPKPRSNNGRNGYRF"
     gene            <45165..>45926
                     /gene="GRX3"
                     /locus_tag="PVL30_003890"
                     /old_locus_tag="LELG_04163"
                     /db_xref="GeneID:5231539"
     mRNA            <45165..>45926
                     /gene="GRX3"
                     /locus_tag="PVL30_003890"
                     /old_locus_tag="LELG_04163"
                     /product="glutaredoxin"
                     /transcript_id="XM_001524143.2"
                     /db_xref="GeneID:5231539"
     CDS             45165..45926
                     /gene="GRX3"
                     /locus_tag="PVL30_003890"
                     /old_locus_tag="LELG_04163"
                     /codon_start=1
                     /transl_table=12
                     /product="glutaredoxin"
                     /protein_id="XP_001524193.2"
                     /db_xref="GeneID:5231539"
                     /db_xref="PFAM:PF00085"
                     /db_xref="PFAM:PF00462"
                     /translation="MGVIEIESEEQFTEITQSSDSKLLALYFHTPWAGPCKTMNQVFK
                     TLADSKADDSSIVFLSINADDLSEISELFDVSAVPYFILIRKQTILKELSGADPKEFI
                     AALNQFSGSNDSNSAASATSVATNTNNTASGSAADPAQAEPVEESEEALNERLSKLTS
                     AAPIMLFMKGSPSSPQCGFSRQLVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTF
                     PQLYINGEFQGGLDIIKENIEEDEQFFEHALNSNE"
     gene            complement(<45946..>47598)
                     /gene="RAD17_1"
                     /locus_tag="PVL30_003891"
                     /old_locus_tag="LELG_04164"
                     /db_xref="GeneID:5231597"
     mRNA            complement(<45946..>47598)
                     /gene="RAD17_1"
                     /locus_tag="PVL30_003891"
                     /old_locus_tag="LELG_04164"
                     /product="RFC checkpoint protein Rad17"
                     /transcript_id="XM_001524144.2"
                     /db_xref="GeneID:5231597"
     CDS             complement(45946..47598)
                     /gene="RAD17_1"
                     /locus_tag="PVL30_003891"
                     /old_locus_tag="LELG_04164"
                     /note="BUSCO:EOG09263HK2"
                     /codon_start=1
                     /transl_table=12
                     /product="RFC checkpoint protein Rad17"
                     /protein_id="XP_001524194.2"
                     /db_xref="GeneID:5231597"
                     /translation="MPPRKKQCKQQDVSFELVDSLSDDDDESQDFFSVPPSPEKLNKS
                     QVPWLEKYAPQNASEICINPTKLQQVRQSLNNMLKGRSPKKLLVLTGPCGSSKSTTVK
                     LLARELCGGDIFNDSIVEYQESENFSVFLQSCRYKNGSIVLLEDLPNVYHFETLQLFR
                     EALRHWINYDGQLPPLVLCLSEFEYETDDQRTGYNLENTMTAETLLGRDLLVSEQVEV
                     IKFNPLAHRFLSKTVKRVLKSESLAIDESFLNDIYKTGDIRSVMFNLEMWSRSRSHLS
                     MIRENSLNIFHALGKIIYSSKEFEGKSSNYNSIAKVIESYPEKNSDLLNLGLLENYHI
                     FQDSKFPLQIGAAICDDLSNADICPFGELGLRSTRINLSRVTQKPMVSKLKMKFPRHF
                     RAMKIRSKTHSQVESYRQYLAPSNSFQTLNLIDGFYLPLIYNKTRGSLLRYNRLGGRL
                     QEVYAGEEVVADDDWPLMDAYDQFQMDIGEARTKRKRKDNIDRSGIANGNVNGNDNYN
                     YNYNDDDDDDDDTLSDEIENSTQSDSDFDDDDIDYLISQGKL"
     gene            complement(<47929..>49077)
                     /locus_tag="PVL30_003892"
                     /old_locus_tag="LELG_04165"
                     /db_xref="GeneID:5231541"
     mRNA            complement(<47929..>49077)
                     /locus_tag="PVL30_003892"
                     /old_locus_tag="LELG_04165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524145.2"
                     /db_xref="GeneID:5231541"
     CDS             complement(47929..49077)
                     /locus_tag="PVL30_003892"
                     /old_locus_tag="LELG_04165"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524195.2"
                     /db_xref="GeneID:5231541"
                     /db_xref="PFAM:PF02373"
                     /db_xref="PFAM:PF02375"
                     /translation="MQTRSSKARKYLDSVKPAFIDNGVPVFKPTIEQFSDFYAFNKAI
                     NEYGLQSGIVRVIPPAEWLDSVAKCYTVDNLSRVCIKNPIVQTINHDGHGVFQSQNVE
                     RARKYNLEQWRELSRSYEPPRKKRRQSVEQEKESLKDSKEGKESKADLKKYFIDTSIY
                     TDERCQELERAYWKGLTYAEPIYGADTLGSLFVDDIKSWNVAKLPNILDLMEEEIPGV
                     NNAYLYAGTWKATFAWHLEDQDLYSINYLHFGAPKQWYSIPQAQHEKFFNVMKDLFGD
                     EYKNCSQFLRHKTFLASPQFLEKKGITVNKTIHREGEFIITYPYGYHAGFNYDYNLAE
                     SVNFALESWFEYAKSTESCQCISDAVNLNVERLWKRYKEVGDSKFMNA"
     gene            <49399..>49713
                     /locus_tag="PVL30_003893"
                     /old_locus_tag="LELG_04166"
                     /db_xref="GeneID:5231706"
     mRNA            <49399..>49713
                     /locus_tag="PVL30_003893"
                     /old_locus_tag="LELG_04166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524146.2"
                     /db_xref="GeneID:5231706"
     CDS             49399..49713
                     /locus_tag="PVL30_003893"
                     /old_locus_tag="LELG_04166"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524196.1"
                     /db_xref="GeneID:5231706"
                     /translation="MSYTRDNKIKKGVYDKDAAASHKSRVVNSFIITTVMILVLLMLG
                     YHFIWSFKVIINQPYGTLLNNLVYGPGTFLANAGLSFRFLRYLNKILVEDKVDSDYKK
                     YF"
     gene            complement(<49833..>51461)
                     /gene="RLF2"
                     /locus_tag="PVL30_003894"
                     /old_locus_tag="LELG_04167"
                     /db_xref="GeneID:5231533"
     mRNA            complement(<49833..>51461)
                     /gene="RLF2"
                     /locus_tag="PVL30_003894"
                     /old_locus_tag="LELG_04167"
                     /product="chromatin assembly factor-I (CAF-I) p90 subunit"
                     /transcript_id="XM_001524147.2"
                     /db_xref="GeneID:5231533"
     CDS             complement(49833..51461)
                     /gene="RLF2"
                     /locus_tag="PVL30_003894"
                     /old_locus_tag="LELG_04167"
                     /codon_start=1
                     /transl_table=12
                     /product="chromatin assembly factor-I (CAF-I) p90 subunit"
                     /protein_id="XP_001524197.2"
                     /db_xref="GeneID:5231533"
                     /db_xref="PFAM:PF12253"
                     /translation="MTTVYASNFQENSRLDEDTHQRGENAIDSETKSPDQLGYEDKDD
                     TSASNRKLRKRKSPEQDGHAEKDNIKPESPTEEEKAAKRKKLDDEKAALKKKQEEEKE
                     LKRRQAEEEKLAKKKQLEEEKEAKRKKLEEEKEAKRKKLEEEKEAKRKKLEEEKEAKR
                     KKLEEEKEAKRKKLEEEKEAKRKKLEEEKEAKRRKLEEEKLERERKKEEEKLEKERKR
                     KEEQLQREQKKQAELQEKERRREEREKERLEKKLKIEEEKRAKELERQKAEEEKRKAE
                     EAKERSQMRISSFFQAGPAKKTDVKLEEKQVESDYESLFLPFFVQKNVTLKTLGIVAD
                     ATEASKKELDLMISNQGKENESKFKSFLQKSKLSIPVHRVPTTPESILSALNSPSTTE
                     QQIIKLIESLDPIKFISFYENSKPPYTGTWTSTKHQSQLLPILSNPLDACTTGLDYDY
                     DSDLEWNEEDKDGDDIDDEDEDEDDGVGLLSDEEDDEFIENDQQDNKKRNWNLKQLVV
                     VNKWNDENEETFFQGYSTVHLVSEDKVTLRTIQH"
     gene            complement(<52228..>54702)
                     /gene="SUL2"
                     /locus_tag="PVL30_003895"
                     /old_locus_tag="LELG_04168"
                     /db_xref="GeneID:5231653"
     mRNA            complement(<52228..>54702)
                     /gene="SUL2"
                     /locus_tag="PVL30_003895"
                     /old_locus_tag="LELG_04168"
                     /product="Sulfate permease 2"
                     /transcript_id="XM_001524148.2"
                     /db_xref="GeneID:5231653"
     CDS             complement(52228..54702)
                     /gene="SUL2"
                     /locus_tag="PVL30_003895"
                     /old_locus_tag="LELG_04168"
                     /codon_start=1
                     /transl_table=12
                     /product="Sulfate permease 2"
                     /protein_id="XP_001524198.2"
                     /db_xref="GeneID:5231653"
                     /db_xref="PFAM:PF00916"
                     /translation="MSEFIHAVKSITSQNGPESNVPEIYPEFSNEAHSVKRPSQEYHP
                     ENVAGHSNYYVPAYDEEEVTVKEWLEHVFAHPLQFIKHYLISLFPIAQWILHYNYKWL
                     YGDLVAGITVGVVLVPQSMSYAQLAGLEPQYGLYSSFVGVFIYSFFATSKDVSIGPVA
                     VMSMQVGKVIAHVQSKFGDQYAAPEIATFLALICGGIATGIGLLRLGFILEFISIPAV
                     MGFMTGSAFNIIAGQVPALMGYNSLVNTRDSTYMVIINTLKNLPHSTVDAAFGLVCLF
                     ILYVWKFGTDWAQKRWPRYKMWFFYFQQLRNAVVIIVATAITWGIVHPEKIAYKGDIK
                     NFKGSIKTIGEVPSGLRHVGVMTIPDGIVGAMASEIPVSTVILLLEHIAISKSFGRVN
                     DYKVVPDQEVIAIGVNNLIGTFFNAYPATGSFSRSALKAKCGVRTPLAGIFTGAVVLL
                     ALYAFTSSFFYIPKAVLSAVIIHAVSDLLANYKVTWSFWRISPLDCGIFLIAVILTVF
                     VTIEAGIYFAIAASLVVLLWRIALPTGLFLGKVQVAEVVNPVIEQAALSEYEQSSENS
                     SDIEIHQVLSGNSNYRSTDEKKNKENGAFNAQTQDKTSTFALQKTNPHIKFHTRWVPL
                     NKKNINKHINITPPPPGVLVYKPLESFTYPNASRQIDIVSDEAKRLTKRAKPYSSNDT
                     GSRPWNDPGPLKWNLPFLRKYNVPEKHESDTRPVLRIVHFDFSTVSQIDVTSIQALVD
                     LRKALNAYADREVEFHFSGILSPWIRRGLLNAGFGTYEDGLTSSNNYVGIAAGYEDLE
                     EGIDEQYLAAVGTNTPFFHLDIPDYQ"
     gene            complement(<56932..>59169)
                     /locus_tag="PVL30_003896"
                     /old_locus_tag="LELG_04169"
                     /db_xref="GeneID:5231674"
     mRNA            complement(<56932..>59169)
                     /locus_tag="PVL30_003896"
                     /old_locus_tag="LELG_04169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524149.2"
                     /db_xref="GeneID:5231674"
     CDS             complement(56932..59169)
                     /locus_tag="PVL30_003896"
                     /old_locus_tag="LELG_04169"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524199.2"
                     /db_xref="GeneID:5231674"
                     /db_xref="PFAM:PF00370"
                     /db_xref="PFAM:PF02782"
                     /translation="MVASKSNISLANRRQSSFFAQLPPAQPDIYYVGVDVGTGSARAC
                     LIDTNGIILGLSEKPISRHELKANFITQNSTEIWNAICFCVKSCLRDSGVDPHHVFGI
                     GFDATCSLVAVSQSTDEPESVGPDWSDNTENIILWMDHRAEEETKAINATGDKCLKYV
                     GGQMSIEMELPKMKWLKHHKPGGIKDCKFYDLADYLVHKATSKETRSYCSVVCKQGFV
                     PLGVDGSETGWSEPFLLSIDMPELVENDFERLGGIPGKNGTYLTAGDNVGKLTEKAAE
                     ELGLSTECIVGSPVIDAYAGWVGTVAAKADVPALLDERTDGTIGDSCGRLAAVAGTST
                     CHIAMTKEPCFVKGVWGPYKNVMAEGYWLAEGGQSITGQLLAHVLSIHPANQELLRLA
                     DQSNISKFDYLNSTLEHMVRDKKERSVVSLAKHLFFYGDFHGNRSPIADPNMKASIIG
                     ESLDNSLGDLAINYFGACEFIAQQTRQIVEHMEEAGHKIYCIFMSGGQCRNGLLMRLL
                     ADCTGLPIVIPRYIDAAVVFGSAILGAVASADSVEEYSQDRENCSRSKVLKKKSELNL
                     QNAGAESGDIIPPSPYTAPTATSAIDLARIAYSHQHSGLQGGDGNVDYFNQPVQQQKQ
                     SAVESEDDSEDEGKLSFGSKQDTQKSLSKKLASMGIKPLSSTKKPSELDKSNPGALLW
                     KTMTQMTGPGKVINPRPKNDPDRKLLDGKYKIFLEQCYSQRKYRQMVDEIEAENLKAG
                     NVTAA"
     gene            complement(<60452..>61162)
                     /locus_tag="PVL30_003897"
                     /old_locus_tag="LELG_04170"
                     /db_xref="GeneID:5231607"
     mRNA            complement(<60452..>61162)
                     /locus_tag="PVL30_003897"
                     /old_locus_tag="LELG_04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524150.2"
                     /db_xref="GeneID:5231607"
     CDS             complement(60452..61162)
                     /locus_tag="PVL30_003897"
                     /old_locus_tag="LELG_04170"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524200.2"
                     /db_xref="GeneID:5231607"
                     /db_xref="PFAM:PF00808"
                     /translation="MSNLRHLMNYDNNSIGYQHNGNSNSSNNPGGSSYLSGRNKASIS
                     NLIDTGSDVSYNNQNVASINNITQSPPSSLPNYNYNYNTYTQQPPIQHHQQQQQQQQA
                     NTVETSQSPEDENIGTATEYDQASTNNAITTTDQVSSERILQSFERIKTHFPAARIKK
                     IMQSDEEIGKVAQATPVVVGRALEIFMANLVEVSVSQAKKQGVKRITASHVKSAIENT
                     EQFDFLMEAVEKYPSLKN"
     gene            complement(<62292..>63548)
                     /gene="SEN2"
                     /locus_tag="PVL30_003898"
                     /old_locus_tag="LELG_04171"
                     /db_xref="GeneID:5231537"
     mRNA            complement(<62292..>63548)
                     /gene="SEN2"
                     /locus_tag="PVL30_003898"
                     /old_locus_tag="LELG_04171"
                     /product="tRNA splicing endonuclease subunit sen2"
                     /transcript_id="XM_001524151.2"
                     /db_xref="GeneID:5231537"
     CDS             complement(62292..63548)
                     /gene="SEN2"
                     /locus_tag="PVL30_003898"
                     /old_locus_tag="LELG_04171"
                     /note="BUSCO:EOG09262WXK"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA splicing endonuclease subunit sen2"
                     /protein_id="XP_001524201.2"
                     /db_xref="GeneID:5231537"
                     /db_xref="PFAM:PF01974"
                     /translation="MGKKNSRLLNKIYQKPLPVVLAGEKYGIDLKNIGKQSPLLWVWY
                     LLKLVKLNFLSYFRPVPIKQVDVQFENGIFKVVDEKSMVKLWREGFFGKGILSRSDPT
                     WFERTKTRLNLRAESLKNSKQNVVKEDLTKARRLERLEFKKKRQELQDLVLKQRQGII
                     TEDELKEMQVIDEYLSEYRKKDSVVINIVNSDNNDSMNKDVEMRVEDESIIDENGFLV
                     QLEYMQLQAVEAFFLKFALDSIAVIGKGEDSLSLRSLFEQCCRLYDVNAVDSFTNSSN
                     DSNSTIDANNKFIIHYIVYHYFRSKGWCVRSGIKFGCDFLLYKRGPPFSHAEYCISIM
                     QDNESSVSFINDWTQMSGQARVIGGVKKNLVQIYVEPPTQDEFDKIYYHNEKEIDEGL
                     KLKLLLSKYRVSELLYRRWNPSRTRD"
     gene            <64267..>65877
                     /gene="atg6"
                     /locus_tag="PVL30_003899"
                     /old_locus_tag="LELG_04172"
                     /db_xref="GeneID:5231730"
     mRNA            <64267..>65877
                     /gene="atg6"
                     /locus_tag="PVL30_003899"
                     /old_locus_tag="LELG_04172"
                     /product="Vacuolar protein sorting-associated protein
                     atg6"
                     /transcript_id="XM_001524152.1"
                     /db_xref="GeneID:5231730"
     CDS             64267..65877
                     /gene="atg6"
                     /locus_tag="PVL30_003899"
                     /old_locus_tag="LELG_04172"
                     /note="BUSCO:EOG09262FJB"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar protein sorting-associated protein
                     atg6"
                     /protein_id="XP_001524202.2"
                     /db_xref="GeneID:5231730"
                     /db_xref="PFAM:PF04111"
                     /db_xref="PFAM:PF17675"
                     /translation="MVNNQHICGECDTPVTLSDTLRRLNESQLKLLINTTQNKEFQKA
                     DNERLNDLNPSDYLTKEKLDLYNQLPRNAKPMYIKSYFESEDEEDDEDDNDEDQEEEE
                     EDDDDDDNDDDDDGTHGAFRSTRSNSNTNSDTNSYLVVSENDDLEEANGVQEGNRATS
                     NINNLDLEDEENYEIKISSRIKTLNKIFRILSNTQDIDHPLSENCANLLIENYKLKFD
                     QSQKEKEQYLSFLKKLKLQDSKLNLHDEQGHVRTSFGDDESLDNNLKQTLEEYKLLTQ
                     KEQDGLQELKKLESTRTQLEQQISKSENELEDIKTSQLDKIMRLRNELQLNISDKQTK
                     LDQLKASYQLHLNHIDELRNFNIYKLMFDINLDEKYGMINGLRIGYKIVWPEVNAALG
                     QISLLVAFILRRLHLKLEAYKLVPMGSQSHIVKFTKHEDGSRSKKILNLYSSDEFTLG
                     RLFNFNKMDVSLIALLEILSIISIKLRELDTDIELPYKIKNDSIGGKSIRVTSNSEWT
                     QSCKLLLTNLNWMLIFVQAHTSGPDGSA"
     gene            <66246..>67862
                     /locus_tag="PVL30_003900"
                     /old_locus_tag="LELG_04173"
                     /db_xref="GeneID:5231673"
     mRNA            <66246..>67862
                     /locus_tag="PVL30_003900"
                     /old_locus_tag="LELG_04173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524153.2"
                     /db_xref="GeneID:5231673"
     CDS             66246..67862
                     /locus_tag="PVL30_003900"
                     /old_locus_tag="LELG_04173"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524203.2"
                     /db_xref="GeneID:5231673"
                     /db_xref="PFAM:PF00172"
                     /translation="MRRLHEHTESFIRHSTPIWNSNNHHRFRHQQLNNQQSQQQYSEG
                     YSETPDSVSISFITNFNDTPTKVNNPISLPATTTTTTRNAPKSFRIINESMIPRSISF
                     EVDEREDESPRKEPQIGKEICNDMEMPLYSFASSTLVNCNRYRQNVELIESSPISVEF
                     LRSKAVGGEWADCRDQDDLLRAKEVFRNLYEMSPYTTTSFEPRSAINTKSVRSNASIM
                     NKMNINENAMNGVKDYLSNHTLKDITDTKHSTPSIMKVESLLNYDDINLVANSNIEDV
                     EENGEEQDRENKSLPLNAEFKGICSTPTPTNNKNNTNNNNTPWMFSKVLELKQEPVEV
                     SNASLVEMKKEILLDHSFNQSTNNASDHSRHFLVTLKFSQQNISKLQTLFVNSRNSPK
                     LQSQSQSQKQQFDETSISSDESGETIHRLKKRKTVIIKKRKSCANIPKPKPKPKPSNS
                     RSKSGCWTCRIRHKRCPEEKPACSQCERLHLQCDYSKSRPDYMLDASLHSAKLEDIKE
                     QTSKVKKKNLRELCIKRKHQRSASRFAQTD"
     gene            <68430..>70334
                     /gene="TMN2"
                     /locus_tag="PVL30_003901"
                     /old_locus_tag="LELG_04174"
                     /db_xref="GeneID:5231608"
     mRNA            <68430..>70334
                     /gene="TMN2"
                     /locus_tag="PVL30_003901"
                     /old_locus_tag="LELG_04174"
                     /product="Transmembrane 9 super member 2"
                     /transcript_id="XM_001524154.2"
                     /db_xref="GeneID:5231608"
     CDS             68430..70334
                     /gene="TMN2"
                     /locus_tag="PVL30_003901"
                     /old_locus_tag="LELG_04174"
                     /note="BUSCO:EOG09261FH7"
                     /codon_start=1
                     /transl_table=12
                     /product="Transmembrane 9 super member 2"
                     /protein_id="XP_001524204.2"
                     /db_xref="GeneID:5231608"
                     /db_xref="PFAM:PF02990"
                     /translation="MLQLLFVALVGFFASLTNAFYLPGVAPTDYKKGDPVPLLVNHLT
                     PSLHHVSNQNKINSATYVYSYDYYYPKFHFCQPEGGPKKQSESLGSIIFGDRIFNSPF
                     EIKMLEPLKCQRLCTSKYPKADSVFVNRNIRAGYNHNWLVDGLPVASILQDRRTNSEF
                     YGAGFHIGEVDKDQRAVLYNHFDIEVEYHKRSDDIYRVVGVTAAAMSLDRSELEDETD
                     ADKLCSFEDLQQVHLEKDKDTEVLFTYTVNFKESPVAWATRWDKYLHVYDPKIQWFSL
                     INFSLIVLILGIVITHILIRTLKNDIVKYNEVNLDDDISDESGWKLVHGDVFRPPPQR
                     MLLSVLVGSGVQIFFMAFVTIIFALFGLLSPSNRGALSTFMLIVYIGSSILSSFVSGY
                     LYRFLGGDNWKLNLVLTPVLVPGILFGIFVFLNFFLISVDSSGAVPMGTMVAVIFIWF
                     AISLPLSIAGAILASKRPLLDVPVRTNQIPRQVPQQPWYLRSIPVMFISGIFPFGSIA
                     VEMYFIYSSLWFNKIFYMFGFLFFCFLLMILTTCLITVLMVYYTLCSENYKWQWKSIF
                     IGGGCAIYVFIHSLFLMGGEKLGGFTSMVLYTGYSIVISLLVFLCCSSVGFISSLFFV
                     RKIYGQIKID"
     gene            complement(<70691..>73384)
                     /locus_tag="PVL30_003902"
                     /old_locus_tag="LELG_04175"
                     /db_xref="GeneID:5231682"
     mRNA            complement(<70691..>73384)
                     /locus_tag="PVL30_003902"
                     /old_locus_tag="LELG_04175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524155.2"
                     /db_xref="GeneID:5231682"
     CDS             complement(70691..73384)
                     /locus_tag="PVL30_003902"
                     /old_locus_tag="LELG_04175"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524205.2"
                     /db_xref="GeneID:5231682"
                     /db_xref="PFAM:PF00172"
                     /translation="MSSHTQSASRSILSINNILSDTGQSSITGVPSNTPRNPVSNEPK
                     NEPKNEQQQQHQHQHLSNGTRERAQGQSGAMPSTLHSNPAVVTPSSASEISHTDPRNA
                     DPPRKRSKISRACDACRKKKVKCNAEFSTTLNKVTKICNNCEKNVENCTFSRTPLKRG
                     PSKGYTKDLEDRIDAINGKSESRLSSDGGSYNHHIQQNTSSGISPSRPDGSASDDGKN
                     SHSSSNSTNSQNRPHSQSLSSLGGTIKLPPLMGYLPKSVPGIQSSGTINYEPDQLSPK
                     NAQRPLPSSNYVQTQTQATPQAPSSQAPPPPQQQQQQQGQGQGNSNATSPPIQGPFWK
                     VPYEMPPASTSHRSSIVNLSSSGQSHSRRKSSIDSITSNSTTNSRIPLVRTPSSAMLS
                     DSDSEDFYSIRSGTSIASRPMFTRENSQSLSPRNSIVSLSSLNGRMNRSLHVGVPPQS
                     PVGSSVVGSPYNFTPQPTQQQQIEFSKSNPHQFLSTPQIAQINPHQPHKSPMDLLKLD
                     LEVYERTFAPTFPILQVSAETLISMIKSTGDEMPIENIVESFHLALNDLINFKTTEEY
                     ASISLFFRLQSIASQSKVNKYTRFIFAASLVVLNYTLLLKGVRYSPGIAMAAAFFGDL
                     TPVEVYLQKKSLKEPLDPLLIAFVRLYLTLVIIDSVSSLVEGTTKLVTLDSTATTLIL
                     GNDKENNLLTMECPILKDELCLTNILNDRKHLCNRTNGYEIKDELHTSSPDVLCTHFT
                     NIIRRKYAVYQLILNETASNINLSTLTARLDVLASTVMHFANYLSTTTISNKSVVHPY
                     LCASVVQSFYVVAFTKRIISHMQPTDEVSKINHNLSISFNLLNLNLNNLQLSESKVRQ
                     IRDQLTRDKLDFSYTGQPAKDLGWLEEVKVAVQKDLMNGYK"
     gene            complement(<74118..>76856)
                     /gene="ARG83"
                     /locus_tag="PVL30_003903"
                     /old_locus_tag="LELG_04176"
                     /db_xref="GeneID:5231606"
     mRNA            complement(<74118..>76856)
                     /gene="ARG83"
                     /locus_tag="PVL30_003903"
                     /old_locus_tag="LELG_04176"
                     /product="Putative transcription factor"
                     /transcript_id="XM_001524156.2"
                     /db_xref="GeneID:5231606"
     CDS             complement(74118..76856)
                     /gene="ARG83"
                     /locus_tag="PVL30_003903"
                     /old_locus_tag="LELG_04176"
                     /codon_start=1
                     /transl_table=12
                     /product="Putative transcription factor"
                     /protein_id="XP_001524206.2"
                     /db_xref="GeneID:5231606"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF11951"
                     /translation="MPKKGRTFNGCWTCRSRKVKCDLTQPYCTRCAKSGRKCQGYEIR
                     LGWSNPISISEKDGEMITLKMGDDLDSFQRRSIELMKFPQSMNYETYQQLNDILEEIE
                     NSVVLFGKGCVGPFRCFHFQKRSKLDRGVNISDIDSHSSSNLEPPPKRMRITTNNNEN
                     ENEDENEIGQKQGKVITKVSSASTSSRKNSHGTLFSKTNRANVHYDLINYAKLTILAI
                     KGPDYKFNEQNMMHILYPKFFPNVDSDDDWLANAKMVNNKLYKKQGENLVIHALFRTL
                     LNNFRSDFISISRVGFENNYIDIILLPFIKSIVGEFVCWEFAYWEEIVEADTVVANKE
                     KDYNDDEDADAEEDDDEEDDFEETGGNSYINNKGDDDDNDHDKIDHRHLLASIKLCII
                     CLTLGLSAFNLSRKTCLGKKNVCNFNDENETNVKSNEDYEDDESDNNESDNNESDDNV
                     YEVDEFLRISMELRKISIKLLNRHLDDADEISEFQKEQQASSVPSVQYAMADYDTMLL
                     LALILQIELDNFFSVFENLDLIYAIGDLVIKTKFESKKRMETINRLLINIFKLKYFMY
                     ESTQAVNTVNYQINDKDIEHNYGDLKDDYNLISSVDSDDDDDDDDFDKVYQNNSDDDM
                     GINVDADADANDEQTVQMQPTIKNMITTDGSGVSKYVPTAYTISFEQNKKFKDAYEVT
                     TASELGPSHKMKFTPYIATKFTSMFDADLIYLMFGIPRDLLLIFHESIHLANHKNIFN
                     LRNVFPRNFPRISAEVEDRIINWNHTRSNWSLDPSNSFHEFLINNVNSFHYAVIICHH
                     KLMKKNFCAEQYQDLVDKCLMYLECAIRVSQKLQLQYRPMFWNLLMCGSIAVGTMRQE
                     RIRQIWDFECYRNQPNYWRSKQILFEIWDRRNNGEDEEHLGFMNMIREWDICLSLG"
     gene            <77195..>78481
                     /locus_tag="PVL30_003904"
                     /old_locus_tag="LELG_04178"
                     /db_xref="GeneID:5231531"
     mRNA            <77195..>78481
                     /locus_tag="PVL30_003904"
                     /old_locus_tag="LELG_04178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524158.2"
                     /db_xref="GeneID:5231531"
     CDS             77195..78481
                     /locus_tag="PVL30_003904"
                     /old_locus_tag="LELG_04178"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524208.2"
                     /db_xref="GeneID:5231531"
                     /db_xref="PFAM:PF02214"
                     /translation="MSFTTLPIQTFEEFDPSVPVVLPHEKVYSIQVGYRLFRLSGLSL
                     SSDSPSYFTKFFSEPENEEKVLFFDRSPRVFEKIYTHLQGYSINVEEDFEFMHLWSDA
                     CYFGLTGLRKVLTEHDYFATVGTERFKIPKALLQGQGNYPNYFSIHSERLYFDNLALV
                     EKKNMLRPPPQRPCIVSNRSPELFRDLLEILRGNILVIKSNEHRQLLIKEAKYYRFME
                     LEQRILQHKVLAAGIVLNLNDIARKGLVNDSPADKSNEIPLRYSRPYIDEPKRDLIFQ
                     IDNSLENQGDVKLKLNKKTKIVTAVFTKKTFAKYLKAFGNLKEGVMMEKDSATLFVGF
                     NNSSTVINGREMKQCWVSDLIGDNIPFTNGTDEPEGKEAPSKKRKLSDDIKGEIIELY
                     LRKSLWKVMMRGPLARLEAVTLDAVTTLKEDKVEFL"
     gene            complement(<78683..>80098)
                     /locus_tag="PVL30_003905"
                     /old_locus_tag="LELG_04179"
                     /db_xref="GeneID:5231683"
     mRNA            complement(<78683..>80098)
                     /locus_tag="PVL30_003905"
                     /old_locus_tag="LELG_04179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524159.2"
                     /db_xref="GeneID:5231683"
     CDS             complement(78683..80098)
                     /locus_tag="PVL30_003905"
                     /old_locus_tag="LELG_04179"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524209.2"
                     /db_xref="GeneID:5231683"
                     /db_xref="PFAM:PF07690"
                     /translation="MTASKEVSDEECVLSSSASGVSSQVDAPSSEPNPDLSVQRNENL
                     NHIDAANAHLLDDPSKFPDGWNRTAMTTLLGSFIGLIGTLGFVNTGGVISTYLSENIL
                     KHEPQSTIAWIFSLYSFFAFGGCLISGVIFDKFGCRVPVLIGSILMFVGLLCTSWCHT
                     VWQFILAYGVLAGIGAALTFGPFVACLSHWFLKKRALAVGSAYTGGGVGGVIFPLLFR
                     KLFPIVGFGWTIRIGAFVCLFFLLIGWLLVRDRKEEFHEPSDDHMVKQIYDSIDFKIL
                     IRNPLFAIIVTGLLFNGLAFLISMVELPTYATVRGYSESESYLLIVVFNSFSIPGRII
                     PSFAADHGLGRFNTFCIINVMSLIIFCVVWVPFGHHLKALFVFAGFFGFTSGSVLSLS
                     ASLVTSIVRTADVGKGLGTAFFILSLGDLFGLPIAGAITNKTPESFDHLVYFLTCCAF
                     VGACVSFVSRYMYAGFNLKFV"
     gene            complement(<81180..>82331)
                     /locus_tag="PVL30_003906"
                     /old_locus_tag="LELG_04180"
                     /db_xref="GeneID:5231710"
     mRNA            complement(<81180..>82331)
                     /locus_tag="PVL30_003906"
                     /old_locus_tag="LELG_04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524160.2"
                     /db_xref="GeneID:5231710"
     CDS             complement(81180..82331)
                     /locus_tag="PVL30_003906"
                     /old_locus_tag="LELG_04180"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524210.2"
                     /db_xref="GeneID:5231710"
                     /db_xref="PFAM:PF10277"
                     /translation="MSRSSEKNGKVKKPIVRFQVIHYYLIPIIALIVWWGMLIAMLAC
                     WGAQGRPIYKFMNGDYQNPVYLSDIGATNLQPLFISCAGFQGIFFVGTLVVGMYLRKK
                     HKIQPYISHHQPRLAIASIIMATIGQLGILFVSIFNTKNFHSVHMSMVGIFIAFCFFA
                     CCCDFGITYIFGTRGDQLDPVHRTTVFGTSRRGNLYYIGFWAKIIWILAAICFAAAFG
                     YYMNTGNDSRSARFEWTICFWYGLLLVLWSVDLIPSAVRKYRARHPEIYQTNELDYEQ
                     QVGAKWEEQMGHQDILGGAADAADGNDSYTYVNSPVMQNQPIMQNQQLANQHFASQQQ
                     HFQREAPVSYPAQAHTTANTANIASTTNPAQLTSQQLNYPQPTEPVARY"
     gene            <94639..>95658
                     /locus_tag="PVL30_003907"
                     /old_locus_tag="LELG_04181"
                     /db_xref="GeneID:5231681"
     mRNA            <94639..>95658
                     /locus_tag="PVL30_003907"
                     /old_locus_tag="LELG_04181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524161.2"
                     /db_xref="GeneID:5231681"
     CDS             94639..95658
                     /locus_tag="PVL30_003907"
                     /old_locus_tag="LELG_04181"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524211.2"
                     /db_xref="GeneID:5231681"
                     /translation="MISLYYLYKHYLNTILDQQETIQYSLSKDGTGEEMGNSFEQVID
                     PMIIYAILSSLVLSNKTLDDQSYTLKTWWIIIDNTNRQLPTSTVSLDLKLLNTMESFF
                     LASLNYQLNYIKMATDWQFWQMIEQDKLFRFNKTILNRFKSIMSLDDELPQLQEQQLQ
                     SNACTGPCCMNNYFINTPVLSPITSTFSSPIELPLTPQTPGDYYKRRRLDIKPLPQQQ
                     QQSIQQPVQPLPIQQEFSQQFEESVVLPSQSFATPCPPMTFMASCQLAPTTMTSVPMT
                     SMNPVYAQPSSTLFSSQGLFPQYYEWPAYQPQQVKPFYNNTSSIIPSQIAVNPYTNQN
                     YVSYW"
     gene            <96272..>97795
                     /gene="HIT1"
                     /locus_tag="PVL30_003908"
                     /old_locus_tag="LELG_04182"
                     /db_xref="GeneID:5231624"
     mRNA            join(<96272..96382,97409..>97795)
                     /gene="HIT1"
                     /locus_tag="PVL30_003908"
                     /old_locus_tag="LELG_04182"
                     /product="HIT domain protein"
                     /transcript_id="XM_001524162.2"
                     /db_xref="GeneID:5231624"
     CDS             join(96272..96382,97409..97795)
                     /gene="HIT1"
                     /locus_tag="PVL30_003908"
                     /old_locus_tag="LELG_04182"
                     /codon_start=1
                     /transl_table=12
                     /product="HIT domain protein"
                     /protein_id="XP_001524212.2"
                     /db_xref="GeneID:5231624"
                     /translation="MAFPAKISRQFGYRRIFTFFTILDIYVKFCGLQKEDTHQSHTDS
                     NDAALKDSLQTETNTSIKQDTSKSSHTTGIESESKTPLSKFDKILADEQIKNLLKEPV
                     LQFHLVTILSIIQEGFIRNLNHEQKLEVMNLKLTDLRAGGVEENEIVEEFVQRVLDLN
                     EQIQS"
     gene            complement(<97929..>98906)
                     /gene="CGR1_3"
                     /locus_tag="PVL30_003909"
                     /old_locus_tag="LELG_04183"
                     /db_xref="GeneID:5231308"
     mRNA            complement(<97929..>98906)
                     /gene="CGR1_3"
                     /locus_tag="PVL30_003909"
                     /old_locus_tag="LELG_04183"
                     /product="rRNA-processing protein cgr1"
                     /transcript_id="XM_001524163.1"
                     /db_xref="GeneID:5231308"
     CDS             complement(97929..98906)
                     /gene="CGR1_3"
                     /locus_tag="PVL30_003909"
                     /old_locus_tag="LELG_04183"
                     /codon_start=1
                     /transl_table=12
                     /product="rRNA-processing protein cgr1"
                     /protein_id="XP_001524213.1"
                     /db_xref="GeneID:5231308"
                     /db_xref="PFAM:PF08450"
                     /translation="MSTQLSASNIFPEDYRGRLTEGITYDYRNNTLLWVDIILGEVHR
                     ISLDDLNKHEVLKWNEQGESIGFVALTKDLDTVLVCGKSGLAYGKFKANTLEYFFKYP
                     LTEVEQKRLRSNDGIIDPWGNLWIGLMNDFHVTAKEGEVKPEGKLLRITPDLKVDVMI
                     ENTKISNGLAFCSKGTKLYWTDSLNYTIWKFDYDHETNTLSNKVPFLETKKVYTDVES
                     PEPDGMVRTTNGEVYTAVFSTSTVLHVDKEGQVIEKIHVPAERCTCVTIGGQDGDHLF
                     INTANLKLDDFDAKIDPTDFFGDLGGFLFKYKSDHNLKGIKKNFWGGDV"
     gene            complement(<99384..>100547)
                     /locus_tag="PVL30_003910"
                     /old_locus_tag="LELG_04184"
                     /db_xref="GeneID:5231742"
     mRNA            complement(<99384..>100547)
                     /locus_tag="PVL30_003910"
                     /old_locus_tag="LELG_04184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524164.2"
                     /db_xref="GeneID:5231742"
     CDS             complement(99384..100547)
                     /locus_tag="PVL30_003910"
                     /old_locus_tag="LELG_04184"
                     /note="BUSCO:EOG09264WF4"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524214.2"
                     /db_xref="GeneID:5231742"
                     /db_xref="PFAM:PF07065"
                     /translation="MTDYAKFEEIDLTVEEVLNCSFSKWAPLFPKNVFPYKIIAPLPD
                     GFIDYVQRDGIKLPSAKTNKIVLEQNSDNEYSDWEDVEDIENDTGEVEEMHSEFQENH
                     KEKEVLEASGHFPQLNQEITQSIAELGGKVIPKLNWSSPKDASWLMPGNVIKCTEVDD
                     VLLLLKSSDHVIDDLAYPFSEVSQLPEDETRKNGQDRIKVDYELVLKQWRDLNPALEF
                     RVFVKEGKILGISQRDLNHYDFLKELEPQLKENIQSFVTDKVVNKLNASLPNLTKFIV
                     DVYVPRPFDKIYIIDINPFSRKSDSLLFTWNELLTADPDSDTVPFRLINETNVGAFAK
                     KQYSESQVPLDVIGAAQDHEALIELAKEWEKLQSKEAEEEDEAVVVDGVIEEK"
     gene            <101007..>102608
                     /gene="CCT4"
                     /locus_tag="PVL30_003911"
                     /old_locus_tag="LELG_04185"
                     /db_xref="GeneID:5231547"
     mRNA            <101007..>102608
                     /gene="CCT4"
                     /locus_tag="PVL30_003911"
                     /old_locus_tag="LELG_04185"
                     /product="T-complex protein 1 subunit delta"
                     /transcript_id="XM_001524165.1"
                     /db_xref="GeneID:5231547"
     CDS             101007..102608
                     /gene="CCT4"
                     /locus_tag="PVL30_003911"
                     /old_locus_tag="LELG_04185"
                     /note="BUSCO:EOG09261XNJ"
                     /codon_start=1
                     /transl_table=12
                     /product="T-complex protein 1 subunit delta"
                     /protein_id="XP_001524215.2"
                     /db_xref="GeneID:5231547"
                     /db_xref="PFAM:PF00118"
                     /translation="MAAAARTQVAPSNATFKNKEKPQEVRKANILAARAVSDAIRTSL
                     GPKGMDKMIRTKNGEIIISNDGATILKHMAVLHPAAKMLVDVSHAQDVEAGDGTTSVA
                     ILTGALLGAAERLLNKGIHPTLIAESFQRAAQRSVEILLEMSHQIKLEDREQMIRAAT
                     TSLSSKIVSQHSQLLAPLAVDSVLKVMNESKDNVDLNDIRLIKKLGGTIDDIQLVDGV
                     VLTQSVVKNAGGPTRMEKAKIGLIQFQLSPPKPDMENNVVVNDYRQMDKILKEERAYL
                     LNICKKIKKAKCNVLLIQKSILRDAVNELALHFLSKLNIMVIKDIERDEVEFLSKAIG
                     CKPIADVENFTEDRLGSANLVEEIESSGSKIVEISGITSKTTKPTVSIVIRGANNLIL
                     DETERSLHDALCVIRCLVKEKALIAGGGAPEIEVSRQLMKESHSLFGVEQFVYQEFAQ
                     ALEVIPTTLAENAGLNPINVVTDLRNRHENGEKNAGISVRRAGASNTFDEHVLQPVLV
                     CTSAIVLASECVKSILRIDDIQFSR"
     gene            complement(<102674..>104416)
                     /gene="SAS10"
                     /locus_tag="PVL30_003912"
                     /old_locus_tag="LELG_04186"
                     /db_xref="GeneID:5231756"
     mRNA            complement(<102674..>104416)
                     /gene="SAS10"
                     /locus_tag="PVL30_003912"
                     /old_locus_tag="LELG_04186"
                     /product="something about silencing protein 10"
                     /transcript_id="XM_001524166.2"
                     /db_xref="GeneID:5231756"
     CDS             complement(102674..104416)
                     /gene="SAS10"
                     /locus_tag="PVL30_003912"
                     /old_locus_tag="LELG_04186"
                     /note="BUSCO:EOG09264BOA"
                     /codon_start=1
                     /transl_table=12
                     /product="something about silencing protein 10"
                     /protein_id="XP_001524216.2"
                     /db_xref="GeneID:5231756"
                     /db_xref="PFAM:PF09368"
                     /translation="MARRTTRRSVEEDIEPDEVDSFHSNRSKILLNEAGEYGQQKSID
                     DVESEEEVFGESASGSDDDDEGGDDEDEDEEEEGDVDEEEEEGWGGRKNYYGGDEASD
                     DEDSKQMTEEAMRQQRKHLEDLAMDDYIDEDIMEDWQKKADTFDNKEQQTTFTQKIMS
                     SGTSIEQLDDNERLQLLRQSFPEFVPLMKELEILRPELDELRNIKSPNQCVQIKIAAL
                     SGYLASIASYFALFVENLQTQEDSFISMKDHPVMETILSSKEVWRQANELPMEVKDTV
                     VALTSSTASGADVSSEFNEDEFVDAEEYNSEEEEEEEGEEENEDDDNNAKLKNGSLDS
                     DLDIDITKQRAIRKVANTAEDDYAEGNIEDVDMEDKKRRKKTLRFYTAKIDKAAAQRE
                     KAISGDMDVPYKERLFERQQRLVEEARKRGLEKRDILDADEDDLNENNVEAGDYGDYD
                     GDADNNDVYDGGDYYERLENRKHTKKENRKQAHIAAVKAAKEGKLAELQDEVGEDGKR
                     AINYQILKNKGLTPHRKKEYRNSRVKKRKQYETAKKKLKSVRQVYDAEKHRGPYEGEK
                     TGIKKGLSRSVKLV"
     gene            <104796..>106175
                     /gene="RPC53"
                     /locus_tag="PVL30_003913"
                     /old_locus_tag="LELG_04187"
                     /db_xref="GeneID:5231438"
     mRNA            <104796..>106175
                     /gene="RPC53"
                     /locus_tag="PVL30_003913"
                     /old_locus_tag="LELG_04187"
                     /product="RNA polymerase III subunit C53"
                     /transcript_id="XM_001524167.2"
                     /db_xref="GeneID:5231438"
     CDS             104796..106175
                     /gene="RPC53"
                     /locus_tag="PVL30_003913"
                     /old_locus_tag="LELG_04187"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase III subunit C53"
                     /protein_id="XP_001524217.2"
                     /db_xref="GeneID:5231438"
                     /db_xref="PFAM:PF05132"
                     /translation="MSNRLDSLNTKKTPTPSGSKSGLKFKPKVVQRKSKEEREKVAPK
                     VKDESSHASTQPTRGRGGGARGRGRGGRNNNYAGTHLVTQGPLAAGSVSLGKASGSKL
                     GLTSDLIFNSSGQEVSTSEFIGSLKLKDPKTLKSPSGEGAEGRNGDDDEEEEDKTRIN
                     MTKEYRFEESETELFPQRPFRDDGIQRKVEETKVVEEPSPVKLEPSAENTPAVISISR
                     EDTAKSENIEAKIESIKENKAKLESKITQADSIVTDEQSKLITDHEQIIDLLTGSVQD
                     VSINETKKEEGAEEEAEEEAEEEGNHTSNYNKTNNNNKYVMFQLPHLPTYEREKSKVK
                     LEPGIEHSTNITEEAEKSGKESQEEKTRSAFATTSSDLYGTIGKVNIHQSGKITISLG
                     NGIKLNVTKGSPTDFLQELALLEVRGQPLGENSDDMDLVDDEGREVAGKLFHLGNVND
                     KIIATPCIE"
     gene            <106482..>109161
                     /locus_tag="PVL30_003914"
                     /old_locus_tag="LELG_04188"
                     /db_xref="GeneID:5231550"
     mRNA            join(<106482..106979,107131..>109161)
                     /locus_tag="PVL30_003914"
                     /old_locus_tag="LELG_04188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524168.2"
                     /db_xref="GeneID:5231550"
     CDS             join(106482..106979,107131..109161)
                     /locus_tag="PVL30_003914"
                     /old_locus_tag="LELG_04188"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524218.2"
                     /db_xref="GeneID:5231550"
                     /db_xref="PFAM:PF00488"
                     /db_xref="PFAM:PF05192"
                     /translation="MFQRRAAWNEQDGRSVHREGEEEETAAAATGNTSFEDITFDVCD
                     KRILSIDYHKATLGVTCLDFDARVAYIYEDFEVSNPNVYLYTILDDLKPNLVFASSRC
                     KQSMFIYLREKESQYEFQLFTKIVADFNRFDLQQLADSFINCITSVRSRLFSDLALKS
                     SCFKLSVGTLNAIYLGVADYVEESNIAEFVDSVQFCNFTDHMFIDVDSLYALQILPDP
                     SKVFSKSKSQKSCLFDLVNYTATSEGYSLLMDWVRKPLADITLIMERQSMIRYLSSGV
                     FGHDNRGCSQIVTILRSMKGCFAKVRRLKTNEMSWQCWNSLILLLRNSVSIVKLLRQH
                     INVEELHESSLSMSFLLNEDLFAFQELERIIHSVIAIELSAEEGKIIIRDGVDAEIDR
                     LRSIYNNLDSILQTCTKNISECYPGIGFNTIYIPQLGFLVSREITHNVITHDTTDVCL
                     PSDWKEVFATSTHLYYKSPEVRQMDDAYGDVHTLIIDREIEIIQLLQEKEVDKYASTL
                     VDTMLALTELDCLCSLATVSQLPGYKFPKLTTGYDLCLKQSRHPLVETYSNSFVPNDV
                     EFSDQEEEEEEERIMVLTGANFSGKSVFLNQIALITVLAQLGCAIPAQSGVIGVVDML
                     LTRISSRESLEKHLSTFAIDINQLSKCITLATDKSLILVDEFGKGSDSIDSPALFGGA
                     ISYLARMSSPPRCIMSTHYLELFRDHWLANNILSENKRVKYVSMQISLQPDSPSNTQH
                     VDSIKYLYKVKAGVAADSFGIHCAKFCDLPQQIINRAKVFAKMLAQGKDLVDELMLLS
                     KEEETQYAIARDVVMQFLTIEFDETEVSPDKSKADIAKFESLIM"
     gene            complement(<109321..>111648)
                     /gene="DBP4"
                     /locus_tag="PVL30_003915"
                     /old_locus_tag="LELG_04190"
                     /db_xref="GeneID:5231341"
     mRNA            complement(<109321..>111648)
                     /gene="DBP4"
                     /locus_tag="PVL30_003915"
                     /old_locus_tag="LELG_04190"
                     /product="ATP-dependent RNA helicase dbp4"
                     /transcript_id="XM_001524170.2"
                     /db_xref="GeneID:5231341"
     CDS             complement(109321..111648)
                     /gene="DBP4"
                     /locus_tag="PVL30_003915"
                     /old_locus_tag="LELG_04190"
                     /note="BUSCO:EOG09260YMF"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent RNA helicase dbp4"
                     /protein_id="XP_001524220.2"
                     /db_xref="GeneID:5231341"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF13959"
                     /translation="MVKSQRNGKKGAKVLSRKEKRQSEKEEMDSLRQRIEEYNPEVDE
                     ASIKHFSDLPITQNTLRGLKECSFVSLTDIQKKSIPVALKGEDLMGTARTGSGKTLAF
                     LIPVIEILLRNDITEYDGLAALIVSPTRELAVQIFEVLAKIGKYNSFSAGLVTGGKDV
                     QYEKERISRMNILVGTPGRISQHLNESVGMETSNLQVLVLDEADRCLDMGFRKQIDNI
                     LNHLPRTRQTLLFSATHTDSVQDLARLSLTNPKRIGTSSDQDISAIPESLDQYYVKVP
                     LNEKLDVLWSFIKSHLKSKILVFFSSSKQVQYAYETFRTLQPGIPLMKLYGRHKQTSR
                     LETTVKFSQAQHACLFATDIVARGLDFPAIDWVIQVDCPEDVATYVHRVGRSARFGRQ
                     GKSLLMLLPTEEDGMLKRMKVHKIEPKMMNIKEKSKKSIRPQLQSLCFKDPVIKNLGQ
                     RAFIAYFRSVYIQKDKDIFKVDELPVEEYAASLGLPGAPKIKIKGGEINKEKKNQSRK
                     LLQLSKADENGELKEDDDKPAKVRTKYDRIFDRKNQTILSEHYLNMTKSAHGGKDDDE
                     DEDFMTVKRQDHELVDDELPDLSLPVSKRQAKKALSRKATLASKGNPTKLKFDDDGVP
                     HAIYELEGEEDFEKAGDAKQQKMEFVQKEQEAMKITDLADREVERQKRQEKKRKRKEI
                     ERRIREEEWDDGSGMDGEDLPDLERDMEPTEAKPKRTSNWFDDDDDDNDGGDEKHGNG
                     KPPVKKAKSDSKYVEFEEPETLEDLESLAATLIGN"
     gene            complement(<112130..>112940)
                     /gene="SRB2"
                     /locus_tag="PVL30_003916"
                     /old_locus_tag="LELG_04191"
                     /db_xref="GeneID:5231407"
     mRNA            complement(join(<112130..112859,112930..>112940))
                     /gene="SRB2"
                     /locus_tag="PVL30_003916"
                     /old_locus_tag="LELG_04191"
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /transcript_id="XM_001524171.1"
                     /db_xref="GeneID:5231407"
     CDS             complement(join(112130..112859,112930..112940))
                     /gene="SRB2"
                     /locus_tag="PVL30_003916"
                     /old_locus_tag="LELG_04191"
                     /codon_start=1
                     /transl_table=12
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /protein_id="XP_001524221.2"
                     /db_xref="GeneID:5231407"
                     /db_xref="PFAM:PF08612"
                     /translation="MVSAVILVQHATPETIIQFEDQLSNELPTRRGNWGFTFKIFRNN
                     SYSVPEAIAGTHERNPTSQFLFTLAPTYLPGSTITIINGHSAGVFCNSIQEEVIELGN
                     NPELSIPDNHLHLGATTGLNDSFDLFLNQKLQSLWTQKQIIKGDGGQIYELENGKVLI
                     KTSNVFMHGSFKGLLVQIEVDDSYRKRGGAISATAVTEREEDANIIRQVLAKYNVPQG
                     KISFDVLDTAASDRYGNLCLQYSRTLDF"
     gene            <113383..>115905
                     /gene="ELP2"
                     /locus_tag="PVL30_003917"
                     /old_locus_tag="LELG_04192"
                     /db_xref="GeneID:5231454"
     mRNA            <113383..>115905
                     /gene="ELP2"
                     /locus_tag="PVL30_003917"
                     /old_locus_tag="LELG_04192"
                     /product="Elongator subunit elp2"
                     /transcript_id="XM_001524172.2"
                     /db_xref="GeneID:5231454"
     CDS             113383..115905
                     /gene="ELP2"
                     /locus_tag="PVL30_003917"
                     /old_locus_tag="LELG_04192"
                     /codon_start=1
                     /transl_table=12
                     /product="Elongator subunit elp2"
                     /protein_id="XP_001524222.2"
                     /db_xref="GeneID:5231454"
                     /db_xref="PFAM:PF00400"
                     /translation="MTSQEVDQKAIFIGTNKQNYVSDYNHEISVVAFGASNTVALWNP
                     LDKSQKGVYHTLKKHTGEVTGVKFLPNTPFLVSVAEDNQVNVWKQKSDKTFYEHFQTL
                     EGHENSVTCIAEINEHVFVTGGADHNIIIWLFDGGEFRLGHKFQVKSNFYPLALAVQN
                     LDDEGNYVLAVGGTTSSIYIYTFQIDKTSIGKFSTSEELMGHEDWVKCLQFVVQSENK
                     DFILASGSQDRYVRLWRLKLNEFIDDSDEDPNKLILLSNKQYKFQYGDNKRAAFSFEA
                     LIMGHDDWISGIQWHPSYKYQKRSSASLSSGSTQAEQKLQLLTATADTALMIWEMDEE
                     SGIWVCVSRLGEMSIKGASTATGASGGFWSCLWFVDPSSQDEYVLASGKTGAIRAYKS
                     TTTGGAGGTSAADSRYFEEVLGVTGAVGPITDVKWSLEGDYFMATSLDQTTRLYAPWK
                     RTKDGESTTTWHEIARPQIHGYDMICLDNITSTKFVSGGDEKILRVFELTKSIDESLK
                     ELSNVNINTENSILPDFASLPVLGLSNKADAQIQEEEKNDDERDDDEKEGEQSDEDKF
                     KEREEGPAGASPHSVPPSESFLQRNSLATETEKLYGHGYEISCCTTSPSGQLIATACR
                     SNNAKHAVIRVFNVSKDYQQSSQVLAGHNLTISSLEFSPDGKYLLAVSRDRQFSLWRV
                     VNEANAEFELLELNAKAHSRIIWDCSWLTVQDYFVTVSRDKQLKLWKVDDANNKVELI
                     NSLKVDEPIISVSAYKGEWEQDKNVVAIGLESGSIKIISVSLQDEGKLEEVYSIGSDL
                     TPSDRISKLSFSNKLIDGVFYLAVGSNDTSVRLYALSKTICQ"
     gene            <116148..>117926
                     /locus_tag="PVL30_003918"
                     /old_locus_tag="LELG_04193"
                     /db_xref="GeneID:5231485"
     mRNA            <116148..>117926
                     /locus_tag="PVL30_003918"
                     /old_locus_tag="LELG_04193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524173.1"
                     /db_xref="GeneID:5231485"
     CDS             116148..117926
                     /locus_tag="PVL30_003918"
                     /old_locus_tag="LELG_04193"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524223.2"
                     /db_xref="GeneID:5231485"
                     /translation="MEKKEEESKVEAEDFQRITALRPYSSMSTLEQVLNSILEKGATK
                     DLLDQLTVLFRDEQARSSEIVFTNLESLVHQFNHVFDEIRSSVKNGSRDPNNEIISSV
                     LKTTINLLADNDTNRAYFTSDKKGVDLFWGNLYEYASIADDNNLVLILLKQFIYNTSN
                     TGLYMEYLRQKGMHRVAYNEFRKSNSALDLPYEFIVAGKSNLDESDKDILKYITSNFK
                     SLYTREALKEDEEEEEEEDEEEEEEEEENRIKLLELVEYAPRNLSTYKDILAILEIEN
                     KSKLARLLMVALSDVFTDTIDDMHFDFIESNNPYVFAAACICIGNCISDVQSSSHAIE
                     TIENKLGMDILMDKFFTGFKITDVIQIQAVHMWVNLMNQSIAKTIIELYSDAIIALTK
                     LVIDNADYYKEIAKTYFKFIKKLVSLSPTQAIPTKFIRQIVKYEDHGNVALMQAKYCL
                     LQRAGTFNNDQSICIDDLVVSCVKHTDNQAILEQVKTLAIFNNLIIEKKIQLAELDKL
                     YLNPLEKILSSLQTKTSEPSSASSASGWGDKILANNLRFLAASTLQVIGEDPDEYSSL
                     KSLCENIIKTVDVSTQTPERKIDELD"
     gene            <118561..>119769
                     /gene="AAT22"
                     /locus_tag="PVL30_003919"
                     /old_locus_tag="LELG_04194"
                     /db_xref="GeneID:5231368"
     mRNA            <118561..>119769
                     /gene="AAT22"
                     /locus_tag="PVL30_003919"
                     /old_locus_tag="LELG_04194"
                     /product="Aspartate aminotransferase/Glutamic oxaloacetic
                     transaminase AAT2/GOT1"
                     /transcript_id="XM_001524174.2"
                     /db_xref="GeneID:5231368"
     CDS             118561..119769
                     /gene="AAT22"
                     /locus_tag="PVL30_003919"
                     /old_locus_tag="LELG_04194"
                     /codon_start=1
                     /transl_table=12
                     /product="Aspartate aminotransferase/Glutamic oxaloacetic
                     transaminase AAT2/GOT1"
                     /protein_id="XP_001524224.2"
                     /db_xref="GeneID:5231368"
                     /db_xref="PFAM:PF00155"
                     /translation="MTVQSIFADLKTEQPDPIILTMQQYAQDNNPAKIDVSIGVYKDE
                     NGACYEFPAITKAKQILAKNDPGHNYTSMSGIADFISGAQRLIFGKEIVSEGKVASLQ
                     TISGTGSLHMAMLFLKEAGFTEYYIGVPTWQNYQPMVESIGCKVAKLYNYYDEKTKSL
                     DFQSIRAAAEAAPQGTVFLLQTCCHNPTGSDLSQDQWVELVKIIKQRKLVPLLDTAYQ
                     GFGSGDLDKDAWPIRYIYSQGLEFVVCQSFSKNMGLYSERVGSCHVVMGDQQYKPAVQ
                     SNLVALFRHESSFAPAFGARLAAIILNNPELEEQWRGEVAECTRRLKELRRAVLDRLT
                     KLGTPGNWTNVVEQNGLFWFSGLTKEQNDKLVAKHVYSTNMGRVNVAGLNFNTVDHFC
                     KAIDQVVRED"
     gene            complement(<120130..>122730)
                     /gene="CAS5"
                     /locus_tag="PVL30_003920"
                     /old_locus_tag="LELG_04195"
                     /db_xref="GeneID:5231363"
     mRNA            complement(<120130..>122730)
                     /gene="CAS5"
                     /locus_tag="PVL30_003920"
                     /old_locus_tag="LELG_04195"
                     /product="Zinc-finger of C2H2 type"
                     /transcript_id="XM_001524175.2"
                     /db_xref="GeneID:5231363"
     CDS             complement(120130..122730)
                     /gene="CAS5"
                     /locus_tag="PVL30_003920"
                     /old_locus_tag="LELG_04195"
                     /codon_start=1
                     /transl_table=12
                     /product="Zinc-finger of C2H2 type"
                     /protein_id="XP_001524225.2"
                     /db_xref="GeneID:5231363"
                     /db_xref="PFAM:PF00096"
                     /translation="MENFLVSSPTQLAQPYNYDDSRYMQSNSGVNLNNDVQSLDYYDD
                     SSENQTFIQQQQQQQQQHNQHSQSQSQSQSQSQSQQQRQQHQQQQTQGSNQNLLPSPQ
                     HQFQQNQSLSFPYSPPNTEDRQEQYPSNQLQHPQANSFPYQHQSQDFYPKHSRDQDHL
                     DYLPNPNFQSDSSYNQKLNDPNLESENEIVPISTKLPDNKVYVTDESGFGINIYDTNH
                     TSFQHSRNISLDGVLHISNQPHNYHNNNNQLQQQQQQPYYRSHQYTDSIASISQDPPI
                     GQIGDMLPQSISSNTLYSLDSVPSFESPLHQQHHHQQQQQQPQSQQQSQHHHNQLFPT
                     SQAQHFTTTPRRVGRNKSASISMYTTPSRVGHPGLSPVNLAASTFANGGANNSNNNNN
                     NNNSSTNAGNSSSCTRVNNRTPANKVVKGHSRTRSRVSLDAAAAALASKTNSASSYNP
                     TLNPFYTPSQFTQRSFDEHEDDLSSTPLVTPGYNKLKQSHSTFFSPIRNDAFDALDDD
                     ETDAVTQLKKAKSYSSLARRHQKRDSLHRPHSQMNSLSENILSGPLLSSQKATADDYQ
                     SQSQSQSQSQSQSQPHLQQGHKIDLLSPEFEDNQSLNYGAYDKSITTNLSQSVSPYNK
                     HKRAPQPQPQPQVNLQYPSASVNLNASFTITQSEEEHFTSNGNSPAATTTTTATTTNT
                     NTNTTTTTPNLLPPMATFSNTSSQRSSKDESVYFDNAKKPNSSKNNRKNKSSGGSVPK
                     SVKSSKSSLSSSSSSGSDGSISSLQDVVDEDGTVTIAIPSDLHVTRPTVRNNRSDKND
                     KVDPKKKHKCPICESRFQRPEHVKRHLKSHSSEKPFQCDEPDCGKCFNRKDNLKAHLK
                     KIHGIIRKPL"
     gene            complement(<128391..>129389)
                     /gene="MDH1_3"
                     /locus_tag="PVL30_003921"
                     /old_locus_tag="LELG_04196"
                     /db_xref="GeneID:5231534"
     mRNA            complement(<128391..>129389)
                     /gene="MDH1_3"
                     /locus_tag="PVL30_003921"
                     /old_locus_tag="LELG_04196"
                     /product="Malate dehydrogenase, cytoplasmic"
                     /transcript_id="XM_001524176.2"
                     /db_xref="GeneID:5231534"
     CDS             complement(128391..129389)
                     /gene="MDH1_3"
                     /locus_tag="PVL30_003921"
                     /old_locus_tag="LELG_04196"
                     /codon_start=1
                     /transl_table=12
                     /product="Malate dehydrogenase, cytoplasmic"
                     /protein_id="XP_001524226.2"
                     /db_xref="GeneID:5231534"
                     /db_xref="PFAM:PF00056"
                     /db_xref="PFAM:PF02866"
                     /translation="MFSKVAARSFSSSATNAYKVAVLGAGGGIGQPLSLLLKLNHKVT
                     DLALYDIKGAPGVAADVSHVPTNSTVKGYNPDQLKEALTGADVIVIPAGVPRKPGMTR
                     DDLFNTNASIVRDLAKAAAEYAPEAALAIISNPVNSTVPIVAEVFKSKGVYNPKKLFG
                     VTTLDVLRASRFVSEVAGTNPVNEHVPVVGGHSGITIIPLLSQTTHKDLPADKRDALV
                     HRIQFGGDEVVKAKDGAGSATLSMAQAGARFTGALLNGLAGEKDVIECTFVESPLFKD
                     EGVEFFSSKVTLGPEGVKQVHDLGNLSDYEDGLVKTAKETLIQNIKKGTEFVKQNP"
     gene            <131167..>133086
                     /gene="TFC1"
                     /locus_tag="PVL30_003922"
                     /old_locus_tag="LELG_04197"
                     /db_xref="GeneID:5231642"
     mRNA            <131167..>133086
                     /gene="TFC1"
                     /locus_tag="PVL30_003922"
                     /old_locus_tag="LELG_04197"
                     /product="tau 95 subunit of transcription factor TFIIIC"
                     /transcript_id="XM_001524177.2"
                     /db_xref="GeneID:5231642"
     CDS             131167..133086
                     /gene="TFC1"
                     /locus_tag="PVL30_003922"
                     /old_locus_tag="LELG_04197"
                     /note="BUSCO:EOG09263GSR"
                     /codon_start=1
                     /transl_table=12
                     /product="tau 95 subunit of transcription factor TFIIIC"
                     /protein_id="XP_001524227.2"
                     /db_xref="GeneID:5231642"
                     /db_xref="PFAM:PF09734"
                     /db_xref="PFAM:PF17682"
                     /translation="MSHSPSPAPMLDGKKLAESHPMDIPHITAVELPLHVKNVNRAIN
                     ALGGKKRISESINHGEPLELRLRNDPFHHPIQASTSNNERVLLKVTMSKKTIQKDEDG
                     KLSLRELIKMNDADPSTPKTRIQPIAIIDKTFRFRAMADFQVITKNSPMVQQFNENVR
                     HPKNFKSVANYVAQHGDMNGYMDLNSEYFKNKDHDLPPPPILSPIRFPFDYNYKMNRA
                     TTTIMDKQSGQKKVVSTKTALKLHTKIIDHTATPPSQPAPDLIQNREMIEKEQHQLPP
                     SHPNSMLLKCIEWLETMFEIKPFWIRKHLMDLAPKEYQKYIKLALPYVTYIYRSGPWR
                     FCNIKLGIDPRSDSKYWKYQSEYFRVLGVRNSSDPNSSSIKRITPPSLEHTLSPDFSQ
                     SENKLELAQNLFFDGTNLPTAVTYQVGDILDLDISSTIESHMKDMGKDFLRKTWDVQD
                     GWLNATTMEVIRKIVRYKLKQLVNEEPIDQNKIYKIINAPREEAFASRVPKVGTTKSN
                     DKNDIDNNNNSDDNIEGEGKEDEEEDEEEDEEDEESVRNEEEEEAELEGDEVHDMTLT
                     EEMISRGEAPYGGTSGAIADRMVDGMNVDKTEEDEGDVDDVISRLNNLNGDAAQKIKH
                     LVKIIKQDDIDYMNE"
     gene            <133467..>133745
                     /locus_tag="PVL30_003923"
                     /old_locus_tag="LELG_04198"
                     /db_xref="GeneID:5231291"
     mRNA            <133467..>133745
                     /locus_tag="PVL30_003923"
                     /old_locus_tag="LELG_04198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524178.2"
                     /db_xref="GeneID:5231291"
     CDS             133467..133745
                     /locus_tag="PVL30_003923"
                     /old_locus_tag="LELG_04198"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524228.1"
                     /db_xref="GeneID:5231291"
                     /db_xref="PFAM:PF08285"
                     /translation="MTKATETALTLFALSALYFALSTGVIVSPKLFHDEILPYLPWWG
                     LVTFGSYALFTLGWGIITFKDKKDKYEELKLQIDEAKAFYSSKGISLD"
     gene            complement(<133997..>134794)
                     /locus_tag="PVL30_003924"
                     /old_locus_tag="LELG_04199"
                     /db_xref="GeneID:5231517"
     mRNA            complement(<133997..>134794)
                     /locus_tag="PVL30_003924"
                     /old_locus_tag="LELG_04199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524179.2"
                     /db_xref="GeneID:5231517"
     CDS             complement(133997..134794)
                     /locus_tag="PVL30_003924"
                     /old_locus_tag="LELG_04199"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524229.2"
                     /db_xref="GeneID:5231517"
                     /db_xref="PFAM:PF09791"
                     /translation="MISRPKSFTRSLATASKLRPTAAKKTSTTEKRKYAYYDLVLRTP
                     THPTHPIESSLMTANELSNLKRHTKTRYEGNYSIDTSITPEERIRRVFGGRIKGEDRT
                     ASSRVERGEPQVIAGITVPSRPPEPDNCCMSGCINCVWELFEEDLKEWNEKREEAAAK
                     LVKMAESRTKSGTKSDEKSLRWPENFHAPLKLLKRENYPESLKDKSDEELFDKSKPGQ
                     SKTADDEKWGDVPVAIRVFAEVEKKLKMKHKRIEEQQTQPQAQSSSA"
     gene            <139136..>140962
                     /gene="PHO89"
                     /locus_tag="PVL30_003925"
                     /old_locus_tag="LELG_04200"
                     /db_xref="GeneID:5231677"
     mRNA            <139136..>140962
                     /gene="PHO89"
                     /locus_tag="PVL30_003925"
                     /old_locus_tag="LELG_04200"
                     /product="Na+/Pi symporter"
                     /transcript_id="XM_001524180.1"
                     /db_xref="GeneID:5231677"
     CDS             139136..140962
                     /gene="PHO89"
                     /locus_tag="PVL30_003925"
                     /old_locus_tag="LELG_04200"
                     /codon_start=1
                     /transl_table=12
                     /product="Na+/Pi symporter"
                     /protein_id="XP_001524230.1"
                     /db_xref="GeneID:5231677"
                     /db_xref="PFAM:PF01384"
                     /translation="MALHQFDYIFAIAMIFAFLDAWNIGANDVANSFSSSVSSRSLKY
                     WQAMILAAIMEFLGAVLVGSRVSDTIRNKIVDVSVFSDEPAVLMLTMATALVGSSTWL
                     TIATSIGMPVSTTHSIVGAVIGAAIAAKGGQNIHWGWSGVSQIIASWFIAPCIAGAFA
                     SIVFLISKFAVLEIKNPRTSLRNAMMLVPILVYAAFSILTMLIVWKGSPKLNLSDLST
                     GAIVGAIFGTGAVACAVYLLFAYPYYYRKLVNEDWTLKWYDIFRGPLLWFKSTDNIPP
                     MPQGHQLTLDYYEGRRYDEAGNLVGSTNASVKCDSVDGKLSDEIESHDGVDYDAEKAN
                     SITVNQLSKEPSAIESKKGSANPTTAAAGTSTTRKYPNKYPEYWKLAKASPKNWPLVC
                     FLVFFHGVRQDIISNQANNKDMLAGDLHKMHTSSKYYDNKIEYMYSLLQAITACTMSF
                     AHGANDIANATGPLATVYLVWTTNTTASKAEVPVWVLCYAAAALVIGLWTFGYRIMAN
                     LGNKLILQSPARGFAIELGAAVTTVMATQLKIPISTTQSAVGATVFVGLCNKEWKSVN
                     WRMVIWCYLGWIFTLPCAGLIAGILNGIILYAPSKGMEYTMS"
     gene            <141812..>142780
                     /gene="CAP2"
                     /locus_tag="PVL30_003926"
                     /old_locus_tag="LELG_04201"
                     /db_xref="GeneID:5231688"
     mRNA            <141812..>142780
                     /gene="CAP2"
                     /locus_tag="PVL30_003926"
                     /old_locus_tag="LELG_04201"
                     /product="F-actin-capping protein subunit beta"
                     /transcript_id="XM_001524181.2"
                     /db_xref="GeneID:5231688"
     CDS             141812..142780
                     /gene="CAP2"
                     /locus_tag="PVL30_003926"
                     /old_locus_tag="LELG_04201"
                     /codon_start=1
                     /transl_table=12
                     /product="F-actin-capping protein subunit beta"
                     /protein_id="XP_001524231.2"
                     /db_xref="GeneID:5231688"
                     /db_xref="PFAM:PF01115"
                     /translation="MSIDKVDASLELLRRLDPRSVSTNLNSICTILAANSNSEDEEGE
                     SAELIEELLSAVDVPLKVAHCTESGKDYLCCDYNRDGDSYRSPWSNQYFPEPEEDDSE
                     SPPPYPSKILRQLEMKANDAFDIYRDLYYEGAGISSVYFWDTAYDDDDEEEDEKQGNN
                     AGRDQGLEDGFAGVVLFKKETSDGSGKWDSIHVLEVIPESSRRVNYKLTTSVILDLKN
                     SNQNIASKSGKNGKGLSLSGSITRQLEQSQVIDLDSGVNLETNHLINIGTLVEKAEYN
                     IRNALQEVYFDKLKDIMLKDLRSLDGASEREIKGSQSDIIKGLQSL"
     gene            complement(<142910..>144619)
                     /gene="TDA11"
                     /locus_tag="PVL30_003927"
                     /old_locus_tag="LELG_04202"
                     /db_xref="GeneID:5231562"
     mRNA            complement(<142910..>144619)
                     /gene="TDA11"
                     /locus_tag="PVL30_003927"
                     /old_locus_tag="LELG_04202"
                     /product="Topoisomerase I Damage Affected"
                     /transcript_id="XM_001524182.2"
                     /db_xref="GeneID:5231562"
     CDS             complement(142910..144619)
                     /gene="TDA11"
                     /locus_tag="PVL30_003927"
                     /old_locus_tag="LELG_04202"
                     /codon_start=1
                     /transl_table=12
                     /product="Topoisomerase I Damage Affected"
                     /protein_id="XP_001524232.2"
                     /db_xref="GeneID:5231562"
                     /translation="MSQFADTTAMETTERKTRDQQRTPSPPKIDYSSKSKDRYSLPKP
                     LHVSRSRTGSVSNSATNNNNGISNSHKPLKLTTTASIAPNAPNAHTALTAPSESTTTP
                     NSNKTQSQPKTKGLNIFAVSPITPSSITKNSALQSDSTDLLKRNGSQSRHQRRRSSII
                     SESSPLPSLIETSDDLSFDEKVSFFGPSSRKSPELKYDVPLPSNEKLREMSIDEQLRL
                     LALKEMCLVEIKDQIQNLNSKLSSHENELHDLRQVIQRSLYQELSGATSNNNGQNDSM
                     NDNDNNNNNNNMDNNNNSNKHNKNNGGNLDRNNNSTTSILSSRQRTNSNPRDQALESL
                     RGRRRASLIGPNKEDEIKKTGEEDSKSKIWSGLTKSLNVLNQLDSFVSNEFEQSLKTN
                     KDGQIAHSEQQQQQQKNHHSSHKPRKSEDSITSVGTVSSPLQSRSARSLSEYRASQDR
                     KSDDMIHTVSSSIWSFVNEVKTNVLASLSEETDYGKPPQSPQSPQPSQPRPSQQRQSQ
                     QNNTIHTLDNGSVVSLDNDRNVVKQVSPNCFDDSELLIDLEDDYEAAAGEKLDLSIYK
                     KME"
     gene            <145850..>147484
                     /locus_tag="PVL30_003928"
                     /old_locus_tag="LELG_04203"
                     /db_xref="GeneID:5231289"
     mRNA            <145850..>147484
                     /locus_tag="PVL30_003928"
                     /old_locus_tag="LELG_04203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524183.1"
                     /db_xref="GeneID:5231289"
     CDS             145850..147484
                     /locus_tag="PVL30_003928"
                     /old_locus_tag="LELG_04203"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524233.2"
                     /db_xref="GeneID:5231289"
                     /translation="MSSMSVSNLMSSSIYNYIDHELETIEDNLENTEREIAKNLQPVY
                     KKVLFHPSLRNWLKWAILFSIFRVQNPVQWANFLSLNKPIRQILTHYKSRIIKLLSYI
                     KRFDSKTPNLQLFIQYFSNLSTCVFLYLASVNNDSVPKDYFAVDFLSTYYGNLNPPSK
                     SQILVTPRFSKYSKLSHYKSSRYYKQIRAIYDHKEYIIFPILYAQLLSNYLTPTKYKL
                     NQRYFSPFIKRNFFNPIWINFSMGVNYNRMDWFNLASTYALQNIVLLVVIAAYNFKEK
                     ILDKFYEMKHGKRSKDEEVPILKNFVVYCAHRSNSILNFIYCPNLISILLIALTARVF
                     KMLTPLSGHYQANMLQTYYLRNKKTFFKTYTKLIGFVAGFLTLGLNSFNLIPDVGYTK
                     PNKRKAEDGYNVSDDDYDAYDNDYYDDDDDDDDDVDDDKVDNHNRYFNKVNEERKKDA
                     TNPPLRLISKEFLSSLDLYLFQVILLSKWRIIKSFHPFFSKVKLKTYNRIETILMCFG
                     FFKYMNLNDFINKTKMADDRERIAGDYTIKAANYVT"
     gene            complement(<147759..>148502)
                     /gene="clc1"
                     /locus_tag="PVL30_003929"
                     /old_locus_tag="LELG_04204"
                     /db_xref="GeneID:5231661"
     mRNA            complement(<147759..>148502)
                     /gene="clc1"
                     /locus_tag="PVL30_003929"
                     /old_locus_tag="LELG_04204"
                     /product="Clathrin light chain"
                     /transcript_id="XM_061119508.1"
                     /db_xref="GeneID:5231661"
     CDS             complement(147759..148502)
                     /gene="clc1"
                     /locus_tag="PVL30_003929"
                     /old_locus_tag="LELG_04204"
                     /note="BUSCO:EOG09264XOC"
                     /codon_start=1
                     /transl_table=12
                     /product="Clathrin light chain"
                     /protein_id="XP_060975491.1"
                     /db_xref="GeneID:5231661"
                     /db_xref="PFAM:PF01086"
                     /translation="MADKFPEIDTHTDDATATDSDFLSREKELVGDEFATDQDKVLQE
                     ESDEEINDFKEQFPEVDGSTHAGFEQSKSVSQGDGHDNEDDNDDDDDDDEFEGFESKS
                     HNASTSGSQVKDLSQSEPIKEWKQRRDLEIEEREKVNSQKKQDILKKAQSTIDDFYEN
                     YNAKKETGSKKLQKEEEEFLKKRDGFLKNGTLWDRVYELIEGVGELNTGDKDKEDPVV
                     SSRDKSRFNEVLKKLKGKADVPGAGGYQE"
     gene            complement(<149256..>151001)
                     /gene="NEM1"
                     /locus_tag="PVL30_003930"
                     /old_locus_tag="LELG_04205"
                     /db_xref="GeneID:5231679"
     mRNA            complement(<149256..>151001)
                     /gene="NEM1"
                     /locus_tag="PVL30_003930"
                     /old_locus_tag="LELG_04205"
                     /product="Nuclear envelope morphology protein 1"
                     /transcript_id="XM_001524184.2"
                     /db_xref="GeneID:5231679"
     CDS             complement(149256..151001)
                     /gene="NEM1"
                     /locus_tag="PVL30_003930"
                     /old_locus_tag="LELG_04205"
                     /note="BUSCO:EOG09263F3I"
                     /codon_start=1
                     /transl_table=12
                     /product="Nuclear envelope morphology protein 1"
                     /protein_id="XP_001524234.2"
                     /db_xref="GeneID:5231679"
                     /db_xref="PFAM:PF03031"
                     /translation="MNSIKVLVHSFDNILPNSVSQNSEQYDKNVEQINELDRAEDETA
                     DAEDSEDAEEEQNSQLKKNSGSFVSKQTALEEEGLNEESCKVLEKDRQHLKEKLTAVK
                     IEENENSLRTTGYHKNNLGEEETKKTKEAEEQDDDEEDEEEEDEEEENAITNSEEINL
                     IGSETRLNDATLVDQPESAYSVLLSILYTMWTIISFLPKYLIVKPITLAFKIILYPFV
                     LIKASLGFGDKQSIESPQFPFNEKESTYDSSNQEDEEEEADDPLVTREKPSSSSSSSS
                     TSSSSFSSSSPTPLSPSKQRRGELENLSEQDEYQHDDDDVEDKKLRQLKKDSIMANEV
                     KSPTSFSKYLIPPPIRLYPLSRNPHKKNKKKILILDLDETLIHSLSRGSPRSFHSSGS
                     HCKMIEIRINNMSSLYYVHKRPYCDYFLREISKWFELQIFTASVKEYADPIINWLEEE
                     ISDSLNKQKNLQQSGGGHGGGHGGGSLKSTRQKIFTKRYYRNNCSYRPGVGYIKDLSK
                     YIRDDELKNVMILDNSPISYALHEDNAISIEGWINDQNDRDLLNLLPLLHSLSLCIDV
                     RFILGLKNGEKLFES"
     gene            complement(<153432..>155681)
                     /locus_tag="PVL30_003931"
                     /old_locus_tag="LELG_04206"
                     /db_xref="GeneID:5231361"
     mRNA            complement(<153432..>155681)
                     /locus_tag="PVL30_003931"
                     /old_locus_tag="LELG_04206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524185.2"
                     /db_xref="GeneID:5231361"
     CDS             complement(153432..155681)
                     /locus_tag="PVL30_003931"
                     /old_locus_tag="LELG_04206"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524235.2"
                     /db_xref="GeneID:5231361"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF05495"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF14599"
                     /translation="MTNIKYKEPSLNRHNREDPIGTPISHAKNEEMKNEEKPKVEEDG
                     EEEEEEGVNAMAEDLDQIGLINLSYFLDKINFNLPNFDLKNISNEINKQVDKYKSYYR
                     GYNNGSMAEDGDHDTSSGIDGGVDLVNGVRGDAAHILNSLKTILNTRLQIKQFSSDLT
                     AALDKLQPITEVIHRAVTLPADDSSDFEDNDIDSDIDSDIVFDEDKGQKGKSKDVELG
                     SEAEMDPEVQKVADAIGLSDVISSGQEYIAKFIKQVTGSTTSLDANNNDYKDHTPQHL
                     DMDNQTNHVPLDQVEGLSSELIKELTEVECMNDFKKEEILRSKILAIQQLSIDQTAKN
                     RLMTKLMMGNYCKYINQQLKVEKRRLSNLLEDQRDVFVGERNGRAIGSTNDGAAIYDE
                     ADQKGYNNLINNEGVNGGNYNHNDNDNDENENENENGNGNEIEDADEDADEVIITEED
                     QQVSYNDAINNILGCHHYQRSCKLECATCHKWYTCPFCHDAQTRDHKMVRNQVRHILC
                     MHCKTPQNIESKFCVNCEKELANYFCSKCVLYDDDPNKDIYHCDKCGICRLGLGLDKD
                     YFHCDVCNICLSIDLKDKHKCVTNTTHCNCTICNEYLFTSVQKVVFMKCGHSIHQHCY
                     DELIKHSYKCPICKKSIANVDNQFRLLDQEISQSPMPEPYNEWMCTITCNDCKGKSNC
                     QYHVLGLKCKYCKSYNTNQVKIKKPNEPEEEPAANEVHDFDANIMRLVSTNLQSNFGI
                     DLQHGVSLE"
     gene            <156199..>159948
                     /locus_tag="PVL30_003932"
                     /old_locus_tag="LELG_04207"
                     /db_xref="GeneID:5231733"
     mRNA            <156199..>159948
                     /locus_tag="PVL30_003932"
                     /old_locus_tag="LELG_04207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524186.2"
                     /db_xref="GeneID:5231733"
     CDS             156199..159948
                     /locus_tag="PVL30_003932"
                     /old_locus_tag="LELG_04207"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524236.2"
                     /db_xref="GeneID:5231733"
                     /translation="MGDLSPKSKSASIKQNAVANQHDSKEPDQLQQEDTRNKDRDKTP
                     HISAVEGNGYSIHIGKESCTKTVNAIGENEQKFLTSNTNGWIHGYRVPFSLITYKRSL
                     DTSTKIRLDKSYRDFQFIFNPKYHLDEIEHSGFGRKSSDVSFSQEDYSPNSSPRSQKI
                     YKPGSTSDSDAFMGYVSFPRVSFNVPNHVRRDKRRLRQVSEIPQLCYQTSFPVGDLTY
                     LFGGLFVSKFTTFDDIGLPRNVDLNKISVHFPYELPPFVNTKLLTSPFLQKHPSLFIM
                     NSLNNTVTDFDISNSGDFPGHLSAMVATKITPEHFFFYGGFEIIDESVSYHPTIDRWI
                     IRKKLVMNQDGYILNTVNFKFTKIKLEPSNASVKIARIGSGACANIFEPFSKQQSRAL
                     SDIKLNHANISAENQRPSSPVAFSRARSSHWSSETSSVHTPIPPQPQKSSASVKSKTT
                     EAELMTTTAAMTETATTTPATTPTPTPPATTTTTTTTTSASAMANTESKRLSSPNSNK
                     GSESSTSTSSAASKDSGADFSVTRTRSVRQPNLHRVATTKSYDFAKNESPVSNTSSSG
                     PTSVSENASASPSISMPTPTSSTTFDKFKKRFHRSNMKNTYSQSVRNHRSNSFSNKND
                     ANNNAQNNTNGNNSNNNSGNNSTANSATPSPVLKTTRPIIGSLNNVITNLTVFPISSK
                     PVDLNSHSQASYKSAKASRTPSSSSIKFTNAGETAHKQPPKLSVQTSNFEQHSKTLDS
                     LPDTIASLQHNKQDSSQTPHHKFAPPKRAKTMDNEIIEVETIRQNMPSLKTHTFDYQA
                     IDTDLSSHTDVDEENGGVKPSRNTHSKVGKLFNDVLTNISVFIYGGFVLNDEEENENE
                     DDREEQETKKEENVLGSSSNVRKFYATNDFLKIDLSTTEENPKSLERMTFLDSALVMK
                     IGSDPKTCDICLDEDINWPTPRGYFASSMIDISNDVGEKCNLEIAKVPKHPLNPLAEK
                     RPQSPDISIGGSSGSTGAAGIAVDSARASLEQSDVSLGQVRSYFSGRAFVVQGGCTED
                     NQFFGDFYKFVFDTCKWEKMPTYTFDYFQKPLLPGEDDDATYYTKENTVDKPHLMEAE
                     FRSCHHTCLYYQNEEHDYLFFIGGIVNEYLRFVDPKPYVTDKFDVSRISALQVASSNP
                     YIMRFAVLNLRTQTWKYIRYFFDFNHAITNSYLDRLKDKDYYINSRLLHFAGTVSLTG
                     KIITVAQGLFIISPEKKEDLKNVRDDIPPDEALLGAHIQFTLAGL"
     gene            <160361..>160639
                     /gene="TIM10"
                     /locus_tag="PVL30_003933"
                     /old_locus_tag="LELG_04208"
                     /db_xref="GeneID:5231322"
     mRNA            <160361..>160639
                     /gene="TIM10"
                     /locus_tag="PVL30_003933"
                     /old_locus_tag="LELG_04208"
                     /product="protein transporter tim10"
                     /transcript_id="XM_001524187.1"
                     /db_xref="GeneID:5231322"
     CDS             160361..160639
                     /gene="TIM10"
                     /locus_tag="PVL30_003933"
                     /old_locus_tag="LELG_04208"
                     /codon_start=1
                     /transl_table=12
                     /product="protein transporter tim10"
                     /protein_id="XP_001524237.1"
                     /db_xref="GeneID:5231322"
                     /db_xref="PFAM:PF02953"
                     /translation="MFGLGGTATPQISSQAKLAAAEAELDMVTGMFNSLVSQCHNKCI
                     NKSYNESDITKQESLCLDRCVAKYFETNVQVGENMQKLGQSGQFMGRR"
     gene            complement(<160988..>161908)
                     /gene="CYT2"
                     /locus_tag="PVL30_003934"
                     /old_locus_tag="LELG_04209"
                     /db_xref="GeneID:5231739"
     mRNA            complement(<160988..>161908)
                     /gene="CYT2"
                     /locus_tag="PVL30_003934"
                     /old_locus_tag="LELG_04209"
                     /product="Cytochrome c1 heme lyase"
                     /transcript_id="XM_001524188.2"
                     /db_xref="GeneID:5231739"
     CDS             complement(160988..161908)
                     /gene="CYT2"
                     /locus_tag="PVL30_003934"
                     /old_locus_tag="LELG_04209"
                     /codon_start=1
                     /transl_table=12
                     /product="Cytochrome c1 heme lyase"
                     /protein_id="XP_001524238.2"
                     /db_xref="GeneID:5231739"
                     /db_xref="PFAM:PF01265"
                     /translation="MGNEDSQPKCPVDHSSRQTWLSSLLWKSNESAQRPQANTSTSTT
                     TSQCPVPHQASHPAPTQDQPVCPVSPSSRQAWLDKVSVTVTAPDAIESPSHASHASRA
                     PASTSPPLPIANTSTDSTTCDSSVLMNDTSVKDNTTSNVDLPVEREISSIPRTSSSSN
                     WIYPSQKQFFEAMQRKNWNPDTSDMKVIVPIHNLVNERAWKHILMWEQPYNEQATKEC
                     GGITLTSFKGDSKKMTPRAWLRSVIGGQQPPFDRHDWLVNRCGTEVEYVIDFYNGEEQ
                     GDANVWLDVRPKLNSWEGIKLRCMKAFGLS"
     gene            complement(<162536..>163513)
                     /gene="ERV29"
                     /locus_tag="PVL30_003935"
                     /old_locus_tag="LELG_04210"
                     /db_xref="GeneID:5231455"
     mRNA            complement(<162536..>163513)
                     /gene="ERV29"
                     /locus_tag="PVL30_003935"
                     /old_locus_tag="LELG_04210"
                     /product="ER-derived vesicles protein erv29"
                     /transcript_id="XM_001524189.2"
                     /db_xref="GeneID:5231455"
     CDS             complement(162536..163513)
                     /gene="ERV29"
                     /locus_tag="PVL30_003935"
                     /old_locus_tag="LELG_04210"
                     /codon_start=1
                     /transl_table=12
                     /product="ER-derived vesicles protein erv29"
                     /protein_id="XP_001524239.1"
                     /db_xref="GeneID:5231455"
                     /db_xref="PFAM:PF02077"
                     /translation="MSYRGPNQFQNQFGQPHQQHHSIPTAAAAAAAANSQPHPHPHIG
                     PISSSKSPLEQFEQFSKKIEDLIDEYFKPLKPYVPAIGRAFLVATFYEDTIRIFSQWN
                     EQVYYLHNYRHYWRWLTVIFLINNMLIMTIASTLVIIRKKINIATVGLIFVVVIQGVA
                     YGLLFDTQFILRNLSVVGGLVLAFSDSIVRDKRSLNMPGLPMLDNKDHKKYFLLAGRL
                     LLVLLFLGFVFSSEWSLGRVLIILVGLTSCASIVVGYKTKFAAAVMLILLFFYNVFTN
                     QFWQYASKDARRDFLRYEFFQVLSIVGGLLLVVNAGAGELSIDEKKKIY"
     gene            complement(<165091..>165825)
                     /gene="SKI6"
                     /locus_tag="PVL30_003936"
                     /old_locus_tag="LELG_04211"
                     /db_xref="GeneID:5231564"
     mRNA            complement(<165091..>165825)
                     /gene="SKI6"
                     /locus_tag="PVL30_003936"
                     /old_locus_tag="LELG_04211"
                     /product="Exosome non-catalytic core component"
                     /transcript_id="XM_001524190.2"
                     /db_xref="GeneID:5231564"
     CDS             complement(165091..165825)
                     /gene="SKI6"
                     /locus_tag="PVL30_003936"
                     /old_locus_tag="LELG_04211"
                     /note="BUSCO:EOG0926407T"
                     /codon_start=1
                     /transl_table=12
                     /product="Exosome non-catalytic core component"
                     /protein_id="XP_001524240.2"
                     /db_xref="GeneID:5231564"
                     /db_xref="PFAM:PF01138"
                     /db_xref="PFAM:PF03725"
                     /translation="MSRMELYSPEGLRIDGRRWNELRRFECRINTHPNSSDGSSYVEQ
                     GNTKVICTVIGPMEPTSRAQMNQDRANVEVNLTIANFSTFERKKRSKTEKRLVELRTT
                     LERTFEQSILLHLYPRTNITINVQVLNQDGGMLAAVTNSITLALMDAGIAMYDYVSSI
                     SCGLHDQSPLLDLNNLEENDMSCLTIGVIGKSEKLALLMLEDKMPLDNLEKVLGIAIA
                     GSHRIKDLMDMEVRRHGSARAAKLVK"
     gene            complement(<166241..>167377)
                     /gene="GPI14"
                     /locus_tag="PVL30_003937"
                     /old_locus_tag="LELG_04212"
                     /db_xref="GeneID:5231676"
     mRNA            complement(<166241..>167377)
                     /gene="GPI14"
                     /locus_tag="PVL30_003937"
                     /old_locus_tag="LELG_04212"
                     /product="GPI mannosyltransferase 1"
                     /transcript_id="XM_001524191.2"
                     /db_xref="GeneID:5231676"
     CDS             complement(166241..167377)
                     /gene="GPI14"
                     /locus_tag="PVL30_003937"
                     /old_locus_tag="LELG_04212"
                     /note="CAZy:GT50; BUSCO:EOG09261XAF"
                     /codon_start=1
                     /transl_table=12
                     /product="GPI mannosyltransferase 1"
                     /protein_id="XP_001524241.2"
                     /db_xref="GeneID:5231676"
                     /db_xref="PFAM:PF05007"
                     /db_xref="PFAM:PF06728"
                     /translation="MPVKYTDIDYLVFSDASKYVYNGMSPYMRETYRYTPVLAWLLLP
                     NNWSGVWCHYGKVVFILGDLVTGYIITKLLSQSKLNQRKITEKRKLIYASIWLLNPMV
                     ITISTRGSSESVLTSMIMMSLYYLLSTSNENLVVSAIWLGIAIHFKIYPVIYLPSILY
                     YLSDKVETPLVGISSLKINWKNITFLLVTCASFSTLTALMYLIYGQEFLDETYLYHLT
                     RLDHRHNFSIYNVLLYYKSAVLGSSPLSTGYDIEKLAFIPQLMISGIVIPLLLAKQDL
                     ISCLFIQTFVFVAFNKVITSQYFIWFLIFLPHFLTRSNLATTRKTRGTIILLLWIGSQ
                     ACWLYNAYRLEFLGENTFDYALLYSAVFFFLSNCICIREFIASV"
     gene            <167868..>168434
                     /locus_tag="PVL30_003938"
                     /old_locus_tag="LELG_04213"
                     /db_xref="GeneID:5231586"
     mRNA            <167868..>168434
                     /locus_tag="PVL30_003938"
                     /old_locus_tag="LELG_04213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524192.2"
                     /db_xref="GeneID:5231586"
     CDS             167868..168434
                     /locus_tag="PVL30_003938"
                     /old_locus_tag="LELG_04213"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524242.2"
                     /db_xref="GeneID:5231586"
                     /db_xref="PFAM:PF17733"
                     /translation="MSNPQEQAYIEFLNYDWEKSEDFQKHLKELGLAAGVTSNSTSAA
                     DSNQLIEQAKSFFFCQETGHILSLDDYEDWKLHNGDKYDRNAKIIEIAEDEDLKSNND
                     KASKETSSSARATNIEESGQANSSNGDENGEDGEPPYSSNYQNLVELIMTGKPVPGIK
                     EIPDTVLRDQGSVSHEQQRKKPWEQSQN"
     gene            complement(<168673..>169608)
                     /locus_tag="PVL30_003939"
                     /old_locus_tag="LELG_04214"
                     /db_xref="GeneID:5231362"
     mRNA            complement(<168673..>169608)
                     /locus_tag="PVL30_003939"
                     /old_locus_tag="LELG_04214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524193.2"
                     /db_xref="GeneID:5231362"
     CDS             complement(168673..169608)
                     /locus_tag="PVL30_003939"
                     /old_locus_tag="LELG_04214"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524243.2"
                     /db_xref="GeneID:5231362"
                     /db_xref="PFAM:PF00153"
                     /translation="MSVVELEEEIWVNQEKHVPNQPSKYLGFVAGMASGVMKNLVGHP
                     FDTIKVRLQTSPKGMFNGPMDCLLQTVRKEGVLGLYKGFTPPLVGWVLMDSVMLGSLH
                     VYRRWCKEFIYPEDKKLPLLGHIIAGLGSGMTVSFVAAPIEQFKARLQVQYDSKTRLY
                     SGPIDVAVKLYKTSGIRGIYSGLFATMMFRTNFIFWWGSYEIFTQWFEEHTKMSKPSI
                     NFWSGGLSATVFWIFAYPADVVKQTIMTDSPVPSQKKFPHYMDAVRYIYETRGLRGFT
                     RGFLPSILRSFPANAAALAAFEAVMRFFTKDGHRI"
     gene            <170177..>171268
                     /gene="HGH1"
                     /locus_tag="PVL30_003940"
                     /old_locus_tag="LELG_04215"
                     /db_xref="GeneID:5231732"
     mRNA            <170177..>171268
                     /gene="HGH1"
                     /locus_tag="PVL30_003940"
                     /old_locus_tag="LELG_04215"
                     /product="Protein hgh1"
                     /transcript_id="XM_001524194.2"
                     /db_xref="GeneID:5231732"
     CDS             170177..171268
                     /gene="HGH1"
                     /locus_tag="PVL30_003940"
                     /old_locus_tag="LELG_04215"
                     /note="BUSCO:EOG09262F7P"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein hgh1"
                     /protein_id="XP_001524244.2"
                     /db_xref="GeneID:5231732"
                     /db_xref="PFAM:PF04063"
                     /db_xref="PFAM:PF04064"
                     /translation="MPTELEELVGFLHSPQPAVVQIALDNLVGYSTGPTQQIFRYDNY
                     EAIKDLKRLSKSDSKTTVAQSVTILANLCEDIAMRNLIVENLEFLKFLVSRIIRIKNT
                     NADIMCILLTNLAKNDLINKILEFEVDFTDEEEKKVFSSSKALDCLMDCFVKGYDRKL
                     NPYANYDYLAYFFADLSRFQQGREYFITEQVYDSVVPISKLLVFTEKYDDKIRREGVA
                     STIKNSLFDTNAHMKLLTDPKINILPFLLLPLAGPEEIDEDEMFDLPDELQLLPPDKK
                     REPLAGIQCIHLESILLLCTTRSAREYLREKQVYAIIRELHKATTSDKVADLCDRVVQ
                     MLKRDEAPETAEIEELESDEDDDKIVEIL"
     gene            complement(<171315..>173366)
                     /gene="TFG1"
                     /locus_tag="PVL30_003941"
                     /old_locus_tag="LELG_04216"
                     /db_xref="GeneID:5231751"
     mRNA            complement(<171315..>173366)
                     /gene="TFG1"
                     /locus_tag="PVL30_003941"
                     /old_locus_tag="LELG_04216"
                     /product="transcription factor IIF subunit tfg1"
                     /transcript_id="XM_001524195.1"
                     /db_xref="GeneID:5231751"
     CDS             complement(171315..173366)
                     /gene="TFG1"
                     /locus_tag="PVL30_003941"
                     /old_locus_tag="LELG_04216"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor IIF subunit tfg1"
                     /protein_id="XP_001524245.2"
                     /db_xref="GeneID:5231751"
                     /translation="MSQQVPQVKTEPGIKKEPGTENNEEWQTIPLKSYGPEDVDENTR
                     IHIMKLISRNDVNIVKDFEKPVRLHRKDPRNMQFHLTRQELDQRKREKEEAEKQNATK
                     QETKKGKGEGKDKDKGKGKDKENENENENGGENEKEQEEGNTEGDGKSDVKSDKAKEE
                     IKSKIAPEEGKLMRGQADLSQVAPDGGARKNKKNLFKRKTKQINLMDEAKRKLRYEEH
                     YPWVIEDYTGKNVYVGNYEAGSTESSHVLFVFDKDGFKMIPAEKVYRFTPRNKYATLT
                     LEEAEQKMEKNSSVPRWLMKHIENDSIAEGSPDQRFRNNSPSANGRVINDNTRGRRMR
                     TVIGGSSSSGHTNSGSGKDRDSDHDDLDFEEEFADDEEAPIMDGDEEENKMSERKIKK
                     EMLRAAHLNADEDADVEDDLDDLFETEKSRKVDKEGKKLKKMLNKREGGIYDSDDEER
                     ELLPYLSKSDLESDEESDNEIKVKQEPNQEEAGSGATSGPGAGESVGPAMRHITAAYL
                     GDGFVTISAPKEFLSTFPAGEWVPNGRKRPTSPIGVEMASPQKKSKTGNVSSSDKDKD
                     IDKDNKNNNDNNKENENNASMNTVTVKREPSREPVSRSASPVNAEGSTYDLNDAGPSN
                     LLVTVNEILSIVKDRPLTTKELLLGLKNRISAHADNKQRIIAIVKQNLKLVDGKLALR
                     E"
     gene            complement(<173834..>175111)
                     /gene="ERG8"
                     /locus_tag="PVL30_003942"
                     /old_locus_tag="LELG_04217"
                     /db_xref="GeneID:5231420"
     mRNA            complement(<173834..>175111)
                     /gene="ERG8"
                     /locus_tag="PVL30_003942"
                     /old_locus_tag="LELG_04217"
                     /product="phosphomevalonate kinase"
                     /transcript_id="XM_001524196.2"
                     /db_xref="GeneID:5231420"
     CDS             complement(173834..175111)
                     /gene="ERG8"
                     /locus_tag="PVL30_003942"
                     /old_locus_tag="LELG_04217"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphomevalonate kinase"
                     /protein_id="XP_001524246.2"
                     /db_xref="GeneID:5231420"
                     /db_xref="PFAM:PF00288"
                     /db_xref="PFAM:PF08544"
                     /translation="MTKAFSAPGKALLAGGYLVLDPQYDAYVVALSSRMYAVIDSNGE
                     NLHLTNSKVIITSPQFQNGEWEYHFEKSADYKHPMETKKNGNPFLEATLATILSYTQP
                     NSHFDLKITIFSDPGYHSQTNTSEKHSVNGKKTFLYHSQEINKVPKTGLGSSAGLVTV
                     VTTALMSYFQPGSEDSLDLIHNLAQVAHCKAQNKIGSGFDVAAAVYGSIIYRRFQPSV
                     VTDILDKLYADPHAAKLAIDGDWEFKHAKCALPPSIRLMMGDIQGGSETPKMVSKVLQ
                     WRSECPERAKKVYKSLNDANVGFTNVIGSLSQDSMNITKDQRRAISEAIQRIRQGLKE
                     LTAGADVPVEPPIQTTLLDNVSQINGCLGGVVPGAGGYDAVAVLVLAEYMDTIKESTK
                     TSPELYNFVQWVDLHEEAEGLRKEDISDFNGLI"
     gene            <175449..>176789
                     /gene="TYR1"
                     /locus_tag="PVL30_003943"
                     /old_locus_tag="LELG_04218"
                     /db_xref="GeneID:5231355"
     mRNA            <175449..>176789
                     /gene="TYR1"
                     /locus_tag="PVL30_003943"
                     /old_locus_tag="LELG_04218"
                     /product="prephenate dehydrogenase (NADP(+))"
                     /transcript_id="XM_001524197.1"
                     /db_xref="GeneID:5231355"
     CDS             175449..176789
                     /gene="TYR1"
                     /locus_tag="PVL30_003943"
                     /old_locus_tag="LELG_04218"
                     /note="BUSCO:EOG09262CBI"
                     /codon_start=1
                     /transl_table=12
                     /product="prephenate dehydrogenase (NADP(+))"
                     /protein_id="XP_001524247.2"
                     /db_xref="GeneID:5231355"
                     /db_xref="PFAM:PF03807"
                     /translation="MSSDKSKELENEWKKSKVIGIIGLGDMGFLYARRFSAAGWRVIG
                     CDREDVYDELSDKYKDEKFQVRRNGHLVSRESDYIIYSVEAENIKKIVSLYGPSTKYG
                     AIVGGQTSCKAPEIEAFEKFLPSDTQIISLHSLHGPKVNTTGQPLVIIAHKAESESVQ
                     FVRSLVSCLNSKIVELTAKEHDRITADTQAVTHAAFLSMGVAWRTSNQYPWQVPKWVG
                     GIENAKINISMRIYSNKWHVYAGLAITNPSAHDQVLQYSKSTTELFTLMIQGKKEELN
                     QRLQKVKDFLFHHISDHNLLLDDNILEKFSLSKTPPEGKQPNSHLSLLAIADSWYNLG
                     ISPYDHIICSTPLFRIFLGVTEYIFCTPRLLEESIDVAANDPTFRQDDLHFTIAAESW
                     AKIIKFGNFDLYREEFNKTQAFFQPMFQEANSIGNEMIRTILDRVKEREKERGE"
     gene            complement(<177160..>177717)
                     /gene="ARL1"
                     /locus_tag="PVL30_003944"
                     /old_locus_tag="LELG_04219"
                     /db_xref="GeneID:5231388"
     mRNA            complement(<177160..>177717)
                     /gene="ARL1"
                     /locus_tag="PVL30_003944"
                     /old_locus_tag="LELG_04219"
                     /product="Arf GTPase arl1"
                     /transcript_id="XM_001524198.1"
                     /db_xref="GeneID:5231388"
     CDS             complement(177160..177717)
                     /gene="ARL1"
                     /locus_tag="PVL30_003944"
                     /old_locus_tag="LELG_04219"
                     /codon_start=1
                     /transl_table=12
                     /product="Arf GTPase arl1"
                     /protein_id="XP_001524248.1"
                     /db_xref="GeneID:5231388"
                     /db_xref="PFAM:PF00025"
                     /db_xref="PFAM:PF00071"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF04670"
                     /db_xref="PFAM:PF08477"
                     /db_xref="PFAM:PF09439"
                     /translation="MGQAFSFANIFGKLWSTNKEIRILILGLDGAGKTTILYRLQMGE
                     VVTTKPTIGFNVETLKYKNITLNIWDLGGQTSIRPYWRCYYSNTSAVIFVVDSTDKDR
                     IDTACKELHTMLKEEELQDSALLVFANKQDQPGAMTAAEVSQALSLTDLKDRSWSIVA
                     SSAIKGEGLTEGLDWLMDVIKDEQL"
     gene            <178435..>179151
                     /locus_tag="PVL30_003945"
                     /old_locus_tag="LELG_04220"
                     /db_xref="GeneID:5231667"
     mRNA            <178435..>179151
                     /locus_tag="PVL30_003945"
                     /old_locus_tag="LELG_04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524199.2"
                     /db_xref="GeneID:5231667"
     CDS             178435..179151
                     /locus_tag="PVL30_003945"
                     /old_locus_tag="LELG_04220"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524249.2"
                     /db_xref="GeneID:5231667"
                     /db_xref="PFAM:PF04979"
                     /translation="MSEHQPRGILRNKSVSGESGDQVSQHSPQSHQIPDKLDRQEVIK
                     NTRLNAQLKSESARGDAIRAKIAEEKRKQGIDPDDLSQSPHEHLKWDEVNIYKNEQEK
                     SATMKIDEPKTPYEGGFNPEGEYYKDDDNEDGENGETDIPEFELGEGEYDKLSQDAHS
                     SSLHGGQVIKDESQNQEQDWDQNRDAEEEQDQEPLSAEERHRRFEEKRKEHYHLKALP
                     LKHKIDIPDEDDTDGNANDE"
     gene            complement(<179364..>180650)
                     /gene="zuo1"
                     /locus_tag="PVL30_003946"
                     /old_locus_tag="LELG_04221"
                     /db_xref="GeneID:5231672"
     mRNA            complement(<179364..>180650)
                     /gene="zuo1"
                     /locus_tag="PVL30_003946"
                     /old_locus_tag="LELG_04221"
                     /product="Zuotin"
                     /transcript_id="XM_001524200.2"
                     /db_xref="GeneID:5231672"
     CDS             complement(179364..180650)
                     /gene="zuo1"
                     /locus_tag="PVL30_003946"
                     /old_locus_tag="LELG_04221"
                     /note="BUSCO:EOG092634M1"
                     /codon_start=1
                     /transl_table=12
                     /product="Zuotin"
                     /protein_id="XP_001524250.1"
                     /db_xref="GeneID:5231672"
                     /db_xref="PFAM:PF00226"
                     /db_xref="PFAM:PF16717"
                     /translation="MSIVLPAGDASGFKAVGKYSAPVRRPIEPVGRYFLAHASRTLRG
                     HTWSEFEKIEAEKNVKQIEEDEDDDLGDEEQSEELLEHDPREWKTANLYAVLGLSHLR
                     YKATEDQIRRAHRKQVLKHHPDKKSASGGLEHDSFFKIIQKAFEVMLDPVKRKQYDSV
                     DTESDPQPPSPKTNYDFFEVWGPIFESEGRFSNKQPVPSLGGPDATKDEVDAFYNFWG
                     KFDSWKTFEFKDEDVPDDTANRDHKRYIERKNVAARKKFKQEDNKRVIGLVERAYSED
                     PRIKAFKEAAKKAKAAKKWEQEAGSRKAAEEAAAKKAAEEEAAKKAAEEAANAKANSK
                     KAKEAAKAAKKKNKRNIRAAVKDNGYFGDEAKSSVIDADVDLLIEKFDDVKLGEVASS
                     LKDADATTTKSVIENAAKDLVSAGSLEKSYLKYFQL"
     gene            complement(<181003..>181758)
                     /locus_tag="PVL30_003947"
                     /old_locus_tag="LELG_04222"
                     /db_xref="GeneID:5231631"
     mRNA            complement(<181003..>181758)
                     /locus_tag="PVL30_003947"
                     /old_locus_tag="LELG_04222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524201.1"
                     /db_xref="GeneID:5231631"
     CDS             complement(181003..181758)
                     /locus_tag="PVL30_003947"
                     /old_locus_tag="LELG_04222"
                     /note="BUSCO:EOG0926400M"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524251.2"
                     /db_xref="GeneID:5231631"
                     /db_xref="PFAM:PF01172"
                     /db_xref="PFAM:PF09377"
                     /db_xref="PFAM:PF20268"
                     /translation="MAVINQPNSQIRLTNVSLVRMKKGKKRFEIACYQNKVQDWRSKI
                     EKDLDEVLQIPQVFINVSKGQVANNDDLMKAFGTTDQDEIVLEILNKGEIQLNEKERN
                     ANLQQKQNEFLTIISTKCINPRSKKRYPPTMIEKALNEIKFHLNPTKTTKTQALEAIK
                     ALVEKQIIPIARAQMKVKINLTKKAYQKAYENDIKPAIDHLEELENDGKMYEIVGIID
                     PMNYRVLVNLFEEKELKNEGSVEVLDMSAVKET"
     gene            complement(<182387..>182927)
                     /gene="QCR9"
                     /locus_tag="PVL30_003948"
                     /db_xref="GeneID:85890385"
     mRNA            complement(join(<182387..182578,182922..>182927))
                     /gene="QCR9"
                     /locus_tag="PVL30_003948"
                     /product="qcr9 subunit 9 of the ubiquinol cytochrome-c
                     reductase complex"
                     /transcript_id="XM_061119509.1"
                     /db_xref="GeneID:85890385"
     CDS             complement(join(182387..182578,182922..182927))
                     /gene="QCR9"
                     /locus_tag="PVL30_003948"
                     /codon_start=1
                     /transl_table=12
                     /product="qcr9 subunit 9 of the ubiquinol cytochrome-c
                     reductase complex"
                     /protein_id="XP_060975492.1"
                     /db_xref="GeneID:85890385"
                     /db_xref="PFAM:PF05365"
                     /translation="MLTVLGRLLERNSIYVGTIFAGAFAFQGFFDVAINRWWDAHNHA
                     KLWSTVKSNFIEGGDDDEDDE"
     gene            complement(<183303..>184589)
                     /gene="TYS1"
                     /locus_tag="PVL30_003949"
                     /old_locus_tag="LELG_04223"
                     /db_xref="GeneID:5231708"
     mRNA            complement(<183303..>184589)
                     /gene="TYS1"
                     /locus_tag="PVL30_003949"
                     /old_locus_tag="LELG_04223"
                     /product="Tyrosine--tRNA ligase cytoplasmic"
                     /transcript_id="XM_001524202.2"
                     /db_xref="GeneID:5231708"
     CDS             complement(183303..184589)
                     /gene="TYS1"
                     /locus_tag="PVL30_003949"
                     /old_locus_tag="LELG_04223"
                     /codon_start=1
                     /transl_table=12
                     /product="Tyrosine--tRNA ligase cytoplasmic"
                     /protein_id="XP_001524252.2"
                     /db_xref="GeneID:5231708"
                     /db_xref="PFAM:PF00579"
                     /translation="MASLSSQEQYDLITKGLQEVLNGQIIKDVLEKEQRPVKIYWGTA
                     PTGKPHCGYFVPMVKLAHFLKAGCEVTVLLADLHAFLDNMKASLEVVQYRAKYYEYVV
                     KAILRSINVPIEKLKFVIGSSYQQDGPYIMDLFKMSNVVSQNDAKRAGADVVKQVANP
                     LLSGLIYPLMQAIDEEHLKVDAQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPG
                     LGQGGKMSASDPNSKIDIIEEPKVVKKKVNSAYCAPGDVKDNGLIAFLEYVVQPIHEL
                     KTGVNGAFELTIDRPEKYGGLISYDSLDKLKKDYEEGSLAAPDLKSGVADKINELLAP
                     IRAEFEQSEEFQAAQKNGYPVEVPKEQKKVKKPKNKGTRHPGAAKTGAASTETTQSVE
                     KDAESTEITESAATATEKKEGEVEAVSAAVEEVKLN"
     gene            <185120..>190618
                     /gene="UBR1"
                     /locus_tag="PVL30_003950"
                     /old_locus_tag="LELG_04224"
                     /db_xref="GeneID:5231579"
     mRNA            <185120..>190618
                     /gene="UBR1"
                     /locus_tag="PVL30_003950"
                     /old_locus_tag="LELG_04224"
                     /product="E3 ubiquitin-protein ligase ubr1"
                     /transcript_id="XM_001524203.2"
                     /db_xref="GeneID:5231579"
     CDS             185120..190618
                     /gene="UBR1"
                     /locus_tag="PVL30_003950"
                     /old_locus_tag="LELG_04224"
                     /codon_start=1
                     /transl_table=12
                     /product="E3 ubiquitin-protein ligase ubr1"
                     /protein_id="XP_001524253.2"
                     /db_xref="GeneID:5231579"
                     /db_xref="PFAM:PF02207"
                     /db_xref="PFAM:PF02617"
                     /db_xref="PFAM:PF18995"
                     /translation="MGIDLRRFLVGLPRRMSYDDDGSKAHLYKVLYYLATNNGKLLQE
                     LFPDIANEDLELMSNFSNSLSLEQLQDVSPFYRVKSKSQPSQESYSHPPGQPCARLFK
                     FNDPVYRCEDCGFDDTCVLCTYCFNEADHLGHNVTMYTSQGTSGGICDCGDPEAFVNP
                     LNCKCSTSETKASGDQKDHLDSETIDFQTEQLLETFKICFEYILDVTNLSILTLPMVH
                     ELVKFGGFSEKEWSDYSSMPEGRYGEIDVNSQDKWYLILWNDEFHDVNQAVESIKSCK
                     RCNDDQAIKLATKIDKEGYAILLKAENYRELTTPKFKVEAGGLVSTIVSARDYMRSVF
                     VRTIFSWFEDCLNSKNKAFQSACRAVVTDLLVDTGYSLGKKIPESFFLDATFGNDLRE
                     RYFANGLPINNEFTVYSNSNELKTFPKSHHSTIDQQVLPKPFKRFSRLQFLLIFQIRL
                     AKPIRQALVPIIIPSLVSHDKQVFAQQFTEIYPTLLTILARSDREDDLNLIDEIAAQL
                     YTCPVTVPKLIKSVGIGYILSPVISIIENCSSEFEPLHLSHRVYKFIGDESHIKRTIQ
                     AAIIRGIRDFGHFTSSAFSKEALAPLMEPANVFFLIRFIQLFQGYLPLTRKYGDHVEH
                     ESYLFQFHLIMSIQILKSLQNLAFSQSDNLLADAVAEHLPTVASSLEISQPQLHELSV
                     WHHPHGLVYPITSYLSFLIQSRGFDKFVKNQNHNKLEPIADHCIWNIVMASQIKIGLW
                     IRNGVGASRQASMYFGTAMSEFTFRRDLHILQVALMTGDASSLVRKMLERWELYEWFS
                     NECAHDGTMYEERFFSIIEMFLWISYILLTDRTLFIAGTTPTEQANMEARRIIAYRLC
                     DSAKSYSELKTKCGSSITSLPEFDSILSEIAEYQPPSSFLDSGHYRLKSSMYKQLDPM
                     SVHLNSTDFHSVSEVMARLISKQDKIKEEDVIFQPVFLNSDNSNNSNNSNNSNNSNNS
                     NNSNNSNNSNNSNSNNNENIDQVIGLFAKTRLFVKLLYKLLQLALDTSNETYLPQLLH
                     LLHAIVLDDEIIHGKGYLNQYFVELPICDLLVTIVESKMSKTVRRKADYILDQFLAKD
                     TRIYENLMSCFGEEYVERFIKGKQQHHKDSHEDAAKKKSEARKRKIMKKFAKRQEQFL
                     RQNSGKNGNDNVDADTVMKEDKKDATGKLSLEEGADGSVCVMCGEAASPESTFGCLMK
                     RTFAPIFWKYNDPKLTPCDVWNEDLYDGADDTNYGKGYDVTNIDSKNFEKPVLSTCGH
                     GVHLSCLRRVQTQRGFTACPLCRNYHDLFIPILRESTDLDYATGDVASDISSDAPAAS
                     ILQYLLYTDFQSSTYLTITAKNNVSPKLEHLRKLLIPSNASYTSDYYAELFPEIKQGD
                     SIDKYIDELINTIEMNEIATRLNGTEGFTNFSSQVPNSAKTLLRSLLQAVVLLPRSVE
                     KEDEDESDSENENETPTNIVDLTDISTSRITKKRKYEKGVFSNTMNLFFNTNESLASL
                     VKIGICETLAIVMSRVHHTKHHDTSSSSSYFGGDIGDVGSLSSEFEQLWARYCPNSKV
                     SLEVYKLVKQIICIYLRRVVLFQDILLGHFEGEDFVSSKIIINELDNFEQTALLEAYS
                     LTQLESMLRIPTLDRIIGSIVSFESSMEKSAFETVFTKTASNHLPLEYPGVIHLTTLP
                     KDYQNCLLRLSELDAYNKMCCLICGTWIAYNNRLERRHHVCANKFQIYFKPKECTIHV
                     YLSVESAVFPLDIPAPYLTKHGEIKTIKDRGKAMLGEFRFKELNKLWINQGLYALLTR
                     TMFGPGVMENAFNVLNRGRNFLVEELGLNDQMDLEEDDDDDDEEFITW"
     gene            complement(<190714..>196596)
                     /locus_tag="PVL30_003951"
                     /old_locus_tag="LELG_04225"
                     /db_xref="GeneID:5231571"
     mRNA            complement(<190714..>196596)
                     /locus_tag="PVL30_003951"
                     /old_locus_tag="LELG_04225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524204.2"
                     /db_xref="GeneID:5231571"
     CDS             complement(190714..196596)
                     /locus_tag="PVL30_003951"
                     /old_locus_tag="LELG_04225"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524254.2"
                     /db_xref="GeneID:5231571"
                     /db_xref="PFAM:PF02207"
                     /db_xref="PFAM:PF18995"
                     /translation="MNEELKRFLLFAPSRYNYEVDANVRKELRKRLILSVSKSGEYLD
                     WLFPEVSNLERTLEKDFDWEFANYLKTLSIKRDVQNTHDHSAFHPNQPCSKIFRRGEP
                     IYRCLTCGIDETCAMCSHCYQPEEHKDHDTYIAICLRENGGVCDCGDPEAWKRQVKCP
                     YALTDSFVKDREIPSEFSEAIHDTLSVVLDYIIDAMSRSDTHLAQAPHDEKNAVIRQT
                     QLSAFEPHGYASCPAEFQDQTNGNFSLVLYNDQIHHYREAIQRVRLASGKFKDFATMI
                     TEKVQNYGRAKVITSKNLDLLIERQNILNSTGMTSCIRSDRDIFREDICDEMINWLND
                     YTESEFFKASKVAKDIFCQTFCEPWTCGVTKENESKNENENESKNESESKIESKNENE
                     NGNEIEDQEKEKEKESVFSMEDGLALLRKGKLNKNLSIPNARSLHHHHHHHHQQRRMQ
                     EDVNSFNSDKICPTCEVHIKGNTDKYGSRLQYIIYFDVRFWKSARIILRDMFSTSLIT
                     NLEFKNTLSSQYVDIYTGVANNCMIVDREPEQNLMTTLSTQLFMSQSNSKSIIQRGDF
                     ISILQSIHAFLTSRLSSPNSKLEFERELSMKDLKSRRWGQLFFDISFVINKGKEHRDV
                     LSKESIAIICDILELFQGRPPLKRETENHIEYENSDYTTIFQSVQTIYKFAELSADSM
                     NSAENTVYKKHERARSAIYEVLKYLRDLDFGKISGVKYENTDINLTFDLVLKEPITGM
                     MMKSSKVECNKVSFLHPLHSFLSWLIEYANFPTMDTLRDILQKVQNENVVGSYISIES
                     IIFDYPIKAIVLLSQIKAGFWVRNGFSVKSQSHLYRNSGIRDYGYMRDLYLIQILLNI
                     AHPEFVTFFLLDRWSLNGDWLMTSVYEENILPYMLEECLGFFIHLSTESIFLRGISED
                     DLRRTQIEQEIIHNLCFEPLGYKKLCSYIPENIVNDKKFDIILNEITIYKKPTGSNDA
                     GVLQLKDKYLDEVNPYYSNYTLNRREEALKFVKARKLEKIASSKEKKVPIVIEPVSIK
                     CQILDNYSHVVNFSTTSYFQSFLLKILLYVQRNDCEKVESLFETALHLIMICSLEDLI
                     DKQHGDFYTRFIEWTKVEEKLSVSICQLLYSFLSNSAYGAFHDKIRAIFDLIGSKHSQ
                     LLTFMEESIPNFDSQNLHNDLEKSSSVKDEAAKKKRLAKKKQNRLMEKFKKQQAQFLE
                     NNVKGESLDDNFEDVDMGQGNDENNEKKSWSVQEQHCILCQDTNTENEALYGMVANIA
                     QAATFRNVPFEDDYWFLKAFSSAANLNSREDQLSQDSKTTSHWHSYMSKIKNENTFGP
                     GFDIASAVDSKLVSSSCGHVMHFQCYLNYVASSHARSTQITRNTPENSQEILCPLCKS
                     VNNVFIPIFGKCNSQSLKQYLSKEPTSISTTASMTTTTTTNTTTTDTTTSIPLLTSQS
                     CGNPFANMNMESFMKPEYRDSFFSLYKQDLRFLLGPEEDSVWFAWEGFEGDKFHTMME
                     AVHSAFKTITFPLIVEPTSPEILSNTIKSTEIALRGINSPHSLIIHQMTNSATSLLQN
                     INNLRLSLIDMALSGRKPVIGKDPRIMMMTTILSFTPENINSTLTQGDFFEILVSIIP
                     APSLGLSFNSILRFIFVCHVIQTLHILWRELESNSRRGRKYSFEDIPRYKFSTKQDHD
                     SAGASFRRFQSFGGGGGGGGGVAHFNISDSVIYTMLLKAITPFLRRSLLLAFVQCAND
                     AELDIFDNGCDNDCEKNEDQNNSVAEADTLCSTLNLPSLKEILVSLNEENSWENALFT
                     NFISFLNKKNSEVLLIKRLEYPGIISLIDLPERLDYIFSRYYYSDKFGNPHRFIEDPA
                     ICLVCAKVVDLQKQATGCNEGECTVHYQKECKSGLGIFLIPKDRTMLLLHKNGGSFYN
                     APYLDDQGELPDENKRTKALHLMKPRYEDFNRNVWLSHNIPNYIARNLDSVLDPGGWE
                     TL"
     gene            <197144..>197467
                     /locus_tag="PVL30_003952"
                     /old_locus_tag="LELG_04226"
                     /db_xref="GeneID:5231577"
     mRNA            <197144..>197467
                     /locus_tag="PVL30_003952"
                     /old_locus_tag="LELG_04226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524205.1"
                     /db_xref="GeneID:5231577"
     CDS             197144..197467
                     /locus_tag="PVL30_003952"
                     /old_locus_tag="LELG_04226"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524255.2"
                     /db_xref="GeneID:5231577"
                     /db_xref="PFAM:PF07019"
                     /translation="MSSVEKLYSQANIDTNVQKLQHVHDVTSLVLGVVAGIMTLESLY
                     GFAVYIIGISITNLAFYIICGEKQANKFFKKPIQEIFVNGLLNNTPGFIMSWCLVYAL
                     VKSSS"
     gene            <198077..>199972
                     /gene="ABP1"
                     /locus_tag="PVL30_003953"
                     /old_locus_tag="LELG_04227"
                     /db_xref="GeneID:5231627"
     mRNA            <198077..>199972
                     /gene="ABP1"
                     /locus_tag="PVL30_003953"
                     /old_locus_tag="LELG_04227"
                     /product="actin binding protein"
                     /transcript_id="XM_001524206.1"
                     /db_xref="GeneID:5231627"
     CDS             198077..199972
                     /gene="ABP1"
                     /locus_tag="PVL30_003953"
                     /old_locus_tag="LELG_04227"
                     /codon_start=1
                     /transl_table=12
                     /product="actin binding protein"
                     /protein_id="XP_001524256.1"
                     /db_xref="GeneID:5231627"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF00241"
                     /db_xref="PFAM:PF14604"
                     /translation="MEKIDTSTNSKKIQEPYDKLVRGDPNVTYVVYAVDKNATLDVDE
                     TGSGSLDEFVENFTDGQVQFGLARVNVPGSDVSKIILLGWCPDNSPVKLRLSFANNFA
                     DVSRIFSGYHIQITARDQDDLDVDEFLNRVASAAGARYSTVGGGKASGGSASRKSASP
                     SISKPIVSKPVSSSTKKPEFVPKSTGKPITPVVSKSKSPAARDDGWGDAQDVEERDFD
                     EKPLENVPSTYKPTKVNINELRKQKSDTVSSTPKAQKSANDSNNNQINKGQKKQADGD
                     DDEEKEDVTGKPLSERLKAYDHHDDGRLTSLPKPKVGHSVADRYKANAGQGKASFGAK
                     PNFGSTPSSSKPKDKVVGGFSKDFGAENGKTPAQIWAEKRGKYKTVSSEDDSNDNDAS
                     GSTLNQADEHPSHASELAKKFEQQAKLQDQEDDEEAEEEEEDDDDEEDEKPARLPARS
                     NIPPPPPAQSTNPDDEDEDEEEDEDEDEKPARLPPRRNLPPPISSQGFGQDDEEEEEE
                     EDEEDEQPARLPARNLPPLPSRQVEPEPEEEDEDEDEQPPLPSRQVEPEPEDEEEEAE
                     TPASSAGATATAEYDYEKDEDNEIGFEEGDLIIEIDFVDEDWWSGKHQKTGEVGLFPA
                     NYVKLNQ"
     gene            complement(200262..200335)
                     /locus_tag="PVL30_003954"
                     /old_locus_tag="LELG_06083"
                     /db_xref="GeneID:5231731"
     tRNA            complement(200262..200335)
                     /locus_tag="PVL30_003954"
                     /old_locus_tag="LELG_06083"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:5231731"
     gene            complement(<201712..>203112)
                     /gene="CRH1"
                     /locus_tag="PVL30_003955"
                     /old_locus_tag="LELG_04228"
                     /db_xref="GeneID:5231744"
     mRNA            complement(<201712..>203112)
                     /gene="CRH1"
                     /locus_tag="PVL30_003955"
                     /old_locus_tag="LELG_04228"
                     /product="transglycosylase"
                     /transcript_id="XM_001524207.2"
                     /db_xref="GeneID:5231744"
     CDS             complement(201712..203112)
                     /gene="CRH1"
                     /locus_tag="PVL30_003955"
                     /old_locus_tag="LELG_04228"
                     /note="CAZy:GH16"
                     /codon_start=1
                     /transl_table=12
                     /product="transglycosylase"
                     /protein_id="XP_001524257.2"
                     /db_xref="GeneID:5231744"
                     /db_xref="PFAM:PF00722"
                     /translation="MLLKNSFAVLASICTYINTSSACNPLTQSDCSPNPALGGSFQED
                     FSNGLGSYFKSLNKQGTIDTGDDGLSLTLKKRFDNPSIESDFYLMFGYVEVVLQAAEG
                     KGIVSSFYLQSDDLDEIDIELFGGDNYEWQSNYFVQGRTETYDRGGYHQISNPLTSYH
                     TYAIDWTSERLNWIVDGQVIRTLSKDGPQGYPQSPMKIFAGIWAGGDSSNPPGTIDWA
                     GGNPDYSQAPFTMHIKSVAVVDYSTGDSYSYGDQSGSWESIKAENGEVNGRLKEGQSD
                     VDKLTSGGSIEDSADVKSNSDSESSTEAPESSTESSTESSTESSTTSSTTSSSSSSSL
                     SENTISSVESTTSTENSVVSTEQPSSSLLGESTPQSTVDSSTSVAPTLASSPSSPLSS
                     SQAQAQAQQTTPTTSSTKSSESQQPSSTSSEAPAISSATSEDSGVRLLFNGDGMLSVR
                     TYFAYVLVSSLFAFAL"
     gene            <206206..>207963
                     /gene="ssh4"
                     /locus_tag="PVL30_003956"
                     /old_locus_tag="LELG_04229"
                     /db_xref="GeneID:5231740"
     mRNA            <206206..>207963
                     /gene="ssh4"
                     /locus_tag="PVL30_003956"
                     /old_locus_tag="LELG_04229"
                     /product="Protein ssh4"
                     /transcript_id="XM_001524208.2"
                     /db_xref="GeneID:5231740"
     CDS             206206..207963
                     /gene="ssh4"
                     /locus_tag="PVL30_003956"
                     /old_locus_tag="LELG_04229"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein ssh4"
                     /protein_id="XP_001524258.2"
                     /db_xref="GeneID:5231740"
                     /db_xref="PFAM:PF00622"
                     /translation="MIINFDEPDVIPPYNRDGGNNNHNPNNPNNNNPNNDMANFEDIL
                     LISFITMTSIVGLFVISGIIFLIIRRSNQISEDDLEREEENQAYLELNSDEQELYFQS
                     KEYLHNNPYFVGELTLSQNLSIQEKGVSAYEFVKDSMLTNNDLLVVNKTELNFFKNFE
                     CSAQTNLPMPTKNEVYYFECKLYSLPSPEETIISMGLSTKPYPWFRLPGRHPHSVVYD
                     SNGFRRHNQPFNFLDMEPPFPQLAKGDVVGVGYRTRTGTVFFTRNGKKISESKLGGHV
                     KNFKPANQGQLFPIVGANNICSVHVNLGQRGFVFIEGNVKNWGYAPIEGTGPAPPAYN
                     KFNSDILLERSEILDDTDDNGGGGGAAGFNAADDNGLIDREHDFPPDFWSTVKQEGSG
                     LEDEDDVEGRRRRKEAGENVLNHDKFSYNAYSEVGSADERITLDSLVPPHKPPSYHDD
                     EEGEGGGRREGEVEEVEGGVEVREEDGVQNIPREGPSSALVASLEHTQSEQNEEEEEA
                     AAAAAAAAAASRSVNEGESNTALDTMAGPSTSTFTPTSNETTDNKKNKSRMVHHDGID
                     GVQVEQQEEEDVDNNWEIY"
     gene            <210213..>210665
                     /locus_tag="PVL30_003957"
                     /old_locus_tag="LELG_04230"
                     /db_xref="GeneID:5231494"
     mRNA            <210213..>210665
                     /locus_tag="PVL30_003957"
                     /old_locus_tag="LELG_04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524209.1"
                     /db_xref="GeneID:5231494"
     CDS             210213..210665
                     /locus_tag="PVL30_003957"
                     /old_locus_tag="LELG_04230"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524259.1"
                     /db_xref="GeneID:5231494"
                     /translation="MKFAAVLSLASVALAINVEQIRLLNDDELIIQDAQYGFPKIVNL
                     AQADSEDEAEVEGGKKKDKSTSKTTTASTSYSTISSTSKSTSTTTTKYLTTSESLSTT
                     TKTKTDKHGSTSKNTKTKTYSITKTAGAEAVAAANVGGPLLFALGLLL"
     gene            <211824..>212732
                     /gene="ILV6"
                     /locus_tag="PVL30_003958"
                     /old_locus_tag="LELG_04231"
                     /db_xref="GeneID:5231726"
     mRNA            <211824..>212732
                     /gene="ILV6"
                     /locus_tag="PVL30_003958"
                     /old_locus_tag="LELG_04231"
                     /product="acetolactate synthase, regulatory subunit"
                     /transcript_id="XM_001524210.1"
                     /db_xref="GeneID:5231726"
     CDS             211824..212732
                     /gene="ILV6"
                     /locus_tag="PVL30_003958"
                     /old_locus_tag="LELG_04231"
                     /note="BUSCO:EOG09263MGE"
                     /codon_start=1
                     /transl_table=12
                     /product="acetolactate synthase, regulatory subunit"
                     /protein_id="XP_001524260.1"
                     /db_xref="GeneID:5231726"
                     /db_xref="PFAM:PF01842"
                     /db_xref="PFAM:PF10369"
                     /translation="MLRRSQKAFAQTFVRATRSSSSGSSTSALAYKTLHRNQKRPPLP
                     TVETLNWSADTAVSSILYETPVASRAPPKQHVLNCLVQNEPGVLSSVSGTLAARGFNI
                     DSLVVCNTEVKDLSRMTIVLKGQDGVVEQARRQIEDLVPVYAVLDYTNAEIIKRELLL
                     ARVSILGPEYFQELIATHQLHVDDASAIPDLSACESAFHPSNLAPSEALRQKHEHLDH
                     ISTLTKQFGGKIVDVSDRNVIVELSAKPSRISAFITLLQPFGIIELARSGMMALPRTP
                     LESLSEEDDLPVDAADIVDASQLPPG"
     gene            <214689..>218820
                     /gene="ZCF27"
                     /locus_tag="PVL30_003959"
                     /old_locus_tag="LELG_04232"
                     /db_xref="GeneID:5231737"
     mRNA            join(<214689..214695,214788..214795,215146..>218820)
                     /gene="ZCF27"
                     /locus_tag="PVL30_003959"
                     /old_locus_tag="LELG_04232"
                     /product="Zcf27p"
                     /transcript_id="XM_001524211.2"
                     /db_xref="GeneID:5231737"
     CDS             join(214689..214695,214788..214795,215146..218820)
                     /gene="ZCF27"
                     /locus_tag="PVL30_003959"
                     /old_locus_tag="LELG_04232"
                     /codon_start=1
                     /transl_table=12
                     /product="Zcf27p"
                     /protein_id="XP_001524261.2"
                     /db_xref="GeneID:5231737"
                     /db_xref="PFAM:PF00172"
                     /translation="MIHNPQGQQPPQMENYDGGYYRPHSQPQIQQQVQPQAQVQAQLG
                     HQQPSVQPQVIPPPHIQFQGNTIQSTFPGTISSQHQVNDAASFSSNPNAYQYATPSSN
                     SPDYGQSISGGHFAPLPPHHLRPPIGGQSQPAAGYQRFPPQPPPPPAPPLQPSTQSQA
                     PAPPAPPAPPQQQEYHRYLSQRGDTKNDQSLPFPPPSNISSVTLPARAHTSPPQTQQQ
                     LSAQIAPPSAQQALTPQQHTQYSSPKTTLTYNDNSPKGKKRQLHSNKNVSRAAAMYPR
                     KRALTACNTCRVKKTKCDNRRPICGACERSGATTCTYSSDDQNRDYSSFDPASLTILS
                     KLDDIMREIKKPELETETLERREVKIKKEKSGEELEKEKETRREKDEVVVEKECIRPG
                     CWDMSISSIFDWDSFRKRFKVSQEDIDKDNIDLVRSYDRNVYLRNFQQLTLQERLAEF
                     SKLEEILDSNFKSIINSYFVNCYSKVPHLDVFNFFELIEIYTWIKNKLPGTSFMDLVS
                     EDITTKIFERHKSDVKIPHEALKKKVQTLRNSIPMILLICASGIVSTPVSLDNFKNFK
                     NSSEEAFARLGCLGSDTTFGNEEQEEAEAEAEAEVEKGEIIEEGREGTGAGKRAKKFV
                     FGRLKIAYSLVTYAEMIRQLYPHIMMENTVTSVQYYLTLSQLYLLANCPLLAHENVTR
                     AARNIVYVLRKEGRYDPKTGYKGVLTDNVQHNQLVDRLFWLCLKLECELNVELSPAVQ
                     PSGIAGISGIPCVIPDYKKDAYSEQVQRLGKNYDDEYTWYFYLTEVAVRKVDNKMFDD
                     FYSINNAFKNPWIKFVKYLNQYNGIINTLPKEIRDFVLHEVNVDQIYRHIKNKYDNSK
                     QFGNDDCDDIFESLDDFFIDDDLILRAQSDSIMFIKTRILLSKTLLFRPLVYLFLEDQ
                     IPFADVLEAIATVVGNLASNGSNGSQLQQENCNYGPFSGSPHSCTDSVTSASASSVSA
                     PSLHGSNCFDMDMDFLGLVNAPLFYQQEHPDEDFSSLIKPTGIGSNTNTNTNTNTNTN
                     TNTNTNTNTNTNTNTNTNTNTNTNINTGTRTGTTNDSNEDDDPSFVITDMKLAKRKIL
                     AILIKNLITLPKLNIPKLSTHRHPGSWYFIRNVIVGNIIQYLLYKKIQEMLVHAGANP
                     AIQQLIATKLSAFTKSSDSSVNGTPNNPPSGAPSLENMMKMVIDQDGTKASLEHSKIV
                     LNYWKDEMTDCEVYEKYIDKMLCDL"
     gene            <220564..>221919
                     /gene="BEM1"
                     /locus_tag="PVL30_003960"
                     /old_locus_tag="LELG_04233"
                     /db_xref="GeneID:5231431"
     mRNA            <220564..>221919
                     /gene="BEM1"
                     /locus_tag="PVL30_003960"
                     /old_locus_tag="LELG_04233"
                     /product="bud emergence protein 1"
                     /transcript_id="XM_001524212.1"
                     /db_xref="GeneID:5231431"
     CDS             220564..221919
                     /gene="BEM1"
                     /locus_tag="PVL30_003960"
                     /old_locus_tag="LELG_04233"
                     /codon_start=1
                     /transl_table=12
                     /product="bud emergence protein 1"
                     /protein_id="XP_001524262.2"
                     /db_xref="GeneID:5231431"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF00787"
                     /translation="MPLFAVTLYEFKAERDDELDVSPGENLSICAHYDYEWFIAKPIN
                     RLGGPGLVPVSYVRIIDLMDPAKYASVDTYDREQVMKIIDEFKIPTVEQWKDQTRRYK
                     ESSIQIGNGHGQSQGHSQGQSQGHSQGSGYSQSYGRQSSVSQYSKTPPSSNRSSKNSI
                     WVEKCNVTSYLLIEGRYQYLIVAKMSNGKERELYRYYQDFYDLQVRLLEMFPFEAGKM
                     EHSKRIIPSIPGPLINVNDSISKLRRAKLDSYLSNLIALPTHISRCNEVLNLFEVLNN
                     GFDTETESRRGKPISQISNSHQDRLSQYMLDSPTTEKQQLQYQQYDQQQQQQQQQQQQ
                     QQQQQQQQQKFKVKFYYEEDIFALLLPQTLRLEDLKIKLYNRLELEDSQQHNFKTPKT
                     HESIHLYLKNDYEEFKTENNITEVDYDLHGANLKEFEVDDDTKFHEILGDKCKIIIKV
                     V"
     gene            <222418..>226344
                     /locus_tag="PVL30_003961"
                     /old_locus_tag="LELG_04234"
                     /db_xref="GeneID:5231720"
     mRNA            <222418..>226344
                     /locus_tag="PVL30_003961"
                     /old_locus_tag="LELG_04234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524213.2"
                     /db_xref="GeneID:5231720"
     CDS             222418..226344
                     /locus_tag="PVL30_003961"
                     /old_locus_tag="LELG_04234"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524263.2"
                     /db_xref="GeneID:5231720"
                     /translation="MSFLGLGWKSNNKKKQKKIDNRIDANVQTQEPKGSIFNRFLEFI
                     APPQQTDQKEHNIGQLQENGVNNTLNDQVGNIKSLNGAEGIGQMKNNGDDELYFDAQD
                     SIVADNSGTVKAWLENTYLPSNEQLSKSIHDTPSLYKERLSWRSRNANQSEVETSVIL
                     SPQLSKYSNASNVKPERPLQSKIRDIGTPTPQKKNCPSSLEEATEALDDSNIRPNENI
                     KSIDLETSRIKKPKKSAKWRISQMLKKRMEKEKEVLEPQTIYSPKMDIVTSKSPFSPN
                     LGHPRKSQSPSSTNSNHVNFVESATDKFSNKVGETSFEESPSLKTRKEKQLQVNTSAG
                     TISLRRKQRVADEGNVSNLQDYMNLRSKVMDANHNDRQPIQKQLSDFKTTNTSTPNSK
                     KSRLLIRASPQEENNNLIKFRIRPRKNQRLEVQTQLLAQEEEQEKEQKQEQLGRKDHN
                     GQSSSFVNDQQNHFNSPLDSKNILQTSPTSQTHQTNQRQPTQQTKQTPKVFDSKFNVT
                     SPPEHFIQPLESTTSNTEPINSSPVTIIRVIEGKNSTNNNDFTLRSLPTSPPKSNTHI
                     HKIGEFYVKSPHRTPKPLNFFPTETQHLHSSNESLHRHEKKSKSLIPITTPEKQTLKK
                     IRAPQSSSLFPTRSPEMVSGDDSQKILSVDNFQISSPKLSAFVRASPKSINAQFRPRE
                     HEDLTTNKQQLVNKDNSSTEIEQSQITKFPLTAAQKRRKRIAERAKELEAKQKVKKRK
                     KIIRRGNVSWMANTSDEYSEDDEIQEIAEARAQAAIDNKKRDPNDNEGNFKNSSTFID
                     LAETGLDSLHRSHEKTCKNKHKPEHDYQVNENDALLEKLDEDGHFNKSVNTGQIINIE
                     ETNIGTEKTATDLLEASLENDKNKRVVFNLESNMDASKEYEEKNVESINTKEFKQFDS
                     LFVPESPSKWRVDDVDENGDDVEKTKKRKEGKDEETEEGEGKDEEKEEEDFKNTEKSK
                     ELSSSNLNNERMVGQNESTHDCETLPTEESKPNSIPKTVTAHGADNIDSNQGNAVASQ
                     DERLSTSSISFGQLEEGKREGSVRDFATSTQEAQTRANKQDDFSEDSQYNFTAKLFST
                     KTDSKDQAIGIAPTECVENRASTSSDRNGDIKISNNCSDNQGEAFDKYASEGAKDQHI
                     SSCIEVEKTISQTTVFLQSLDRGETRHIDHSVYSETSAHRFDMSSVSQRYGEIELDTG
                     KTKRRKAFLDEGLNTKEKVINERTEVKKKEEGKVEQKEEGKVEQKEEGQEDLDKANHT
                     TSAIAIETNDFCNDEKLKKPSKAKNRANQSRRRKKRRIERKTPYVD"
     gene            <226702..>227361
                     /locus_tag="PVL30_003962"
                     /old_locus_tag="LELG_04235"
                     /db_xref="GeneID:5231719"
     mRNA            <226702..>227361
                     /locus_tag="PVL30_003962"
                     /old_locus_tag="LELG_04235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524214.1"
                     /db_xref="GeneID:5231719"
     CDS             226702..227361
                     /locus_tag="PVL30_003962"
                     /old_locus_tag="LELG_04235"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524264.1"
                     /db_xref="GeneID:5231719"
                     /db_xref="PFAM:PF13462"
                     /translation="MISPKYSTTHYSLGIKALSTAKSAPHVVNLFFDYNCPFSAKLYL
                     KLYNKVIPELQKTHPDKFQFVYINVVQPWHTNSTLLNEFGLAYAKVLREKNIDDSQKL
                     FWDFNKVVYQDKEQFYDNSTIELTRNQIYEKIYDVVAKDLDLKVGKDDLLKELLIKSG
                     GEPDNAGNGATADVKYFTRIVRNTGIHVTPTVTVDGVVDDSISSGTSEDELIKVFTAK
                     L"
     gene            complement(<227548..>229218)
                     /gene="PWP1"
                     /locus_tag="PVL30_003963"
                     /old_locus_tag="LELG_04236"
                     /db_xref="GeneID:5231722"
     mRNA            complement(<227548..>229218)
                     /gene="PWP1"
                     /locus_tag="PVL30_003963"
                     /old_locus_tag="LELG_04236"
                     /product="rRNA-processing protein"
                     /transcript_id="XM_001524215.2"
                     /db_xref="GeneID:5231722"
     CDS             complement(227548..229218)
                     /gene="PWP1"
                     /locus_tag="PVL30_003963"
                     /old_locus_tag="LELG_04236"
                     /note="BUSCO:EOG09261DW8"
                     /codon_start=1
                     /transl_table=12
                     /product="rRNA-processing protein"
                     /protein_id="XP_001524265.2"
                     /db_xref="GeneID:5231722"
                     /db_xref="PFAM:PF00400"
                     /translation="MISSSTWVPRGFASEFPEKYELDDEEMARINEMANLEISDAKEE
                     VEEAQKSSLKDQLEIDDDLKEYNLETYDDETEDLGAGESISMFPGLASTDAKMHETGE
                     GEDGETDVYLSLPTEIDEQEEKKENQIYPTDNLVLATRTEDDISWLDIYIYDDGAGAP
                     AGAEEEEEDKMDADVAKGLVRDSALYVHHDIMLPAFPLCVEWVNYKKGGDDDNGSNIG
                     NFAAVGTFDPQIELWDLDYVDKAFPDVILGEMETNKSKKKKKKSKSKEHVLTHHTDAV
                     LSLTHNKIHRSILASTSADTTVKLWDLNTATAARSLDKIHNGKTVSSSQWHPTEATVL
                     LTGGYDGMAALTDVRISDDAQMSKTYSVNGEDVENVTWSSNPEIFYVGTDKGNVYCFD
                     AKNDGKPLWTLHAHDAGISSLDINKYVPGMLVTSAMGEKTVKLWKAPESSQGGPSMVL
                     SRDFGLGNVLTTSYAPDIEVAGNLVVGGVTGGLKMWDTFSNRSVKNVFREELHSLQKR
                     ARDEAKAAGRASRIARKYKNDVNDVILEVDGSKDDSESEDEDANIADN"
     gene            complement(<229684..>231063)
                     /gene="NMT1"
                     /locus_tag="PVL30_003964"
                     /old_locus_tag="LELG_04237"
                     /db_xref="GeneID:5231691"
     mRNA            complement(<229684..>231063)
                     /gene="NMT1"
                     /locus_tag="PVL30_003964"
                     /old_locus_tag="LELG_04237"
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /transcript_id="XM_001524216.2"
                     /db_xref="GeneID:5231691"
     CDS             complement(229684..231063)
                     /gene="NMT1"
                     /locus_tag="PVL30_003964"
                     /old_locus_tag="LELG_04237"
                     /note="BUSCO:EOG09261SS1"
                     /codon_start=1
                     /transl_table=12
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /protein_id="XP_001524266.2"
                     /db_xref="GeneID:5231691"
                     /db_xref="PFAM:PF01233"
                     /db_xref="PFAM:PF02799"
                     /translation="MSDPNKKSIEDLLKMLALGESLTPSQEKQMKDYKFWKTQPVPSL
                     DETITKEGPIDVLKTPEDVPSEPLPLIKEFEWCNIDIQNNEQLDELYKLLYDNYVEDT
                     DATFRFKYSHEFFKWALMPPNWQQDWHTGVRVKETGKLVAFIAATPVTIKLNKSGTVI
                     DCVEINFLCIHKKLRNKRLAPIMIKEITRRVNKQNIWQALYTGGSILPTPLATCRYQH
                     RPINWSKLHDVGFSHLPANQTKAGMLAHYALPNKTNIQGLREMEEKDVKDVLKLLTEY
                     QERFDIVQLFTEEEFKHWLLGNADANANNANNAKTKTNSSGDKLNSNVIKTYVVENSE
                     GKITDFFSYYLLPFTVLENTHHDELGIAYLFYYATDAEGDRYKPRLNELINDALITSK
                     QYNVDVFNCLTSQDNTYFLKNCKFGSGDGFLNYYLFNYKTFPMSGGIDKQTKSVIDDE
                     TSGVGVVLL"
     gene            <231518..>232738
                     /locus_tag="PVL30_003965"
                     /old_locus_tag="LELG_04238"
                     /db_xref="GeneID:5231727"
     mRNA            <231518..>232738
                     /locus_tag="PVL30_003965"
                     /old_locus_tag="LELG_04238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524217.2"
                     /db_xref="GeneID:5231727"
     CDS             231518..232738
                     /locus_tag="PVL30_003965"
                     /old_locus_tag="LELG_04238"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524267.2"
                     /db_xref="GeneID:5231727"
                     /translation="MVLKNSKWDKQAKYKYMKKHGLKTSRPKDSVVTPKWSGKKAGKD
                     GDARKITLEDSDEEEEEEEEEEWDSDVDEALINHFYPQLDKGESLTIEQKLKIKQQIL
                     NDLQNSNASPELDANDKEGKREEIDGIYLGQASDGQISKGLEPGQGQRQDQSQSNPAL
                     PQNPSFNLQDFINSIEKKPNKNKKLLKNKFSENFLEEYGLESYNYGKDDYNKMYEERQ
                     KSSHSKNLLNELTSRGIDEYEIGQSIDKQKQSIRSLTEEEKEEEKRRRALMESDNFYK
                     EIKRKFGAQEGNAKKKVLELNNFNSSDLSQLQRLQEKLEKGDDAPNTLEDDLFNLLGL
                     PIPSKDGNVDSEIEMESGKNKGSKNQEQEHERKQTTLSHNFGNLHLSTDKQDLNASKQ
                     PFEDDLNFVDSLLK"
     gene            <233038..>234198
                     /locus_tag="PVL30_003966"
                     /old_locus_tag="LELG_04239"
                     /db_xref="GeneID:5231581"
     mRNA            <233038..>234198
                     /locus_tag="PVL30_003966"
                     /old_locus_tag="LELG_04239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524218.2"
                     /db_xref="GeneID:5231581"
     CDS             233038..234198
                     /locus_tag="PVL30_003966"
                     /old_locus_tag="LELG_04239"
                     /note="BUSCO:EOG09261FAB"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524268.2"
                     /db_xref="GeneID:5231581"
                     /db_xref="PFAM:PF19270"
                     /translation="MSTAATSLPSNHAESNLDHEAIKYFERAIEKEAQGLMSDAVENY
                     RKAFRINDRVDTLYRNLKVPSAMKKLTQERGKNVGTRVDEKEVAKINVDFLIKSFANL
                     EVDGLHMSTHEDEENMTVAQPSPLVHLPKDIWLYILEVLVITLPESWFKMSITCKKFA
                     YIGFGSSSIWRLLCQLVYPKQRYEENEGRFEPAIPDDQLQMVSQYTGWKQMLSKRPFV
                     KFQGCYISVINYYSEGARGESSLSWTNPVRTITYYRYLRFYPDGTVLKVLTVLPPDQV
                     VAHLQIDNPSIPHDEKHNKESHRIYRGKWTINSDGEIHIRIDQGSVDYLIFQYYFTVK
                     SLGINKHAKLTWNQYYAQRKEIENDDRSGEISEYSIRNEKPFKFSRVRSYQT"
     gene            <234635..>237007
                     /gene="NIP1"
                     /locus_tag="PVL30_003967"
                     /old_locus_tag="LELG_04240"
                     /db_xref="GeneID:5231599"
     mRNA            <234635..>237007
                     /gene="NIP1"
                     /locus_tag="PVL30_003967"
                     /old_locus_tag="LELG_04240"
                     /product="Translation initiation factor 3 subunit c"
                     /transcript_id="XM_001524219.2"
                     /db_xref="GeneID:5231599"
     CDS             234635..237007
                     /gene="NIP1"
                     /locus_tag="PVL30_003967"
                     /old_locus_tag="LELG_04240"
                     /note="BUSCO:EOG092616QN"
                     /codon_start=1
                     /transl_table=12
                     /product="Translation initiation factor 3 subunit c"
                     /protein_id="XP_001524269.2"
                     /db_xref="GeneID:5231599"
                     /db_xref="PFAM:PF01399"
                     /translation="MSRFFVSGYNSESSSEEEDLLSSEEELLTSSGEENEDSDFFNDD
                     DESSSDEEDGRPSGPAYFLKKSFLKGAGGDSDSDSDDEGRKVVKSAKEKSLDDMKASI
                     EVINVNKRTNNWIVVLSEFEKLGKLINRANQQNFGTPKFYVKLLASLDDSITETVNNE
                     KDDKTMKADEARAFNTLRQRVKKQIKEFQVYFDLYKDVPENFDQEDESLDSFAKNQET
                     REETRTLSPIFHNLKLINESRGKKNIDKSEQVTTLEGLISDEASDFELISLYQSLLSV
                     RFDASSNQSFMAIQDWRSNKRDLNNLLDILVKSKVYQLSEEGQTTDDIDIEPTANEDG
                     VKVIYGSVTSLIDRLDDEFTKSLQNTDPHSMEYVERLKDETEIYNLIVRGQAYIESIV
                     ADKQQSNQLARVVLRRLEHIYYKPNQLIKANEEEAWKNIKPSTQTPSEVIESLTQFLQ
                     SNKVFAKQALLYSIYYYAVNGDYNKAKELFLSAHFNLSDSALQVSYNRALVQLGLSAF
                     RSGAIEESHKILNEMVNSQRSKELLGQGFNSKFPNQATVVEKQRLLPFHQHINLELLE
                     CVYMTCSLLIEIPALASNKDPKRRNASLKSFKSKLEFHDRQYFTGPPESIKDHIVHAS
                     IALQKGDWSKAYNLLSSIKIWHLFPDHDNLLAMMKNQLQIEGLRTYIFTYKAVYSKLS
                     ISKLSSIFGLSQENVSEVLTQMIEKSDINGEVSGDYIVYTTDSQRSKLQELAIVMNDK
                     IQLLTEKNEKTSSNGYAKKNQSQTQPQAQSKEVEENKFRYANVNTNTDEF"
     gene            <237522..>238661
                     /gene="CTU1"
                     /locus_tag="PVL30_003968"
                     /old_locus_tag="LELG_04241"
                     /db_xref="GeneID:5231602"
     mRNA            <237522..>238661
                     /gene="CTU1"
                     /locus_tag="PVL30_003968"
                     /old_locus_tag="LELG_04241"
                     /product="cytosolic thiouridylase subunit Ctu1"
                     /transcript_id="XM_001524220.2"
                     /db_xref="GeneID:5231602"
     CDS             237522..238661
                     /gene="CTU1"
                     /locus_tag="PVL30_003968"
                     /old_locus_tag="LELG_04241"
                     /note="BUSCO:EOG09262IZ6"
                     /codon_start=1
                     /transl_table=12
                     /product="cytosolic thiouridylase subunit Ctu1"
                     /protein_id="XP_001524270.1"
                     /db_xref="GeneID:5231602"
                     /db_xref="PFAM:PF01171"
                     /db_xref="PFAM:PF16503"
                     /translation="MVESSNTKKVKVSSLCELCHGRKAVMKRPKNLRKLCKECFFHVF
                     ETEVHNTIVENKLFANVENSEFPERRAVAIGASGGKDSTVLASVMKTLNERYNYGLKL
                     VLLCIDEGIKGYRDHSLETVKMNQKEYDMPLEILSYKDLYDWTMDEVVSCAGIRSSCT
                     YCGVLRRQALDKGAEKLGINHIVTGHNADDMAETVLLNLLRGDINRIENSTKIITDSE
                     NSVIQRSKPFAYMSQKEIVLYAHYKNLTYFSTECTYSEEAFRGECRSLFHSLSAVLPS
                     VHTNTIYSGQQFKRKAKAMKRQNNKNNKNNKNNMADEHEVLPNGTVAIKESKRCKKCG
                     SLASNDLCQACFLLAGLEVSRAKVSIDSEGDGAAKLSKTLEGLTF"
     gene            <239402..>240274
                     /gene="SPS19_2"
                     /locus_tag="PVL30_003969"
                     /old_locus_tag="LELG_04242"
                     /db_xref="GeneID:5231478"
     mRNA            <239402..>240274
                     /gene="SPS19_2"
                     /locus_tag="PVL30_003969"
                     /old_locus_tag="LELG_04242"
                     /product="peroxisomal 2 4-dienoyl-CoA reductase sps19"
                     /transcript_id="XM_001524221.2"
                     /db_xref="GeneID:5231478"
     CDS             239402..240274
                     /gene="SPS19_2"
                     /locus_tag="PVL30_003969"
                     /old_locus_tag="LELG_04242"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisomal 2 4-dienoyl-CoA reductase sps19"
                     /protein_id="XP_001524271.2"
                     /db_xref="GeneID:5231478"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MPNTLTDAYVKNSVWKPYIYKDKVVFVTGGAGTICRVQTEALVL
                     LGANAAIIGRNVEKTEAAAKEIAQIRPGAKVIGLGNVDVRKVHDLKAAVDKTVAELGK
                     IDYVIAGAAGNFLADFNHLSSNAFKTVIDIDLLGSFNTVKACFEELRKNKGAVIFVSA
                     TLHYYGIPFQSHVGAAKAGVDALMNALAVELGPIGVRLNCIAPGLIGNTEGGARLNPP
                     TEVPLDQKVPIGRIGTTTDVADTTVYLFSPAASYITGTVTVVDGGLWQIGGFLGELYP
                     SVVKQQLEDPEVKL"
     gene            <240615..>243821
                     /locus_tag="PVL30_003970"
                     /old_locus_tag="LELG_04244"
                     /db_xref="GeneID:5231729"
     mRNA            <240615..>243821
                     /locus_tag="PVL30_003970"
                     /old_locus_tag="LELG_04244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524223.2"
                     /db_xref="GeneID:5231729"
     CDS             240615..243821
                     /locus_tag="PVL30_003970"
                     /old_locus_tag="LELG_04244"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524273.2"
                     /db_xref="GeneID:5231729"
                     /translation="MSDNVERHKSTRWVKGVPTYGDWGDDEDDSYDYDYNDDDVGDEA
                     SHRNKPHDGDQTSGAVTHDLTTDHQTSTSAPMPALPQNIQDKYKDIISDAKRDHKNDD
                     TVGDKLVLSIDHNNDDLSSNSSDDDEKANPVSFQDSLNYRNSGHEHLNEAQQPFFNRT
                     KAISLEEVPHTYEEAVPGAFRSEYKQDSKFDQNNSGNGDDSQNAIEKKKADGANSTSK
                     VTSQYDVYAEDEETNDERADVEPSQYPYQYKQQYQTQQHYQDQNTPIMDNSRRNDFFV
                     PPTPTYSEFSTHSGHTEPASEASFQSDTSIQAEPHDLNIGKTHYREHNDEISVLESHK
                     SHVQQTNSSEIDGTTDKLVLSIDNKRDGVDSDSTDDDWGYNGPESDDDDDDNDNEDDD
                     EERKRQTYSEKNRDETTEPDIDTMISELSANTSDINSTLKQQQQQQDQEILPNLRTSL
                     EHDDENVAYHYEEFESPIAPLSTLSQHNEYLSGFAERKGSVRKPPARDEKEVGNDNIE
                     KKETKNVDTTTISTQNSQKGSVNKAPSMKNNDVVDYASLLGGYEEEEGDVNSKETEKE
                     KEKEKDSKKQEGKNQFNDAESSFVTNQESQDSRYTQNELASGNYDTQSIQSSSSFTFN
                     EPPIDANTARKSGATTKYENDNNNDNSNNNDNSNNNEDDIASRRVSQSTLNFGNWVPN
                     TDSFRNQFINSNDNESTANSDFTTTLPSSSQKGYNKFTNVRNPSGLSEVVSNASSSES
                     LPDTIDVAMPVIEEDSDDDGRDGYGEKHGHDEHYNDGEGGKEKEKEEEKEEGDDDEED
                     EDNDFHDSSSNHRLNTMVTQDSILETKAYPSALFKEEKLTPAASRESLPQKYSSLVGN
                     ESVSASRNTSDTLTVPKTRKFSNTSESTTVLSSGATTTGGGDGSGPAVGADAGAGAGD
                     GSGSANTTSNSIPTITKTTATTSTPTPVAHGSGQFKRAKYPVSDWKAIVTISQPVERI
                     AAFKDALGKEAEYDTGLQTWLNHALKQSQDFNNIHIGRIASEAYQNAQHNDLRRHVSF
                     RSTVNVVKDKVEGTGSTASNFGKKLFSRSKKFISGGDK"
     gene            <244408..>246192
                     /gene="TGL3"
                     /locus_tag="PVL30_003971"
                     /old_locus_tag="LELG_04245"
                     /db_xref="GeneID:5231728"
     mRNA            <244408..>246192
                     /gene="TGL3"
                     /locus_tag="PVL30_003971"
                     /old_locus_tag="LELG_04245"
                     /product="triacylglycerol lipase"
                     /transcript_id="XM_001524224.2"
                     /db_xref="GeneID:5231728"
     CDS             244408..246192
                     /gene="TGL3"
                     /locus_tag="PVL30_003971"
                     /old_locus_tag="LELG_04245"
                     /codon_start=1
                     /transl_table=12
                     /product="triacylglycerol lipase"
                     /protein_id="XP_001524274.2"
                     /db_xref="GeneID:5231728"
                     /db_xref="PFAM:PF11815"
                     /translation="MIRSLISQAVLPLAAFIINNTPSFIWALIEFFFDICFFWVRRLY
                     HHFYRKDPLKEHIKQLKNVQNYTEWKATTFEIDRLTNMDLWRENFISKHYDYVLINER
                     TKSLREARENRDFQQIMSLLRAGLIRNFGGIAQKRLFLKSYMGTKFKIEEYINEVLSC
                     LDFLNESLNSGNGNDYVMNSKQLKLDFFHDARQSFGCTALLLQGGSLFGLCHLGVVKA
                     LYFKRLLPRVIAGSAVGAAVASLVCTLTDEDLIPILVNIEELMKNIDILNHEIDERYG
                     NVVENVVKKGYSQDILLFLKFVRDTIGDLTFEEAYMKTRKILNIVVHPTNRSVPSLLN
                     YITAPNVIIWTAIYASIGTGVLSDDIALYVKDFNNEIVLQTPDINVKFLKPQDVSYST
                     SYFQKNLSTNIQHQSPYTKLTELFNVNHFVISLARPYLAPLISNDLKHYHTSYGNVKY
                     DKKTKTYDNGTEMTKKDIEKYAKDTGFNFMKRFKTILGMEIQHRLVVLNKLGLLNEVM
                     KRFFIDEKPTSLQYLASIREVTIVPEVRYLVKDFSRVFDVHRTMENIPYWVLVGERSV
                     WPLFPLLWTRCAIEFALDDLYNLHRKRG"
     gene            complement(<246396..>247193)
                     /locus_tag="PVL30_003972"
                     /old_locus_tag="LELG_04246"
                     /db_xref="GeneID:5231486"
     mRNA            complement(<246396..>247193)
                     /locus_tag="PVL30_003972"
                     /old_locus_tag="LELG_04246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524225.2"
                     /db_xref="GeneID:5231486"
     CDS             complement(246396..247193)
                     /locus_tag="PVL30_003972"
                     /old_locus_tag="LELG_04246"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524275.2"
                     /db_xref="GeneID:5231486"
                     /translation="MSSEPSQELTFYKDHTLTPDTSLDDPYLTTITHISSTSPNWLIN
                     SLIECNLTGTSSTVNKELKQPYTKSVVVLSFLHTKEFYVKNCKKSGLDLARNDKFIFL
                     DCFTDLFSERKIKNPLDALQDVQKLLDIDVVPHNDTVVFVEAPEVLLYSTNLQANDLL
                     FQIMKLNKKVSHLYLISSKDSPQLVDYEVNDIANPTYKITDFLTKLLFRANLNLTLEP
                     LATGRAEDLTGTLVVSKGARPHASTVVSEREYVYHITKEAAVKVYYR"
     gene            <249077..>250846
                     /locus_tag="PVL30_003973"
                     /db_xref="GeneID:85890386"
     mRNA            <249077..>250846
                     /locus_tag="PVL30_003973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119510.1"
                     /db_xref="GeneID:85890386"
     CDS             249077..250846
                     /locus_tag="PVL30_003973"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975493.1"
                     /db_xref="GeneID:85890386"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPISRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKKYLRITN
                     TSHLAQETWISIFKTLFERMGSVMDQIIMYMTPEVKIEKPGRTGPIVTFEDASIIKIG
                     LGLLKNKPNDKIIQGVKSYDLTFERIWDAVNATFQTRMHLISDDEEKDAGTTSVSKGD
                     KSQKTTKCNFCGKYRHTVDSCHLLVTALDEKLVKKVDGKYYLANGEPLVMDFYKCPLL
                     KHQGGRMSQCDTHWTLCALVSAK"
     gene            <256828..>259485
                     /gene="BUL1_3"
                     /locus_tag="PVL30_003974"
                     /old_locus_tag="LELG_04247"
                     /db_xref="GeneID:5231738"
     mRNA            <256828..>259485
                     /gene="BUL1_3"
                     /locus_tag="PVL30_003974"
                     /old_locus_tag="LELG_04247"
                     /product="ubiquitin ligase-binding protein bul1"
                     /transcript_id="XM_001524226.2"
                     /db_xref="GeneID:5231738"
     CDS             256828..259485
                     /gene="BUL1_3"
                     /locus_tag="PVL30_003974"
                     /old_locus_tag="LELG_04247"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin ligase-binding protein bul1"
                     /protein_id="XP_001524276.2"
                     /db_xref="GeneID:5231738"
                     /db_xref="PFAM:PF04425"
                     /translation="MSNSPRIPRSTDLPPSYETSVSGNTSRVASPSPTRANGNSRSAK
                     NVPYQPSREQQQQINILTNARNNSSATNLVATTSSNTQTEYFDILPSFEMFQSILKRD
                     DQQFQEDLTTVPPRYGDTAHSRSSRPTSPRLHAQSSIDQNLSQVSRRLEDTLQMERDR
                     QQEQMHEHAMVFVDETGLMPVTSTADANSQVHNENLAITSDSYGHSPLDNIDRLQKAT
                     KSPFDIQIFVTKDVPRPNQENELETKLKEYTNGDHVNGYVIVTNTSSKPVKFGLFTVS
                     LEGTIKSLERSANPLQQRYRKILMKKILKMYDLCAGYSYGYVPSSAGIEFVPFTEDSY
                     DGCEIGLPDDRILQPHRKYKKFFTFRFPQRLLDNDCPDAIFSHLLPPPSVGVDKTSFY
                     NRGEGIVINKALGYGSLNLRGTPILTKDYSFEDMSVSYAVEAKIIDNVRTKDAVSHDE
                     INDAKRQDYVISKSAQYYLRFIPEQIPFQGISNARKFLEQYQDDQTWMSIREQNNRLE
                     KDIEKKLTGNVSVEEMKMKNLRISESHNSLRDVKTKKRQRPRGRGRGRGTSGGFNVDD
                     NGTNVNKNNSNHNYNNINNNHGNNREGEELGGEDGEEEEGVLDEYEDNNSDSDIDDGS
                     YISTNHPIEIYGKKKKMMMSSLVKIGESTMRVKVPNGVLAYSAPRLLMKYNEVSMERV
                     YNQHTEEVLKHIDAQLTFEGNSRPQIVSIETNIVIWSYSTDYPIPFDIAYDFFYKNHD
                     GTVPSTDPVVTTTKNLQFLKDQVAHYIEFVKDSGIELDKESYIYLKSAQKLRVKKDII
                     RDYFKPTSISDDKWDVHKLNNIRWTQKLKIPLVVENQRNENLLPTFQSCLTGRLYCLQ
                     IAVKFKGASQEANEFAHNVVSVDVPILVG"
     gene            <260071..>261327
                     /gene="CPA1"
                     /locus_tag="PVL30_003975"
                     /old_locus_tag="LELG_04248"
                     /db_xref="GeneID:5231327"
     mRNA            <260071..>261327
                     /gene="CPA1"
                     /locus_tag="PVL30_003975"
                     /old_locus_tag="LELG_04248"
                     /product="Multifunctional pyrimidine synthesis protein
                     CAD"
                     /transcript_id="XM_001524227.2"
                     /db_xref="GeneID:5231327"
     CDS             260071..261327
                     /gene="CPA1"
                     /locus_tag="PVL30_003975"
                     /old_locus_tag="LELG_04248"
                     /note="BUSCO:EOG09262914; MEROPS:MER0060647"
                     /codon_start=1
                     /transl_table=12
                     /product="Multifunctional pyrimidine synthesis protein
                     CAD"
                     /protein_id="XP_001524277.1"
                     /db_xref="GeneID:5231327"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00988"
                     /translation="MFNFRRCMATAAKSFTDNKKQLDRATLTIKNGPVFSGYSFGANR
                     NVSGEAVFTTSLVGYPESMTDPSYKGQILCFTQPLIGNYGVPSSTVKDQFNLLKYMES
                     PKIQCIGIVVGDVALEYSHWTAVESLQQWCQRNGVAAITGVDTRQLVSYLRDKGSSLG
                     KITIGEEYDADEDAAFEDPGAVNLVHKVTTKQPFHVACPKEYSKNVHVAVLDCGAKEN
                     ILRCLVERGASLTVFPYDYPIDKVATKFDGLFISNGPGDPTHCSSTVEHLGKVMEKHP
                     DLPIFGICLGHQLLALASGAKTVKLKYGNRAHNIPTLDLISGKCHITSQNHGYAVDSE
                     TLGSDWEQFFINMNDLSNEGMIHKRNPVFSTQFHPEAKGGPQDTAYLFDKFFENIAHY
                     KANNGLNLPNVDGSLLVDILPKERVE"
     gene            <262124..>263053
                     /gene="ERG25_3"
                     /locus_tag="PVL30_003976"
                     /old_locus_tag="LELG_04249"
                     /db_xref="GeneID:5231379"
     mRNA            <262124..>263053
                     /gene="ERG25_3"
                     /locus_tag="PVL30_003976"
                     /old_locus_tag="LELG_04249"
                     /product="C-4 sterol methyl oxidase"
                     /transcript_id="XM_001524228.2"
                     /db_xref="GeneID:5231379"
     CDS             262124..263053
                     /gene="ERG25_3"
                     /locus_tag="PVL30_003976"
                     /old_locus_tag="LELG_04249"
                     /codon_start=1
                     /transl_table=12
                     /product="C-4 sterol methyl oxidase"
                     /protein_id="XP_001524278.2"
                     /db_xref="GeneID:5231379"
                     /db_xref="PFAM:PF04116"
                     /translation="MSLNASNSSNFGAASTSIDITVLQSVGLTYIEKLWAQWYLYWQN
                     DVLATGLLFFLVHELMYFSRCLPWFIIDQIPYFNKYKIQPNKIPSNQEQWECFKSVLK
                     SHFLVEALPIWAFHPICATLNITYGVPFPSWKIQFAQITFFFICEDLWHYSFHRLFHW
                     GWFYKNIHKVHHKYAAPFGLAAEYAHPAEVMALGVGTVGFPILYAFLATKYETLPPIH
                     LFTITCWIVLRLFQAVDSHSGYDFPWSLNKFFPLWAGAEHHDDHHHYFIGNYASSFRV
                     WDWLLSTECGDLARGKRVKIAHEKSEKQYKKSM"
     gene            <264115..>264633
                     /gene="RPL20A"
                     /locus_tag="PVL30_003977"
                     /old_locus_tag="LELG_04250"
                     /db_xref="GeneID:5231735"
     mRNA            <264115..>264633
                     /gene="RPL20A"
                     /locus_tag="PVL30_003977"
                     /old_locus_tag="LELG_04250"
                     /product="60S ribosomal protein L20A"
                     /transcript_id="XM_001524229.1"
                     /db_xref="GeneID:5231735"
     CDS             264115..264633
                     /gene="RPL20A"
                     /locus_tag="PVL30_003977"
                     /old_locus_tag="LELG_04250"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L20A"
                     /protein_id="XP_001524279.1"
                     /db_xref="GeneID:5231735"
                     /db_xref="PFAM:PF01775"
                     /translation="MSRLNEYQVIGRRLPTESVPEPKLFRMRIFAPNTVVAKSRYWYF
                     LQKLHKVKKTSGEIVSVNIISEAKPTKVKTFGVWLRYESRSGIHNMYKEYRDVTRVGA
                     VETMYQDLAARHRARFRNIHILKVVELQKADDVKRQYVKQFLSKDLKFPLPHRVQKQT
                     KLFQAHAPTTFY"
     gene            <265170..>265976
                     /locus_tag="PVL30_003978"
                     /old_locus_tag="LELG_04251"
                     /db_xref="GeneID:5231734"
     mRNA            <265170..>265976
                     /locus_tag="PVL30_003978"
                     /old_locus_tag="LELG_04251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524230.2"
                     /db_xref="GeneID:5231734"
     CDS             265170..265976
                     /locus_tag="PVL30_003978"
                     /old_locus_tag="LELG_04251"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524280.2"
                     /db_xref="GeneID:5231734"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MSLGKASAERLLNKVVLITGATSGIGQAIAKELASINSNIKLIV
                     TARRLDKLNELKDLLEKQHEGIKIHAERLDVSKVETIAPFIKSLPEEFANIDILVNNA
                     GLALGREEVGEIDTEDIETMFQTNVLGLITMTQAVLPIMKKRNTGTILGIGSIASRDG
                     YPGGSVYCATKASVRAFFQSLQKETISTKIRASLLEPGMVRTNFSMTRFKNDAEKEEA
                     TYKGGEPLTAEDIAEIAAFIVTRRENTVIAETLVFPTNQASSAHIYRAPE"
     gene            complement(<266167..>267324)
                     /locus_tag="PVL30_003979"
                     /old_locus_tag="LELG_04252"
                     /db_xref="GeneID:5231625"
     mRNA            complement(<266167..>267324)
                     /locus_tag="PVL30_003979"
                     /old_locus_tag="LELG_04252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524231.1"
                     /db_xref="GeneID:5231625"
     CDS             complement(266167..267324)
                     /locus_tag="PVL30_003979"
                     /old_locus_tag="LELG_04252"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524281.2"
                     /db_xref="GeneID:5231625"
                     /db_xref="PFAM:PF00153"
                     /translation="MSQSFTSSTIPIPFEPHDHRHHHHHHHLQQKPPPNGDGGGNNDK
                     KSNENDIDDIESQAPIWQCMVAGGLGGVVGDSAMHSLDTVKTRQQGFPNNPKYKNMIP
                     AYRTILKEEGFFRGLYGGYTPAALGSFPSTAAFFATYESSKRIMINKWNMNETVAYLI
                     AGTLGDMASSVFYVPSEVLKTRLQLQGKYNNPFTKECGYNYRGLWDAIKSIYKTDGPR
                     TFVFGYKETLYRDLPFSALQLSFYENFRSLAIYYNHGSTDLSVGAEMFTGAAAGGLAG
                     VLTTPLDVIKTRIQTQTNTADFSNNNSTHNLTPSRNPIVRFCSSNATLRAIYSIYKHE
                     GIFGAFSGVGPRFIWTGVQSSIMLLLYQMSLKQLGEIFGTDRGNQVKKLDA"
     gene            <268420..>269769
                     /gene="QRI7"
                     /locus_tag="PVL30_003980"
                     /old_locus_tag="LELG_04253"
                     /db_xref="GeneID:5231574"
     mRNA            <268420..>269769
                     /gene="QRI7"
                     /locus_tag="PVL30_003980"
                     /old_locus_tag="LELG_04253"
                     /product="Mitochondrial tRNAs modification protein"
                     /transcript_id="XM_001524232.2"
                     /db_xref="GeneID:5231574"
     CDS             268420..269769
                     /gene="QRI7"
                     /locus_tag="PVL30_003980"
                     /old_locus_tag="LELG_04253"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial tRNAs modification protein"
                     /protein_id="XP_001524282.2"
                     /db_xref="GeneID:5231574"
                     /db_xref="PFAM:PF00814"
                     /translation="MISRLTKGGFWSPLKQSLHFYCPLYRLQHHRNYRVLAIESSCDD
                     SCFALLERNHPNETPRILDHAKKTLHSADVGGIMPTVAFNYHMSTIANLCTEFCQRNG
                     ITAQTPPDLICVTRGPGMSGSLSSSTEFAKGLSVAWNVPLVGVHHMLGHLLTSFLPKS
                     EQPNSKPPQYPFLSLLCSGGHTMLVLSKSVSEHEIIINVSDIAVGDSLDKCARELGLY
                     GNMLGPELEKFVDSIPQDEIEEFQSMDVRKRGQNKYGFKIALPYMMSNIEDEEKLYFA
                     FAHFLSTIQGYKLKYCKDRGEGVTEFDDKTKRMLAYFTQEFIFDHIIRRINQAMKRHG
                     LSMRTSDGLFVGVKDFVCSGGVAANKRLRNKLFNKIKYQEISDTPLNFHFPDLPLCTD
                     NAVMIGLAGMEIFEKLKLRTDLSFIPIRKWPLNELLTANSWVKVDQKEIDRVCKYNI"
     gene            complement(<269848..>271143)
                     /locus_tag="PVL30_003981"
                     /old_locus_tag="LELG_04254"
                     /db_xref="GeneID:5231570"
     mRNA            complement(<269848..>271143)
                     /locus_tag="PVL30_003981"
                     /old_locus_tag="LELG_04254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524233.2"
                     /db_xref="GeneID:5231570"
     CDS             complement(269848..271143)
                     /locus_tag="PVL30_003981"
                     /old_locus_tag="LELG_04254"
                     /note="BUSCO:EOG092634ZL"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524283.2"
                     /db_xref="GeneID:5231570"
                     /db_xref="PFAM:PF08743"
                     /db_xref="PFAM:PF15412"
                     /translation="MSQSSSPTDSQLRSQSLVAKPSKRTKEQHFEAYNKLRQRMKNQL
                     KEAAKGQGTSLALNNIDELTRLYSIVEKDHVRDTKVHLEDSEVFKEASGFAALNARNI
                     QLGETGVSLNEKDVIKRLKRWAATDESVVGVVKQDASGNGNEVEGEESDDDASDADDS
                     SMDNDLLADEFTFNKINWLKLGVSYHQLSKKAISVNFLHGPLASERKRAAPRARTVDD
                     TKNGTSTTARAVEARDIQDDEEKNTAYMVRMIYEIYLTKDDGEELNFYKFFIDPFSFA
                     QSVENLFYTSFLVKDGRLKLYRGKNGYPCIMRVSQQEIEESRLDGSNLFSSHHIATFN
                     YDVWHYLIETFGIKDSFLGHRDEDEDQVPEEDLIEEEDEEASENGYGNGREIEEEEEE
                     KEEEAAVAEMLNGKASNSIDSLPNSMGSSPSTTASFEED"
     gene            <271524..>273890
                     /gene="mlh1"
                     /locus_tag="PVL30_003982"
                     /old_locus_tag="LELG_04255"
                     /db_xref="GeneID:5231615"
     mRNA            <271524..>273890
                     /gene="mlh1"
                     /locus_tag="PVL30_003982"
                     /old_locus_tag="LELG_04255"
                     /product="DNA mismatch repair protein Mlh1"
                     /transcript_id="XM_001524234.2"
                     /db_xref="GeneID:5231615"
     CDS             271524..273890
                     /gene="mlh1"
                     /locus_tag="PVL30_003982"
                     /old_locus_tag="LELG_04255"
                     /note="BUSCO:EOG092615IE"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA mismatch repair protein Mlh1"
                     /protein_id="XP_001524284.2"
                     /db_xref="GeneID:5231615"
                     /db_xref="PFAM:PF01119"
                     /db_xref="PFAM:PF13589"
                     /db_xref="PFAM:PF16413"
                     /translation="MSEINNFDQQKKQKIKKLDESVINKIAAGEIIIQPANALKEMLE
                     NSIDAKATNIEIVVKEGGLKLLQITDNGQGIDKSDLHLLCERFATSKLTKFEDLESIA
                     TYGFRGEALSSISHISRLSVVSKTRDSNLAYKAYYINGKMCASNFKPATGNNKIEPKP
                     IAGRDGTQITVEDLFYNLPSRFKGLKSKSDEFAKILDIVGRYAIHTGHVGFSCKKYGD
                     PLHQLNTRANLSIKERVRIVYGSNIANELLEFNFEPTEEEDGGNMAYKVPDLGILRVK
                     GTLTNANFNNKKKIQSVIFINHRLVSCDPLRRAMNSVFQFFLPKGSHPFFYISLEIKP
                     ENLDVNVHPTKREVRFLNEDEIIDLIVARVHKILSSVDTSRKFKTQTIVTRRNNELEE
                     EKLSFGDGSQSESNSQGASQGASQGASQNASQNASQYTNSGFVQTQEAPPLKKYRQEN
                     KMVRVDASQSKINPFLSQRDTNRSFSEFIKDEFDYKDETTTLVDQEDTDLFVKDFDEG
                     LTDTQRINQESQLANNSQQSLNSQRTQVEVNLESIKGLKSDLTEFIDKQLTNVFNHAV
                     FVGIIDPLKRLCCFQYDVKLFICDYAAVLLEFYYQISLHEFCNYGEIEFDEPLSLDDL
                     LEPLYTMEGMENVLLAKEKVIETIINMKDMFQEYFRIIIDDENRLVAIPMIMKKIQPD
                     FKKLPFFIYRLGTKINYDNEKECLQGILRQIALLYLPEPFSDEDNNEAREKRDVLEQE
                     LENILFPELKKQFLATRNLTRDVVQIADLPGLCRIQGIYVVIKLATNL"
     gene            complement(<274377..>274882)
                     /locus_tag="PVL30_003983"
                     /db_xref="GeneID:85890387"
     mRNA            complement(join(<274377..274535,274826..>274882))
                     /locus_tag="PVL30_003983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119511.1"
                     /db_xref="GeneID:85890387"
     CDS             complement(join(274377..274535,274826..274882))
                     /locus_tag="PVL30_003983"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975494.1"
                     /db_xref="GeneID:85890387"
                     /translation="MRVGELDPWVISVRIDVTGVEFSKGTSGVLVRNGGVVSPVPRKP
                     KRSNHSLCGVGGVIPPVWNNELLFPDL"
     gene            <281676..>284975
                     /gene="YPP1"
                     /locus_tag="PVL30_003984"
                     /old_locus_tag="LELG_04256"
                     /db_xref="GeneID:5231583"
     mRNA            <281676..>284975
                     /gene="YPP1"
                     /locus_tag="PVL30_003984"
                     /old_locus_tag="LELG_04256"
                     /product="Cargo-transport protein ypp1"
                     /transcript_id="XM_001524235.2"
                     /db_xref="GeneID:5231583"
     CDS             281676..284975
                     /gene="YPP1"
                     /locus_tag="PVL30_003984"
                     /old_locus_tag="LELG_04256"
                     /codon_start=1
                     /transl_table=12
                     /product="Cargo-transport protein ypp1"
                     /protein_id="XP_001524285.2"
                     /db_xref="GeneID:5231583"
                     /translation="MYIENSINEKYIRSLNLGCFPKNVLNFQESQDYFQQLIFIDYQL
                     QLLIQNELNNKELVTINDFQRLQKDARSNDPKGKLIQLINYTNSIHLNYQHETNSRTY
                     EENLYYINLMANLLYLDGNLPEMNRLLSSITVSHQVNKTSQHANVSQNVLEFIQYLTC
                     RYYVLLGLSLSNHSTSTSNNNSNSNNTQVWFDYLAKFNKPFSKSQVVANHWLDLMFRK
                     LALAVSQNGTIPLSFTSQVSNLPFFKNKLSAIAFSNFLLRPENLRLTNKSFKSDYASY
                     LTIDINECIHSQIQFPNASDTNTQVNDFINNLYETMSYVPFNLAIFKPSLSKSFLVDA
                     TKKTYQSRIVLSNLIYTLIDLNEYDEALVAFKTYIAYLEKDEEQKDGYIEDILAIIDT
                     YSTCIIHFNPLKSFKNHKKFKYSDEQFVVNELHEFAKSLKRYMDKLAELIDLTYDDEN
                     YAGDRNPLSFLYRKYNLNVLQSDHSQFIELISKAWHSLGYYHYYFAVEQSANQKILDG
                     HVREVMRNYKNSLIVNSTGNVLYLFTYALALANSGELKSSLKLCKLILKKYPESFKTW
                     NLLVLLISSFNNDNAEVIKPAGAHSNILPDNLLSDEEKYNGVANLDQKVDSYVAPTPE
                     IREPEKFINKALNISGLYILKHQQKDIKLTTDAKYEILQLKMTQLAVLESIHGPQYMI
                     DYISEVFVLFHELFDVKLASNSANTSSSRQYGSGEKWSHRPSVIDPKVANGVSTSTPT
                     PIPMQPESKQSQNQKQGDKESSDTGFNPPRAASPDVVSEHKLERVQTSKRSNAVDKLK
                     RFSKLPMKEVKDAMIVRRDSVASYGSNDSGPRHIRKPDFMKRGGGTSSPPPPSQRFAT
                     TGTDATAYNDKTTTTTTTATAAAAATSKPKTILANANGTGAGNSPLGASRSNATSAPA
                     HRHDNLIERKLLQEIWLWTARIFLKVGLLDECEQSIIEAELVYEPNYKTFIATGNLHS
                     KSKKFLALSEFERSLEILDKNYKFNKIDYGYAILGLAKLVLVDDKLSNSLFISTRDMD
                     AAIIRLKNLLEQYSISWPYGVNNPEVWFYLSKIYEIIDDKILLTKSLWKCIELEDVRP
                     VRAFEICNFSI"
     gene            <285484..>286137
                     /gene="TMA22"
                     /locus_tag="PVL30_003985"
                     /old_locus_tag="LELG_04257"
                     /db_xref="GeneID:5231576"
     mRNA            <285484..>286137
                     /gene="TMA22"
                     /locus_tag="PVL30_003985"
                     /old_locus_tag="LELG_04257"
                     /product="Translation machinery-associated protein 22"
                     /transcript_id="XM_001524236.2"
                     /db_xref="GeneID:5231576"
     CDS             285484..286137
                     /gene="TMA22"
                     /locus_tag="PVL30_003985"
                     /old_locus_tag="LELG_04257"
                     /note="BUSCO:EOG092652NQ"
                     /codon_start=1
                     /transl_table=12
                     /product="Translation machinery-associated protein 22"
                     /protein_id="XP_001524286.2"
                     /db_xref="GeneID:5231576"
                     /db_xref="PFAM:PF01253"
                     /translation="MTELAPKQITYCGVCTWPLEFCEFGISLPRCQSWLASKHPELFS
                     TVYPNTPNPESVSASAPSADELASKLESATLSSDPKEAKIQAELLKKQAKHQLKQEKE
                     LTKKQNSKIIIKRIERNKRKHIISISGLEVFQIEPKKLAKTFASKFATGASVVKNAEK
                     LDEVVVQGDVSDEAKEYIEKLLKEQEGLENVKVEQVDDKKIKKKQEAAAEAAAKVKK"
     gene            complement(<286758..>288866)
                     /locus_tag="PVL30_003986"
                     /old_locus_tag="LELG_04258"
                     /db_xref="GeneID:5231575"
     mRNA            complement(<286758..>288866)
                     /locus_tag="PVL30_003986"
                     /old_locus_tag="LELG_04258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524238.2"
                     /db_xref="GeneID:5231575"
     CDS             complement(286758..288866)
                     /locus_tag="PVL30_003986"
                     /old_locus_tag="LELG_04258"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524288.2"
                     /db_xref="GeneID:5231575"
                     /db_xref="PFAM:PF00172"
                     /translation="MYHYPNYPNYQNQYQQPPQQHYLPSLSQVQQPQPQQQQQQQQQQ
                     QQPQQQQQVYHQQIYPPPPPPSHLLHQPQQQQQQPHPNYITTTSAQPLTQPQTQSTHT
                     PPPPPGILTSFNNNTNTQQNTPQSSVSPQKHDLHSNSIPRRKKNSRRKHRNSHLGCGT
                     CKKRRIKCDESLPSCMNCIKGKLHCAYLNLDNNARSALRLAQYNQNMRQDKLEQGIRP
                     MPPAQELHHQHQQQQQIQIQQQQQQAPAPAPSSVSVPGPPLPSGQLQQHMNMGIPHQQ
                     IHQTPQGPVLITGTTPIVMAPAGGAHPQVQPQISGPIGVTTAAPIIQSPYGPLVPMLT
                     TTGSIVYTTTTQPQPPQQPQPPQQQQQQQQQQPQQQPQQQQQQQPQTMSTPQNIQILS
                     QQPIQTIPLSHSQVAAPPANPQSLSLQQSATLQIPHTQQQLPTTSPASIHSSHSSYSM
                     PAPPAPLAPLAPTSQSSPSTTSSTQKPSSTPITSSAANAATMASQAINVSPRESTKLP
                     SIVHKIPHIPSIKTFTPSPPLPPQPQSSSSSTSTTTTTTSAVQPPKIEIHSISGTPQP
                     PQLATKNIHKRVKSSTSSPEKSPILPSIAQITNGTHNFGSGNGSSSNSSTNSTTSSNS
                     TNSLGAHSFSRPNSANLTNLTPLASIPKSSSGVSGFGGLHISDKKSGSEDNDSKIKLP
                     GINSLKKNDEEKVSISKLIT"
     gene            <295674..>296255
                     /locus_tag="PVL30_003987"
                     /old_locus_tag="LELG_04261"
                     /db_xref="GeneID:5231573"
     mRNA            <295674..>296255
                     /locus_tag="PVL30_003987"
                     /old_locus_tag="LELG_04261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524240.1"
                     /db_xref="GeneID:5231573"
     CDS             295674..296255
                     /locus_tag="PVL30_003987"
                     /old_locus_tag="LELG_04261"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524290.2"
                     /db_xref="GeneID:5231573"
                     /translation="MTSDSTADENVTNLENLTISAQEHHPSLAPSSPNPASTNTTSVT
                     SYQQQQQQQQPKSKKQRKPQTQEEYNHQLQLWQKTGPQINTETWLYENMDNLNVDNKA
                     DRTKALHACEKAYYERDWTKCLQMCKVAELLFGVDFGELEAEEEALLQQFKDVKKKSR
                     ICSKLEKQVYELWNIKSRCIMRAKQRDKDKEEA"
     gene            complement(<296474..>297004)
                     /locus_tag="PVL30_003988"
                     /old_locus_tag="LELG_04262"
                     /db_xref="GeneID:5231693"
     mRNA            complement(<296474..>297004)
                     /locus_tag="PVL30_003988"
                     /old_locus_tag="LELG_04262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524241.2"
                     /db_xref="GeneID:5231693"
     CDS             complement(296474..297004)
                     /locus_tag="PVL30_003988"
                     /old_locus_tag="LELG_04262"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524291.2"
                     /db_xref="GeneID:5231693"
                     /db_xref="PFAM:PF12328"
                     /translation="MAKRIQGKNIRHTKHSPVQKLQNETEFNSTILIKSSTPFISALK
                     RIQKQLNKFSKSAATSTSSKKYQNDQYKKLQYIKVRGMGKCLEKTLKLALKFQELNYR
                     VDIVTGSIEVIDEFEKLENEDEEEDEEEEKMDVDVDVDVGKETMQEDDVFDDEERIYR
                     KRMVSTVEVRIWLNRD"
     gene            <297477..>297818
                     /locus_tag="PVL30_003989"
                     /old_locus_tag="LELG_04263"
                     /db_xref="GeneID:5231588"
     mRNA            <297477..>297818
                     /locus_tag="PVL30_003989"
                     /old_locus_tag="LELG_04263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524242.2"
                     /db_xref="GeneID:5231588"
     CDS             297477..297818
                     /locus_tag="PVL30_003989"
                     /old_locus_tag="LELG_04263"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524292.2"
                     /db_xref="GeneID:5231588"
                     /translation="MSRKRSWDSDLESDNFHFENTSSSSLPSTPPSLSQLYSSPVCKR
                     FQDHKIHTEVHYKTIEMMMNASRNIKYNENGTMEKDLQQQQQQQQQQQQQQTMDLESD
                     TGSRYYQRPHW"
     gene            complement(<298206..>300338)
                     /locus_tag="PVL30_003990"
                     /old_locus_tag="LELG_04264"
                     /db_xref="GeneID:5231680"
     mRNA            complement(<298206..>300338)
                     /locus_tag="PVL30_003990"
                     /old_locus_tag="LELG_04264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524243.2"
                     /db_xref="GeneID:5231680"
     CDS             complement(298206..300338)
                     /locus_tag="PVL30_003990"
                     /old_locus_tag="LELG_04264"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524293.2"
                     /db_xref="GeneID:5231680"
                     /translation="MITLRRLNAVGTRIVVPKTCFKQFHYTSRRQFNPIVENFLNDLK
                     EEGEDDKKSNKSRRLNSLGNNDRNDHNNERNNNNNYNDGEDNGGDSSGRFDRFKSFLM
                     KCLETIGITISSVGILAGAGFLYHRFYGYHVLYKMDKAFDKGEDPAAQIAMHSKTHAH
                     TSNSEDDKGDQSKNNDKEDGDHNHNSIQDFWVDRPQQKLLDEIISGKIIGRYFLIIGE
                     KGTGKTSLIMEAMKKVNGLNVCIFDAHADPEIFRLRLGKALNFTFSEDYIGSLFSIRG
                     PRDTTALLDIERAFSKLEELAINRVAKTKRPLVMIINNAHLIKENEEGVKLLELLQQK
                     AEALSGAGLLTMIFNSDDYWVYEKLKQLGTRLELINVRDLNRKETVNALKFIRHRFFP
                     KDRVLNDAVCNKVYDLIGGRPQHITQVARHNDIVKACHEIIDREKTWYLNQCGLLGSG
                     MDDDVMESGKFSSSAMLLMREFVEMDRQRADSLILSKDNSNQHDHYLPELPLWRARQV
                     MTRADYIQRYDNLNIFTIDSESRVRADSVPMMRAFHEIASQPHFDELLEDTMDRVADI
                     ESLGRTREIVMKDLNMGSEYLWKKYGPAELKMTMLKSAKTKDVHGDFTEFNNAANEKG
                     SHSGSSGVGLGNDNSAGAGAGDGAGGGVDKIENDDDDDDEELYLEDIDRKDSRKWWKR
                     RMNDQLFVPEKDRHAKEGDLDLNRVNED"
     gene            complement(<300774..>301406)
                     /gene="RLP24"
                     /locus_tag="PVL30_003991"
                     /old_locus_tag="LELG_04265"
                     /db_xref="GeneID:5231587"
     mRNA            complement(<300774..>301406)
                     /gene="RLP24"
                     /locus_tag="PVL30_003991"
                     /old_locus_tag="LELG_04265"
                     /product="ATPase-activating ribosome biosynthesis protein"
                     /transcript_id="XM_001524244.2"
                     /db_xref="GeneID:5231587"
     CDS             complement(300774..301406)
                     /gene="RLP24"
                     /locus_tag="PVL30_003991"
                     /old_locus_tag="LELG_04265"
                     /codon_start=1
                     /transl_table=12
                     /product="ATPase-activating ribosome biosynthesis protein"
                     /protein_id="XP_001524294.2"
                     /db_xref="GeneID:5231587"
                     /db_xref="PFAM:PF01246"
                     /translation="MRIYQCHFCSSPVYPLHGITFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLRWTKAFRKAAGKELVVDSTLTFAARRNVPVRYNRDLVATTLKGMSRIEEIRQR
                     RERAFYKNRMRGNKERALAADRKLVEENPELLRLREVELRRKAEKQAAKENAMEEEDE
                     EEEEDDVEEEDEEMMDEDEEMESESESESETEGKKIKQKVLLKNKRKTRR"
     gene            <302022..>302498
                     /gene="PAM18"
                     /locus_tag="PVL30_003992"
                     /old_locus_tag="LELG_04266"
                     /db_xref="GeneID:5231589"
     mRNA            <302022..>302498
                     /gene="PAM18"
                     /locus_tag="PVL30_003992"
                     /old_locus_tag="LELG_04266"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM14"
                     /transcript_id="XM_001524245.2"
                     /db_xref="GeneID:5231589"
     CDS             302022..302498
                     /gene="PAM18"
                     /locus_tag="PVL30_003992"
                     /old_locus_tag="LELG_04266"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM14"
                     /protein_id="XP_001524295.2"
                     /db_xref="GeneID:5231589"
                     /translation="MEVPTLAIPGENNSQYQQQQQSHPQFQYTGQLQKKQAAEGSAEW
                     YFDQGVNWMGDHPWLTGLGGLTIAYFAAGLFKKNRPGINGKAFYTGGFGQKMTAREAL
                     QILNLKETNLSKMKLKEHHRKLMMANHPDKGGSSFLATKVNEAKDFLEKRGGMKAK"
     gene            <303736..>305769
                     /locus_tag="PVL30_003993"
                     /old_locus_tag="LELG_04267"
                     /db_xref="GeneID:5231718"
     mRNA            <303736..>305769
                     /locus_tag="PVL30_003993"
                     /old_locus_tag="LELG_04267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524246.2"
                     /db_xref="GeneID:5231718"
     CDS             303736..305769
                     /locus_tag="PVL30_003993"
                     /old_locus_tag="LELG_04267"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524296.2"
                     /db_xref="GeneID:5231718"
                     /db_xref="PFAM:PF01417"
                     /db_xref="PFAM:PF07651"
                     /translation="MTTYEKIVKGATKLKVAAPKPKYIEPILMATSTDHSIISNDNFN
                     TIMRTLQHRLRDSAWSVVYKALIVIHLMIREGDKDVTLKYLADQGHSMLNLSSSNISH
                     GGGSGNTDVRFIIKYSKYLHTRVKQYDATGIDYVRDERSNNSTSQQGGRLRFLTIDKG
                     LLRECESVQKQIDALLKNSFMENDVNNEIVLTAFRLLVNDLLALFQELNEGVINILEH
                     YFEMSKYDAERSLKIYKKFVDQTKFVIDYLRVAKHLEYATKLHVPTIKHAPTALTSSL
                     EEYLDDPNFEVNRRQYLAEKDGKKNLNNNTAIASKEAQQQQSNNNSNNNVSSGFGNSS
                     IGQSNSGGDVNRHASLVVQQTYNPWSNMFVPGQAQGYMQSPQQVQQQAQLQAQQQQEA
                     YQQQLQAQQQAQQQAQLQAQQQQEAYQQQLQAQQQAQQQAQLQAQQQQEAYQQQLQAQ
                     QQAQQQAQLQAQQQAQQQLQAQHTQSFQQNTLPSIAQGQQYQSPNSTTQFQSAFTGFG
                     FGGYGPTTIQPQSTNPFAQSQSQSQSQSQQPAPNQYTQPQGSLTRAGTNPFSVMQTGH
                     QTIPSSQSQPQISSLIGQPPPPPQQQQQQQQQQPHILNPLQPQSTNPFMRMATGQQQQ
                     QQQQQQQQQQPLAPQSTNPFAAFSAGSNQQSSFNSYPQSQQQRAFNPVTDSLI"
     gene            complement(<306048..>306506)
                     /gene="ibp1"
                     /locus_tag="PVL30_003994"
                     /old_locus_tag="LELG_04268"
                     /db_xref="GeneID:5231585"
     mRNA            complement(<306048..>306506)
                     /gene="ibp1"
                     /locus_tag="PVL30_003994"
                     /old_locus_tag="LELG_04268"
                     /product="Cdc25 phosphatase Ibp1"
                     /transcript_id="XM_001524247.1"
                     /db_xref="GeneID:5231585"
     CDS             complement(306048..306506)
                     /gene="ibp1"
                     /locus_tag="PVL30_003994"
                     /old_locus_tag="LELG_04268"
                     /note="BUSCO:EOG092658QH"
                     /codon_start=1
                     /transl_table=12
                     /product="Cdc25 phosphatase Ibp1"
                     /protein_id="XP_001524297.1"
                     /db_xref="GeneID:5231585"
                     /db_xref="PFAM:PF00581"
                     /translation="MSRLYSISDIKLIKPATLYKWITTCHSPNGTFQVIDVRDSDYVG
                     GHIRGSWNYPASDLNGSKILELQQRIYDAKIKDVVFHCMLSQARGPKSALKFLRSLDD
                     IVDPEMQRYFQQDDVRVYILKGGFTEWAGEYGPNSEVTEDFAEDIWGFGS"
     gene            <307051..>308598
                     /gene="PCT1"
                     /locus_tag="PVL30_003995"
                     /old_locus_tag="LELG_04269"
                     /db_xref="GeneID:5231605"
     mRNA            <307051..>308598
                     /gene="PCT1"
                     /locus_tag="PVL30_003995"
                     /old_locus_tag="LELG_04269"
                     /product="choline-phosphate cytidylyltransferase"
                     /transcript_id="XM_001524248.2"
                     /db_xref="GeneID:5231605"
     CDS             307051..308598
                     /gene="PCT1"
                     /locus_tag="PVL30_003995"
                     /old_locus_tag="LELG_04269"
                     /note="BUSCO:EOG09264I9J"
                     /codon_start=1
                     /transl_table=12
                     /product="choline-phosphate cytidylyltransferase"
                     /protein_id="XP_001524298.2"
                     /db_xref="GeneID:5231605"
                     /db_xref="PFAM:PF01467"
                     /translation="MARLPRRKAIENELNGHGAPLTRTLSIESISSLFKRNRKRKLED
                     DSSVKSSSPTTDNEDAESSKYEDEVEENDDDDDDDDDNEEEEEDKDKDGNDQEGRGGN
                     RRAKKRRIKTKEEEEFEEKERKLDEELPEEYRKFRPRGFRFNIPPKDKPIRIYADGVF
                     DLFHLGHMKQLEQAKKSFENVELVCGIPSDKETHKRKGLTVLTDEQRCETLKHCKWVD
                     EVIPNAPWCVTPEFLREHNIDYVAHDDLPYASSDSDDIYKPIKEQGMFLTTQRTEGIS
                     TSDIITKIIRDYDKYLMRNFARGATRKELNVSWLKKNELEFKKHINDFRTYWMRNKSN
                     INNVSRDLYFEIREFMRGKKFDVQQYLENQQKQQQKHKNQQSITNGSQGPSRSGSISD
                     FEDSTSYKGGSPLTDFASKYIGNANKELNNAGKVISKWIHGEDDSDEEEIKPIVIKPV
                     HKARRRSSSSNSSIKPRLINNSATTNANMNATTTTTKGTSSGAAVKSTPKKGSSTPRK
                     TPQKKAY"
     gene            <309060..>310352
                     /gene="MMM1"
                     /locus_tag="PVL30_003996"
                     /old_locus_tag="LELG_04270"
                     /db_xref="GeneID:5231595"
     mRNA            <309060..>310352
                     /gene="MMM1"
                     /locus_tag="PVL30_003996"
                     /old_locus_tag="LELG_04270"
                     /product="ERMES complex subunit mmm1"
                     /transcript_id="XM_001524249.2"
                     /db_xref="GeneID:5231595"
     CDS             309060..310352
                     /gene="MMM1"
                     /locus_tag="PVL30_003996"
                     /old_locus_tag="LELG_04270"
                     /note="BUSCO:EOG09262X74"
                     /codon_start=1
                     /transl_table=12
                     /product="ERMES complex subunit mmm1"
                     /protein_id="XP_001524299.2"
                     /db_xref="GeneID:5231595"
                     /db_xref="PFAM:PF10296"
                     /translation="MTEIDPNIKEQEMAEVINSDKDIDSDSNTVGSTLFAQLQNQLRL
                     QQEELLQQQRELLSQESHLQSLQSSHSSISNTWNFTQGLVVGQLSVIFLIIIFVKFFV
                     FADSSSSIPSKFVARDGAGVIVRRDNKSTTSRDRHNGIGGKDSNSEPSTDDERLQNNR
                     AKVSSILEKTYYDVNNHASESLDWFNVLIAQTISHLRTEALLSDNIYHSLSNFLDNSE
                     LPDFLDKINLTEIDVGDDFPIFSNCRIKHSKEDTGRLEAKIDVDLSDTLTLGMETKLL
                     LNYPRPLTAILPVAMTVSIVRFSGCSTVSLVNTNDQEFQADQVARPSNGHTSTDNGND
                     EIGKGSSSEDKKGGTALMFSFAPDYRLEFVVKSLIGSRAKLQDVPKISSLIENRLRTW
                     FIERCVEPRFQVVKLPSLWPRTKNTREPAKPKDSDDTL"
     gene            complement(<310599..>322130)
                     /locus_tag="PVL30_003997"
                     /old_locus_tag="LELG_04272"
                     /db_xref="GeneID:5231480"
     mRNA            complement(<310599..>322130)
                     /locus_tag="PVL30_003997"
                     /old_locus_tag="LELG_04272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524251.2"
                     /db_xref="GeneID:5231480"
     CDS             complement(310599..322130)
                     /locus_tag="PVL30_003997"
                     /old_locus_tag="LELG_04272"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524301.2"
                     /db_xref="GeneID:5231480"
                     /db_xref="PFAM:PF05792"
                     /db_xref="PFAM:PF10182"
                     /translation="MSDWLFLKKMWIFLLLISISAATIVQRSSDSYDYTQGYSYTVQP
                     LRCYGQTNSYTITSIGTAPAQNIFVNLFDWVLGIGTPAADLQVLDTQYVGNNYFRVTL
                     SFQIQGSIGGSITTTLNNLGSAYANSIVINGDGAANIFSDQYSFTATVLVQGSSHNGM
                     SCLPDNLQITYRIDKTILFVTKTKTFTYTLNQNFNSPSSTNGDLQVRNYCWKGPGCTG
                     TTTTFWSNTYTSTTTISNGFGTGTDEVLINVPSNKAITTSGFWTYPYTSKSTFINTVG
                     GTDTVFVGYPPNPTTSKTSFWTGTVTSTSTIRNLPGSTDTVVALYPPNPTVSSTTIWT
                     NAFTSTTTVKNSPGMTDYVVAEYPPNPTRTTSIFWTRSITSTTTMKNNAGATDSVVFE
                     YPANPTTTTSQFWSGTSITSSTITNPPASTDTVVIKYPANPTTTVSSFWVGSTILTAT
                     ITNAPASTDTVVLNYPANPTTTISQFWTGTTTSRSTITNGPASTNTIIVNYPSNPTTT
                     VSKFWVGSTVLTVTNTNGPVNTDTVVVNYPANPTSTVSSFWTGSATSAITVTQGPAGT
                     DVVVKEYPSNPTITTSQFWTGTTVTKSTITNGPASIDTVVVKFPSNPTTTVSQFWTGT
                     SVTKSTVTNNPSGIDTVVVKYPANPTITLSSFWTGLGTSISTSTQGPAGTDVIVKEYP
                     SNPTTTVSSFWTGTTVLRSTITNAPAGTDTVVINYPSNSKSTTSQFWTGSTVTTSTIT
                     NSPGGIDTVVVKFPFNPTSTFTSFWTGSATSLLTITQGPGSTDAVVKEYPSNPTTTIS
                     MFWTGSTVASAKFTNAPGEVDSLVIGYPSNPTVTVSTFWTGSNTAKTILTHGPSNTDT
                     IVIQYPANPTTTVSSFWSGLGTGYNTITNGPNDVDTVVVEYPPNPTTTVSSFWSHSGS
                     GITTITQGPDSVDTVVIGYPANPTVTITSYWSLKATSSSVQSNQPAKTDTMYIWELPI
                     TTATSETTRTTSSFSSFSSSPNSLFSSTTTPDIVVTNTQAEDASSTFDFTSESRTESS
                     FESDFMSDLTTLSELTDSSGHSTEQSATHIDVSTTTNESSYSLEHSTSDPELGSKLQT
                     TEESTTSEDYVTKSHDSSFFEETMTDEGSLSTTESSTLMNDSRSNEYSTTVEETVTSK
                     TLGLTTEESTNSIADEISTSYRSVSFDMSNSYAEESDVTDYVTTFKESTTSTYKSSPS
                     DVFATNIGSSTTIEEFTSSEQQIFTSKPTSSSIDSVLSEGYDSDTDSYSATTEVNVSS
                     EELSSFIDVSITSDASKTDVEINTLLDESSTNNESTFTMHETNFEEESSKTADVSDST
                     RAESSTAIDESILSSEFVATPTKSTSTVESNTNEKPTGSIAYSSTDGNNTDLNDTTES
                     TAESNITSNEQNTIGETITNEQTSFFTGEINSQLYSSTEDEEKSILTNIESGISTDSF
                     NTISNSFTNFDSAIVTTESYTEDNSESSEQYTTIEAGSSFEESVATYDEFSSGTDDLS
                     YTHKLTSSNGETILTAQSSDYYYYESSSFEETSFISDESVTDSDFTSSEDSHMTAQSS
                     YSIDSSYTDEGYISTSESSLYTDQTCSSEQYETTTKDLSFNTVEYSTDDEIRSSIDIN
                     STTEESFTSTLEENVSIVNDVSDSTKDFITTSSHDSTLEKTSSTNESTANDYDTNQDF
                     SSKETNAIETPITSVGSKSITSDNLITSSDESIVTQMPTNSDEYTISNTDESSTAEQL
                     TTSIYTSENEHFESTSDQTNISKESKTSSQSDITIFETSSVDEYSTSEDGSTSNGDDY
                     STGESLFTSSEYVTTHELSSMTDKSRGTDETETSTEMSDITESATTKVTNTTEDYSYF
                     PTGDESFSIDLSNIATQATMENSDKQSFIVTMTTDGVSISSEETLVNSSEPTFNEQTV
                     STFNDSVKTNENVSGNESSTFTDDPSSTIENITSEYTEATIDQASFNNDSSLDDASST
                     VSNKLHTNDSFMASTDSTTDHHQVSASATEDSLNKETSTYFQTSFTDELSLTTNDSTA
                     TTPPISTIDISTSSEETSAIEKSRETDNGSSFIVESIISTDEHITESSSNEISIPSSD
                     LDFDTLESISIDEILSTTYDEVTTSKELLSQFETNSVTGETVFTDEVLSSSTEPVSSI
                     ADISSYKDAPIETEESLSTQIESSSVTNKISFSTAPTSTDGYFSTGLSNISKDVDPTT
                     YEASPSSQYVSSHEYISTIEETRTNNAFSTYSSIYPETDSSIAMEKSFSTDDFSTSEE
                     SSESESSDVIKDFSSFITDSISSDVASTMDEKDTSTDSAFSLPAVSTTNDNLFSSTDI
                     LFSSNNQYATLTALYSQSEESFTSSDEVTTNDDTINTITEEATSFKGSMTIDGSGSVP
                     SNESSTFNESDTTAYHLTTDETEYSKEFSSTEMVSSSIHEVTSTVVTEPNVTIEGSSF
                     NESFNTNNESSVMATESSSLEELSFSKDSGIYSSESYSIVDSFYETSTYTIDDESLTQ
                     DTTTTTVNASGQQTSTVSIITNQSTNSDGSATNSKTNQTTQHVVSMQTTVSDDEPNYT
                     TEEIDYSDDVSTTNEYHTIFDKSTISTDLSTYSDNSSTNFIERTSLSISESSSTDNLY
                     ISSSIPTSTLTLTTKVEDSISDDSSYTSLESYYSDLSSYLEELTTIQETNIPSTSNSN
                     LNVITSYSDMSATIAESDLPTDSFSFSNEYSSDEDTATISRDESSSTNKFISTNASTT
                     SSNETIITDITNTEDTFTFLQSSDSTTSSSFAIIESSSVEEPSSDANEPNFETDSSAT
                     TEYHTTNQEVTTAIEISKHSKDISSSDETTISIEDSVYSTDMSTLQEFTDSIGNAATI
                     SQLSAQVTFTSTRDDESTLNSKSLAGVELTTSVGDLDIKSDSFEDNDLSTFTTDLNTS
                     TKTTTVEEGSAILSSILSFYKESTTNTDLSTLTSEAYYSESSSIVEDTTISFENSISN
                     VEITTHIVASLSTDDFSSHVLSSTSDEVIHTFTDNSMDTLTDGLSSSLGFITSESSSS
                     TTDSVSILDNKTSIETIQTINDSDSGSLLSVYSTYTYTHDSSISSDIVSAIEHESGTF
                     EISLESTASPGDSSIQFPHTLDATSFIESNGEQIPSIESSPSVTVDFGMSYSDLSPTV
                     TLTENENSQFSSLTTDVEHLTSKETITTLTNTTSTISTSASTSDLKEFSSGLVSESID
                     FASKSTFDLVSSVSSKVTTSSNTVNTSTIATLSNENDNTNFGISSQSINDIPYVTSSV
                     SANHISVTGSSGSGSVFVTNTLLSSSTPTSSPSYSLGESESKYIAESDIHSSNESESV
                     FRSLNAEESTTLITLVNSISNDDSVAKPGTKTDSILSTTSVSSVPSKITSQSPPQVSP
                     LESTSHSTEDQQYTTSAEFSHLLDATSVYASGPILLTKESLLTTSYSSKLSLSTTSTP
                     NSIVASSTGPVYWNSSNANTHSSSNRNDLQSTLLASSTLNILDTEAIQTSTTYASVVT
                     ATNSLSTDNIDQNTKGDTDILTAQSLTISHELISTTFDSQSGTYSTPALYDQSRCSTC
                     SANSNTVSEIPPNTTNKISTASPSDFKNTLISSTRAVTKPDILSLPSKSDSGVPTNTQ
                     TTNFNTQPTTQLDYSNVPSSSSTGQTGIMEFPSQSDIQSLNKPVLASSINKTKPTSVK
                     SLFLESSKSNESARNTLAADISNSSKQDLSSEAKTTNSNMPSKTMGYEGATEKSSNIE
                     STKTNQVNPSLVDEEDDHDFSTTTTTKTTGLQKTSKSELAPVALSTDAYAQSELPIFD
                     PDTLSTTNGIAQLTSANPVPSRKYGTTLSSASRPPQSSPSSPSSPSSLSLTLPQNTVS
                     SYEGSASSLTSIGTFLIITITTIVSCFVL"
     gene            complement(<327857..>331129)
                     /locus_tag="PVL30_003998"
                     /old_locus_tag="LELG_04273"
                     /db_xref="GeneID:5231747"
     mRNA            complement(<327857..>331129)
                     /locus_tag="PVL30_003998"
                     /old_locus_tag="LELG_04273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524252.2"
                     /db_xref="GeneID:5231747"
     CDS             complement(327857..331129)
                     /locus_tag="PVL30_003998"
                     /old_locus_tag="LELG_04273"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524302.2"
                     /db_xref="GeneID:5231747"
                     /db_xref="PFAM:PF10182"
                     /translation="MQFKNLLVFIVAALSTTEATKKVTKPPSVPGKGDYYDFARNFAL
                     APVGHNCYGQEVPFDIQSSAGIYEGLEKRTVKSSAKSSAKSAPAAHFQVTKAEKVDEK
                     HYKIDFLFKTTYDPSALKSFAGESSIEIDFVNLGSPYMDNIKAHGDTATFKYNNPFDF
                     EASVIVSPIQHGNYFCLPPDFGIEYRVSVWYSDWSHVFDTNYKYTCEKNLDKVKRTVH
                     KSYTKFDAAKTFDLTLPNYCWKVPDCEPYKPTLSSTITSTTLSSTFFTETSTASSTDY
                     STTLTTPIVATSSESEIEKVTTFTTTVPTVVVTETTVTHTITEDGTTFVTTEVATETV
                     TMNVTETSKETTTEAITVTQEAETVTTTVEKVLETTVEREILVTETITRDGKTFLTTD
                     TETATVTELNTETLVQTLVVSTTFTDEPETETITTTVEGVPETIIKYQQPVTHTVTEE
                     GQTFTKVRVETIYSTEQPITYTTTVEGAVETVFKYLKPETKTVTEQGEAYSITETNYE
                     TIVVTKEPKTVYETVEGIPTPITIIEVQKPITKTVTEEGQAYAVTEKSVEFITVTQDA
                     QTITTTVEGVPKTIVEYKEPITETVTEKGKEFTTTEIKFKSITVTESPKTTTKTVEGT
                     PVTIIEFKEPVTKTVTMDGEITTVTETTKDQITITEEPVTVIKTIEGVLETVLEFKEP
                     VTVTITEEGKERTKTQVHTSLETVVLSTTVTEEPKTYTTTVEGESETIIEYKVLTKEV
                     VVKENETFTVTDTNHETVTLVSVVTEEPVTITSTIEGEVITVVEQEKAEVKLITKDGY
                     TITETDTVIDTVTIKEEPITVEATTTEIQEVFVEKTQYFTKLITEEGKISTVTESSVE
                     TSIVTEVFTNPITITTEVTVVDQKVPVTKTITKEGETFTTTEVGFETIVSQSVIYKKA
                     STTTTLIDNSTIIITTTITTTTTTPITIVDEGVLITQTLTKDGETYTTEEVGTKIETS
                     TLTLTLTMTTEIAKESEIASATILDYTVTETAVVKEEEEKEEKEEEAEEQEEINEEKQ
                     STLFTTTGITSLVTEMESGSTMAYSTTAVTDVLEVFEGSAGYITKSSWTVLIGFIGYC
                     FI"
     gene            <333176..>336292
                     /gene="NMD5"
                     /locus_tag="PVL30_003999"
                     /old_locus_tag="LELG_04274"
                     /db_xref="GeneID:5231746"
     mRNA            <333176..>336292
                     /gene="NMD5"
                     /locus_tag="PVL30_003999"
                     /old_locus_tag="LELG_04274"
                     /product="Nonsense-mediated mRNA decay protein 5"
                     /transcript_id="XM_001524253.2"
                     /db_xref="GeneID:5231746"
     CDS             333176..336292
                     /gene="NMD5"
                     /locus_tag="PVL30_003999"
                     /old_locus_tag="LELG_04274"
                     /codon_start=1
                     /transl_table=12
                     /product="Nonsense-mediated mRNA decay protein 5"
                     /protein_id="XP_001524303.2"
                     /db_xref="GeneID:5231746"
                     /db_xref="PFAM:PF03810"
                     /translation="MDANLLLKCFAETLQADVTSRTAAEKQLKEISVQPGFLGACLDI
                     LETQETPAHVKKAAAVYFKNRVVRYWASKDTNLRVDEGEKPVVKDRIVPVLLVVDHST
                     RQQILPAFRLLVSLEFDNWSKLLEQTGQLLQESEKSEDYLYTAILCLVEITRKFKWAD
                     NQSRSNKLDPILEQTFPFLLSIGKSLLSQHENGVELTETKAEILKLILKSYRFVTYYE
                     IPNMLRERDQLLQWGEFHASVISMKPPAYAANTDVSEQEKSLLQVAKCYKWSVANILR
                     LFIRYGSQNSLSRKIAYPEFLNVFINEFMPHFFNHILKVVEEFCQGVRWIGLTELYQL
                     LEFLSHCISEMPTWKLIKPHFEILMHHFIYPVICPSDHLLETFEDDPQEYINLCFDTC
                     GDYDNERYAALGFVTTSLLKHAKFCLPPITLMIQQELTNVQNDDSLESAKKKDGLMRI
                     LGSISGYLVDDDSIAPLLTTLVVPNFKTAHEFLKARTIEVCSQFADVQFAPDVLAVIT
                     HGILNNFDGDVSLPVRFNSALSIQAFITNEDSKNALSQTILPVMSKLLELSNEIDNDA
                     ISIIMQECVESFSEQLQPFGVDLMSKLVHQFLKLAIEINEASKVEVDDFDANYEDQGD
                     KAMAALGFLNTMITVLLSFENSHEICVKLEEICAPAIDYVLVNQMDDFFAEIGELIEN
                     ATFLLRAITPIMWKNFKLLYDIFEQGSGLLYVEELLPCLTNYMIYGKSTIKNDENLQK
                     HFFQLLNVIAASSQEEEVGSISDLVLTYEFAENFILTLEENAAPYVPQILEVVLSNYH
                     QCEERKLNGTFTVNSNNVIIACLVYSTEATIAILKQTNQFSTFFKKWLDSSLERVFDL
                     KLSLLGLMKLISINQLDSDISLAVSGKIPSTLKQLVTSITNLEKKRKNIDDFKDDVNL
                     NLDQAQSSVQTQNSIQNNSLGADDEQQQGESGYEEDWEDDVEATKKYIEFLNNEESQL
                     TGSGFQDEEEIYEDPLAPTPLDEVNIFELFKSFLHEFQSADPDKFNVLFGNLKDEDQK
                     VIIDVVNT"
     gene            complement(<336834..>338582)
                     /locus_tag="PVL30_004000"
                     /old_locus_tag="LELG_04276"
                     /db_xref="GeneID:5231724"
     mRNA            complement(<336834..>338582)
                     /locus_tag="PVL30_004000"
                     /old_locus_tag="LELG_04276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524255.2"
                     /db_xref="GeneID:5231724"
     CDS             complement(336834..338582)
                     /locus_tag="PVL30_004000"
                     /old_locus_tag="LELG_04276"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524305.2"
                     /db_xref="GeneID:5231724"
                     /translation="MMGFHSNATSNATSDANANTIATANVVRLEQPRQLAQSWNSNSS
                     SNNNNKGNSKNTSKSKSNQDHTNRPPSNGKKNRKNQVSISHLMNFQSYRDTEEYQQSK
                     HRERTKRRPSKNKQDGRRVELTGMRFLSVNFKFVVHERYTPQLLHSDPNLPIDLEKVI
                     AVIAPSSTCPICISSDMIAPRMICAGGHVLCLLCCLRLMANDGHCPICFEYVRNLRPV
                     IISDECFERPRVGEDVILKLMERQNQLATPVLESATASDFPDARDILTAPYFRFYKGD
                     QQYLLDFFEMERMLVLAVDDEDKEMVPKGVQHIDQLLSQWTAPFNIDDQIMPSENDSA
                     VAAKKFFYYTTGCNYFLSPFDFKVLKHSSGNQYELLPTSIVAKIEDIKVEVLDSDTIQ
                     HHKYLGHLPIGSQVSFIQCNWEGIIDSESWSLFGNDLQKRSKASKKKQLREEMNRKRA
                     LDNEEVKLKRFFMHGNDLSDSEYNDYDTGSYGRRRFIDTFDSLSLSNQTSPTDADIDG
                     DAGTNGIGVDHGVAESDKGGRYETTVWGTRIKVHSDDDDGTDDLEKDAEEIQEMILKA
                     KEKRSKKSKKLVLMST"
     gene            <339098..>339580
                     /gene="SPC2"
                     /locus_tag="PVL30_004001"
                     /old_locus_tag="LELG_04277"
                     /db_xref="GeneID:5231748"
     mRNA            <339098..>339580
                     /gene="SPC2"
                     /locus_tag="PVL30_004001"
                     /old_locus_tag="LELG_04277"
                     /product="signal peptidase complex subunit spc2"
                     /transcript_id="XM_001524256.2"
                     /db_xref="GeneID:5231748"
     CDS             339098..339580
                     /gene="SPC2"
                     /locus_tag="PVL30_004001"
                     /old_locus_tag="LELG_04277"
                     /note="BUSCO:EOG09265B95"
                     /codon_start=1
                     /transl_table=12
                     /product="signal peptidase complex subunit spc2"
                     /protein_id="XP_001524306.2"
                     /db_xref="GeneID:5231748"
                     /db_xref="PFAM:PF06703"
                     /translation="MSLKKANINSVKDLHKHTDEQLGSILQQLGYEESFTLTDIKLGL
                     GLVSVAIAGLLFLADKKYEFKDIYGLTAASCFIYAILNGVLFLVNRKYKNVKYIGYSK
                     GNKLVIATETTKYDPIYFLTINGKRAQIPFSKIYDSIGYLDRDEFSKLLSREINKKDE
                     "
     gene            complement(<340114..>341070)
                     /locus_tag="PVL30_004002"
                     /old_locus_tag="LELG_04278"
                     /db_xref="GeneID:5231721"
     mRNA            complement(<340114..>341070)
                     /locus_tag="PVL30_004002"
                     /old_locus_tag="LELG_04278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524257.2"
                     /db_xref="GeneID:5231721"
     CDS             complement(340114..341070)
                     /locus_tag="PVL30_004002"
                     /old_locus_tag="LELG_04278"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524307.2"
                     /db_xref="GeneID:5231721"
                     /db_xref="PFAM:PF00106"
                     /db_xref="PFAM:PF08659"
                     /db_xref="PFAM:PF13561"
                     /translation="MNFFDTNNGGSLAIPYTPSTSNICILLAIFTTLLLLRYISRLIR
                     QYNLPSGRWGNLGASDIALVTGGSNGLGFELVKELLEKQVVVYVLDRQAPREKDVNMH
                     YIPCDLQNEDALEKTMEKLILDLEESGRYLSVLINNAGIRDNKSLVNTSFVDVKKVFT
                     VNTLSQVMILQKVLDKHLKNNKHGKLSIVTISSILGVFAPRNLSTYSASKAAQIMLHD
                     SLQQELKQYPLIRLLLVTPGQMDTELFKDVKPTKQLVAPVVKHVELAKTIIDKVDIGY
                     MGCLAEPFYANFLPGVRTAPMFVQDFCRWISEMDEKVKETQH"
     gene            complement(<341672..>343234)
                     /gene="DPH2"
                     /locus_tag="PVL30_004003"
                     /old_locus_tag="LELG_04279"
                     /db_xref="GeneID:5231745"
     mRNA            complement(<341672..>343234)
                     /gene="DPH2"
                     /locus_tag="PVL30_004003"
                     /old_locus_tag="LELG_04279"
                     /product="Diphthamide biosynthesis protein 2"
                     /transcript_id="XM_001524258.1"
                     /db_xref="GeneID:5231745"
     CDS             complement(341672..343234)
                     /gene="DPH2"
                     /locus_tag="PVL30_004003"
                     /old_locus_tag="LELG_04279"
                     /note="BUSCO:EOG09262SI7"
                     /codon_start=1
                     /transl_table=12
                     /product="Diphthamide biosynthesis protein 2"
                     /protein_id="XP_001524308.2"
                     /db_xref="GeneID:5231745"
                     /db_xref="PFAM:PF01866"
                     /translation="MQAPVLSTNSDYSYAKVQSSTKSRREDVVQYYALDKLAEKLAET
                     ETDTETDKDTSTSKGKPKFRHITLQFPDDLIADSASIVYYLQKKLNLNNSDSDQQKIW
                     VLADTSYSACCVDEVAAEHVGSDLVVHFGDACLNDVAKLSAIYVLGKPSIDEEQVLSQ
                     FRSRYSKEDRVILMADAPHTYILSNLKQKLSNEYEQIEIADLKNANIVDYQPSSAEHM
                     NFNRTLSVQEVSDYHLFHITVPEAPRLLQLTTNFASVTTYDPGNNQMSQGPFPNLMRR
                     YKLVHVARSSGTIGILVNTLSLTNTKLLINTIKDRIKAAGKKHYIFVVGKPNVAKLAN
                     FESIDVWCILGCDHSGIVIDQNNEFYKPIITPYELLLGLSDELSWTGKWVTDYQSVIE
                     NYQEEITRGASNDDEEDNDGDASSDEEPEFDPVTGTFVSTSRPLRQLNHLTIQNDDSN
                     ELVKRSANAIAIRNTVSTSAMFLQQRQWTGLGSDLASNNDKSDEGSVLEEGRRGIARG
                     YEFDTTQKKGAN"
     gene            complement(<343776..>345227)
                     /locus_tag="PVL30_004004"
                     /old_locus_tag="LELG_04280"
                     /db_xref="GeneID:5231725"
     mRNA            complement(<343776..>345227)
                     /locus_tag="PVL30_004004"
                     /old_locus_tag="LELG_04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524259.2"
                     /db_xref="GeneID:5231725"
     CDS             complement(343776..345227)
                     /locus_tag="PVL30_004004"
                     /old_locus_tag="LELG_04280"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524309.2"
                     /db_xref="GeneID:5231725"
                     /translation="MSSDQFKAVGIATFKGIGKGAKKLGQAGHETYKKNKAERNGTTY
                     VPPQKDDKQSSSSHRPASLEPEPEQPYRFRPLPSKETLQSYQPPPKRNVGAYSIPERG
                     GQSKYATAVTATTTNTTQVQQSGDVGVQQVYSTTSQQQQHQQFQSPQQVHQHQQQQQP
                     QLVYEQQPPRYETQPSYSASEQSSYQSQPHQSQYEQPQPQPSQLTQPQQPPQPHPQLP
                     SRPQSQQQVQYAVPTSQLGQQGLASQQQQQPLPPPSYHQQNYNYNNQQPAHIQTQAPS
                     SVPPQAQSVNYSAAQQINTFQPTSSLDLSRVSTNHTVSSSNSYAAPPNYPPTQSKPEE
                     AEASPPPPPTPARRPLPSPNSFAPPPARNPAPLQQVRTNSTVSSSQTTQSNELAPPPL
                     PTRKSLSLTPTTTASTYQEKVEDASSPPPMPQRKISSIAQEIENLSINKKKPPPPSKP
                     LKPASLKPQKPAKPAALSKPTADTPPPIKRRNY"
     gene            complement(<345837..>346991)
                     /locus_tag="PVL30_004005"
                     /old_locus_tag="LELG_04281"
                     /db_xref="GeneID:5231743"
     mRNA            complement(<345837..>346991)
                     /locus_tag="PVL30_004005"
                     /old_locus_tag="LELG_04281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524260.2"
                     /db_xref="GeneID:5231743"
     CDS             complement(345837..346991)
                     /locus_tag="PVL30_004005"
                     /old_locus_tag="LELG_04281"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524310.2"
                     /db_xref="GeneID:5231743"
                     /db_xref="PFAM:PF01733"
                     /translation="MMSVSTITSMAYNFYLSQKQTGVNYKQRVMTGLNLTIGVSIFMA
                     ITCITRVFIDMNDVWFFTILMLMVFLSATATCLAQNGTMAIVNVMGDIYANAVMVGQA
                     IAGVLPSCALIISVLIAGEKTKDAQLEKDYGVFLYYITASLISGASLGLLFLIGRYEE
                     KTLYKELRQSAGEHLSVTNTAGNENGHGFDLEVDELVSVQKVFVPFGQLWSKLKLIVM
                     TIFLTFAITLSFPIFASAVESTNTTSSVILFKKQIYVPFIFLVWNLGDLLGRIACGYP
                     KLRMVVSEPRTLITYSIARVVFIPLFMTCNIHPGKASPMINSDAWYILLQLLFGFSNG
                     QLCTSSFMVVGKHCDTDDEKEAAGGFTTVFLSSGLAVGSVLSYLLVLAIN"
     gene            complement(<347572..>349833)
                     /gene="TOK1"
                     /locus_tag="PVL30_004006"
                     /old_locus_tag="LELG_04282"
                     /db_xref="GeneID:5231617"
     mRNA            complement(<347572..>349833)
                     /gene="TOK1"
                     /locus_tag="PVL30_004006"
                     /old_locus_tag="LELG_04282"
                     /product="Potassium channel"
                     /transcript_id="XM_001524261.2"
                     /db_xref="GeneID:5231617"
     CDS             complement(347572..349833)
                     /gene="TOK1"
                     /locus_tag="PVL30_004006"
                     /old_locus_tag="LELG_04282"
                     /codon_start=1
                     /transl_table=12
                     /product="Potassium channel"
                     /protein_id="XP_001524311.2"
                     /db_xref="GeneID:5231617"
                     /db_xref="PFAM:PF07885"
                     /translation="MANESANDGQSTISLHRNVKRALRQARTVLQPDFTNELLINNEK
                     SYEDILGPLLLDKPIDQKRKRSAPIAIKSALNVPIGAILNLNVMPGEPYFVMWFLISS
                     YFPLIAACLGPLANMISIIALIQHWRQDPTTEVLIPDPHSVLVMNALSLALGIIGNIS
                     LLMNFSRSVKYLITQCVSICAWFCASALLVAGVLVTHYKYMGDYKHSEGFFFACFTAG
                     YYFACMLILLINFLGYRLDKYPATFNLDQKQRTLMVYTILFAIWSVVGAVTMHHLISG
                     LGYGSSLYYCIVSFLTIGLGDITPKTAAAKIVVLVFSLGGVLIMGLIVATLRSVILSS
                     AAPAIFWNDIEIARLNYIKKLKIQDRPISPENAYRKMRRIRHKIKVKHMNFSLALTVI
                     IFLAFWLIGAMIFHFIEEWTYFNGVYFCFLCLLTIGYGDFAPKQSLGRVFFVSWATGA
                     VPLMTILVSNVGDKLYEVFNNTSAWFSKWIFQPDREYLAKKKIKQQMKEYQEDETSTT
                     SSFLSEQIKEDFDSSAFDEDTDNEEEFDDDDDDEEDEDEDDDEEEEEEEEEEEEEEEE
                     DGVEEAEKEEDEQEDDDLRQIDSDLEESSSEILDNSSSASTRMNVIRDKLFKRKDAHE
                     RLLHYLERLKPLISDGITNPNKKYTLSQWQRAYKALELQKLPDGVDADPYTGFWLGNY
                     SPLRLPLKEPNYLILRVYYKIEETLQMIVNEEKNDLEMLESKGNASLANSLKRRVKFS
                     TRGEDVENRVCDK"
     gene            <351372..>352637
                     /locus_tag="PVL30_004007"
                     /old_locus_tag="LELG_04283"
                     /db_xref="GeneID:5231458"
     mRNA            <351372..>352637
                     /locus_tag="PVL30_004007"
                     /old_locus_tag="LELG_04283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524262.2"
                     /db_xref="GeneID:5231458"
     CDS             351372..352637
                     /locus_tag="PVL30_004007"
                     /old_locus_tag="LELG_04283"
                     /note="MEROPS:MER0006204"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524312.2"
                     /db_xref="GeneID:5231458"
                     /db_xref="PFAM:PF00144"
                     /translation="MKFTETSVKKLSTTLNNLLDEITTTNTEKEPPIVAPACTMGVTD
                     AKGTVYINTKGVTNLKDPSPATNDHLYAFYSCTKSLTVAGALILYERGQLDLDAPVTN
                     YFPEIAKIGVLEPGIVDKKRGVYLRDLKKPKTAITAKHLMTHTAGFSYGFIHPDYFTL
                     ITKGEKLDAIDPIMDFFFKKTPLVHEPGTAWMYGHSIDWLGFIIEKISGMKLSAFLQK
                     EVFDPIGMTSCTFHKKNFDNLVRVHYRLQDESLKLQEKFSLSLDPHLDLGGQGCFGTV
                     GDYLKFLRVWLNYGQSPDTGKRILKESTVKFAIKNHLPEHINLEFIGLSHNFVDDDEP
                     SKKMDGWTLTGNAYGSNDLPSGRPKGSIYWGGLANLSYWIDFENQVGGFYAVQVMPYM
                     DEYNVAYIEQFETEVYKAVKESKTTTAKF"
     gene            <353322..>355421
                     /locus_tag="PVL30_004008"
                     /old_locus_tag="LELG_04284"
                     /db_xref="GeneID:5231470"
     mRNA            <353322..>355421
                     /locus_tag="PVL30_004008"
                     /old_locus_tag="LELG_04284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524263.2"
                     /db_xref="GeneID:5231470"
     CDS             353322..355421
                     /locus_tag="PVL30_004008"
                     /old_locus_tag="LELG_04284"
                     /note="MEROPS:MER0002104"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524313.2"
                     /db_xref="GeneID:5231470"
                     /db_xref="PFAM:PF04389"
                     /translation="MSNHHHYERLDSGSRSGSQSGSGSSTLRTTTNLDLPAHPPQYKD
                     IGNGNGFDNDNNIDSALYHASASLDSDPTGLPGSSPSSSSSSRMLQFEIDEPQPEQTF
                     INRAQSFSKKFANNFQTRILHPVSKMIDPIYEGYKFLQLHYEKSILKLGNPLVVKRLL
                     YVLIMMLVIFGISRYTANEYFSGPASSGGAFSSGQYDLTEKIMAEVAEMIDAKSMKEH
                     LEYFSSVPHISGSKGDLLLAKYTELFMKTNGLQNVGLNEFSTFLNYPSSENTYIRSLD
                     GSFTAKLYEKDNQGMESLAYNQNVLNNVEVIKTQYVYANYGSHQDFENLQKHGVDING
                     KIVLVKYGGSTPEPKKIFFAQQHSAKAVIFITPQVEPTGDAIQKESIAFTRLVTGDSQ
                     GFGWPTNEDGYVTKLSWEMSEIVPKIVSIPISWRDGEKLIKKLADGYKFDDGFSGTGK
                     NGEDSFTLEMKVDNIDRPHHPIWNVMGSINGRGIGEQGVIIGAQRDAACYGTIGSSTG
                     MAAFLELIKILTTLQRKYQWAPSRPIYFISFDATDYNLAGSTKWIESRKDALRQDGFL
                     YIDMSDLVSGDELQVNMHSSMKKIVHDALKKVSTGGESLLKVIENQKKPNLENNFSET
                     KNYMPFINLVKIPALEVKYKGKTYPKNSCYDDFENFEKSNIDKSMSKHSQLVELLSYI
                     ILDFVETPIAPYDYVPS"
     gene            complement(<355641..>356402)
                     /locus_tag="PVL30_004009"
                     /old_locus_tag="LELG_04285"
                     /db_xref="GeneID:5231499"
     mRNA            complement(<355641..>356402)
                     /locus_tag="PVL30_004009"
                     /old_locus_tag="LELG_04285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524264.2"
                     /db_xref="GeneID:5231499"
     CDS             complement(355641..356402)
                     /locus_tag="PVL30_004009"
                     /old_locus_tag="LELG_04285"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524314.2"
                     /db_xref="GeneID:5231499"
                     /db_xref="PFAM:PF04752"
                     /translation="MTNFDQGLWVIGYGSLIFKPPPHYSLKVSGHLQGFIRRFWQSSI
                     DHRGTPESPGRVVTLISLDELRQERFFHNDLHTYELMDNKGLGQKLEVDHFDISSLQP
                     QDLKVCGCAYYIPPAHAEEVRNYLDIREQNGYELKTLRFYIRDEELPKLKPKVLDVNE
                     VAGTDLITQSVEMSDFCLQHDEFGPYIQSQIYIGGLDLESFIGPESIHETAKIIKTNV
                     GPSGKNVDYLTSLNTAVKQLGWKDSYLEDLVRLIE"
     gene            complement(<356857..>357885)
                     /locus_tag="PVL30_004010"
                     /old_locus_tag="LELG_04286"
                     /db_xref="GeneID:5231659"
     mRNA            complement(<356857..>357885)
                     /locus_tag="PVL30_004010"
                     /old_locus_tag="LELG_04286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524265.2"
                     /db_xref="GeneID:5231659"
     CDS             complement(356857..357885)
                     /locus_tag="PVL30_004010"
                     /old_locus_tag="LELG_04286"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524315.2"
                     /db_xref="GeneID:5231659"
                     /translation="MNTSMNTSTTLTTPNSNRQFEQSYKLALKHFINRNFSQAFQQSR
                     TLFIQAFDEYRTGSISMNLLVKVIDLYLVVVGVSLREKRLNQIMTTEAKNSITSNEVW
                     NLISSVWGSKHGEDVPWEILYNWHLLMISNLELIQDRSEYLRDLKRVYTRLSIDEIDG
                     EGQSEKYVNKLMILIKFEILPRLDQYEESYRLIGDNVEEREKLDKIKQNRIDAEQKAQ
                     ETKKQEEKKLKEEKEKQDAEARKLARESNLKYRSIKEIRRGYEDNGDEKRLSIKENQD
                     IDGRVDTIKSRLIYLSKLMKSYLSQNYMVLIVLVIAALGSGKYLRQANIREKVIETVK
                     MAFKFTYV"
     gene            complement(<358368..>361445)
                     /gene="CNH1"
                     /locus_tag="PVL30_004011"
                     /old_locus_tag="LELG_04287"
                     /db_xref="GeneID:5231556"
     mRNA            complement(<358368..>361445)
                     /gene="CNH1"
                     /locus_tag="PVL30_004011"
                     /old_locus_tag="LELG_04287"
                     /product="Na+/H+ antiporter"
                     /transcript_id="XM_001524266.2"
                     /db_xref="GeneID:5231556"
     CDS             complement(358368..361445)
                     /gene="CNH1"
                     /locus_tag="PVL30_004011"
                     /old_locus_tag="LELG_04287"
                     /codon_start=1
                     /transl_table=12
                     /product="Na+/H+ antiporter"
                     /protein_id="XP_001524316.2"
                     /db_xref="GeneID:5231556"
                     /db_xref="PFAM:PF00999"
                     /db_xref="PFAM:PF08619"
                     /translation="MAWDQLELEAPHIAYACVGIFCTLFSLVSLFVKERLYIGEATVA
                     TIAGLIIGPHCLDWFNPIEWGNSDFITLEICRIVLCIQIIAVAVELPKKYMQKHWISV
                     FIFLVPVMTTGWLVVGLFIWCLIPHFTFNDGLLVSACVTATDPVLAAAVVGKGKFAER
                     VPGHLRNLLSAESGCNDGMAFPFIYLSLYLITYSGRGGEIVKNWFLLTILWECIFGCF
                     LGVVMGFVLRKLVAFAETKNLIDRESFLAIFVFLAFNCAGIGSMLGVDDLLVSFAAGT
                     AFGWNGDFAKKTEESHVSTVIDLLLNLSFFVYFGAIIPWEQFNDVKLGLNVWRLIILA
                     FVIIFLRRVPAVVLLKPITPDVKTWREAFFCGHFGPIGVGAIFASILARSDLEKHYTT
                     EETPLHKLPNEEFPHYQLLAAIWPMVCFIVVTSIIVHGSSVAVLTLGKRLNRMAITMS
                     YTRTTGNDSDNTANWIQRLQKLDRTSSSFSLQRVDTMAPEELQNLKNKAEQMNVPETS
                     GVKVRPAGGAKRRTKKKKKHNHGLLSRTLSRVRTGDDQREERHRPVTESLQLGGLGTG
                     AGVGAGAKSNFSSEPDTSTNEVKASSSSSTESDQQEKRAGTTNEDSEENGDGGDEFIT
                     SPGISEKQSGKSKYGLHPSRTKDRERIPTAAYQEGDNLIVEDQHGEILDNLKLNTLPV
                     GQRKPVGKAESKNDDDSIHSMESLQRRLSQYSIASDKSRESMKQDEMRAGATSGATSG
                     PEKRKPSIAQSAASHILPKIKRTESRRTYYKKDDPKRRKVYAHRIDNLILIENEDGDI
                     IRRYKVNRHASNIPKPNRSRSSTLVGKMKSFVGMKDKEQQQQALASSSAGANGELQQQ
                     HQQQQQQQPTVHVTDLEKSTHHTILVPQDDEKNQHSPHLADGLDKVEDKIAGILESRH
                     QHGGHELVRRASPPPPIHGDINEEGEDEDGDVVDDDDENGEDSEEYDTDSDEEEEEEE
                     EGGDGHGELMDDEAESDEEETSVERARRLQALGRIPNRNRDEDDEEEDVVSIR"
     gene            <363846..>365441
                     /gene="RAD17_2"
                     /locus_tag="PVL30_004012"
                     /old_locus_tag="LELG_04288"
                     /db_xref="GeneID:5231654"
     mRNA            <363846..>365441
                     /gene="RAD17_2"
                     /locus_tag="PVL30_004012"
                     /old_locus_tag="LELG_04288"
                     /product="Cell cycle checkpoint protein Rad17"
                     /transcript_id="XM_001524267.2"
                     /db_xref="GeneID:5231654"
     CDS             363846..365441
                     /gene="RAD17_2"
                     /locus_tag="PVL30_004012"
                     /old_locus_tag="LELG_04288"
                     /note="BUSCO:EOG092648O6"
                     /codon_start=1
                     /transl_table=12
                     /product="Cell cycle checkpoint protein Rad17"
                     /protein_id="XP_001524317.2"
                     /db_xref="GeneID:5231654"
                     /db_xref="PFAM:PF02144"
                     /translation="MSAHSLFVRSEDEDDDNQHEAEHTSVYVPEDPALEEFDVNKRPL
                     THASPSRSTHRQSTATSTSKANVKVNTATTTTAAVATSTFRNNIGTHPTYPNRPKNVT
                     FTASTTQIAHLSDVFQSLLHINNQAIITIKPTGITLYSTYNYSTNVHVTIDPTLFSIF
                     NLSVHNDDDENENENENDDTRVQTTQEEQEQDENLELRLGVDINLIADCFTSVMNTLK
                     FESAVTCYLTYMGDGHPLIIEFEDTFISEKLEFYTFYVDSDDDYTGYSNTNASKSNTS
                     DYNLRIDYEKVIMEIMVKSDVLTNLLQDLYQIGTEVLFIYCAENVLNFISQGPIGVSK
                     LIFPNERTILEKLYLAKETDDHHQYDISQFQFHDFSKILKAVKLSTKSKIVKDANGCF
                     SIQLLCKNFQQTGYSGTLIVINMTEMVHDEIMVESIIKDEQHIDQEKQNEGFASSNND
                     AATRVTEPILLKSIPDLTHRGNEPLINSFKRSRPKLTNSAVDDNNARKNKSDGPSLKR
                     NRNGEDGMRNNNNQREEGIPLFL"
     gene            complement(<365699..>366748)
                     /gene="VMA6"
                     /locus_tag="PVL30_004013"
                     /old_locus_tag="LELG_04289"
                     /db_xref="GeneID:5231500"
     mRNA            complement(<365699..>366748)
                     /gene="VMA6"
                     /locus_tag="PVL30_004013"
                     /old_locus_tag="LELG_04289"
                     /product="H(+)-transporting V0 sector ATPase subunit d"
                     /transcript_id="XM_001524268.2"
                     /db_xref="GeneID:5231500"
     CDS             complement(365699..366748)
                     /gene="VMA6"
                     /locus_tag="PVL30_004013"
                     /old_locus_tag="LELG_04289"
                     /note="BUSCO:EOG092638RC"
                     /codon_start=1
                     /transl_table=12
                     /product="H(+)-transporting V0 sector ATPase subunit d"
                     /protein_id="XP_001524318.1"
                     /db_xref="GeneID:5231500"
                     /db_xref="PFAM:PF01992"
                     /translation="MEGLYFNIDYGYIEGVVRGYRSGLLSTNQYVNLTQCDNLEDLKL
                     QLSSTDYGNFLANYSGPLSTSVIQENLNKKVFQQYQYVKSQSSGILTEFLNFIQYGYM
                     IDNVILMITGTLHERDKSDILKKSNPLGWFDTLPTLSIATDIESLYSTVLIDTPLAPF
                     FKNCVSADDLDDLNIEIIRNKLYKNYLEAFMGFVQKNMDGPDREIMTRLLILEADKRV
                     INIALNSASNQDLSADDKLSLFPQLGLLYPTYHLELAQADDYEQIKLTVENIGEYQQI
                     FSDSGNDGNKSIGDWFYLLEMQYCRDAFTQQFTLSTVYAWLKSKEQEIRNIYWIAECI
                     AQNQKSRIDDYISVY"
     gene            <367160..>368632
                     /locus_tag="PVL30_004014"
                     /old_locus_tag="LELG_04290"
                     /db_xref="GeneID:5231538"
     mRNA            <367160..>368632
                     /locus_tag="PVL30_004014"
                     /old_locus_tag="LELG_04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524269.2"
                     /db_xref="GeneID:5231538"
     CDS             367160..368632
                     /locus_tag="PVL30_004014"
                     /old_locus_tag="LELG_04290"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524319.2"
                     /db_xref="GeneID:5231538"
                     /db_xref="PFAM:PF04124"
                     /translation="MSSSILLNTLKSGLDPSLQKQLDSNPSLSKEAEKYLHEILLNDD
                     LLSTDAFTTTTTTATAAATVTSPAHGALSNAAVTTPTREFSQPQSQVKTIVEEIAELD
                     LHKHKINQELSTLTNDNRDLIIEVNQDLNDVNHKLSIDYPHYIESLLKILENDTNAQN
                     SLPSDHHQPRQPRQQQQQQQQQQQQQRQIGNDHHHHHHHHHQHHSSISSIHNKLQNHD
                     KSLLQSIELDSQILGNMDFILDILELPTLCKLCILQGNYQESLEISMYAKSLIIRFPN
                     LQIFKTIAEQIDNELHLMLKGLIKLLNTDLRQNHILKIFQILNKLDTISGKVLHRIYL
                     NSRFKFITNEISSIKPILKFNKLTYLKRYVEIYREHLYASLSMYNTIFKEEVNLILLN
                     EFVTSLGYALCDEFIKYLPTIKSQVIGISDGNEASIEAQLELNNAIDGLLLQLIYLSK
                     SLSNFQFDFEPILLSQLCYKHELFTEKSWVDNSNKVKKHR"
     gene            complement(<368890..>372138)
                     /locus_tag="PVL30_004015"
                     /old_locus_tag="LELG_04291"
                     /db_xref="GeneID:5231604"
     mRNA            complement(<368890..>372138)
                     /locus_tag="PVL30_004015"
                     /old_locus_tag="LELG_04291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524270.2"
                     /db_xref="GeneID:5231604"
     CDS             complement(368890..372138)
                     /locus_tag="PVL30_004015"
                     /old_locus_tag="LELG_04291"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524320.2"
                     /db_xref="GeneID:5231604"
                     /db_xref="PFAM:PF00176"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /db_xref="PFAM:PF13445"
                     /translation="MSLFFEENQFKRRKLAPPSLSVSSQYPEVINLSSDENDEDNEQE
                     HEDVEMEVMSDSNNDNIVSYGITPTSIKVQNGHNSNREPIVIPVGDEANNNGKGGNEG
                     NDKDDVDDDDDDIIIMDKRDVSGIRFKSPSFNSQSFRPESHFDPDVSNSQAGKFNGDL
                     TELPAGSSLVSKFGDEFGHYASNSSPTSQNLPSLDNFTMPGAFNAPAPVPHADQDLTS
                     IQRDELKKRSESKLTMVKDLIESKGKISSQMQLHQAQYDTQARNNQKLQQQLAQANAM
                     GRHDLVSQIRGLISKVQRQMEGPRNYINNLQKSLFVVEAKLHKYQTELSFINNKIRQL
                     GHTLNAAFNPYEAQIADDYHHSFSQQASSSNMQGTPADLDLQSLLDNIKPEDTLEEGL
                     APTPREMTVKLLKHQRIGLTWLQRMESSKTKGGVLADDMGLGKTIQTLALIVSRKSDN
                     PSCKTTLIIAPVSLLRQWAAEIQSKLHPQSNLNVGIFHGDEKKEMSTFSAMKKYDVVL
                     TSYGTLASEWKKHFAEELQNNQDKGKKFYPRAEGGGISYISPFYASYSKFYRIVLDEA
                     QNIKNKFALASKAVIYLKGEYRLCLSGTPMQNSIEELYPVVRFLKIRPYYIEEKFRAD
                     LIIPLKSKNENYDDVDRSRSMRKLRALLSSIMLRRNKNSLIDGQPILQLPEKHLISDF
                     VELEGEEKDYYSSLESGIQKVARKVLDNGDKSSVLTMLLRLRQACCHSYLVEIGQIKK
                     EREGREAEDGLMGAGGIKSDWRQQLKLIAGISDSVRRSVVERMSLDNIQFTCPVCYDA
                     VDSTGRLAIFTECGHIICQACVNEFFENNMTEDEQRGSTRIAECLDCKTHVKNTNVAD
                     YAIFNKLYIQQMDVAEVERHCRVYYAKKQISNISIIKELTKRDQGFEASAKIEKAIEL
                     INNIQQANPSEKIIIFSQFTTLFDLMKLVLDHLKILHLRYDGSMTVEAKNNVIKQFYQ
                     SNCNVLLLSLRAGNVGLTLTCANHVIIMDPFWNPFVEEQAMDRAHRIGQEKEVHVHRV
                     LITNTVESRIMELQERKKELIGDALNENEMKSISKLGRRELGFLFGLNTLEE"
     gene            complement(<372904..>373500)
                     /locus_tag="PVL30_004016"
                     /old_locus_tag="LELG_04292"
                     /db_xref="GeneID:5231632"
     mRNA            complement(<372904..>373500)
                     /locus_tag="PVL30_004016"
                     /old_locus_tag="LELG_04292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524271.1"
                     /db_xref="GeneID:5231632"
     CDS             complement(372904..373500)
                     /locus_tag="PVL30_004016"
                     /old_locus_tag="LELG_04292"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524321.1"
                     /db_xref="GeneID:5231632"
                     /translation="MQSILYDAKTKKLSLDAEAREPALKLELDQLNTLTQEIINQGSD
                     VPPVPTAENFNKDLSKMIKKLYESGVQSFKMGKFEDSARQFSVGIEMINRRPKLESFQ
                     GTIQELSLFLMSRTDAYLKTKEYLKAYNDVDLLLNMQMNSPDNFLRRGVANYFLGNYE
                     LARADYQRGLSFDENHQRLQHELTICLDKILEENGDYL"
     gene            <374268..>375248
                     /locus_tag="PVL30_004017"
                     /old_locus_tag="LELG_04293"
                     /db_xref="GeneID:5231614"
     mRNA            <374268..>375248
                     /locus_tag="PVL30_004017"
                     /old_locus_tag="LELG_04293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524272.2"
                     /db_xref="GeneID:5231614"
     CDS             374268..375248
                     /locus_tag="PVL30_004017"
                     /old_locus_tag="LELG_04293"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524322.2"
                     /db_xref="GeneID:5231614"
                     /translation="MRITTYHSKRAFSSFTSIKQEPSEHPIKFQLDKECKSNQEQVGK
                     TLEEYSQKSPLVLITNEKDKEEQVNCFTAFIDESNESINKEIKGRNQHSIFGKVWLKF
                     KPRKKSSSRTISTSFISTEEVDLPHKSKTVAGFPFHQHSAQVPTSARSQTPIIASTTS
                     WRRRIFHKYNAISVFKPFATTSNNCAFEKEQDVLSQSSMYIESPRMDFVSPPTPKPMR
                     SIDSVHVINRKTRNDQIKCEGEQLRESDETRRMRETSFLPIDPFGDLEICSSLRALYE
                     NSFFKSHARQPIDYDNSQITDETLNVAALANAFSSSPHPLPAAAAAAMTS"
     gene            <375734..>376927
                     /gene="HIS5"
                     /locus_tag="PVL30_004018"
                     /old_locus_tag="LELG_04294"
                     /db_xref="GeneID:5231662"
     mRNA            <375734..>376927
                     /gene="HIS5"
                     /locus_tag="PVL30_004018"
                     /old_locus_tag="LELG_04294"
                     /product="histidinol-phosphate transaminase"
                     /transcript_id="XM_001524273.2"
                     /db_xref="GeneID:5231662"
     CDS             375734..376927
                     /gene="HIS5"
                     /locus_tag="PVL30_004018"
                     /old_locus_tag="LELG_04294"
                     /note="BUSCO:EOG09262K9A"
                     /codon_start=1
                     /transl_table=12
                     /product="histidinol-phosphate transaminase"
                     /protein_id="XP_001524323.2"
                     /db_xref="GeneID:5231662"
                     /db_xref="PFAM:PF00155"
                     /translation="MVDFKSIIRPNIYSLEPYRCARDDFKEGILLDANENTHGPALSQ
                     PSDSEKQLQLNRYPDPHQEELKQQIIDFRNSQPNEHSKQNLKVSNLCLGVGSDESIDM
                     LLRCCCVPGKDKLLICPPTYGMYSICATVNDVEIVKVPLTTPDFQIDINAIVEKVTAD
                     PTINLLYLTSPGNPTAQLINPDDIIKLLQETDEKNWNGLIVVDEAYIDFTAPKDNGHS
                     QSMSTLVNQYANLVVLQTLSKSFGLAGIRLGITYCDEQLARILNAMKYPYNISSLTSD
                     VAIRATSPKKGLQVMQNYVKSIIEQREFVLEKILQFEYVGRNIGGLDANFILVEILDK
                     DKKPSNEVANKLYNTLAVDNAVVVRFRGKELNCTGALRVSIGTEEENKVMLQKFERVL
                     NEINK"
     gene            <377473..>378234
                     /locus_tag="PVL30_004019"
                     /old_locus_tag="LELG_04295"
                     /db_xref="GeneID:5231622"
     mRNA            <377473..>378234
                     /locus_tag="PVL30_004019"
                     /old_locus_tag="LELG_04295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524274.1"
                     /db_xref="GeneID:5231622"
     CDS             377473..378234
                     /locus_tag="PVL30_004019"
                     /old_locus_tag="LELG_04295"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524324.2"
                     /db_xref="GeneID:5231622"
                     /db_xref="PFAM:PF00366"
                     /translation="MAKQNFVGLVVSQGKMNKTVKVRVLGKVYDRRVDKEIVRRKDYL
                     VHDQGNICKEGDVVRIESIPKLSKRKAFAIAEIKENRGQQFAEYEDIAKRRIQEEDEA
                     EARKFLESRKQFSNLITQLEDLKRLDELNFSLQNELDLENDDKKHESLINEVKSIREK
                     YGIKSWPTTEPVVDLELNKPIWETETQRRTYFIKHILDELMNKEMYKEFKEKVLQSYF
                     KDKPIEEVSKAIQKNVLRKYVLDEKNEIPVQFPAN"
     gene            complement(<378908..>380257)
                     /locus_tag="PVL30_004020"
                     /old_locus_tag="LELG_04296"
                     /db_xref="GeneID:5231669"
     mRNA            complement(<378908..>380257)
                     /locus_tag="PVL30_004020"
                     /old_locus_tag="LELG_04296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524275.2"
                     /db_xref="GeneID:5231669"
     CDS             complement(378908..380257)
                     /locus_tag="PVL30_004020"
                     /old_locus_tag="LELG_04296"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524325.2"
                     /db_xref="GeneID:5231669"
                     /db_xref="PFAM:PF12937"
                     /translation="MKRYQLIGRRGTPFVKRRAPEYPTAHLYSLPTEILLRIFQYFSN
                     DPQTLIILSSVCVKFSNIINKCFLYKSIEFKTPISFFRFANSHLSSEPSNKINFVQNV
                     TFVNPQSQKSSKHKITIAGSYAVESESGLTSDLTYTDFIKALGTLCTRTYGLQTLQFS
                     EISPEFAFPTEFKASSSNIFKRKIVKTKRRLPKLILKSQTGWSIPLRDTHLSLVCEYF
                     DVIDELELVNFILDAPIYSSILIKRITFTSCSYASKKGNKSPCRAFKDVQTLQLSRIT
                     NSSELSLIDLVKIDNHKLNTLVLDLSSTLFYERGEFNFTKFNPFFKLLCSGEGGYARL
                     KTLVLVNFDLFSYLQHDDVHIRDVDSWVEPPTNNFETFMAYISHVPELILQLKKTAIK
                     VKTCKRCGFTEQYQDRQIEHLTRDEWKHFLKPLDLQENKFRIQSHNNEILYSVSKYV"
     gene            complement(<381087..>381953)
                     /gene="LUC7"
                     /locus_tag="PVL30_004021"
                     /old_locus_tag="LELG_04297"
                     /db_xref="GeneID:5231703"
     mRNA            complement(<381087..>381953)
                     /gene="LUC7"
                     /locus_tag="PVL30_004021"
                     /old_locus_tag="LELG_04297"
                     /product="splicing factor"
                     /transcript_id="XM_001524276.1"
                     /db_xref="GeneID:5231703"
     CDS             complement(381087..381953)
                     /gene="LUC7"
                     /locus_tag="PVL30_004021"
                     /old_locus_tag="LELG_04297"
                     /note="BUSCO:EOG09264D7Y"
                     /codon_start=1
                     /transl_table=12
                     /product="splicing factor"
                     /protein_id="XP_001524326.2"
                     /db_xref="GeneID:5231703"
                     /db_xref="PFAM:PF03194"
                     /translation="MAEEQRRHIEKLMGRQGSSSSYARHSRDPGMTAPEVCKAFIVGT
                     CPHDLFVGTKSDLGPCPNLHMPKYKLEYEYKTKKLGRTYPEIEHEYYQVLQSYVRDLD
                     RTISVAQKRLEHTPEEREKISKVTADLDNLDAEIGLMIQELNYLIKLSTRGKYMENAE
                     NEDDSNKGEENGENGGDKAVSGSEIADASRLVKDLGHNDQTLKIIDLSIKLDAKCQER
                     DEASKRARNIIDNVGQTSQQKLQVCDGCGAYLSRLDNDRRLADHFVGKIHLGFVQLRM
                     AYEELRPKYRRA"
     gene            complement(<382461..>383947)
                     /gene="STE24"
                     /locus_tag="PVL30_004022"
                     /old_locus_tag="LELG_04298"
                     /db_xref="GeneID:5231648"
     mRNA            complement(join(<382461..383825,383930..>383947))
                     /gene="STE24"
                     /locus_tag="PVL30_004022"
                     /old_locus_tag="LELG_04298"
                     /product="zinc metalloprotease"
                     /transcript_id="XM_001524277.2"
                     /db_xref="GeneID:5231648"
     CDS             complement(join(382461..383825,383930..383947))
                     /gene="STE24"
                     /locus_tag="PVL30_004022"
                     /old_locus_tag="LELG_04298"
                     /note="MEROPS:MER0002635"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc metalloprotease"
                     /protein_id="XP_001524327.2"
                     /db_xref="GeneID:5231648"
                     /db_xref="PFAM:PF01435"
                     /db_xref="PFAM:PF16491"
                     /translation="MKFVIDSLSFLDNPNINWKAIIVGFTVGQYVFESYLQYRQYQVL
                     KNKSPPASIKAEVDQTTFDKSQKYSRSKAKFSIFASTVGLLQNIAVFKYDLLPKIWNW
                     SGGLMQSAAFLLPKFMGGVITQSIIFVFTTQIMSTIFELPLSYYSHFVLEEKYGFNKQ
                     TLNIWITDKLKGIALSIVLGSPVIAGFLKIIEYFGDSFIFYLMGFFLVIMLIAMTIVP
                     TLIMPLFNKFTPLEDGELKTAIENLAKSQKFPLKKLLVVDGSKRSSHSNAYFTGLPWS
                     KQIVLFDTLIEHNSTEETVAVLAHEIGHWKLNHIPKMIAMQQIHFFIIFSLFGAFVRN
                     KSLYNSFGFYKEQPILISFMLFGDILQPLECILAFAQNLLSRKHEYDADKYAQDCGYS
                     EELSRSLIKLSNENLSGMNADWLYSSFHYSHPILPERLSALGYISKEKIVKKNVSEQT
                     EDVEKSEKQD"
     gene            complement(<384427..>386647)
                     /gene="ATP2"
                     /locus_tag="PVL30_004023"
                     /old_locus_tag="LELG_04299"
                     /db_xref="GeneID:5231664"
     mRNA            complement(join(<384427..385822,386538..>386647))
                     /gene="ATP2"
                     /locus_tag="PVL30_004023"
                     /old_locus_tag="LELG_04299"
                     /product="atp2, beta subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /transcript_id="XM_001524278.2"
                     /db_xref="GeneID:5231664"
     CDS             complement(join(384427..385822,386538..386647))
                     /gene="ATP2"
                     /locus_tag="PVL30_004023"
                     /old_locus_tag="LELG_04299"
                     /note="BUSCO:EOG09261T74"
                     /codon_start=1
                     /transl_table=12
                     /product="atp2, beta subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /protein_id="XP_001524328.2"
                     /db_xref="GeneID:5231664"
                     /db_xref="PFAM:PF00006"
                     /db_xref="PFAM:PF02874"
                     /translation="MVLPRLFNATSRTAVNAARSSRALATAAAKHAHGKVRAVIGAVV
                     DVQFPNEDLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTEGLVRGTEVTDT
                     GAPISVPVGRGTLGRIINVTGDPIDDRGPIECKKRNPIHAEPPSFIEQSTAAEVLETG
                     IKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGN
                     DLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLL
                     FIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVY
                     VPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYD
                     VATGVQQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIQRFLSQPFAVAEVFTGI
                     SGKLVRLSETVKSFKEVLEGKYDHLPENAFYMVGGIEDAVAKADKMAAEAK"
     gene            complement(<387397..>389922)
                     /locus_tag="PVL30_004024"
                     /old_locus_tag="LELG_04300"
                     /db_xref="GeneID:5231619"
     mRNA            complement(<387397..>389922)
                     /locus_tag="PVL30_004024"
                     /old_locus_tag="LELG_04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524279.2"
                     /db_xref="GeneID:5231619"
     CDS             complement(387397..389922)
                     /locus_tag="PVL30_004024"
                     /old_locus_tag="LELG_04300"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524329.2"
                     /db_xref="GeneID:5231619"
                     /db_xref="PFAM:PF00628"
                     /db_xref="PFAM:PF01388"
                     /db_xref="PFAM:PF02373"
                     /db_xref="PFAM:PF02375"
                     /translation="MSKFDKNVLTPCPVLRPTDAEFMDPIGYLSSPAALELGRKYGLV
                     KVVPPESWKPSFQISPHFKFHVRQQVISDLGITTRSRKFFKENINRFLNMRRKRLLKL
                     FFKVDGHTVYYYDLYALVEKMGGFQEMTKPRWQEVNTHFGIDLKSKAIELEYNATIKN
                     YANYLNCNKDVELPESDSEIEIENDEQDSDYCLICGDNDNPEETLLCDHCDGAFHMAC
                     LNPPLTQVPATNWYCDKCLIGTGEYGFEEDPEIKYSIPEFYRLCKEFDKSFFEDYNNG
                     LPMSVDEIENKFWSFVDIEKSDLEVKYGADIHNLKPGEISGFPMKTTPGLDLSDPKNH
                     FYINHPYNLTKLPFAKGSLLNYINTSISGMTVPWIYIGSLLSTFCWHVEDHYTLSANY
                     CHFGAVKKWYGIPSSHSTQFETLMRDSAPDLFQKQPDLLHQLTTLMNPMKLVENGIPC
                     VYADQNPNEFVITYPKVYHAGFNCGFNFNEAVNFAMDEWLEFGEQSITNYKPIGKENV
                     FNFYELVENIIKQFVNEENKIFNDGANHSLDMIKRSTKIFANFLNKQDELLKQIHKFN
                     LNIQYRPKVYRAREFESEQSGKIMDYSDEEEDLCFGCKTHLGFQYCILGEEEEMENKD
                     ECDGEEKDELKAKLYFNTNTNTNSNTNTNLNSTFQLPTPHASPQEENIMSRNKDAAKV
                     VANSNSSEELSHYSVSTPKCVMDEYDELIQRAKRKGSQEPENDGKGQSDSQDSAPKRR
                     KSSRLQTIEEQQFQKRKDHAANFSKNKLKRAKAKAKARAKKFGMRKMNERTFDNDSRK
                     ICLECITKRKTIPKSSIVIYQNQPEQMRELLTKAELKIMSLEK"
     gene            <391112..>391939
                     /gene="PRO3"
                     /locus_tag="PVL30_004025"
                     /old_locus_tag="LELG_04301"
                     /db_xref="GeneID:5231497"
     mRNA            <391112..>391939
                     /gene="PRO3"
                     /locus_tag="PVL30_004025"
                     /old_locus_tag="LELG_04301"
                     /product="delta 1-pyrroline-5-carboxylate reductase"
                     /transcript_id="XM_001524280.2"
                     /db_xref="GeneID:5231497"
     CDS             391112..391939
                     /gene="PRO3"
                     /locus_tag="PVL30_004025"
                     /old_locus_tag="LELG_04301"
                     /codon_start=1
                     /transl_table=12
                     /product="delta 1-pyrroline-5-carboxylate reductase"
                     /protein_id="XP_001524330.2"
                     /db_xref="GeneID:5231497"
                     /db_xref="PFAM:PF03807"
                     /db_xref="PFAM:PF14748"
                     /translation="MALEEFTLTVLGAGVMGTAVSSAILNSSVKPYPKKVILCTPQPT
                     DTLKETFDKFDNVEYSFTAEGNKKAVKEADIILLAVKPFMYQQVYDEVKDALTGDQLL
                     ISLLAGTTINELSIFTKNVAKVMTNTPARYGCGTAAIAFSPDVSQEQQELVKKLIEPV
                     GLTVCIPEKNMDIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVARVSAAKVMEGTA
                     KMLLETGDHPAALKSKVCTPGGTTIGGLLKMEDGALRSTIARGIEEAANISASFAKK"
     gene            complement(<392163..>392564)
                     /locus_tag="PVL30_004026"
                     /old_locus_tag="LELG_04302"
                     /db_xref="GeneID:5231637"
     mRNA            complement(<392163..>392564)
                     /locus_tag="PVL30_004026"
                     /old_locus_tag="LELG_04302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524281.2"
                     /db_xref="GeneID:5231637"
     CDS             complement(392163..392564)
                     /locus_tag="PVL30_004026"
                     /old_locus_tag="LELG_04302"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524331.1"
                     /db_xref="GeneID:5231637"
                     /translation="MFRFATPRIKPNFRLSSPIRSSRCLSNTPRVQFFGKSPSQEEQA
                     QAILKVQKVISEHPELKQLTLEFKELLDKKGLLANGKPSMTQMMKILTDKDIIAHGTK
                     LKKYLDDNKTGITKEEMATLTGAYMFQGKDI"
     gene            <392979..>394992
                     /gene="SUB2"
                     /locus_tag="PVL30_004027"
                     /old_locus_tag="LELG_04303"
                     /db_xref="GeneID:5231565"
     mRNA            join(<392979..393201,393914..>394992)
                     /gene="SUB2"
                     /locus_tag="PVL30_004027"
                     /old_locus_tag="LELG_04303"
                     /product="Suppressor of the cold-sensitive snRNP
                     biogenesis mutant brr1-1"
                     /transcript_id="XM_001524282.2"
                     /db_xref="GeneID:5231565"
     CDS             join(392979..393201,393914..394992)
                     /gene="SUB2"
                     /locus_tag="PVL30_004027"
                     /old_locus_tag="LELG_04303"
                     /note="BUSCO:EOG09262E4Q"
                     /codon_start=1
                     /transl_table=12
                     /product="Suppressor of the cold-sensitive snRNP
                     biogenesis mutant brr1-1"
                     /protein_id="XP_001524332.1"
                     /db_xref="GeneID:5231565"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MSAENQEELLDYSDSEEIAVPTTTQAGEGESANDKEADKKGSYV
                     GIHATGFRDFLLKPELLRAIGDCGFEHPSEVQQVCIPQSILGTDVLCQAKSGLGKTAV
                     FVLSTLQQLDPVAGEISTLVICHTRELAYQIRNEYARFSKYMPDVKTEVFYGGTPVKR
                     DIEKLKNKDTCPHIVVATPGRLHALVQEKAIRLNNVKSFVIDECDKVLESLDMRRDVQ
                     DIFRATPHQKQVMMFSATLSQDIRPVCKKFMQNPLEIYVDDEAKLTLHGLQQYYIKLE
                     EKEKNRKLSDLLDSLEFNQVIIFVKSTQRANELNKLLCACNFPSIAVHSGLPQEERIE
                     RYKSFKEFNKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGL
                     GISFVSTKEDEEVLEKIQSRFDVKITEFPEEGVDPSTYMNT"
     gene            complement(<395220..>396248)
                     /locus_tag="PVL30_004028"
                     /old_locus_tag="LELG_04304"
                     /db_xref="GeneID:5231638"
     mRNA            complement(<395220..>396248)
                     /locus_tag="PVL30_004028"
                     /old_locus_tag="LELG_04304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524283.2"
                     /db_xref="GeneID:5231638"
     CDS             complement(395220..396248)
                     /locus_tag="PVL30_004028"
                     /old_locus_tag="LELG_04304"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524333.2"
                     /db_xref="GeneID:5231638"
                     /db_xref="PFAM:PF13455"
                     /translation="MVVQVHQCNGITVKGQRCKITVRTEHGYCHYHIKQAKGTEEIKA
                     IRKTTTKYPTNNAFEKSPASSVTLLNDSNEKYNVIGGFIAPDPVSSSLSPTPLPKQKP
                     KTSTSTSASASTCTSTSASASTKPVTDAGYIYIYTMENFITPPKGWNFQVKNIPQTKK
                     RHKDKWTRFKSDRSPYILVKIGMTTQLPNIRIKQWKQKCKHELVNLGPRNQYLVKVRE
                     HWWERFKRLTIRDDKESGGNVNTVGDDTSPYTFQRFKNDGFHCKKNLKQVESKVHSTL
                     REKYGKGDVYCSGCVPDDELTVNKNLKRAPLQNNYKVHIEWFLIPKADLQSVYQTIDE
                     LCFTIGGK"
     gene            <398034..>399353
                     /gene="MET15"
                     /locus_tag="PVL30_004029"
                     /old_locus_tag="LELG_04305"
                     /db_xref="GeneID:5231521"
     mRNA            <398034..>399353
                     /gene="MET15"
                     /locus_tag="PVL30_004029"
                     /old_locus_tag="LELG_04305"
                     /product="Homocysteine/cysteine synthase"
                     /transcript_id="XM_001524284.2"
                     /db_xref="GeneID:5231521"
     CDS             398034..399353
                     /gene="MET15"
                     /locus_tag="PVL30_004029"
                     /old_locus_tag="LELG_04305"
                     /codon_start=1
                     /transl_table=12
                     /product="Homocysteine/cysteine synthase"
                     /protein_id="XP_001524334.2"
                     /db_xref="GeneID:5231521"
                     /db_xref="PFAM:PF01053"
                     /translation="MPSHFDTLQLHAGQPVDGPHRPRAPPIYATTSYVFNDSKHGAQL
                     FGLETPGYIYSRIMNPTNDVFEQRIAALEGGIGALATSSGQSAQFLAIAGLAHAGDNF
                     ISTSYLYGGTYNQFKVAFKRLGIETRFVNGDSAADFEKLIDDKTKAIYLESIGNPKYN
                     VPDFEKIVKVAHDNGIPVVVDNTFGAGGFLVNPIAHGADIVVHSATKWIGGHGTTTAG
                     VVVDSGKFDWTKYPEKYPQFSKPSEGYHGLVLSEALKEAAYIGHLRIELLRDLGPALN
                     PFGSFLLLQGLETLSLRVERQSENALALAQWLEKHPQVESVSYLGLPSHESHQLAKKY
                     FNNGAKYYGGALAFTVKDQPKTSEDPFDEASPKLVDNLQIASNLANVGDSKTLVIAPY
                     FTTHQQLTEDEKVASGVSKGLIRVSVGTEFIDDIINDFDQAFKKVYA"
     gene            complement(<399623..>401920)
                     /gene="OPT7"
                     /locus_tag="PVL30_004030"
                     /old_locus_tag="LELG_04306"
                     /db_xref="GeneID:5231618"
     mRNA            complement(<399623..>401920)
                     /gene="OPT7"
                     /locus_tag="PVL30_004030"
                     /old_locus_tag="LELG_04306"
                     /product="OPT super"
                     /transcript_id="XM_001524285.2"
                     /db_xref="GeneID:5231618"
     CDS             complement(399623..401920)
                     /gene="OPT7"
                     /locus_tag="PVL30_004030"
                     /old_locus_tag="LELG_04306"
                     /codon_start=1
                     /transl_table=12
                     /product="OPT super"
                     /protein_id="XP_001524335.2"
                     /db_xref="GeneID:5231618"
                     /db_xref="PFAM:PF03169"
                     /translation="MTGTKIPEDALETVRKGQAETVVESISTKSNVSIEQIDSEAGSF
                     DGEIPPDIAELPQVVRDTVSFEDDPTTPILTFRYFILSIIFIVPGAFIDTMNTYRTTS
                     AAYSIFFVQIASHWFGKWLAKVLPKKRVSLGKLGSFDLNPGPWSIKETALITITANSG
                     ATGSQGLNSLSLAEIYYGEKVNAAVAIFFMWTIVFVGYSYAGIARNFLLYDPQFIWPS
                     ALMQTTLFQTQSKSDLDSKQSSKQMKIFFCVLIGVCAWHFFPEYIWPMTSSLAFLCWV
                     APENYTANFLGSGLGGMGFLNFTLDWSNITSSIMLYPYWVQVVEFVAFVLGAWILIPS
                     VKWGGLSSFKSGLMSNSLFLANGTKYPTTDLLTPDLQLNMTAYHELGEVYLGAQRAWN
                     MFFDYAAYVSGFVWVVVFGYSSLSSSFKKLIKARKSNSSLSLQYTDRLNKMQAVYKEV
                     PLLWYIILFAASFITLLVILATKSLFMPWWCLIVGLVFGSIIVTPLGWLYALSNFQLA
                     IGTFNELLYGYMIQSQSSRHPAGATVYGAIAGDAWYRAQYILQDQKIGHYMHLPPRSV
                     FFSQIFGELIGVPINYAAMRWVLSSKMDYLNGTKEDPLHQWTGQSITSYNTNAIQYVV
                     LGPSRLFKNYPVLPYGFLLGAGAPLVLYAAYRFFPNSKLKFNLWNTTVFFSTLSTFYG
                     NISTGPLSSFIGGTITMFYAYRYKHALWKKYNYLLAAAIDTGYNLAILLIFICFSAGK
                     VILMPNWWGNNELSVERCFALAKAG"
     gene            complement(<402154..>403602)
                     /locus_tag="PVL30_004031"
                     /db_xref="GeneID:85890388"
     mRNA            complement(join(<402154..402359,403566..>403602))
                     /locus_tag="PVL30_004031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119512.1"
                     /db_xref="GeneID:85890388"
     CDS             complement(join(402154..402359,403566..403602))
                     /locus_tag="PVL30_004031"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975495.1"
                     /db_xref="GeneID:85890388"
                     /translation="MEHSILEKNSSTANSAFCNPSTVYFLSKSVMIVRKNIVKIIKII
                     ALTDAQDDDDDDGGGGGGGDDDGAGATEDGYKNYRL"
     gene            complement(<404283..>405044)
                     /locus_tag="PVL30_004032"
                     /old_locus_tag="LELG_04307"
                     /db_xref="GeneID:5231598"
     mRNA            complement(<404283..>405044)
                     /locus_tag="PVL30_004032"
                     /old_locus_tag="LELG_04307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524286.2"
                     /db_xref="GeneID:5231598"
     CDS             complement(404283..405044)
                     /locus_tag="PVL30_004032"
                     /old_locus_tag="LELG_04307"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524336.2"
                     /db_xref="GeneID:5231598"
                     /db_xref="PFAM:PF05730"
                     /translation="MADQYTQYPSVAKTASINGFADRIYDQLPSCAQSCVHENTGSTP
                     CPYWDTGCLCVMPQWSGVVAACIADNCKGDDVVKAESLATSICSSAGVWEPYWFMPAS
                     VSSALDAAATEVDTTPSSTAEPTTTEAATTEAATTEEQPAETSAASSAAAAETTEGSN
                     NNEGEAEQQQSTTAVPVSESTAVAGGDAETQSSAAPSSAEEQPEENSASTVAASSTDD
                     AEAAEASSASVAVVNGGVANGVAVGGVIAALAALI"
     gene            complement(<408303..>408980)
                     /locus_tag="PVL30_004033"
                     /old_locus_tag="LELG_04308"
                     /db_xref="GeneID:5231495"
     mRNA            complement(<408303..>408980)
                     /locus_tag="PVL30_004033"
                     /old_locus_tag="LELG_04308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524287.2"
                     /db_xref="GeneID:5231495"
     CDS             complement(408303..408980)
                     /locus_tag="PVL30_004033"
                     /old_locus_tag="LELG_04308"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524337.2"
                     /db_xref="GeneID:5231495"
                     /db_xref="PFAM:PF05730"
                     /translation="MLSVSIITFCYLVFVNADNYATYPKVPKTASINGFADPIIDLLP
                     DCAKDCVKYSTSNTPCPYWDTGCFCVMPQWSGLVGQCIAENCKGEDVASATFLATSLC
                     STVGANTWMMPASISTMLSTAAGNAKEVTTISGKTAMSWVTAPASVAGEGDAVVSTDG
                     TVMTEVGANESSSTDDSSAAASEETTSSTTTASSTTESSTSNLGVLQTTGSIGTVVLG
                     LLMSLLF"
     gene            <411646..>413718
                     /gene="FRP1"
                     /locus_tag="PVL30_004034"
                     /old_locus_tag="LELG_04309"
                     /db_xref="GeneID:5231492"
     mRNA            <411646..>413718
                     /gene="FRP1"
                     /locus_tag="PVL30_004034"
                     /old_locus_tag="LELG_04309"
                     /product="ferric-chelate reductase Frp1"
                     /transcript_id="XM_001524288.2"
                     /db_xref="GeneID:5231492"
     CDS             411646..413718
                     /gene="FRP1"
                     /locus_tag="PVL30_004034"
                     /old_locus_tag="LELG_04309"
                     /codon_start=1
                     /transl_table=12
                     /product="ferric-chelate reductase Frp1"
                     /protein_id="XP_001524338.2"
                     /db_xref="GeneID:5231492"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08022"
                     /db_xref="PFAM:PF08030"
                     /translation="MGIPFDQQYFVEKQLNNKYEWLVFVITLILLVLHGLLFHWIPLY
                     LRNKRNPSTLSNVKYFKFLHKWDMMTSCCKLRLFNRWDFYYQPSLVLFCLVFTGMCVG
                     FCFAEVTLINYQGYMYPISKRIGRVGVGNLPILLWSVARNDWLTRISGFQFDRLEFLH
                     KWLSRLMWLFISVHLSLGTYYWLSMNFKIMIMIPPQIFGFMAYGSLAILTWTSTKFIR
                     RWAYDFWLVQHRVFAFIMLFMAFIHNPGDRAAVLIAVHGLVIDRVVSKIMSHIHKYHS
                     PTKCRSTFEVLDEDTILMTIPVKDSDYVPNRWFNKFFGYKNWKAGQHVYINVGKIKWF
                     QYHPFTISSLSSSNEMKLLIRVQKGFTKNLYKYLTDIDHSEHDDETVTIQSMFAGPYG
                     AVHQPFISFDSCIFFGAGSGGAFTFPVCLDLMRQIEEKDEAQDYLFRPRNPHIRFIWT
                     IKRKRNIIWFKWILDELIPYVLQGKLTIDIYVTQENGSDDDAHVYAIDSSDESSCDGD
                     SRKNLLKKAQFTVVEKSQTLTGTNTNVTNTTFDEIEQVTEVEQQDPELKKEQPQPQEQ
                     QQQQQQKKSATDGKSEQVSTRISTINRTSSSMTIDPNSTFSTNTTTSSTSSSTPYNLY
                     YGRPHIGHIIKQDAMNLVADDPKNIHKSIAVASCGPPAFTNMIKHECQTVRKMKNSPD
                     VYCYTESF"
     gene            complement(<414560..>416065)
                     /gene="MEP2"
                     /locus_tag="PVL30_004035"
                     /old_locus_tag="LELG_04310"
                     /db_xref="GeneID:5231523"
     mRNA            complement(<414560..>416065)
                     /gene="MEP2"
                     /locus_tag="PVL30_004035"
                     /old_locus_tag="LELG_04310"
                     /product="ammonium transporter"
                     /transcript_id="XM_001524289.2"
                     /db_xref="GeneID:5231523"
     CDS             complement(414560..416065)
                     /gene="MEP2"
                     /locus_tag="PVL30_004035"
                     /old_locus_tag="LELG_04310"
                     /codon_start=1
                     /transl_table=12
                     /product="ammonium transporter"
                     /protein_id="XP_001524339.2"
                     /db_xref="GeneID:5231523"
                     /db_xref="PFAM:PF00909"
                     /translation="MSDSGFTGTGTGGDVFKVDLNEQFEQGDMVWIGTASVLVWIMIP
                     GVGLLYSGLSRKKHALSLMWAALMAACVTAFQWFFWGYSLVFAHNGSKFLGTLQNFCL
                     RNVLGAPSVVSTVPDILFCFYQGMFAAVTAILMVGAGCERARLAPMMVFLFIWLTVVY
                     APVAYWTWGKNGWLVSLGALDFAGGGPVHENSGFAALAYSLWLGKRHDPLTNGKVPKY
                     KPHSVSSIVLGTVFLWFGWFGFNGGSTGNGNMRSWYACVNTNIAAACGGLTWMFVDYF
                     RTGGKWSTVGLCTGAIAGLVGITPAAGYVPVYTSIVFGIVPGIVCNFAVDLKNILGID
                     DGMDVWALHGIGGLCGNIMTALFAADYVAMIDGTEIDGGWFSHHYVQLGYQLAGSVSI
                     AAWSFVVTSILLLVMDRIPFLRIRLHEDEEIMGTDLAQIGEYAYYENESDGNPYVLEP
                     IRSTDAIKEKLKASASNKDAEPLPEADLEAQPEAIDGITRAASNSSSSVKK"
     gene            <419436..>422684
                     /gene="SYP1"
                     /locus_tag="PVL30_004036"
                     /old_locus_tag="LELG_04311"
                     /db_xref="GeneID:5231633"
     mRNA            <419436..>422684
                     /gene="SYP1"
                     /locus_tag="PVL30_004036"
                     /old_locus_tag="LELG_04311"
                     /product="enzyme inhibitor"
                     /transcript_id="XM_001524290.2"
                     /db_xref="GeneID:5231633"
     CDS             419436..422684
                     /gene="SYP1"
                     /locus_tag="PVL30_004036"
                     /old_locus_tag="LELG_04311"
                     /codon_start=1
                     /transl_table=12
                     /product="enzyme inhibitor"
                     /protein_id="XP_001524340.2"
                     /db_xref="GeneID:5231633"
                     /db_xref="PFAM:PF10291"
                     /translation="MEESYNFATTILTSKTPEQAAAIVPNVVAGSSGINKDLISCFNH
                     YSSTLSTHNQNLKQLIDDADKIAKRSNVGFNNFPRNWNCLLKAVEMEHHNNEIIRKNL
                     KSEIIDPLRNLIENDVRISELIVNGQELQEISSHLTKDGEYQWNYKAPQTFQNLEDFK
                     KVEIQLMFNIVLNFFQMYNGKLTKELKNNENSTNYLLGSFKLDNEMNSQLDYLQQTQF
                     QAPANNKPGSSRRASSSTTTTATTTGSSHVGAGAGSLEHGHPKSRRMSSFGKLDKHHG
                     ASDEPSSPKKQSKLRSKVGSIFGRKNKKDKNQLNQEATIPEDASVSTDASISRTQSTS
                     LLSRNTTRRSTYEPPSTQRSQTAATATTTTTNNNNNANGQANIPEPTFASPQYFESNN
                     RDTNATNAANTTNEASEVTSPFKQPLQPQPRQTVANTAQPQQFQQSQPSQFQTSPQSQ
                     QFQQSQPSQFQTSPQSQQFQQPAQAQQQQQQQQQQQQFQSSGQPRQSTFGSVASNQSK
                     EVGQPSTPVHNKFLPPNPLSEQTAESPNFIKYNNEGDEGDDDDDDDDEDDSDESIVAG
                     RRSSLLQRNELGDTSPIDNRNQDFYPTPPASNQVPKSSLDPQAQLPHSQGQGQGQGQG
                     QGQGQGQGHFQGRSLQPSMVPGSFIQNDAQRSRQSSDGIYSFETGDDQKPITAATNTG
                     RNGVRNSITEKNSEQLPEPDLFYKQTEQGSGGASKDSESTLFTSKAPRMGTMAESITS
                     ANSSTAAPRPPPSRKVHHTDTNSSVRDSSIFHNLPAASTSTSTRDSFAAPASAPAYQH
                     QQHQQHQQPPPPIAHRFSSLGETQFKHLSTQDTGSLLKNDFKHFNLSEATSGLNASVA
                     EIINANIKDGQVIAGQVVGEVAFNYNGPLVQDTFINVNIPYKYDKLIVNKNFIQELGE
                     GNYTIDPSTIISKTSGGLKYLYKTSQVPLSIHQVWKHEPHQSSLLISIKSTVSEKLVL
                     NNFVVSAALNQDVQATSASSKPQGAFNKEKNRITCRYHEPVVLQSHGEEKLIARFKTN
                     GQGTEHESGIQVKFAIEDSAKSIRYCTIYDAASGQEVPTYRNLISGHYSSHS"
     gene            complement(<422980..>423597)
                     /gene="YET1"
                     /locus_tag="PVL30_004037"
                     /old_locus_tag="LELG_04312"
                     /db_xref="GeneID:5231657"
     mRNA            complement(join(<422980..423471,423550..>423597))
                     /gene="YET1"
                     /locus_tag="PVL30_004037"
                     /old_locus_tag="LELG_04312"
                     /product="ER 25 kDa transmembrane protein"
                     /transcript_id="XM_061119513.1"
                     /db_xref="GeneID:5231657"
     CDS             complement(join(422980..423471,423550..423597))
                     /gene="YET1"
                     /locus_tag="PVL30_004037"
                     /old_locus_tag="LELG_04312"
                     /codon_start=1
                     /transl_table=12
                     /product="ER 25 kDa transmembrane protein"
                     /protein_id="XP_060975496.1"
                     /db_xref="GeneID:5231657"
                     /db_xref="PFAM:PF05529"
                     /translation="MSLQMSLVFSTMVAQSHSQHFKVVLIFSLVLMSLQFWDCLARLQ
                     KYQKIQEQINGNPQYGGGFINYDKLASKFYSERNLYLSGAILYLQLCIGTVVTIVKKL
                     VLKQKILRDHSVELKKKGLAGRDAERKKTDEEITEIVRLKQLIEVKSRDVKVLKKQIK
                     GMQATYDGMNATGIRNKDD"
     gene            complement(<424372..>427587)
                     /gene="MNR2"
                     /locus_tag="PVL30_004038"
                     /old_locus_tag="LELG_04313"
                     /db_xref="GeneID:5231580"
     mRNA            complement(<424372..>427587)
                     /gene="MNR2"
                     /locus_tag="PVL30_004038"
                     /old_locus_tag="LELG_04313"
                     /product="CorA metal ion transporter"
                     /transcript_id="XM_001524292.2"
                     /db_xref="GeneID:5231580"
     CDS             complement(424372..427587)
                     /gene="MNR2"
                     /locus_tag="PVL30_004038"
                     /old_locus_tag="LELG_04313"
                     /codon_start=1
                     /transl_table=12
                     /product="CorA metal ion transporter"
                     /protein_id="XP_001524342.2"
                     /db_xref="GeneID:5231580"
                     /translation="MESTDQLGNADDPVFRSSSTLNNHLRDKRQNKRSKDHHGIDHSN
                     NQSTSSLEKLINSGSYIDHRNQSDLAHLHSSPARSRRRNNGSVFKRSNLGNSDNTNNH
                     NNHNNNNNDNNNNNNNNNSNSNNAGSPNSGDGNIPPRRPSNLPLTNRNLQHLLRSSVS
                     APGAAESTTPDAVALDMDQFAREQSRLARSHSWTDPFGDGQGQGQNQSSSYGNGNGNG
                     NGKEYGRNDSYTGNGDFDNYSVNSLEFGESNPSSDHSSDSTSLDDVWHFDREEIKRDE
                     WPNLDILEEFVKEEYEIAERENGQGINTEQSVNFGAHHRIHDEGVGTRTGARAATEGG
                     AAAVVGTGSYSPRSHNDRKQQQQQQPSSSSSSPPQQPSSSSSSPPQQQQQQQQQNKDV
                     GVDEDDADENTPLIENFQSNDLESLNSLSESFRVRPTPTQPWEKSKDQIPTILNRKST
                     SPNQKNRNQKDGEVCRYTYFREDLPKTIYSPTIGGLLSDDPKLSIHDRLVELFRPGTR
                     SFGDNSTISHKQQDSLSSTNLQSQQQIQTQTQTQPQTQPQLQSQTPTSTHALSQAQAQ
                     SLKPGRIGNETPLPLSINGEIVNDPFWLDVLDPTEEEMKVISRTFGIHPLTTEDIFLG
                     EAREKVELFRSYYFICFTSFDVVYERRKQKAKEQEKKYNKLQEMYENASDHDSLYGQY
                     NGNGNHGAVQRFLSKAFGGLFKGKKKPPSIYEKPQSSSMKSKGKRIREGELAPLNMYM
                     IVFKNAVISFHFSPTPHPINVRRRARMLKDYLTVSSDWICYALIDDITDSFAPMIETI
                     ETEVNSIEDAILRMHSGENEDSDDSDDEEDDGASQSIHQHTKHPRHVHNHHSQHQNRN
                     NERENVFVWRKRSKSMVEPNPQGFYRMANTKSKASSSSSSTSDTGSSHILGWKRKGDM
                     LRRIGECRKRVMSVLRLLSSKADVIKGFSKRFNDVDTGNYQQSEIAMYLGDIQDHIVT
                     MIQALNHYEKLLARFHSNYLAQINIDMTKVNNDTNDVLGKITILGTIVLPINVVTGLW
                     GMNCIVPGQDYDGLLWFWCIVGAMALFSIFAYHYARRVTGL"
     gene            complement(<429706..>430092)
                     /locus_tag="PVL30_004039"
                     /old_locus_tag="LELG_04314"
                     /db_xref="GeneID:5231348"
     mRNA            complement(<429706..>430092)
                     /locus_tag="PVL30_004039"
                     /old_locus_tag="LELG_04314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524293.1"
                     /db_xref="GeneID:5231348"
     CDS             complement(429706..430092)
                     /locus_tag="PVL30_004039"
                     /old_locus_tag="LELG_04314"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524343.1"
                     /db_xref="GeneID:5231348"
                     /db_xref="PFAM:PF02229"
                     /translation="MAPKRPFSADANETEIILDNKKRVTVRRFKNINLVDIREYWTDA
                     KGKRNPSQKGISLTEDTYIELIKAHNKIQNALDKLNSGDNDAGASNKKKPKIDIGKVN
                     EKKSEKEDGKEAQAGSEAAAENAGED"
     gene            complement(<430542..>431537)
                     /locus_tag="PVL30_004040"
                     /old_locus_tag="LELG_04315"
                     /db_xref="GeneID:5231360"
     mRNA            complement(<430542..>431537)
                     /locus_tag="PVL30_004040"
                     /old_locus_tag="LELG_04315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524294.2"
                     /db_xref="GeneID:5231360"
     CDS             complement(430542..431537)
                     /locus_tag="PVL30_004040"
                     /old_locus_tag="LELG_04315"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524344.2"
                     /db_xref="GeneID:5231360"
                     /db_xref="PFAM:PF00248"
                     /translation="MTRAVSKPYSIDNLPPLIVGGAVFNYQYSSNPQALPIESLLKRA
                     FDCGYNAIDTSPYYGPSEELLGEALLKLGYPRDSYYICTKAGRVKLDEFDYSRASVRQ
                     SVYRSLKRLNTDYLDLVYMHDIEFQTAQAVIDALRELQELKKEGKVRNIGVSGYPVSF
                     LLDIALKWKEVNNGEPLDAVLSYSNGCLQNRILFDYYERFKSEAGVRKVLNGSILSMS
                     LLRSAKTHDFHPASSELKQRVYEIASELKSKDEKNDGVELAELATKYAIAEWLIKYKE
                     SIVLGVSNVEELNLAIDVYENLQKTGLTSEDKKLIDKVQHDLGKHMNETWPSGFH"
     gene            complement(<431923..>434529)
                     /gene="HOF1"
                     /locus_tag="PVL30_004041"
                     /old_locus_tag="LELG_04316"
                     /db_xref="GeneID:5231658"
     mRNA            complement(<431923..>434529)
                     /gene="HOF1"
                     /locus_tag="PVL30_004041"
                     /old_locus_tag="LELG_04316"
                     /product="formin-binding protein"
                     /transcript_id="XM_001524295.2"
                     /db_xref="GeneID:5231658"
     CDS             complement(431923..434529)
                     /gene="HOF1"
                     /locus_tag="PVL30_004041"
                     /old_locus_tag="LELG_04316"
                     /codon_start=1
                     /transl_table=12
                     /product="formin-binding protein"
                     /protein_id="XP_001524345.2"
                     /db_xref="GeneID:5231658"
                     /db_xref="PFAM:PF00018"
                     /db_xref="PFAM:PF00611"
                     /translation="MRTTAAEATTNSVEGYVEFVNNFWGSSPEQSFEIISIRIKDSIK
                     TLYEVINFYQEKISIEKDYIKRLEKLQAKCPLGTHETGSLKRSLDKFHLENDTMIDHN
                     VKFVKSTQDANLEKLHHFTQLYIQKVDKLRHHMGKVILRRANTLKELNVHKNKYQEEC
                     GLMKSLKLQLQTTWGKELEKNQLKYNKLSSSIAQTRNNYQYSINAFKEINDIYKRDWS
                     ISVNDFYKLEIERVQLIKINCFNYCNNIATLCVDVDQSIDLARSSFAAVQPQPDVQEF
                     SNNYGTGNKIYNDPEFVEYMTGTEEPSIGYTISGSRNPNHDEILTRTYSNFSQRQQVG
                     KQQSPPKNLQQPPRNGRDNGESIMFNPIDDFTLKAQAARPSTEKMIANGSNNTNTNTN
                     TTTSNNNHSNGVGRGSPPKSPFYHHITSPLKDLPKVDLQFTNPSENEKNFNERNHFVT
                     PTKNTIFDTSPYKQRNAIPDLSPTKQINATMTTNTTTPSNPTMTPIPIPLPISSPTQT
                     AKTKPIEQHIPATRQTLSPPKNSHTPARKPPIDLLSHKTQSTSSSVPDNDVFSKDERL
                     SNSGGTSSNYSSERNWASPRRREKQLQQMQEQITRRATNEFGRRSQNSRNDAIDQQSI
                     NAKTKVPIVNDFSIDFIAKALEDLNAGGNGDVNQFRRSIRSNGNGSNEGNHERNSERN
                     YERGHERDRESIVTSTYSRRPKSDYIDDHNEVAQRYESISFRRPKSMVDIGGSDNGVN
                     NVNESFANKRASPDVFTTKPQQYPYAQKQNRYYQTPNNSPLKSKTVESKNVKPTIKIT
                     PVNQRPYVSTATARYTFKPQEEGELYFRKGWQMFIIHKQEDNWFVCELGPNCDDCNGM
                     IGLVPGNYIVEH"
     gene            <436850..>438247
                     /gene="RCH1"
                     /locus_tag="PVL30_004042"
                     /old_locus_tag="LELG_04317"
                     /db_xref="GeneID:5231544"
     mRNA            <436850..>438247
                     /gene="RCH1"
                     /locus_tag="PVL30_004042"
                     /old_locus_tag="LELG_04317"
                     /product="LRR receptor-like serine/threonine-protein
                     kinase RGI2"
                     /transcript_id="XM_001524296.2"
                     /db_xref="GeneID:5231544"
     CDS             436850..438247
                     /gene="RCH1"
                     /locus_tag="PVL30_004042"
                     /old_locus_tag="LELG_04317"
                     /codon_start=1
                     /transl_table=12
                     /product="LRR receptor-like serine/threonine-protein
                     kinase RGI2"
                     /protein_id="XP_001524346.2"
                     /db_xref="GeneID:5231544"
                     /db_xref="PFAM:PF13593"
                     /translation="MKKLQLPDSVKNNKVYIWVKKILDFLIGQWFFCLLGVFVALAYE
                     YPEFAKQGGMIRAEYSIGYGAVAVIFLISGLSMSSKALLINALNWRAHFTVLTMSFLI
                     TSSIIYGIVSGIRASHDGQIDDWLLVGMIVTHACPTTVSSNVVMTKQADGNDILTLCE
                     VTVGNILGAFITPALLQMYMTGVWDFGNPSHQPSGENSIGDLYKETMKQLGLSVFVPL
                     FVGQVIQNVFPKQTKWTCTTFKLNKVGSFMLLLIMFQSFSTAFAQHAFTSVSHVSIIF
                     LVFFNIGIYLFFTILTFIYSRPYFVRRWFWEYPNEQSSWLYKWSYKLLNPFYYNKKDT
                     VAIMLCGPAKTAALGVSLVSSQYGSNNPNLGILLVPLVLYQAEQVMTANFLTGIMKKW
                     IHYDDEKKNESDDENQLSHRNTREEDEEISQEEEELQREENNLTEGTEETEQTSSSGS
                     REVESFSMHSQPIKA"
     gene            complement(<438436..>440259)
                     /gene="PEP7"
                     /locus_tag="PVL30_004043"
                     /old_locus_tag="LELG_04318"
                     /db_xref="GeneID:5231469"
     mRNA            complement(<438436..>440259)
                     /gene="PEP7"
                     /locus_tag="PVL30_004043"
                     /old_locus_tag="LELG_04318"
                     /product="carboxypeptidase Y-deficient"
                     /transcript_id="XM_001524297.2"
                     /db_xref="GeneID:5231469"
     CDS             complement(438436..440259)
                     /gene="PEP7"
                     /locus_tag="PVL30_004043"
                     /old_locus_tag="LELG_04318"
                     /note="BUSCO:EOG092629RT"
                     /codon_start=1
                     /transl_table=12
                     /product="carboxypeptidase Y-deficient"
                     /protein_id="XP_001524347.2"
                     /db_xref="GeneID:5231469"
                     /db_xref="PFAM:PF01363"
                     /db_xref="PFAM:PF11464"
                     /translation="MSDNISNSNSKRDSATPALSATAVTSSVSSTSNSKTPSPRRNTP
                     AKKINKIVFSEHGFSIGDIQRSRSSSPTSGSRSESPAVSTELSEASGVSGVSGVSRVS
                     RASAKSRTTSSSLSAHIITSHWKQQSSVSDPRCKICGKKLNVKNGIVNCRKCGELYCN
                     EHTHYRVKLRNPDPQHGETKPQFDTSAHGIWCRCCELCYMERRKTEVNFVDVTLDFKQ
                     KRQEHVDQRELHETKVQRNFIKLTNLMVDKSLSKRAKGGKKGNLEGLGKINSTSNGIF
                     SFFKPVSNDEMSIIGADNWVPDDNATNCTICFTKFNFIIRKHHCRLCGEVVCDDSSGV
                     RKNCSLYVPLVAFLEKLPNLNYSSQVRKHWSEIDQELRFRCCVNCKNAVLHDWKRVHR
                     GQIGSASTIGGTDVEGEEIFRMYDGMLLQKGLIEQMMHQYEFGSRSGITKVGGTGSDG
                     EDEMKTGHKLMLYLKEFENLVIQFKKKFFFKDNDKLLIQQEYLNFERVLLNMYQSVGT
                     FLQNNIIKFKAIQEERRPKIEQASPEKEETPVPRLTKKQIRELREQLMVLNEQKFLIE
                     NQIQEFTRNRQFDELNTLITNKDEILDTIKQVENELGEFGF"
     gene            complement(<440722..>441891)
                     /gene="PTC7"
                     /locus_tag="PVL30_004044"
                     /old_locus_tag="LELG_04319"
                     /db_xref="GeneID:5231698"
     mRNA            complement(<440722..>441891)
                     /gene="PTC7"
                     /locus_tag="PVL30_004044"
                     /old_locus_tag="LELG_04319"
                     /product="Protein phosphatase 2C 7"
                     /transcript_id="XM_001524298.2"
                     /db_xref="GeneID:5231698"
     CDS             complement(440722..441891)
                     /gene="PTC7"
                     /locus_tag="PVL30_004044"
                     /old_locus_tag="LELG_04319"
                     /note="BUSCO:EOG09263I4U"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein phosphatase 2C 7"
                     /protein_id="XP_001524348.2"
                     /db_xref="GeneID:5231698"
                     /db_xref="PFAM:PF07228"
                     /translation="MLLSIINKKSVPLAQSLFKTSVTTSSRSFFFGSGSGSGSGSSSS
                     ASSGSSSGSGSSSSSSWSSSKSYSSTSAQSANASVPPATSSTASLNYDTALTTFTHYN
                     VAVAYQPKDRKPSTNLFKKRNREVPALNSPSGEDNLFVSNQTKDGSIAVGVADGVGGW
                     SEAGYDSSAISRELCASIKYAFEKEYDTQNSITPKDLLVEAFRDVTFSEKVEIGGTTA
                     CLGIFTPDKKLKVANLGDSWCGLFRDYKLIHETNFQTHNFNTPYQLAKIPQHILKQAE
                     LEGRRYIIDSPSMADEYTWNLQKNDIVMFATDGVTDNVVPQDIEIFLKDNLEDRADKD
                     AKLDVVTNKFVKEVVKVSKDSNFPSAFAQELSRITGQKYLGGKEDDITVVLVKVL"
     gene            <442592..>442876
                     /gene="TIM11"
                     /locus_tag="PVL30_004045"
                     /old_locus_tag="LELG_04320"
                     /db_xref="GeneID:5231717"
     mRNA            <442592..>442876
                     /gene="TIM11"
                     /locus_tag="PVL30_004045"
                     /old_locus_tag="LELG_04320"
                     /product="F1F0 ATP synthase subunit e, mitochondrial"
                     /transcript_id="XM_061119514.1"
                     /db_xref="GeneID:5231717"
     CDS             442592..442876
                     /gene="TIM11"
                     /locus_tag="PVL30_004045"
                     /old_locus_tag="LELG_04320"
                     /codon_start=1
                     /transl_table=12
                     /product="F1F0 ATP synthase subunit e, mitochondrial"
                     /protein_id="XP_060975497.1"
                     /db_xref="GeneID:5231717"
                     /db_xref="PFAM:PF05680"
                     /translation="MSATVNVLRYSALGLGVVYGAYHRFSLESAFAKQQAAAQWKKEE
                     KLIAEAKSIYQKINTPPKQETPKSQAGSINWEDPNLDFGAVLESLIAKLD"
     gene            <443843..>445025
                     /gene="PEX10"
                     /locus_tag="PVL30_004046"
                     /old_locus_tag="LELG_04321"
                     /db_xref="GeneID:5231496"
     mRNA            join(<443843..443888,444073..>445025)
                     /gene="PEX10"
                     /locus_tag="PVL30_004046"
                     /old_locus_tag="LELG_04321"
                     /product="peroxisome biogenesis factor 10"
                     /transcript_id="XM_001524299.2"
                     /db_xref="GeneID:5231496"
     CDS             join(443843..443888,444073..445025)
                     /gene="PEX10"
                     /locus_tag="PVL30_004046"
                     /old_locus_tag="LELG_04321"
                     /note="BUSCO:EOG092635ST"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisome biogenesis factor 10"
                     /protein_id="XP_001524349.2"
                     /db_xref="GeneID:5231496"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF04757"
                     /db_xref="PFAM:PF13639"
                     /db_xref="PFAM:PF13920"
                     /db_xref="PFAM:PF13923"
                     /translation="MSSERRLPFADAATIVRAHQKDVYFESSYRSQLQDILQIFKGQR
                     FINEFPQEITVLSKALYLALTTLIGARTLGEEYVDLIYVNKTGRKLPKLLPRLGFLIS
                     YALAPYLINKFVKYLRTKREKRELEGDQSKDSWLVKFFSNYYEVLDTMINIHIAVFYF
                     KGEFYSISKRLFGLRYAYGHHKEPEKMQRGNYSLLGGLIIIQFAVKLLMNLKEFNEEY
                     VKKHSKRKEDDEKSSQQTNSIEDEAKVHSITELSTLSDNFDTTLLIDLADEKQLPYLQ
                     DTARNCMLCLSPMVSPSAANCGHLYCWDCIVDWIRENPECPLCRQQCLEQHLLPLR"
     gene            <445610..>446641
                     /gene="MNN10"
                     /locus_tag="PVL30_004047"
                     /old_locus_tag="LELG_04322"
                     /db_xref="GeneID:5231450"
     mRNA            <445610..>446641
                     /gene="MNN10"
                     /locus_tag="PVL30_004047"
                     /old_locus_tag="LELG_04322"
                     /product="alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_001524300.2"
                     /db_xref="GeneID:5231450"
     CDS             445610..446641
                     /gene="MNN10"
                     /locus_tag="PVL30_004047"
                     /old_locus_tag="LELG_04322"
                     /note="CAZy:GT34"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_001524350.2"
                     /db_xref="GeneID:5231450"
                     /db_xref="PFAM:PF05637"
                     /translation="MSGSYSLPYSSDSGVSPPHDLSKPFKPQQKSSSLDTGLHFVNRH
                     KKIVLAFITLICLSLFTDIPYVPHFKSTSPKVVIILAANEGGGVLKWKSPQEWSVERS
                     SIANKKHYAKQHGYGLTIKDMTIKKRYSHEWRESWEKVDILKQTMRQFPQTEWFWWLD
                     LHTYIMDPSISLEEHFLNNLDNATYRTLEQFNPLGLPTDIPYVDYKQPIDMIITQDCG
                     GFNLGSFLVRRSSWSEMLLDIWWDPAMYEQMHMQWEHKEQDALETLYSTQAWIRERIG
                     FLPLRKINAFPPGACADKADDPQYFFKDHDFVINMAGCEWGRDCWGEMEHYKALSKKL
                     RKSWWKFWQ"
     gene            <447194..>451354
                     /gene="SWI1"
                     /locus_tag="PVL30_004048"
                     /old_locus_tag="LELG_04326"
                     /db_xref="GeneID:5231440"
     mRNA            <447194..>451354
                     /gene="SWI1"
                     /locus_tag="PVL30_004048"
                     /old_locus_tag="LELG_04326"
                     /product="component of SWI/SNF global activator complex"
                     /transcript_id="XM_001524304.2"
                     /db_xref="GeneID:5231440"
     CDS             447194..451354
                     /gene="SWI1"
                     /locus_tag="PVL30_004048"
                     /old_locus_tag="LELG_04326"
                     /codon_start=1
                     /transl_table=12
                     /product="component of SWI/SNF global activator complex"
                     /protein_id="XP_001524354.2"
                     /db_xref="GeneID:5231440"
                     /db_xref="PFAM:PF01388"
                     /translation="MSDTDWINDPNFMGGPTGDDFLNSIFDQTQGQTLSNETQQQQQQ
                     HQQQQQQQHQEQPASQQQQQQEQQQQQRQAPPPQFWQNQQQQEHQQIPQQFNQVQSPA
                     PGSQFQQTQQPQISGFEQTPTTQTLDSQDFNAMFARQQVPQQSNNANKQEMLMKMKQQ
                     IYRQRMQAQAQAQAQALTQGQIQNQGQGQTHNQQFTQNFPSQGSPIPSQIPTPSTVQQ
                     GASPQVSSATSGINTNLGNSFSPQFQHQSPHQSQQGLQGIQSTRPPSNPQVQHFPQQQ
                     QQPQQQQPQQQQPQQQQPQQQQPQQQQQPPQQQIQQQRMQQQKQLMTGQLNSELFHTL
                     LYDFLQRRGTPIKSHPTINGKRVNLFMIYLLCTKMGGFNQLKKFLNINFSQQQQNPWS
                     VIAPRIGVYEGANLQEPGVKESIDQEVCNCYATYILPYEEYNATPNGQRDLSQRRQIF
                     QAQVLQKFQQAQQNQQNQQTSQVQDRSQPQFQTQKSQQIPPQQQLRQQSQQPPSSQSM
                     PSNLQSQVISPSAANNPTPIGTHSTHQSPIVNSAPTPQQRKLSRASNASVQNSPRVNS
                     PYVQNQHNQHNQQFRQPPPSQQQQQLPHARVQQIQQQKQQSRRASPQQQYKAPPQPQV
                     QPQSQNIPQQSQNQRVPSQPQVMQQQNLPQQNLQQQNLQQQNLQQQNPQQQNPQQQNP
                     QQQNLPQQNPQQQILQNQTPVPPPFQQQQQQQQQQQHPRQHLPQQQAIQQDIPATNSR
                     QPSQTGSMQQMKHIISKEEASVLRNYVPFKRIIDTHGFQSIKDISHLGSEIEAAKPIY
                     LFAPELGMINLQALTMAIKSNHGIQSGEVVNALNTLLVTTSDTNYTFQIRDCFELLDA
                     LSALGKEILRKIIHGNAAPQDVVVEDVSKMSSQNNIDDVFAKYVSGGRGEDISYVVNS
                     LTGEVESEDENAVNELFEFEESSSATTPASVSSATATATTTTTDTNKNETATNATTSL
                     GSEEDEDDIREFHIDDYSCALQEFKYENKHHFSELQVKSATDDQVLLIDELITITMIL
                     RNISFSDFNKEPMANNRLFKDLLFAIVKGIASHRSKFRFSRKRLCLLKDCLLMLDNIA
                     FHTQLQSLEEAFLSFVLVECFGPAIEDRWAIPRCNLDTHSYFSFGIDALTKLLVREPY
                     NRSLFQAMFNGTLNIGMTSSYTNNFLVSQEDQDRTRRLISLYLGKNAGEYKSGILLTR
                     AFQLYMSIIPYDANSFEFSKFVFIRAPTVSQLLFGVKLIIDMAPIEDLHTPLHEITLY
                     WILENRELILGNFARIVVALASETGKFPRGSAEHSILSSSLTKALLVVNSLIENALLA
                     KKIEDETQEHSELIEKLTDCYAFPRIIPDVTLTLDTFLAPTIDYGLGDEIVRLLRCLK
                     DLKACETI"
     gene            <453225..>454694
                     /locus_tag="PVL30_004049"
                     /old_locus_tag="LELG_04327"
                     /db_xref="GeneID:5231483"
     mRNA            <453225..>454694
                     /locus_tag="PVL30_004049"
                     /old_locus_tag="LELG_04327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524305.2"
                     /db_xref="GeneID:5231483"
     CDS             453225..454694
                     /locus_tag="PVL30_004049"
                     /old_locus_tag="LELG_04327"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524355.2"
                     /db_xref="GeneID:5231483"
                     /db_xref="PFAM:PF00355"
                     /db_xref="PFAM:PF00848"
                     /translation="MAPVEISSQTPTTLPVEPKVDSITTTPAAAAAAAASVAAAPLLA
                     GEHTLPASWWHSESVYELEKRAIFHKSWLYCTHASRFTKPGDYYSFNVTGISFFLIKS
                     KTDGQIKAFHNVCRHRAYPVVRKESGTSTVLGCKYHGWSYNADGKLNKAPHFDNVEGF
                     KKEENSLFPIRTHVTPQGLVFVNFSNEDDASVIPFDDWFKGLTNEMNEFDFDDYEYHM
                     SYELHGDFNWKTLMDGYQECYHCPTAHPGLNSAFKMETYKVVPKNRYCRHYAAIKRNE
                     EPEAKEVEDVEEETTEGKSSWFGFGKKTQAPPQQQQQQKQKQEKKKASNPGGEFDGLW
                     VYLFPSNGINCYSPAWYSIRVLPLSAKKTTLQYDIYTKKGIDQETAKEFVDFLQLVEI
                     EDFNLCQLTQKNLNQGIYSSGYLHPEKERGVLYYQGLVRDMVKDHHALEQKTNGGKPV
                     DPASIAPNSKNKEIAELEAICQATECGSGENGSGGEMDW"
     gene            complement(<455028..>457610)
                     /gene="HIS4"
                     /locus_tag="PVL30_004050"
                     /old_locus_tag="LELG_04328"
                     /db_xref="GeneID:5231569"
     mRNA            complement(<455028..>457610)
                     /gene="HIS4"
                     /locus_tag="PVL30_004050"
                     /old_locus_tag="LELG_04328"
                     /product="trifunctional histidinol dehydrogenase"
                     /transcript_id="XM_001524306.2"
                     /db_xref="GeneID:5231569"
     CDS             complement(455028..457610)
                     /gene="HIS4"
                     /locus_tag="PVL30_004050"
                     /old_locus_tag="LELG_04328"
                     /note="BUSCO:EOG09262E98"
                     /codon_start=1
                     /transl_table=12
                     /product="trifunctional histidinol dehydrogenase"
                     /protein_id="XP_001524356.2"
                     /db_xref="GeneID:5231569"
                     /db_xref="PFAM:PF00815"
                     /db_xref="PFAM:PF01502"
                     /db_xref="PFAM:PF01503"
                     /translation="MSFPLLPFVSSPESSQVEEFSLTGAILLPYSSLKISKHWTRQFS
                     NDLKIYVKVDPSVTVDQITELLNTGVEKVFIYDIEQYKEATVNAGLPAARFATTNIDT
                     AEAYLESSLIVSEKLNDVKLYNNHENRTIYFDVSNSGTQEEVNALAKEGYTPIISADK
                     LTTKKQEAGKISISSVFIDTLVTDRPDGLFTTLVTSPAPEFTSLGVVYSSKDSIAAAI
                     EEKVGVYQSRKRTHELWYKGKTSGATQKLVAISKDCDSDVVQFIVESRKGYGFCHRET
                     QYTCFGDEQVKSSGKGLVKLDKTLSERFSEIDAAPEGSYTKRLFQDENLLIAKLKEEL
                     DELIDAKGNRDEVAWEAADLIYFVMTWCVKNGVRLADVEKNLDVKSLKVTRRKGDAKP
                     QYVQKEQEKKEEVKAKVEEKDLESNESYEMEVIVADDITSSNVDKAMKRPVQKTSDIM
                     KLVLPIIENVKTNGDKALIELTAKFDGVQLTTPVLNAPFPQELMEISQEMKDAIDLSM
                     ANIEKFHRAQLPTEEVMTVETCPGVYCSRFAKPIENVGLYVPGGTAVLPSTAMMLGVP
                     AKVAGCKNIIIASPPARATGKLTPEVVYVAHKLGAQKIVMAGGAQAVTAMAYGTESVI
                     KCDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADNNADADFVASDLLS
                     QAEHGVDSQVILIGVDLTKEKLAAFQDAVKKQASVLPRKEIVAKCLSHSFILLVKSYK
                     EAFELSNQYAPEHLILQIDNAKSFVPSSIENAGSVFVGALSPESCGDYSSGTNHTLPT
                     YGYARQYSGVNTATFQKFITSQDVTEKGLKSIGKAVMTLAHVEGLEAHRRAVEVRMEK
                     LGLL"
     gene            complement(<458180..>460084)
                     /gene="PEX5"
                     /locus_tag="PVL30_004051"
                     /old_locus_tag="LELG_04329"
                     /db_xref="GeneID:5231441"
     mRNA            complement(<458180..>460084)
                     /gene="PEX5"
                     /locus_tag="PVL30_004051"
                     /old_locus_tag="LELG_04329"
                     /product="Peroxisomal membrane signal receptor PTS1"
                     /transcript_id="XM_001524307.1"
                     /db_xref="GeneID:5231441"
     CDS             complement(458180..460084)
                     /gene="PEX5"
                     /locus_tag="PVL30_004051"
                     /old_locus_tag="LELG_04329"
                     /codon_start=1
                     /transl_table=12
                     /product="Peroxisomal membrane signal receptor PTS1"
                     /protein_id="XP_001524357.2"
                     /db_xref="GeneID:5231441"
                     /db_xref="PFAM:PF00515"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13414"
                     /db_xref="PFAM:PF13432"
                     /translation="MSFVGGGPDCAVGNNAVSQLNKHTQQDRSLQQQASSSQQHGINL
                     PNQGFKSRDNIINARDRQNLDQFMNAGSPSVQANSFQFQQMRHELNGMQHHQQPQQHQ
                     NNWSKDFKQQSVSPVPQNASPIVKNTQWANEFQSVGPSVQQSSQAIHQHHPQALGNQN
                     YTSYRPMMNSYRPMMMMGGAGGMSSYQQQQQQQPMMHQHQQPQADTQKQDSTQQVDWD
                     DQFKQIEELSTSELNKEEEATKQADDKDDIVIDDKYQATFQEVWDSLNSEAFENDLIE
                     QQYEEFKHTQRETFPADMNQWERDFAKYASTRAHFGDYKFEEQSQNQFMDLPADQDPY
                     EIGLQLMENGAKLSEAALAFEAAIQKNENHVDAWLKLGEVQTQNEKEIAGISALEKCL
                     ELHPENAEAMMNLAISYINEGYDNAAFATLERWISTKYPAIAEKARLENPEITDEDRI
                     SLNNRVTELFLKAAQLSPDHASMDADVQMGLGVLFYANEDFDKTIDCFKAALSIRPND
                     AVLWNRLGASLANSNRSEEAVEAYFKALQLKPTFVRARYNLGVSCINIGCYKEAVEHL
                     LSGLSMHQVEGVEGDNNASGNMGTLNHNQSTSLTETLKRAFIGMERRDLVELVKPNMD
                     LNQFRGEFNF"
     gene            complement(<461166..>461645)
                     /gene="DIF1"
                     /locus_tag="PVL30_004052"
                     /old_locus_tag="LELG_04330"
                     /db_xref="GeneID:5231472"
     mRNA            complement(<461166..>461645)
                     /gene="DIF1"
                     /locus_tag="PVL30_004052"
                     /old_locus_tag="LELG_04330"
                     /product="Des-methyl DIF-1 methyltransferase A"
                     /transcript_id="XM_001524308.2"
                     /db_xref="GeneID:5231472"
     CDS             complement(461166..461645)
                     /gene="DIF1"
                     /locus_tag="PVL30_004052"
                     /old_locus_tag="LELG_04330"
                     /codon_start=1
                     /transl_table=12
                     /product="Des-methyl DIF-1 methyltransferase A"
                     /protein_id="XP_001524358.2"
                     /db_xref="GeneID:5231472"
                     /db_xref="PFAM:PF08591"
                     /translation="MSSQERQYKRSNLRDHASYTVAPFTSDSNVMSSHYGPNSDSPLV
                     SVAMRIRKAVSEGYNNGQSNFSGNFQRCPLPNNMSSPPMLSSSESTRTVSNLEEWDSY
                     YKINNAPVQTLDANGGNYYDQSQNALKRKFNDFNEQQEPEIASYQAKYGALHFNEEF"
     gene            <462665..>463987
                     /gene="CAR2"
                     /locus_tag="PVL30_004053"
                     /old_locus_tag="LELG_04331"
                     /db_xref="GeneID:5231526"
     mRNA            <462665..>463987
                     /gene="CAR2"
                     /locus_tag="PVL30_004053"
                     /old_locus_tag="LELG_04331"
                     /product="ornithine aminotransferase"
                     /transcript_id="XM_001524309.2"
                     /db_xref="GeneID:5231526"
     CDS             462665..463987
                     /gene="CAR2"
                     /locus_tag="PVL30_004053"
                     /old_locus_tag="LELG_04331"
                     /codon_start=1
                     /transl_table=12
                     /product="ornithine aminotransferase"
                     /protein_id="XP_001524359.1"
                     /db_xref="GeneID:5231526"
                     /db_xref="PFAM:PF00155"
                     /db_xref="PFAM:PF00202"
                     /translation="MSTSPDFNISSQTAKDYESKYSAHNYHPLPVVFHKASGAHVWDP
                     EGKEYLDFLSAYSAVNQGHCHPKIIQALIDQAQTLTLSSRAFSSDVFGTYAKYITEFF
                     NYEMVLPMNTGAEAVETALKLARRWGYVKKGIPTDEAIILAAQNNFHGRTLGVISMST
                     DEDATTNFGPFLKNVGPKIPGAKDSENGVIRYGVIEDIEKSLQNAGDKVAAILLEPIQ
                     GEAGIVVPPSDYLPKVQQLCKKYNCLLICDEIQTGLARTGKMLCYQHSLSEDVKPDIV
                     LLGKAISGGVIPVSAVLSSKEIMSTLEPGSHGSTYGGNPLASRVAIAALQVLKDENLV
                     ERSQKLGDLLNSKLEELKSQSDGIISEVRGKGLLAAIVIDDKKTNGRTAWDLCLLMKD
                     HGVLAKPTHDNIIRLAPPLVISEEDLLKGVEAIRESLKQLPTAEKADH"
     gene            complement(<466183..>469125)
                     /gene="MPE1"
                     /locus_tag="PVL30_004054"
                     /old_locus_tag="LELG_04332"
                     /db_xref="GeneID:5231685"
     mRNA            complement(join(<466183..466204,466400..466468,
                     466736..466742,467850..>469125))
                     /gene="MPE1"
                     /locus_tag="PVL30_004054"
                     /old_locus_tag="LELG_04332"
                     /product="Protein mpe1"
                     /transcript_id="XM_001524310.2"
                     /db_xref="GeneID:5231685"
     CDS             complement(join(466183..466204,466400..466468,
                     466736..466742,467850..469125))
                     /gene="MPE1"
                     /locus_tag="PVL30_004054"
                     /old_locus_tag="LELG_04332"
                     /note="BUSCO:EOG0926357F"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein mpe1"
                     /protein_id="XP_001524360.2"
                     /db_xref="GeneID:5231685"
                     /db_xref="PFAM:PF00098"
                     /db_xref="PFAM:PF08783"
                     /db_xref="PFAM:PF13696"
                     /translation="MASVVYYRFLHQKNKSVIHFDGTAISVFDLKKEIIIQNQLGAGT
                     DFNLRLYHSEQPDLEYELDNDIISRSSYVLAKRSPASAKMGKFNNASRYITGKPRINR
                     KVFNNTNAASGTGALGASGGLSGAPSTVSAAQLGENATEEDRIKLMFENQSTAWAHTQ
                     DELAQHKMVYYKPTAAAAANSSGSNPEDKPPPGYICYRCGKKDHWIKNCPTNNDPNFE
                     GKKIMRTTGIPKSYLKTISREEVEKNSNLFTTNEHGDIIDKDGNAVLITEEGEYAIAM
                     ADSKTWMSYQEKLQNAAKKSKQEYESRLVASAEQENKFELLDSLSPTKRLLQPPIYMT
                     PCCTDASKLKKLKNFNHNQQELERVLIENDFHCPNCDKEDVYIDSLIQNKELEKQLQE
                     FKDAKEKELGINDPSKRPLTDISGNGGDVVDPDIIVDKIFQPQILDFNLYFVDENRHN
                     DLKSIMF"
     gene            <469433..>473041
                     /locus_tag="PVL30_004055"
                     /old_locus_tag="LELG_04333"
                     /db_xref="GeneID:5231715"
     mRNA            <469433..>473041
                     /locus_tag="PVL30_004055"
                     /old_locus_tag="LELG_04333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524311.2"
                     /db_xref="GeneID:5231715"
     CDS             469433..473041
                     /locus_tag="PVL30_004055"
                     /old_locus_tag="LELG_04333"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524361.2"
                     /db_xref="GeneID:5231715"
                     /db_xref="PFAM:PF11715"
                     /translation="MSATSVTYARSNVSGYASNLPTYNIRLPLKYSNTSSSPSTSSPL
                     PASSSSSTTTTSTTNSSSSALSNINSTITDPNDQFHQRLATAGRFLKFEKVSLFNTIS
                     CSILNDLKTIILTPIELKANSLGLKFQNLQLQLPNVVSSPNCVTFHNNQDYIWIDIID
                     SNYLLISLQIPIETFIENRKNLVLSNFDKWGKISVPYSFEMRSQPFSIKASDELNLFI
                     SLKDGGFLHFSRQTPISDVSVFVFNEPVSFIGGLFGGGKRNIEINGISSNAIVDFILF
                     GDGKVLTLSVSKELKIWNVSTHSLVKTTTLYNKSEHDMWLTRVPTKYLQVLDVDNFDA
                     ADTNNRKKLVTSFITTKNGESNKSRFAFKSWFYSENQLLEEVTKFEFQPELPNTLLSN
                     SDIFFHDSTFQNKIWFIQDYEVEFVEAKKYIKYHILWKSNTSSILAIYTLDFSNGSIV
                     SIDVSQPSSHTEEEAILQSRDSDFYATKIFASGDFDDLIVATSLTILAQHLKSTELIN
                     PLELRHFAETLIQTHSSKQRESPKHLWFKLYSLCEEFSKTSQEAFAIAPFNVTTAVTA
                     TTATSASTKTASTATAGSGGSGGSGGFGDTIGSTSSLICLQASGYTFLRPSSYYESIS
                     YKNLDSADGKLMQIFDKFRKTLSTKSYEKLHRQLVTSFNEFDGAASANEVFQTYLQGK
                     IDESEIQQILLKLGEIPDVLQIIQSLLFDNDFSLVVSSSSVSSLGSFAKLAVFKTFQN
                     IMQQHQDLLMDLIILLLVCEANDEIIKLLNSAVQSIRHYDTAELIFKTSFSSSSIEAP
                     VELSTVANVQNSLFWSVFVSKDKTLTKLIDSMQINAAFDYFFHEVLSPNQAYLTVAIQ
                     ELIVHNQGQYLRKDFLPKLDHNERFFTGIIRLITNDPQGFFNAFENYDEVMKFDFKSL
                     SLLKKDSNFKSFLEEFDDYPSKSEYFHALSLLCLAQIKTSSTHSAKDDHSFIEVALKL
                     EQLAIDNGTNDTIIESYYFNVFEQALTIADFKLVEKSLSKLSKTPELQSLLTKFIHKL
                     IQDSKIKLIFEWKEGYSDKDKDFYIQHYSMIDSIIHNFASQQSLFQSLKIYEYLYSWR
                     LLGCVTEGSDKLKTLAQSPTSHQPQLGDQRGAVEALYEFITRFKDETTTIEKRVKLKI
                     LELYMIVLNLMKTFSKDDQWLVRQLKDGREIVKMEHIEIECFEWMKNLDDDLSILS"
     gene            complement(<473183..>474791)
                     /gene="TAP42"
                     /locus_tag="PVL30_004056"
                     /old_locus_tag="LELG_04334"
                     /db_xref="GeneID:5231644"
     mRNA            complement(join(<473183..474285,474746..>474791))
                     /gene="TAP42"
                     /locus_tag="PVL30_004056"
                     /old_locus_tag="LELG_04334"
                     /product="Type 2A phosphatase-associated protein 42"
                     /transcript_id="XM_001524312.2"
                     /db_xref="GeneID:5231644"
     CDS             complement(join(473183..474285,474746..474791))
                     /gene="TAP42"
                     /locus_tag="PVL30_004056"
                     /old_locus_tag="LELG_04334"
                     /note="BUSCO:EOG092648LP"
                     /codon_start=1
                     /transl_table=12
                     /product="Type 2A phosphatase-associated protein 42"
                     /protein_id="XP_001524362.2"
                     /db_xref="GeneID:5231644"
                     /db_xref="PFAM:PF04177"
                     /translation="MKSDEIVFMVSIKCSLSERFSYALEEYENLSQRQDRHDSITFQT
                     HLSKLIGEFQIILRLIDSLSLFSENEPISELTTSYIPYLNTWYYLANLYTRLLLKEGV
                     GIAIDNKVGYLEQAKLFLIEFLTNVGNYEQLNKDQREKLGMLKRGEEIVQSPQLKRQE
                     KIENFRKEKDLKKKLETFKQLKSTGKSREADVDEEVIRKMYLDQVQLHILNSFNLADS
                     IAMELAVLSNRPKISEITQGANFEMARSQGIDDDRVRQQTDPTGFTTRVEQVPKSKAQ
                     ISDLISKQGKILQPFTITSNRREEMKQRVFGTGQVLPSMTVEEYLDYELANGKMMKEE
                     PKKSALSDDNDDDYDDDEDDEAQLEKRRWDDWKDDNPKGSGNTMGNIG"
     gene            <475050..>475454
                     /gene="toa2"
                     /locus_tag="PVL30_004057"
                     /old_locus_tag="LELG_04335"
                     /db_xref="GeneID:5231482"
     mRNA            <475050..>475454
                     /gene="toa2"
                     /locus_tag="PVL30_004057"
                     /old_locus_tag="LELG_04335"
                     /product="Transcription initiation factor IIA subunit 2"
                     /transcript_id="XM_001524313.1"
                     /db_xref="GeneID:5231482"
     CDS             475050..475454
                     /gene="toa2"
                     /locus_tag="PVL30_004057"
                     /old_locus_tag="LELG_04335"
                     /note="BUSCO:EOG09265ER6"
                     /codon_start=1
                     /transl_table=12
                     /product="Transcription initiation factor IIA subunit 2"
                     /protein_id="XP_001524363.2"
                     /db_xref="GeneID:5231482"
                     /db_xref="PFAM:PF02268"
                     /db_xref="PFAM:PF02751"
                     /translation="MSAPAYYELYRRSTIGVTLADALDTLISDEKIQPQLANRILNNF
                     DRIIAENLKNDANIAKSKLTFKGDLDTYRFCDDVWTFIIKNVIVKLSDVGGGSNSNSN
                     GNSNSNSNDNDLEINVDKFKIVACNSRKAGEL"
     gene            complement(<475751..>477133)
                     /gene="HRT2"
                     /locus_tag="PVL30_004058"
                     /old_locus_tag="LELG_04336"
                     /db_xref="GeneID:5231594"
     mRNA            complement(<475751..>477133)
                     /gene="HRT2"
                     /locus_tag="PVL30_004058"
                     /old_locus_tag="LELG_04336"
                     /product="Hairy/enhancer-of-split with YRPW motif protein
                     2"
                     /transcript_id="XM_001524314.2"
                     /db_xref="GeneID:5231594"
     CDS             complement(475751..477133)
                     /gene="HRT2"
                     /locus_tag="PVL30_004058"
                     /old_locus_tag="LELG_04336"
                     /codon_start=1
                     /transl_table=12
                     /product="Hairy/enhancer-of-split with YRPW motif protein
                     2"
                     /protein_id="XP_001524364.2"
                     /db_xref="GeneID:5231594"
                     /db_xref="PFAM:PF01937"
                     /translation="MSPLPPPYYNDDKRSFAYPTVHKRWPTIIQGAIDDVQQTIEDEG
                     QSHPEIRESGESILTQLKQLLSDFQNDLVVRPFTEEEIDLNENLTHFNTTLAKLNTQR
                     KVTWQTGPWLYLECYLYQFVNNMFIGSTAKFWHSFDVFYRLKTKTFKQSELGVLELCK
                     RYETLSKQLEKVQGDEETLYLLFTEFIDISLWGNATDLSLLAGNVTLEDIKSVQGAEV
                     RKQNEEKIIVNDLQKAWQKSGLKENVGQGSTRVDFILDNSGFELFADLILSLFLLDSQ
                     LAGEVHLHCKEIPWFVSDTMPKDFDDLLSQLDDHEFFAQIYKDDPKAIQLVSKKIHGY
                     FKENKIIINHHPFWTLDYNYWAIPQFKDLYTELQKSNLIIFKGDLNYRKLTGDLQWPK
                     TTPFSEAIQDLQNSGLTILSLRTCKADVCVGLPNGLNEKLIKEYEEAGNEIGEFWSSS
                     GKWAVISFNK"
     gene            complement(<478771..>479052)
                     /gene="NHP6"
                     /locus_tag="PVL30_004059"
                     /old_locus_tag="LELG_04337"
                     /db_xref="GeneID:5231668"
     mRNA            complement(<478771..>479052)
                     /gene="NHP6"
                     /locus_tag="PVL30_004059"
                     /old_locus_tag="LELG_04337"
                     /product="Non-histone chromosomal protein 6"
                     /transcript_id="XM_001524315.1"
                     /db_xref="GeneID:5231668"
     CDS             complement(478771..479052)
                     /gene="NHP6"
                     /locus_tag="PVL30_004059"
                     /old_locus_tag="LELG_04337"
                     /codon_start=1
                     /transl_table=12
                     /product="Non-histone chromosomal protein 6"
                     /protein_id="XP_001524365.1"
                     /db_xref="GeneID:5231668"
                     /db_xref="PFAM:PF00505"
                     /db_xref="PFAM:PF09011"
                     /translation="MAAAGERKKSSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPG
                     ITFGQVGKLLGEKWKALGSEDKVPYENKAEADKKRYEKEKAEYAKKNSV"
     gene            <482060..>483130
                     /gene="RXT2"
                     /locus_tag="PVL30_004060"
                     /old_locus_tag="LELG_04338"
                     /db_xref="GeneID:5231535"
     mRNA            <482060..>483130
                     /gene="RXT2"
                     /locus_tag="PVL30_004060"
                     /old_locus_tag="LELG_04338"
                     /product="histone deacetylase complex subunit Rxt2"
                     /transcript_id="XM_001524316.2"
                     /db_xref="GeneID:5231535"
     CDS             482060..483130
                     /gene="RXT2"
                     /locus_tag="PVL30_004060"
                     /old_locus_tag="LELG_04338"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase complex subunit Rxt2"
                     /protein_id="XP_001524366.2"
                     /db_xref="GeneID:5231535"
                     /db_xref="PFAM:PF08595"
                     /translation="MDSNSLEVITRFRDTVFAKRQQSAKDGGATSAPTFATNESASTA
                     EVLPFSNRGIKLLSQHPSLDVLKTKIVEYKGEPYSVLTNETIERNNRRSKRKWSDYYG
                     KKADYSDKEENEWSDEDNDDDEDNDDDRGEGRIHPLKTARIVELLSPLNHPSELVTHP
                     AISKTYKSQTLSKLAMELIDLIEIEQNNLNWLNKLLQVLNGEDWFYLLEENLGLKDYD
                     HGLNDDKKSSTSEERIGEDKEEKNSEQGQKKDALSADVTSTAEENNNNEYDDDDENSA
                     DPFFALPTAVKRFEAFHESLEPKDDDGGIKEELINYLQVSIQRQHEYIENLTQLRNGL
                     VRADRLKNDLHKWGQEMHDRKS"
     gene            complement(<483425..>484204)
                     /gene="POL30"
                     /locus_tag="PVL30_004061"
                     /old_locus_tag="LELG_04339"
                     /db_xref="GeneID:5231666"
     mRNA            complement(<483425..>484204)
                     /gene="POL30"
                     /locus_tag="PVL30_004061"
                     /old_locus_tag="LELG_04339"
                     /product="proliferating cell nuclear antigen"
                     /transcript_id="XM_001524317.2"
                     /db_xref="GeneID:5231666"
     CDS             complement(483425..484204)
                     /gene="POL30"
                     /locus_tag="PVL30_004061"
                     /old_locus_tag="LELG_04339"
                     /codon_start=1
                     /transl_table=12
                     /product="proliferating cell nuclear antigen"
                     /protein_id="XP_001524367.1"
                     /db_xref="GeneID:5231666"
                     /db_xref="PFAM:PF00705"
                     /db_xref="PFAM:PF02747"
                     /translation="MLEGKFDESTFLKKIVDAIKDSVKLCNFNCTEHGITVQAVDDSR
                     VLLVSLLVGQTAFSEYRCDRDVTLGIDLESFSKIIKCGQNEDYLTLLADENPDSVMTI
                     FEDKKRERVSEYNLKLMNIDSEFLKIDDMDYDSVINMPSAEFSKIVRDLKNLSESLNI
                     IVTKDSVKFTSEGETGSGSVVLKPYTDIEKPDESVSVHLDNPVDLTFGLKYLNDIVKG
                     ASLSSSITIKLADKTPALFEFKLAVGGYLRFYLAPKFDEDE"
     gene            complement(<485003..>485590)
                     /gene="naa30"
                     /locus_tag="PVL30_004062"
                     /old_locus_tag="LELG_04340"
                     /db_xref="GeneID:5231442"
     mRNA            complement(<485003..>485590)
                     /gene="naa30"
                     /locus_tag="PVL30_004062"
                     /old_locus_tag="LELG_04340"
                     /product="N-alpha-acetyltransferase 30"
                     /transcript_id="XM_001524318.1"
                     /db_xref="GeneID:5231442"
     CDS             complement(485003..485590)
                     /gene="naa30"
                     /locus_tag="PVL30_004062"
                     /old_locus_tag="LELG_04340"
                     /note="BUSCO:EOG092645LS"
                     /codon_start=1
                     /transl_table=12
                     /product="N-alpha-acetyltransferase 30"
                     /protein_id="XP_001524368.2"
                     /db_xref="GeneID:5231442"
                     /db_xref="PFAM:PF00583"
                     /db_xref="PFAM:PF08445"
                     /db_xref="PFAM:PF13302"
                     /db_xref="PFAM:PF13508"
                     /db_xref="PFAM:PF13673"
                     /translation="MISDNDESLIGGYRCRQFNIKSKDEFQQISNLISNHLSEPYSIY
                     VYWYFLNNWPQYTYVLLDQTDKGNDQEPSELSECDNNEQVIGVIISKVEPHREVRSRG
                     YIGMLVIDPKYRNKGLASGLVEMTINKMKQENVDEIMLETEVINKGALNLYESFGFLR
                     TKRLYKYYLSTHDAFRLILPLSDKAHTRIAFLPPL"
     gene            <487897..>488979
                     /gene="FBA1"
                     /locus_tag="PVL30_004063"
                     /old_locus_tag="LELG_04341"
                     /db_xref="GeneID:5231447"
     mRNA            <487897..>488979
                     /gene="FBA1"
                     /locus_tag="PVL30_004063"
                     /old_locus_tag="LELG_04341"
                     /product="Fructose-bisphosphate aldolase 1"
                     /transcript_id="XM_001524319.2"
                     /db_xref="GeneID:5231447"
     CDS             487897..488979
                     /gene="FBA1"
                     /locus_tag="PVL30_004063"
                     /old_locus_tag="LELG_04341"
                     /note="BUSCO:EOG092635YY"
                     /codon_start=1
                     /transl_table=12
                     /product="Fructose-bisphosphate aldolase 1"
                     /protein_id="XP_001524369.1"
                     /db_xref="GeneID:5231447"
                     /db_xref="PFAM:PF01116"
                     /translation="MAPPAVLQKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVV
                     AALEAARDNKAPIILQTSQGGAAYFAGKGVGNKNQEASIAGSIAAAHYIRAIAPIYGI
                     PVVLHTDHCAHKLLPWFDGMLKADEEWFEKSGTPLFSSHMLDLSEETDEENIGTCAKY
                     FEKMAKMGQWLEMEIGITGGEEDGVNNEHVQKESLYTLPETVFKVYESLSKISPNFSI
                     AAAFGNVHGVYKPGNVQLKPEILGDHQKYAKEQIGTDAKHPLYLVFHGGSGSSQQEFD
                     TAIKNGVVKVNLDTDCQYAYLTGIRDFILKNVDYLRSPVGNPEGDDKPNKKYFDPRVW
                     VRAGEQTMSKRIEEALEVFHTKNQLA"
     gene            complement(<489296..>489625)
                     /gene="TIM12"
                     /locus_tag="PVL30_004064"
                     /old_locus_tag="LELG_04342"
                     /db_xref="GeneID:5231758"
     mRNA            complement(<489296..>489625)
                     /gene="TIM12"
                     /locus_tag="PVL30_004064"
                     /old_locus_tag="LELG_04342"
                     /product="TIM22 complex subunit"
                     /transcript_id="XM_001524320.2"
                     /db_xref="GeneID:5231758"
     CDS             complement(489296..489625)
                     /gene="TIM12"
                     /locus_tag="PVL30_004064"
                     /old_locus_tag="LELG_04342"
                     /codon_start=1
                     /transl_table=12
                     /product="TIM22 complex subunit"
                     /protein_id="XP_001524370.2"
                     /db_xref="GeneID:5231758"
                     /db_xref="PFAM:PF02953"
                     /translation="MSLFLGSSSQYSYARVDPEKIRLATIQFQAMAATFNKVLSTCEA
                     KCLVHEYGEGELTKGESECIDRCVSKYVKANKVVGEQIQSQRVDPYNRMPAFIKVQQI
                     LSESRRS"
     gene            <490441..>492663
                     /gene="PBY1"
                     /locus_tag="PVL30_004065"
                     /old_locus_tag="LELG_04343"
                     /db_xref="GeneID:5231613"
     mRNA            <490441..>492663
                     /gene="PBY1"
                     /locus_tag="PVL30_004065"
                     /old_locus_tag="LELG_04343"
                     /product="putative tubulin--tyrosine ligase pby1"
                     /transcript_id="XM_001524321.2"
                     /db_xref="GeneID:5231613"
     CDS             490441..492663
                     /gene="PBY1"
                     /locus_tag="PVL30_004065"
                     /old_locus_tag="LELG_04343"
                     /codon_start=1
                     /transl_table=12
                     /product="putative tubulin--tyrosine ligase pby1"
                     /protein_id="XP_001524371.2"
                     /db_xref="GeneID:5231613"
                     /db_xref="PFAM:PF01975"
                     /db_xref="PFAM:PF03133"
                     /translation="MHVLLTNDDGPIDDNACPYMKYFVDEIKQATDWDISIVIPNQQR
                     SWIGKAHFAGKTLVATYIYPKNSTSTPNDQINAYEGPFDHPIAKYNDDPEYQEWCLIN
                     STPAACADIGIHHLYRHSKNKPVDLVISGPNFGKNSSNLYILASGTVGAAMEAVTHGV
                     KAIGLSYAFNNLDHDFYILKKAAQISVKLIERLYVQLQQNKDVDIFSVNVPLVPSLDL
                     EKTRIQYAPIFKNTWKSIYAPKPEPNDKGQLEFYWAPDFKQVYKDGLEDHAHTDSRVL
                     LNEGISVTPLKACFQTVDALVGEINLNDETNTPLSNPRGTSTGFENNTFLITIPKDSY
                     LYEPLVEPFKQLGYTISTDPKVIDDIGKNGKKDDDAVNDEKQSESLDQRVFHYGEYED
                     IDLDKLDNKNYFIPSYIYRKALIRKHYLANTVHHYITKHPESILKKAVPENYQLELDY
                     AEFLDDSLDDSYELRDAIEQGDSMWIVKPSMSDKGQGIGIFKTVQQLQNYFDSFDNDD
                     DDEEEEEEEEKVEHSEIKNEKESKKNGLILSHLRHFIVQKYISNPLLLPEYGRKKFHL
                     RTYVVAQGDLNVFVYKHILALFADQEYPDSTNQKDEEQIEMGGHLTNTCLQAESDILV
                     VPFWKLSGLNQTQKDQIYNQVLEITKEVYQAAASVDKLNFQPLENAVEFFGVDFLVDD
                     NLDVYLLEVNSYPDFKQTGEDLKDIITELFDATVKTVIHPMVTNTKINTTSESLCKVL
                     "
     gene            <497612..>498117
                     /locus_tag="PVL30_004066"
                     /db_xref="GeneID:85890389"
     mRNA            join(<497612..497668,497959..>498117)
                     /locus_tag="PVL30_004066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119515.1"
                     /db_xref="GeneID:85890389"
     CDS             join(497612..497668,497959..498117)
                     /locus_tag="PVL30_004066"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975498.1"
                     /db_xref="GeneID:85890389"
                     /translation="MRVGELDPWVISVRIDVTGVEFSKGTSGVLVRNGGVVSPVPRKP
                     KRSNHSLCGVGGVVPPVWNNELLFPDL"
     gene            <499260..>501572
                     /gene="DEF1"
                     /locus_tag="PVL30_004067"
                     /old_locus_tag="LELG_04345"
                     /db_xref="GeneID:5231753"
     mRNA            <499260..>501572
                     /gene="DEF1"
                     /locus_tag="PVL30_004067"
                     /old_locus_tag="LELG_04345"
                     /product="RNAPII degradation factor"
                     /transcript_id="XM_001524323.2"
                     /db_xref="GeneID:5231753"
     CDS             499260..501572
                     /gene="DEF1"
                     /locus_tag="PVL30_004067"
                     /old_locus_tag="LELG_04345"
                     /codon_start=1
                     /transl_table=12
                     /product="RNAPII degradation factor"
                     /protein_id="XP_001524373.2"
                     /db_xref="GeneID:5231753"
                     /db_xref="PFAM:PF02845"
                     /translation="MSTTQRKSFKNQSKRFNNETSGSTNSTNSNASPELTSLTEMFPD
                     WESDELNSLLQEKRNSLEVVIDLIVNNKVSKWEPIKKEKKEKKVKDDTDGFQANNTTS
                     STHSGSQSGKPFNKFKSSNKPPRKQGNVTKKPIKSTSDNNKPTTSTSNGAEKSKESSA
                     SGSWASALGEDTAKPATSKNTKPTTELEKAPEQDSNKDETPSESEQKQQEPQEQAEQK
                     PKTTASATTTSEPAPKPVLKEAVIPSLNQGSWASAITPKTKPKPKPKAVKTAPSPTQA
                     TEPAQQQQQQQQSEQSEQSEQPEQPQTSQADQNESVSKPEEPVVSESQTSAQEKTSEI
                     QEPVASAAASAAQAPASSSSAVEAGAQGPQVVLPTSSQGVNSVGISFGSLSLGEEEPK
                     DSHKDLREQFDQTQQKYEQPQEQPQPQQQQQQQAQAPAPSQQQQQQQQRYDLYEQQPQ
                     QSTNYQQQPQQPQQSQQSQQPQQQGQGQFGKHASQQSVPSQGQVPQQSQPTQQQYDYY
                     SQFQQQQYPQQAGQPGAQFGGYPAYDYSAFNQQAYAASPANAHAATTGSAAAYNQYAQ
                     QSVGAADSTQSPVSAQNVLQQQQAQQQQQQIPTPFGYPYYNYYYNNPYFGGAGGLGNN
                     GFASANTGSIGQQTQQGAQQASQQSNVPSATQPSGVSANGFGAQQQYYNPNQYSNRYP
                     GYSYPPQPQQQQQPGQQQHQQQPGQHAGQSATGSESDAAQQGQGQGQGQQSHPQSGAP
                     QQPVVPQYGAYQQYPQYGYQDTTQYRGGWY"
     gene            <502563..>506351
                     /gene="ATG11"
                     /locus_tag="PVL30_004068"
                     /old_locus_tag="LELG_04347"
                     /db_xref="GeneID:5231498"
     mRNA            <502563..>506351
                     /gene="ATG11"
                     /locus_tag="PVL30_004068"
                     /old_locus_tag="LELG_04347"
                     /product="oligomeric, coiled-coil, peripheral membrane
                     protein"
                     /transcript_id="XM_001524325.2"
                     /db_xref="GeneID:5231498"
     CDS             502563..506351
                     /gene="ATG11"
                     /locus_tag="PVL30_004068"
                     /old_locus_tag="LELG_04347"
                     /codon_start=1
                     /transl_table=12
                     /product="oligomeric, coiled-coil, peripheral membrane
                     protein"
                     /protein_id="XP_001524375.2"
                     /db_xref="GeneID:5231498"
                     /db_xref="PFAM:PF04108"
                     /db_xref="PFAM:PF10377"
                     /translation="MSTISYLTVYNAHNGVSIKIPKPIRFHSLGNFKEYLIQAFSIDG
                     VENLFLLSSFGIKVNFNHINETSDVLVFDKRLFADKIDQRVLQGYLSDSNYQNKRTKK
                     IDASPLRTETAATTTFETPSLSVANAVVNEQNLQGILRVYNNWARNLLDECNRIGEEC
                     SSLIKQINAIFQSLTSILQFAGKFIDDITQGFYHHYNYVKLLNYKNAHSHLSANFKTL
                     QQFPPVMVNGSHINLVDFIEYKSLKMSADHNSKHLPVVVKQFEDLKRVTKEVDDSRHR
                     VDQAIEELRGESIKKFKSLKSDELLQNVRSTVQSILEKSSELESTAIVQLKQFYSTQK
                     NQTSKALEEMAFQMQSNLNDLLDFRKRLTKEGPTLFRTIANIQLRMVNFRTAYKSLAE
                     EQRSEQIGRQADKQPSSANDSIKNIADIKIHDDRLTLVKDLPLIFGYCLIERRRQYEW
                     NDFFAKGIVDNVSEQLASIVDAENNARKLWNLRYGMEKLSIIKPRQQLRELLLQQQQQ
                     QQQQHQQQSSQYTVLSSRIPFVDISFSGKSNINVPILEGIDVQRDDILKYIQLIEESS
                     FGQTCAEQLRKRYSEMKASTETMKYITRGVSSLRHIKLSSPKTDGSGPGDGSRSDMNV
                     NAVEAEYTVVRELKSRINKLESLLHQYQYRNINSWPVTRNNSDNRMSLIVDSKQIASQ
                     TPLTDPTKLLSRNPSTSRNGGSQPSSAHSQEVQGAHGLESSSIDKHLDNIKLRKINSD
                     LKATNETLLKDIAVKDQEIAQLQLQIEDMKVSHNNKVNKLNQVIEDGEEKLRLQKLES
                     KLDKKEVENLESKVTAKNAQIRDLTDEKTAEANLVADLKHKLEQSTKLVSALRNELND
                     SSKMKNDLLSNMSSKEAEFALERNKYIEDIARWKAKFEEASDDYENLMELTQTKQLKH
                     ESVVDDLYKTSINFMTIIKFLVGKLYDNFRETCVILESMGLLLVKEDKIYKIKRVKGL
                     KSKKLSNGDLDPTSPSVHSTDNIPNSRVVEEIKAKLNWLDDLPLLQTSMPDSFYSSFG
                     IENGNDDKGIGTGDKTACNTDVGDQHLENAKKLRTAFDENFRLDAPSKLEEFLKVISF
                     SENVHLVDQHSTSTQFFVNAILKRFKDVEGFAKKISKDLKAKDQEINKFHSRTRNKIA
                     IKNFEVGDLLLFLPTKLENGSGANEDHNTNQPWAAFNVGSPHYFLKNGNGDGNGNNDE
                     VEKNPALNAKEWFIGRAKSIVEYRVTEDNFASFEANPFHLSIGVTWYMVEAEAERKSK
                     "
     gene            complement(<506570..>507538)
                     /gene="PRS4"
                     /locus_tag="PVL30_004069"
                     /old_locus_tag="LELG_04348"
                     /db_xref="GeneID:5231551"
     mRNA            complement(<506570..>507538)
                     /gene="PRS4"
                     /locus_tag="PVL30_004069"
                     /old_locus_tag="LELG_04348"
                     /product="ribose phosphate diphosphokinase subunit prs4"
                     /transcript_id="XM_001524326.2"
                     /db_xref="GeneID:5231551"
     CDS             complement(506570..507538)
                     /gene="PRS4"
                     /locus_tag="PVL30_004069"
                     /old_locus_tag="LELG_04348"
                     /codon_start=1
                     /transl_table=12
                     /product="ribose phosphate diphosphokinase subunit prs4"
                     /protein_id="XP_001524376.1"
                     /db_xref="GeneID:5231551"
                     /db_xref="PFAM:PF00156"
                     /db_xref="PFAM:PF13793"
                     /db_xref="PFAM:PF14572"
                     /translation="MHQRLPNSIKILAGNSHIDLCEKIAKRLGINIARVGAFQYTNTE
                     TAIAIGESVRDEDVYIVQTGCGEINDFLMELLFMINACRTASARRITAVIPNFPYARQ
                     DKKDKSRAPITAKLIANLLQTAGCDHVITMDLHASQIQGFFRVPVDNLYAEPIVLRYI
                     RENFNKDDIIMVSPDAGGAKRVASLADKLDVQFALIHKERQKANEISRMVLVGDVKDK
                     ICILVDDIADTCGTLCKAADILLDNGAKNVVCMVTHAIFSGNAIERLNNSRLDRVVAT
                     NSLPIEDKLAKCKKLEILDISPTLAEAIRRLHNGESVSYLFNNVPE"
     gene            complement(<507995..>509461)
                     /locus_tag="PVL30_004070"
                     /old_locus_tag="LELG_04349"
                     /db_xref="GeneID:5231612"
     mRNA            complement(<507995..>509461)
                     /locus_tag="PVL30_004070"
                     /old_locus_tag="LELG_04349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524327.2"
                     /db_xref="GeneID:5231612"
     CDS             complement(507995..509461)
                     /locus_tag="PVL30_004070"
                     /old_locus_tag="LELG_04349"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524377.2"
                     /db_xref="GeneID:5231612"
                     /db_xref="PFAM:PF01593"
                     /db_xref="PFAM:PF13450"
                     /translation="MEHKSVIIIGGGMSGIKTAIDLFHGGVEDTLILEARSRLGGRIL
                     SKESPSNNGVVYDLGASWFHDGLKNPLFEKSKKLGNIDYYFDDGKSAFYSATEDGIVE
                     SWKFDAVVDEFYTYSALTYESDPDKQDMSIKDMWKEYSSQFDDRLNENQRKHAPAVIR
                     MWTELWSGESWDQLSAKLSLERNSMHHLGRNIFIKSGYTKVLENELNELPESYRRASI
                     KLEAQVKKIDFSDPKRIKVQLSNGGKEYSCDYLVVTVPQTVLAITEKDDPQYIEWTPK
                     VPTPISESIKDLKFSSLGKVVLEFDECFWPKDFDRFYALTTNFPKVDVNDNGCSETII
                     EAWDFPALFLNFQAIHNVPALVILTQRPLSGYIEELLQRGHSDKVWHIYKPILEKIAK
                     NSQIPAPTNILCSPWNGEKYSRGSYGTSLVGAEDSAAIVEKFQQGFQNRIRFAGTETM
                     GDTSSGCVHGAWYSGQREAKAILKSMSSGEKEVSAESR"
     gene            complement(<510134..>513766)
                     /locus_tag="PVL30_004071"
                     /old_locus_tag="LELG_04350"
                     /db_xref="GeneID:5231296"
     mRNA            complement(<510134..>513766)
                     /locus_tag="PVL30_004071"
                     /old_locus_tag="LELG_04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524328.2"
                     /db_xref="GeneID:5231296"
     CDS             complement(510134..513766)
                     /locus_tag="PVL30_004071"
                     /old_locus_tag="LELG_04350"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524378.2"
                     /db_xref="GeneID:5231296"
                     /db_xref="PFAM:PF02257"
                     /translation="MSTPHRSHKRQKSSVSNPSLLFKQEQDQSQPQSSPPHPLPSLSH
                     FHAPQPTSTTENDPYSSFSLPSSNVGSNIQRPLPIREFQYEPSHSRTGSSLLKRGASI
                     AFNSTAETPPLPIPATTTTTAQYSQQSQQQSQSQSQQQTATTYYYSYGHTDSSEQFAT
                     SAPPTSSSSTAVAQGYQQSHLQQSTMVPIYGAPLLPTSNIGGQVTSSLAYNVFPSTTA
                     YTPIENFQQQQQQQQQQQTQPGNVSIYSQPFSTSSSTVGSKFQPASTFSASTAPSSSV
                     PAVPTVPPHLLGSSNTGTNANSSIISAGVSNAVSSPSRHQKNNLSISSHLTLFSLNSN
                     NTPADTLDYQKRAIGADTTLVLNDLLHSLIGVDGSNINNFLLTILYKINLPFPLDDFY
                     NLLYNSDRQRPYISNFNFHSKLDRTPVSPSSTEISVYVINSILNTFKNPTSLNEIFPT
                     QEEKENKLVNINYHELLRTFLAIKILNDIMIQLPLSADEDPQNYFIPRLSIYKTYFII
                     CHKLIASYPSSSNTTNEQQKLILGQSKLGKLIKLVYPNLLIKRLGSRGESKYNYLGVV
                     WNENIINDAMKQLCDQHDISDLNEIFSSEQSGINKPNPFMPAPLGAPPADVIPLLNTP
                     RKGSRGSGGSGGGQGSHGGGGGGGGRQGSHGGGGHRRSISKQRTRSGDIGIPETILSE
                     GPVIAHDPKDIPDLTNKDKSATYPITSPRLSFVKPFLMYPSETTFTVLSRHSEGENWF
                     QTLLDQLYTKSSAFNRDLIQSILLNNSNLHTSSSILRNLLDSVILPLIYKRNDDTNTE
                     YTERQHEKLDLMLYLIIILEVLPHLLLIKASADINLLKNLRLNLLHLINNFNVEVRNI
                     NSHLFPSSNSTIFLIILKKLINLNDLLITFIKLISKKSSRSLMLSDIENFLKMSSQTM
                     KFEDNSTNNNPSNFFFNLNTTSMGEVNFNFKNDILSNDLIYTLIGYNYDPKVNDELKS
                     SISMNFINDEINIVDEFFKNDLLMFLTSDYDYGDDSESHRRRESQALHEETETEETQA
                     DTLPFQTGVSLNAPTSQDSSSAETVLTIAEMNKLNSLIGLIDKKLLSTHFKSRYPILI
                     YNNYIAYILNDILKYIFLKQQQSQLQSQQQQQQHWKRSNEHMGGSGSSSGVGGVGSSS
                     GGGSGGNGGDGGNSSTDPHGSSQQQSGHGGGENSFGNWWVFNSFIQEYMSLMGEIVGL
                     RDCINQ"
     gene            complement(<520762..>522672)
                     /gene="CAT2"
                     /locus_tag="PVL30_004072"
                     /old_locus_tag="LELG_04352"
                     /db_xref="GeneID:5231356"
     mRNA            complement(<520762..>522672)
                     /gene="CAT2"
                     /locus_tag="PVL30_004072"
                     /old_locus_tag="LELG_04352"
                     /product="Carnitine O-acetyltransferase mitochondrial"
                     /transcript_id="XM_001524330.1"
                     /db_xref="GeneID:5231356"
     CDS             complement(520762..522672)
                     /gene="CAT2"
                     /locus_tag="PVL30_004072"
                     /old_locus_tag="LELG_04352"
                     /codon_start=1
                     /transl_table=12
                     /product="Carnitine O-acetyltransferase mitochondrial"
                     /protein_id="XP_001524380.2"
                     /db_xref="GeneID:5231356"
                     /db_xref="PFAM:PF00755"
                     /translation="MLKLGFTKAQISTHLSKSQQIKSIVMPILQQTKPLSSSSARGET
                     YKLQSQLPKLPVPELQETASKYIKTIEPFLNPQQLAASKAKVEEFIQPGGVGEELQQR
                     LNAFAKGKDNWLAEFWDDYAYMSYRDPVVPFVSYFFSHKDVRNIIGEDQLLKATLIAY
                     YTIEFAEKVQTEVLEPEVIKGNPFCMNAFKYMFNNSRVPAPGSDVTQHYDVDSNRFFI
                     VIYKNNFYKVPTHNESGQRLSKGEIYSYLQQVKNDPSQQGIALGALTSLNRDEWLSAY
                     QNLLKSPINEASLTDIFASTFVICLDENTPITIEEKSKNCWHGNGQNRWFDKPLEFFV
                     SANGNSGFLGEHSRMDATPTVQMNNTILKQISETKPEELIAEIGSVAPKVGPADKLSF
                     DINPTTRANIASAIVKFDETIAAHDEEIFQHYGYGKGLIKKFKCSPDAYVQMLMQLAY
                     YKLTGKVRPTYESAATRKFLKGRTETGRTVSNESKKFVETWTDPNSSIEDKVATFQAA
                     TKQHVAYLSAAADGKGVDRHLFGLKSMLKPGEPVPEIFQDPIFAYSQTWYISSSQVPS
                     EFFQSWGWSQVIDDGFGLAYLINNDWIHVHISCKRGNGLKSDQLKWFLVDSANQMQDV
                     LVKGLLGDKAKL"
     gene            <525136..>526885
                     /gene="HSX11"
                     /locus_tag="PVL30_004073"
                     /old_locus_tag="LELG_04353"
                     /db_xref="GeneID:5231678"
     mRNA            join(<525136..525144,525299..>526885)
                     /gene="HSX11"
                     /locus_tag="PVL30_004073"
                     /old_locus_tag="LELG_04353"
                     /product="Ceramide glucosyltransferase"
                     /transcript_id="XM_061119516.1"
                     /db_xref="GeneID:5231678"
     CDS             join(525136..525144,525299..526885)
                     /gene="HSX11"
                     /locus_tag="PVL30_004073"
                     /old_locus_tag="LELG_04353"
                     /note="CAZy:GT21"
                     /codon_start=1
                     /transl_table=12
                     /product="Ceramide glucosyltransferase"
                     /protein_id="XP_060975499.1"
                     /db_xref="GeneID:5231678"
                     /translation="MAATKSKIVEEAEAQAEEAEAEEDGKDINSNDTDLLTCEGVTII
                     RPIKGIDPELGSCLESSFVQNYPFSKLQILFCVDNPNDPSLPIIRKLIRRYPTIDAEI
                     LISENYNAQAQVSQDHFGPNPKVNNLAKGFLKAKYDILWVMDSNVWASSNILKNSVIT
                     LNSNLNNGRKVSDQRPVKLVHHVPLAVCTDSNTDESGDFLALDELENRVTPTASDEES
                     ETPQNVSYLTNRKPTPPPSSPSLAPPSSSSSKPSKFYSRAKKLGAKLDEMFLHTSHSK
                     FYVSLNNLSIAPCVNGKSNIYRKSDLDQSVKLIPYKDSEFFRDPKVKRDAYEYTSSAI
                     SGNSIKFFARYIGEDNMIGIALWENCNGRTGLTGDIVVQPLNPENNSIRDYIQRRVRW
                     LRVRKYMVLLATLIEPTTESLVCGVYGTYAVSTLFLHQWFSIKWFMMHMIIWLLTDYV
                     QYNVLMSHVKDSSNNNIAYLPQWMNRVGFAKQARGFASWLYVWCLREMLALPIWAIAM
                     IGHEIDWRGAPFRIKKDLTAEEL"
     gene            <529952..>534202
                     /gene="RGA2"
                     /locus_tag="PVL30_004074"
                     /old_locus_tag="LELG_04354"
                     /db_xref="GeneID:5231316"
     mRNA            <529952..>534202
                     /gene="RGA2"
                     /locus_tag="PVL30_004074"
                     /old_locus_tag="LELG_04354"
                     /product="Rho-type gtpase-activating protein"
                     /transcript_id="XM_001524332.1"
                     /db_xref="GeneID:5231316"
     CDS             529952..534202
                     /gene="RGA2"
                     /locus_tag="PVL30_004074"
                     /old_locus_tag="LELG_04354"
                     /codon_start=1
                     /transl_table=12
                     /product="Rho-type gtpase-activating protein"
                     /protein_id="XP_001524382.2"
                     /db_xref="GeneID:5231316"
                     /db_xref="PFAM:PF00412"
                     /db_xref="PFAM:PF00620"
                     /translation="MSQVLPKSASRSSIYPQPHHSSSSSSPPQPPPPPPTDAENLPSI
                     SSPDTSRSREVCKKCSNLISEGHAYELGEDRWHIDCFNCSKCNTSLGCNSNFLVLGNG
                     NLICSNCSYNCKQCGRKIDDLAILTGDQAYCSNCFKCRSCKNKIEDLRYARTSKGLFC
                     MDCHEKLMAKKKKYDARKKHLALLQQKQKQLEKEKDARESQILEEHKRLSANSSRNSL
                     IQSYMLQNYNDSTTSFYKQENGSTNSVTSHKNKSLPVPPTTSSRSPKTMESPNNNSDK
                     NMENNSDKNNTNSNSESSLQQPSYLQSSYHSQETILKSSPNTNYVLEAPKRKLPPVDN
                     DFSIEEVQNSSDSENEDKQTPTGNMSATLRNRSSNSRPTTSQSTPLTTADYEDEFKTP
                     NMDSSSSDRDQKLYLDIVTTPSEEVTSSSNQLKPAADVIPRKGSKSSYSSEKIETQSQ
                     SSSNQGRPQLESSNSNSNSNSNSNLAVETRGKNLLLFSPNQFHDNEFHNTTIRSPMVD
                     SPGTLLSRNSSIHGNDNTKLQALNFEESRPVSTSPFAKANRQARVVETNDEISTDIIA
                     GDDEIIPQVISTPRSKSKPENTIQLSSPPPKVPLPSTPVRRKEVAPASNRPKFEESAH
                     QGLGLEGVKYGGHDHENEGSEGIAIKKPRDKDLDDSDNRGSNKYKEIAQTHPGQIYDQ
                     QQQQQQQQQQQQQQQQPHHHRNYSGSNTPIVQTPSSLNMGSQRIIKNATPSVTNLENS
                     PTPDGEHLHQSQQEQQQQQQQQQQAKESSVSRTTSIIRNLKHKRSTSGNSSTKFGFFK
                     SPREESLKSQGGHVRRTSDASVASNVFNNYFNPATFNNNGHSPNSHVRSTSDSTTMFA
                     SENDFFDVKSLKQELSKLSSEKFIMDQEFKKLKNEKSKLTDQLKSIQSQITMESIRYD
                     NLVTEIKDLEEHKLKLVDDTKNLEECKLKLVDENKELSAQGRALESANSERSVSNDSI
                     SYDSTTITNSSSMSSTSPLKGALHPQQHHHHHHSHQQHHHPQQQQSSQQQQQQQQQQQ
                     QYNPQRELRNPVQQNQQHLQNAHRNSFYQQNIPQESPQKPSQLNGQPDQNAQAQEMQP
                     PPVEEEQTHKATRLKFWRRPKNTTPQVVTTNSTDNNSNNSNNMNNSNNQSRIPNSFSS
                     QALRIPLNGLNYNNASGQAYGNSKFSKSTSSNILDTLLNGGGSDSNNNNNNNNNHNSN
                     NGKDGHVPPLFNSSIQSRAQFENSSIPFIITRCLKEVEDRGMDFEGIYRVSGGNSAVV
                     AIENAFSNLHTQSANLDEKQLNKLESLLSDGDIHAVTTALKRYLRKLPDPVVPYALYD
                     EFINIGQSSPDARLPELTQFLRKLPPANQSTLRELCAHLQKVNDMNHLNRMGFKNLSV
                     VFAPTLARDESGEREMTDMGHRNDLTELLLRESNQIFT"
     gene            complement(<534492..>534731)
                     /locus_tag="PVL30_004075"
                     /old_locus_tag="LELG_04355"
                     /db_xref="GeneID:5231399"
     mRNA            complement(<534492..>534731)
                     /locus_tag="PVL30_004075"
                     /old_locus_tag="LELG_04355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524333.1"
                     /db_xref="GeneID:5231399"
     CDS             complement(534492..534731)
                     /locus_tag="PVL30_004075"
                     /old_locus_tag="LELG_04355"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524383.2"
                     /db_xref="GeneID:5231399"
                     /db_xref="PFAM:PF05347"
                     /translation="MARRLSGLQRDVLSLYKQCMKVTYTKPRATQHHWRNYLREEFHK
                     YLHLPKKQFSTIEHLLRTGNRKLEMFSNPQIKDIH"
     gene            <536503..>540876
                     /locus_tag="PVL30_004076"
                     /old_locus_tag="LELG_04357"
                     /db_xref="GeneID:5231313"
     mRNA            <536503..>540876
                     /locus_tag="PVL30_004076"
                     /old_locus_tag="LELG_04357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524335.2"
                     /db_xref="GeneID:5231313"
     CDS             536503..540876
                     /locus_tag="PVL30_004076"
                     /old_locus_tag="LELG_04357"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524385.2"
                     /db_xref="GeneID:5231313"
                     /db_xref="PFAM:PF13638"
                     /translation="MSTYETTTDNYNEQYSSGNIIQGDIDFNLYSDSEPHFRGDSISN
                     VMNDVKNDSGEKDGFGVSGGGGGGGGGTAGDIDLRGTKFQSQVIYNQQKLHHSHFICQ
                     HHQHRRSYIAHIDRERKYKVHTHHANHLLNTPPLYKIKTFDRPSSTDYSSIGNHNAII
                     DLDLDFDIDIDLITNNKDKNHRKYHNGNIVLPATTSTNTTVLPSQMANTMRKNVFQHT
                     KTPTPSAYEVPSSPNIHNALHLSTTNQNHSDSSDSCPPDSRPEILSSTNPSTLQTPQR
                     QQMSSQQQQQQQQQRPYSSQTQQQQQQQQQQQQQQQQSQDQPSLQQRTMSDEEQQLAT
                     KLKETYKNIVNYEEVVQKNCIEITIKINQITTNPNPSLVYGSQVVNQNIANSLTSNSS
                     LASNSTRTSELSNDLWTVYHHNVALLDNYYDFLITSLKPSSNQTQFKTGKNIVELYKI
                     PRRMWVYGIVGFLEVLKNIMGIFQDHEICSCFISHCFNIISNLTDPILEMEGWWAEKL
                     GDLSRMAIALYSTKSIDWKISAEYWYSVSMRTLYGHGKIYYHMCTVQQDNLDALVNIS
                     KSVACRDPFVPTQHYLRLVVENICTQRNILSLLELPIIDFIKIHKVLLSIYNGRNSEG
                     TSVENIHDSQLQYGIDLVTRYGLTFGSDSNGYNFFTREMYSASGANINVGATSGGIDP
                     HNPYYQKLPQHLAHTTSLGVGGVGSSGVGGIGGAGGLGGIGAPPAMMAPSASNTLEKM
                     NFWFNKGSLFALSNINHLIGFGDAKNPFAKLFELPEALKERKDKKDRKRKTRSVSQSE
                     EAMLSNLGSTSGIDGQSITASQLHIHDWFHSLQYINKSVLELSMRILNHYLVGPKQAS
                     TSHVIVWLYFLISLGEATKKYTIAQPMIQWLLKTLFPWESLINYLNSLLAFIKNSPKL
                     CALYTHYLQLPYVSWFCENEFLPEVWKCWGTLWFDFINVKSDYTDLEEAGLKNNNIFD
                     YPICGTYPVVNMPSDNYNEKSKNKLETDNDERIVRITLLARTIADDYGFGLVRANSEF
                     KFDEQVYMKPSNDSFADSFVTDVRFTQNGFMQPISAENLTMYANNTLTSLQKDELWFG
                     GLDSHLYEDENLELEDDIIEDGLEGVEDDEIIPYEDEYGNISSSNQQPFQPQSSYHNH
                     QSQNQNQSQSQSQSQSQSQSQNHTNQGPHHHRGSSAIGVAVNDFYNDSFIGTPTDPLG
                     NLNNDEIEGNFGDKIDSNITYITLDTNIWLKHCGRIFKCVRNGVIKITIPLIVFQELR
                     ALRKSAEATIADAATRSVIIIRELYLTREIVPLRFDGTVASDINETIEFENNSNWRTN
                     VDETILHAVNEYDDLGKRTMKGLNLKLSPFTRKTIGSHANTSANSSRSFAQYIGGEPY
                     SIHDGYNNYSHSSFKSESNNQFNEPPVLNSRMAKLFKYCILVTDDRNMRLRAKTIGLT
                     SFQSKWLFSQLETVFSDRCID"
     gene            <544352..>546112
                     /locus_tag="PVL30_004077"
                     /old_locus_tag="LELG_05726"
                     /db_xref="GeneID:85890390"
     mRNA            <544352..>546112
                     /locus_tag="PVL30_004077"
                     /old_locus_tag="LELG_05726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119517.1"
                     /db_xref="GeneID:85890390"
     CDS             544352..546112
                     /locus_tag="PVL30_004077"
                     /old_locus_tag="LELG_05726"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975500.1"
                     /db_xref="GeneID:85890390"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPTSRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKKYLRITN
                     TSHLAQETWISIFKTLFERMGSVMDQIIMYMTPEVKIEKPGRTGPIVTFEDASIIKIG
                     LGLLKNKPNDKIIQGVKSYDLTFERIWDAVNATFQTRMHLISDDEEKDAGTTSVSKGD
                     KSQKTTKCNFCGKYRHTVDSCHLLVTALDEKLVKKVDGKYYLANGEPLVMDFYKCPLL
                     KHSSLKSLSSNARHRTPPTK"
     gene            <552073..>552798
                     /gene="DAG7_1"
                     /locus_tag="PVL30_004078"
                     /old_locus_tag="LELG_04358"
                     /db_xref="GeneID:5231508"
     mRNA            <552073..>552798
                     /gene="DAG7_1"
                     /locus_tag="PVL30_004078"
                     /old_locus_tag="LELG_04358"
                     /product="Lytic transglycosylase"
                     /transcript_id="XM_001524336.2"
                     /db_xref="GeneID:5231508"
     CDS             552073..552798
                     /gene="DAG7_1"
                     /locus_tag="PVL30_004078"
                     /old_locus_tag="LELG_04358"
                     /codon_start=1
                     /transl_table=12
                     /product="Lytic transglycosylase"
                     /protein_id="XP_001524386.2"
                     /db_xref="GeneID:5231508"
                     /db_xref="PFAM:PF03330"
                     /translation="MRTSTLALTLAGLLTSLVQAAPAPGVVIVTAYTTVIVDESGLTI
                     TPSAQTENAQAEYTRVPAVQIQSSSKDDEPTLAIASTSSNQEQSLQPTTSTATSTSST
                     EFTPSSVSTSPTSSSSSTSSTSSTSSTSSSQATGSLQSGEGTYYSTGLGSCGITSSDT
                     DYIIAVSHEMYDQYTPNGNPNKNTLCGKKVRAFYGDNSVDVTVVDRCEACSYNDLDFS
                     PSAFSQLASQSLGRIDITWEWLD"
     gene            <553941..>554666
                     /gene="DAG7_2"
                     /locus_tag="PVL30_004079"
                     /db_xref="GeneID:85890391"
     mRNA            <553941..>554666
                     /gene="DAG7_2"
                     /locus_tag="PVL30_004079"
                     /product="Lytic transglycosylase"
                     /transcript_id="XM_061119518.1"
                     /db_xref="GeneID:85890391"
     CDS             553941..554666
                     /gene="DAG7_2"
                     /locus_tag="PVL30_004079"
                     /codon_start=1
                     /transl_table=12
                     /product="Lytic transglycosylase"
                     /protein_id="XP_060975501.1"
                     /db_xref="GeneID:85890391"
                     /db_xref="PFAM:PF03330"
                     /translation="MKYTSILLATLLAIYVSASPQVIVVYKTVYVDKNGNRVGPPSSL
                     RSTSTSSRAIPTFTTTTTIDISKPTNKPQQQLNPQQISEPEESQVKQEPPFASEPEPE
                     SVPAPEPEPESVPQPAPALALALEPEPEPKPEQQGQTFSGDATYYSTGLGACGIVNTD
                     SDYIIAISHEMYDQHTPDGNPNHNTLCGKKIKAFRNGKSIDVTVVDRCEGCAYNDLDF
                     SPAAFKQLADFEEGRVRITWKWL"
     gene            <555685..>556446
                     /gene="DAG7_3"
                     /locus_tag="PVL30_004080"
                     /old_locus_tag="LELG_04359"
                     /db_xref="GeneID:5231629"
     mRNA            <555685..>556446
                     /gene="DAG7_3"
                     /locus_tag="PVL30_004080"
                     /old_locus_tag="LELG_04359"
                     /product="Lytic transglycosylase"
                     /transcript_id="XM_001524337.2"
                     /db_xref="GeneID:5231629"
     CDS             555685..556446
                     /gene="DAG7_3"
                     /locus_tag="PVL30_004080"
                     /old_locus_tag="LELG_04359"
                     /codon_start=1
                     /transl_table=12
                     /product="Lytic transglycosylase"
                     /protein_id="XP_001524387.2"
                     /db_xref="GeneID:5231629"
                     /db_xref="PFAM:PF03330"
                     /translation="MKVSTILQAIAMFQLTTATSLWSLISDKANLPKQVDDLKNCAGS
                     VAAAAANKLSPKKLFPTDAAAAAATTTTTAATAITTNGTIKEIPTIYRTTTIEVFTSE
                     EVAENKQASATLPSDNSGNNNFDDKTPKETSTPPANNITPEPTKGTYTGEGTFYSTGL
                     GACGGRNKDSDYIVALSENFYKEYTPGNNPNKNTLCGKKLRAFYNGKSVDVTVVDCCV
                     GCGYYDLDFSPAAFRQLADQKLGRIQVTWSWLEVA"
     gene            complement(<556992..>558287)
                     /locus_tag="PVL30_004081"
                     /old_locus_tag="LELG_04360"
                     /db_xref="GeneID:5231675"
     mRNA            complement(<556992..>558287)
                     /locus_tag="PVL30_004081"
                     /old_locus_tag="LELG_04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524338.2"
                     /db_xref="GeneID:5231675"
     CDS             complement(556992..558287)
                     /locus_tag="PVL30_004081"
                     /old_locus_tag="LELG_04360"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524388.2"
                     /db_xref="GeneID:5231675"
                     /db_xref="PFAM:PF06687"
                     /translation="MIFACFRVILIFFSVACLILSCFAITGSYKNENYLTSTYLINFH
                     LDGLDLRQIISTSVGSGSNKIKKRAQDTEATATATATPTTTTGGLQLPSQVNSWIGVA
                     TSYINQPGFSSEVAGLATSLGTSIPSSISIPASISLPSGISLPSDLSIPTDASDLTAA
                     IADVLNNVSPQELGIADVYSTSFWGYCRGEKVGNGSEPFDNSLGHWIDKNFDNSNVNY
                     TWCSPPKAGFFFDPLEIFKQEMNRTIDDISVDTQSQQINQLSQQYKTELKLLIDNLSA
                     SDLNLPGNLQNDLTLLNNLTTASFALMLITAALSFISIVVQLMACCISPDNCCLSFLN
                     FMFQVLIFLASIIAAGLVTGCYVFVRRKVNDDLGEFGIKSFLSINFYAFAFSAAAAAL
                     LVVIFSLLGHCCGMFGSGKRRYRTVQQAPAYEHSSYEEK"
     gene            complement(<561041..>562756)
                     /gene="AGP2"
                     /locus_tag="PVL30_004082"
                     /old_locus_tag="LELG_04361"
                     /db_xref="GeneID:5231690"
     mRNA            complement(<561041..>562756)
                     /gene="AGP2"
                     /locus_tag="PVL30_004082"
                     /old_locus_tag="LELG_04361"
                     /product="general amino acid permease agp2"
                     /transcript_id="XM_001524339.2"
                     /db_xref="GeneID:5231690"
     CDS             complement(561041..562756)
                     /gene="AGP2"
                     /locus_tag="PVL30_004082"
                     /old_locus_tag="LELG_04361"
                     /codon_start=1
                     /transl_table=12
                     /product="general amino acid permease agp2"
                     /protein_id="XP_001524389.2"
                     /db_xref="GeneID:5231690"
                     /db_xref="PFAM:PF00324"
                     /db_xref="PFAM:PF13520"
                     /translation="MWFSKGSNRPFSKDTKSEVQDGADPATKETFVDSVSTTSNSDQS
                     TKVENRTHRKLLPRHISLIAIGGSIGTGVFVTIGTTGLVNGGPLGLLLSYCLSTTLIM
                     LLTTAMGELVCYMPTDSPFLDMAGRVIDPAFEVASSVNFWVMQSLYIPFEITAVNGMI
                     HFWRDDYSPAITLSIQIFIYAAINLYAVKVFGECEFWFSLFKLILCIGLLFFTLVTMC
                     GGNPKGDAFGFRNWHVAGGPMGMMYTTGALGRFQGFLGSLRMSSSFTCVGSEYLSMTA
                     GEAINPRHTLPVAFRTVLYRLVIFYVGSALCVSILIAYNDPRYLSLTSESSNGASSPY
                     VVAMENLGIHVLPHIVNAVILTSAFSAGCSYTYTSSRCLYNLAKKGFVPKFLEKCTKQ
                     GVPIYCVLASVCFSLLSLMQLGSSSSKALNYMVNLCTGSQVLNYGFMCITYIGFYHAC
                     KAQNIDRNKLTYKSWFQPYSIYFVTVMYWCIIGILGYHVFMPGHWSVDDFLFSYVMIF
                     VSLAVYILWKVIKKTKFIRPADADLISGLDEIEAHEFEYKAMKEKNEDKAVTSKFKGL
                     ANWIF"
     gene            complement(<567851..>569521)
                     /gene="ASK1"
                     /locus_tag="PVL30_004083"
                     /old_locus_tag="LELG_04362"
                     /db_xref="GeneID:5231398"
     mRNA            complement(<567851..>569521)
                     /gene="ASK1"
                     /locus_tag="PVL30_004083"
                     /old_locus_tag="LELG_04362"
                     /product="DASH complex subunit ask1"
                     /transcript_id="XM_001524340.2"
                     /db_xref="GeneID:5231398"
     CDS             complement(567851..569521)
                     /gene="ASK1"
                     /locus_tag="PVL30_004083"
                     /old_locus_tag="LELG_04362"
                     /codon_start=1
                     /transl_table=12
                     /product="DASH complex subunit ask1"
                     /protein_id="XP_001524390.2"
                     /db_xref="GeneID:5231398"
                     /db_xref="PFAM:PF08655"
                     /translation="MKRLSIAPGSVRRTSKILSEDQKAREILEQLDQDTTIVLQDIDR
                     KLSRANAILNDLIKPTISEYMKESSKIKQSTGFWKKFFESSANVVLDTYEAPIVEVNA
                     NTDLINALEQKEAHDELKAIGETQELRNAHLKRVLDEETPTWSTEQDSSRKPTSSTPQ
                     KHTSTSTSSQQQHHHQNQNQRTRFNLDNDVPKLSDNVNLQHPSRLGSSWQSPRRKEDH
                     AKGSPVRISTIRQSLDAYQRVSISPRKSRTPISGRSAVLQTILNSSPTFPEPPVLKSD
                     LPSEPSRLTITSPHPSSDAGGGGGGGEPHLRKFPNTPKYTGTRSGSLHNTPILDAVTR
                     DDEGENDLQPPQLGSSSQLHESGRGSGPSSGLSSGSNLLSSSSSDEPLPALNTIELSG
                     SSNSNSISSSKARRSKRRSSEDVNRDSLKRRRTLDDDEDNVFLDREHSRSLLSPRVMR
                     DEQQGADHHDNEHVNDLDDNADEDNNNNNNNSSSNTQNKSFSQVYTEEISKVRDVQGA
                     GTSNTETNIVPVEDVTSENTLKSLKDITEGSTDELGPFKERWKYYASL"
     gene            <569988..>570248
                     /gene="MDM35"
                     /locus_tag="PVL30_004084"
                     /old_locus_tag="LELG_04363"
                     /db_xref="GeneID:5231378"
     mRNA            <569988..>570248
                     /gene="MDM35"
                     /locus_tag="PVL30_004084"
                     /old_locus_tag="LELG_04363"
                     /product="Mitochondrial distribution and morphology
                     protein 35"
                     /transcript_id="XM_001524341.2"
                     /db_xref="GeneID:5231378"
     CDS             569988..570248
                     /gene="MDM35"
                     /locus_tag="PVL30_004084"
                     /old_locus_tag="LELG_04363"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial distribution and morphology
                     protein 35"
                     /protein_id="XP_001524391.2"
                     /db_xref="GeneID:5231378"
                     /db_xref="PFAM:PF05254"
                     /translation="MSVSFAPECTPAKKEYDDCFNKWYTEKFLKGKSIENECTEFWDN
                     YIECININLAKQGIKPMLDKAREDQPFSHEEMQESLKESEKK"
     gene            <570957..>571745
                     /locus_tag="PVL30_004085"
                     /old_locus_tag="LELG_04364"
                     /db_xref="GeneID:5231324"
     mRNA            <570957..>571745
                     /locus_tag="PVL30_004085"
                     /old_locus_tag="LELG_04364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524342.2"
                     /db_xref="GeneID:5231324"
     CDS             570957..571745
                     /locus_tag="PVL30_004085"
                     /old_locus_tag="LELG_04364"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524392.2"
                     /db_xref="GeneID:5231324"
                     /translation="MLVEEIPKSSNANSTTVYFSSSINLTARPIGARFNSSFNNNSNI
                     KSSSSISSSSNGSSGGGGGSGPTSTNPKGRAKVNYNLNQLFNAQTQTKAQRDSGPSKS
                     AQQIQLERAVQKRLTELNQESIGKSFELPKNFQYNSIHSSGDNNRNNMSHKSRLGNTP
                     ATKRILAARRNLNSYYDEERNILIINTILTSNYQFIDYDEGNNTNNNTGKGNIKKQKL
                     GNSRPKLRICCVCGSKSNYARCSACGLYYCCVRCNNLHLESRCA"
     gene            <571793..>573007
                     /locus_tag="PVL30_004086"
                     /old_locus_tag="LELG_04365"
                     /db_xref="GeneID:5231650"
     mRNA            join(<571793..571798,572093..>573007)
                     /locus_tag="PVL30_004086"
                     /old_locus_tag="LELG_04365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524343.2"
                     /db_xref="GeneID:5231650"
     CDS             join(571793..571798,572093..573007)
                     /locus_tag="PVL30_004086"
                     /old_locus_tag="LELG_04365"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524393.2"
                     /db_xref="GeneID:5231650"
                     /db_xref="PFAM:PF01764"
                     /translation="MMLVQFANLASVGYCVSHGISTGRLGDPETNCSLNACSNSMLKD
                     VEIIRIFDFNKMNEVGTGYYAVDKERETIILVFRGSSSNRDWATNLNFAPIEYTPIVH
                     DKEFTDAPVYNQQTCEGCQVHRGFYQFLKDNSGAIISAGVKMKQRFPEYQFLIIGHSL
                     GAAFTVMCGVEFSLLGYDPLVVTFGGPRVGNQEFVDYANMIFETEKVATDINMNHDFN
                     SGYIRVVHRHDIIPSLPPMFSHAGFEYFIDKKDLPHKECNLNRRGMEQSHLFWKRSSG
                     PSLRPGSFWPDRLGKYEHTHYFRRITSCRN"
     gene            complement(<573242..>574762)
                     /gene="ARH1"
                     /locus_tag="PVL30_004087"
                     /old_locus_tag="LELG_04366"
                     /db_xref="GeneID:5231643"
     mRNA            complement(<573242..>574762)
                     /gene="ARH1"
                     /locus_tag="PVL30_004087"
                     /old_locus_tag="LELG_04366"
                     /product="NADPH-adrenodoxin reductase"
                     /transcript_id="XM_001524344.2"
                     /db_xref="GeneID:5231643"
     CDS             complement(573242..574762)
                     /gene="ARH1"
                     /locus_tag="PVL30_004087"
                     /old_locus_tag="LELG_04366"
                     /note="BUSCO:EOG09261UOJ"
                     /codon_start=1
                     /transl_table=12
                     /product="NADPH-adrenodoxin reductase"
                     /protein_id="XP_001524394.2"
                     /db_xref="GeneID:5231643"
                     /db_xref="PFAM:PF07992"
                     /translation="MLIVGNGKRFLSRSCQLLSKPFKVAIVGTGPGGFYTAHHLLNKS
                     GPEKDIHIDFFEKLPTPFGLSRYGVAPDHPEVKNCEEFLTDLMKDYRASTQNKRHRVR
                     FIGNVEIGKDIKLGDLESHYNSIVLAYGSTASDNKLDIPGANSPQVIPARQFVNWYNG
                     HPDCYNTKNKYQPPPLDKIKDVTIIGNGNVALDVARILLANPTTHWKHTDISTEAEKL
                     LEKSTVKNVRIVARRGILESAFSNKEIRELLELKGVQFIPVDTDLLQEVAAKKLGRVD
                     KRRVSLLEKYSRGQSSADKDDKLDASKIEKRTWSLEYFLSPVEFVNDENGNLVETIFR
                     KNKPIDDPLLPGRIETTETRIKVENQLVILSIGYKGTPIDGFEELGIWFEKNKLHNKG
                     GRILKKISEKENEVNATYKKGWHTSGWIKNGPKGVIATTMMDSFDTAENILEDMTNGV
                     YIDVAKDSDITDKLAKEIVLWDNWEKLDQYELEEGKKLEKSRYKVCNKEDMLKVCK"
     gene            <576819..>582917
                     /gene="MLP1"
                     /locus_tag="PVL30_004088"
                     /old_locus_tag="LELG_04368"
                     /db_xref="GeneID:5231460"
     mRNA            <576819..>582917
                     /gene="MLP1"
                     /locus_tag="PVL30_004088"
                     /old_locus_tag="LELG_04368"
                     /product="Protein mlp1"
                     /transcript_id="XM_001524346.2"
                     /db_xref="GeneID:5231460"
     CDS             576819..582917
                     /gene="MLP1"
                     /locus_tag="PVL30_004088"
                     /old_locus_tag="LELG_04368"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein mlp1"
                     /protein_id="XP_001524396.2"
                     /db_xref="GeneID:5231460"
                     /db_xref="PFAM:PF07926"
                     /translation="MGDANQLNEEQKSRPNNSSYDSGENDGNHENDLSSKTALASKTA
                     TKEEDEEVEEVGQEKENEKSNSINISDSTSNVKQSIDSKEVLGGTKSVNAVGSNSFME
                     HNPNLIEEGDTSMQEEPNTSVLLPLPPDKTTYNTPSKVLPPLKDQDIITTPKSFHVAR
                     DVIAGEDDSQNFGAVSSPVSLVNKGVESRNNRKSLIYKEEISKIINSAISRIIPIERA
                     TTTTSSSSSSSSSSSSSSTQEVVDSIAETLTNLINSGSQNQQYLESDSSSTIKIELEE
                     VKSKFSAADNDNIRLKEENDMLESKLQSSQQQSKELQHVIEDLQDKIRHSAKSFAELN
                     RKFAESKDTCSQQESHYLSKLEQLTSSNVEQNRKLASLVEELNTREKENFANKLELTK
                     AKSELSFLRNESKWLHEELQSSQQKYSEALKQSGQTQSSTDSAMLNTQSKLKNAEQLI
                     KSHETELLQLNSSLAAETKKNTDLEVRLKKIETQSLLDINAKQELIDLMKIQSRQRES
                     RIKELEEYVNQISKNSDEAFKHLELSVSEKDDEIAVLQEKLQRVEEALAADMAQTLSG
                     ENSEQTFASGYGSSSEFDSGSGPGQISLLYSEFIHVKKELTLERMQKEKLEGELEEFV
                     FEMDSLKRALGDFNAQKQYYESVRSDLQDQITILQNEKLELEKSQRHFRAVQKDNDLE
                     VQRLKQTLKDLGRQLCFSLIHTKIRDNHEEPLSLAEKTFIENVIDRTGNDEEFAESDT
                     SKLISERLLEFKDLIELRQRNEELLSAVRELSTRLESGEAAQNSAEIAAIDEAQETIL
                     MLQNELESTCNKMSLLVKERDALEKIVRERGSGDAGNDKSNGLSIANFGHNEVENEEK
                     EKIRIKMEKQLEQKQKQIGEEKDEKEREEVDKELSQVILQLREVKDARDKLKVELAAQ
                     VRAVEQAEFKVQSLQRTNDRLSSDIEHANQQVNFWNKQFEKLEGQLNEKALLMSGLEA
                     KLNEKETTVKSLCLEKDFALSMQKSLESTIVELRQDKKIMNEQFAVLQSTAETKNSEL
                     AKLAQKLDDSESERLAIQRKLNERESKISILTDQRDMSMKSQQVKLEQINDLSSQLLH
                     ARKELSQMQAIVSELSPDSASQSVARQQMEDELKEYGDRISELTNQLKDKNETILEAT
                     TKFEKELSSMSEKLKSKETEKVAADGEITRLNGVISSKIQEMENMKKQYTTELDETVA
                     KLKAAESKTKSSQSVEDELKKTIEDLQDQRDISKGLEQKIREYHTQVSTLVQQINAYK
                     SDSDSNQELIQSLQDQLEQVRATRKDEENQILSQKLELQTENAELLKKIEELQGQNTL
                     LLNQLELSSSSNQETNPSGEKSQDIAQIISFLRREKESSDEKLPKLEEENVALKIKLE
                     NLQNKVNNFNAGAPSASINLTVNNEQQKQIQMQLDQLKSFKESNSVLVNENLKKNQEL
                     VNLNSEVTKIKSELEKITQLYNNQLSHLSVEQQRVKLFSDENVRLKQILSANSRTSEQ
                     TKSPAPEIAKMQEQMDKLKTKANDRIAVLRRELDGKDGIVKAKEAEIEKIKQELQAAN
                     AKEQNKSVNGDSKDVEKKLADVNRELKTVKEESAKLVGEKNELVKQLATLKAQNMKSG
                     STAGKSVTTPTAAAVVGGATTAAGATAAGATAAGATAAGATAAAVKNGEVPKLEAQIR
                     ELKQSLEKMQQESQKKLDEEKSKTRLEVEKKFEFKLRLLTRKVEKYEKELLPNKNNTV
                     ASAPPVANDALLSKDKDKPTTSVAATGGQSNKIMHNNPKQTTGFTFNSVSQNIPSKPL
                     QQQPPQNIPSKPLQPQQQQQQQQQQQQQQQQQQQQQPQQQQPQQQQPQQQQQQQQQQQ
                     KHSTASITSASPANVPHPNKGTSTQSSLGSAQVSGTLAPTVTQASPSSMVGGQFSNSI
                     PANDKSNAETSSATLNSPVFGSLQAKPAINNQANSLLNVTTRPFGQSVQSTQPTQPIQ
                     MPNTVSTSTLPKNAKPQVKTLNIAPSGSPDKAAIPAVTRPKVATIPSRQDKETQGATK
                     RTSDYERPKVKKTKKE"
     gene            <586567..>588712
                     /locus_tag="PVL30_004089"
                     /old_locus_tag="LELG_04369"
                     /db_xref="GeneID:5231453"
     mRNA            join(<586567..586813,587112..>588712)
                     /locus_tag="PVL30_004089"
                     /old_locus_tag="LELG_04369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524347.2"
                     /db_xref="GeneID:5231453"
     CDS             join(586567..586813,587112..588712)
                     /locus_tag="PVL30_004089"
                     /old_locus_tag="LELG_04369"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524397.2"
                     /db_xref="GeneID:5231453"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MNTAAQEKKGTDTPSLRSIQEKYVTGEDPVVENQQPKKSWMSKF
                     RFTADTSEHPPEIFNMTLYLSIFLFGLFGAARGLDEGNISGNIANPSFIARFGLKDPT
                     KTADQLANLKSNITSMVQLGAIGGAIIAMKSVDFLGRVRALQFVCIIWIVGVIIQITS
                     TKVGQLYAGRLIEGLAVGQTAAIGPVYMSEVAPSPIRGMCNCIFAGAVYFGIMLGYFA
                     NYGSVLHIPSTTSSGSINDKQWRVTLSIKIIMSGLIFILSWFTTVESPRWLLKKGRAD
                     EAVEKLSKLRRLPSDHPYIIAEISDINEQVMAEKEATRGSSLWTNFKQMVSNKSIVYR
                     FICIAGATQILGQWSGANAVTIYASELFALVGVEGVDKLKMSAVLGVVKFVSAYLSAF
                     FIIDILGRKRALYIGITGQMACLLYYAIFLTIVPQAADDGAVITGAAKRASTGALAAI
                     FLSGTFWTVGFNSVQYLIGAEIFPLGIRSFAQSMVMILHFANQYGNSKALPKMMIAMN
                     PYGAFYFFVGVLVLSLVWAFFLPELKGRSLESIEEVFTLPWYNLRRCNKLVPDHSQIH
                     KIRYTNSRGNTGFDHIHYDPESNKPNVEFVENLMRRNSEEDKEEVEKKV"
     gene            <593487..>598136
                     /gene="ADR1"
                     /locus_tag="PVL30_004090"
                     /old_locus_tag="LELG_04373"
                     /db_xref="GeneID:5231310"
     mRNA            <593487..>598136
                     /gene="ADR1"
                     /locus_tag="PVL30_004090"
                     /old_locus_tag="LELG_04373"
                     /product="DNA-binding transcription factor adr1"
                     /transcript_id="XM_001524351.2"
                     /db_xref="GeneID:5231310"
     CDS             593487..598136
                     /gene="ADR1"
                     /locus_tag="PVL30_004090"
                     /old_locus_tag="LELG_04373"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding transcription factor adr1"
                     /protein_id="XP_001524401.2"
                     /db_xref="GeneID:5231310"
                     /translation="MAQSPDFESRSARISNKNTKSSIEKPDTGATYDSSNSSTEYKES
                     GQPNQMEHESTKEPQERKGNGEGEGEGIGEGSAVANSTHGGGGGGSGGSSGSKKNIPV
                     ELTAFGTTPSGKPRLFVCQVCTRAFARLEHLRRHERSHTKEKPFACGVCQRKFSRRDL
                     LLRHAQKLHAGCTDAITRLRKKSLKPLDGEDGGEYAGGNGEYEDEEEEDVYEKESVLE
                     AEEAALKARAKLKREEATAVEFNLELFDKAKPSNGKVKKAKRNTGTGTGTGTNSGANA
                     NTTLSASSSSSGVPTRKSSNAALLQKKRGRKKLEETMATGMSVSSTRLRRGASFSAQS
                     GANYAINVPEFNDLYPNTDNVEFSTPQLMPSTNADELNWLNNISAIPGLSDDSRFNEL
                     MRQGSITSGINNYPGPPVNVSQHGSFSHPSFTNIPQQQQQQQQQQQQQQQLQQPRTDS
                     IASLNSHFDGLGHGHGHGHGFNTGHGPNIGPNTFMMPTVTLTNQEIQNGVTAHQKMLQ
                     QQQQQQQQQQQQQQQQHQQHQHQQHQQSFQSQNEPLHHGIQSFANNSQSQINNPNNPN
                     IPDGQFEIPGYSFYDMPDYMLDAQMMNEIPAHLRVLNPIKQEPDEDLASASQEPLRQT
                     DMDLNFLNDMDNLTHEYDVNAKFTAGGYSFYGDSISTYSSGIDTNSPGFVKSPPRPSP
                     LGVTSTTIDQMRIDSVGSPHQAIASDQPSTWKAPINYTRNKLFTNRMRHLVNKALNKY
                     PINGITTPAIPSNEKLESYLSTFVKDFLTHFPFIHVSKLNEYEIMSMTSNELDDNESA
                     RVCLPLLVATIGALIANNKNDSEHLYEASRRTIHIYLESRKNIVNSKKPSFFSANPLW
                     LIQSLTLSVIYGLFSENINNVYIVMRQLNALNSLVKTSIKDKHELLFSIHGEDEVIYK
                     TLTSEDRESFGHGNASDNGNGGVDSRGGAHSLFTNLHQDEMKFKNQINLQSQNRIVFL
                     IYRLTSFLFMMYNVPLTLSVNDLHQLAIADKTDEYLWNFKSFQEFQEACQDHQNEHET
                     ISFYINRRKIIRYKELLLKIAKNANPEKPPSPDLDTYIKENLQSLSQFGYVCLVHGFY
                     EIMSYKELKKINSFKVLNEVSECFPLPIGVGMFGTEDYARLDYAMLVNYTKLSTVFDL
                     GAIKTFSWLANYDEMVGAFGNILNSGNPEGPQNTLDNVNYLQTLDSALIILKLSLFKA
                     KVIKGDEVDSNREHGHQYNQNQNQNQNQNQNRYRHQSHQNSHHHPVLFSSNASGQSNN
                     DLFSTDFGYLDNNSNSENNVQQSPQTDTRHNSKLIARQFEEMMHLVVTDEFVPTTNLI
                     HSQMLFHVFSILGIVSIILLKKRMDHEMGINIDENEDNKDLLAEMNGKFLAIVSLLDK
                     VKHNLQVKFQALAGDPRAIHSNGNSNSIMLGDAGVAQYSNSNSNNNNNGLMAGMLGAQ
                     GPSTLNKFEDNNNFTSLYLFNGIEGNANSAFPAATPNHGSNDNNGENGNNHAMGMNAN
                     TGYDLEKTLYILKIGETLLYYMYDTNFQVSVFKKLADNLSQIRKYIIDNESFLLN"
     gene            complement(<598494..>602141)
                     /locus_tag="PVL30_004091"
                     /old_locus_tag="LELG_04374"
                     /db_xref="GeneID:5231306"
     mRNA            complement(<598494..>602141)
                     /locus_tag="PVL30_004091"
                     /old_locus_tag="LELG_04374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524352.2"
                     /db_xref="GeneID:5231306"
     CDS             complement(598494..602141)
                     /locus_tag="PVL30_004091"
                     /old_locus_tag="LELG_04374"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524402.2"
                     /db_xref="GeneID:5231306"
                     /db_xref="PFAM:PF00172"
                     /translation="MQNFEIEKRTKVSKACDYCKKRKFKCSGQAPCELCTKKDIECQF
                     SIVDRRTIRRKNKKRTIKPRVESTDDISNNNNSNNNNSNNNNSNNNNSNNNNNNNNNN
                     NNSDTTTNNNRNSNKNGNSFDNTSSTSTTKQNNNKKNKNTSKQHSSHTFVHKPFKNDG
                     HFDKDTLKLLNQKSKIPIHFQPLTIFPLHKVDGSVAGQQDDIDNNDDGSTASESGPGS
                     GPGSGSGSGSGSGPEVLAEGIANTEKEVQKSKDHESTECHLKKDFNAKDTTTFKDNLH
                     SNETSTEAESGQERKQKAGQATDHEAKVNTKRQKHGPAFKHEANPCQNTDYSSNTDST
                     PLSQTDRSSVPASVNTPRALYDSGGNLRYVGESSPLSFLFECRNIFKQLIGESSFTIE
                     SDSFEVFDEADDFQEIVQVPLPNRETLKHILEIFSVNVNVNCYIFDPKSYEKNIIVPI
                     YTNYAACSIDQIAIINLTIGVGLLYAEIAKHPIIYKLQSPQMKSSAYFEYGIYLTKKY
                     MNIGKLWITEAFCLATYYYQTKQQRNSAWLMLGLSIRNAQALGLHRKYINESFKDPQY
                     TRHRRKLFKSLYVLDRIMSVLLGRPLIIDDCDWDDFSSEDIYEKDKDGNIIEDIHMKA
                     LFETCKLAKIIGRAIRSFYLDGIINSYKAERVAIEVKLWSMQLPESLQVDKVLSAVPN
                     KKNGTEMGAEMGTKTGSGETQTKYQDNWAHGKEDLKLPLLMIHLSQLYAITLLSRPFY
                     MYVIFKDKKGKITLKRPKNRQEIAMCNFTKATVKASSLIIQFSECYIDYIKSMNNRVE
                     TYALVHCLFMASLIIGLTVLCVELNKYIDDEGFTTEKLMKLLNSSKTIFCYFSRVNPM
                     SNRFYLIVEKMQDALMLKFKMDANGHKIDVKKSKTSAGAGEGADARAGSNKSHKRRSS
                     AKTQKSTEDAAAHDEISVDASNQKGQLSSSKEYRQLSHDSKATLLSPANSTNTTYSNI
                     TSTISNERESATTTNDNTLLYNQKSNRISTQSATNGANGANGINTINSIGDTVSDPLV
                     DLYNFNKDYDSFIDSFGLHVPEMSSNEFNTFLQSQLQPSPTDSQNYSNTYYRDNSSRS
                     SQNIDAIYANMQNYGSNNNNNGNNNINHSNNSGSGIGFGGGIGVTADNSVSSWNQNAH
                     FNNEAESSTSPFKKGKTSGDNVFGSNNGNDDGNNNSNSNSNNRRKRGRNQLDEFMYNV
                     GLNDLLFDSKI"
     gene            <604630..>605286
                     /locus_tag="PVL30_004092"
                     /old_locus_tag="LELG_04375"
                     /db_xref="GeneID:5231432"
     mRNA            <604630..>605286
                     /locus_tag="PVL30_004092"
                     /old_locus_tag="LELG_04375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524353.2"
                     /db_xref="GeneID:5231432"
     CDS             604630..605286
                     /locus_tag="PVL30_004092"
                     /old_locus_tag="LELG_04375"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524403.2"
                     /db_xref="GeneID:5231432"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13409"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MSLPIKLYTFGTPNGHKVSVFLEVLGLKYETHKVDITKNESKSD
                     WFEKLNPNGRIPTIIDPNFKGVEGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYY
                     KTLEYLIFQVSENGPIQGQANHFAVFAKEKVPYGINRYITDTKRIYGVYEDILSRNKA
                     NDSKYLVGDRYTVADFALFTWTGALKLLEIDINQWPLLTKWYTQLAKVPGVEKGNSVP
                     "
     gene            <605970..>606638
                     /locus_tag="PVL30_004093"
                     /old_locus_tag="LELG_04376"
                     /db_xref="GeneID:5231402"
     mRNA            <605970..>606638
                     /locus_tag="PVL30_004093"
                     /old_locus_tag="LELG_04376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524354.2"
                     /db_xref="GeneID:5231402"
     CDS             605970..606638
                     /locus_tag="PVL30_004093"
                     /old_locus_tag="LELG_04376"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524404.2"
                     /db_xref="GeneID:5231402"
                     /db_xref="PFAM:PF00043"
                     /db_xref="PFAM:PF02798"
                     /db_xref="PFAM:PF13409"
                     /db_xref="PFAM:PF13417"
                     /db_xref="PFAM:PF14497"
                     /translation="MALKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKE
                     DWFVKLNPNGRIPTINDPNFKGVEGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEY
                     YKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVYEDILSRNK
                     ANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEV
                     PPKN"
     gene            complement(<606797..>608218)
                     /locus_tag="PVL30_004094"
                     /old_locus_tag="LELG_04377"
                     /db_xref="GeneID:5231704"
     mRNA            complement(<606797..>608218)
                     /locus_tag="PVL30_004094"
                     /old_locus_tag="LELG_04377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524355.2"
                     /db_xref="GeneID:5231704"
     CDS             complement(606797..608218)
                     /locus_tag="PVL30_004094"
                     /old_locus_tag="LELG_04377"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524405.2"
                     /db_xref="GeneID:5231704"
                     /translation="MSMQSRSSSLKRYSTIDLDFVGYECKHKYQKYRVKWSNLKRKCT
                     IKLKVKQTTSSTIGAPAALSTAIYSSSSFSSSSSSSSSSSSSSQRLTRNSSFRSVLTL
                     RADRIYHKSFRGSNHNKHNNNSDGKEGKEKEKEEEEEEDNDDNEDSEVETIETIVVDD
                     FYELKQIPNIVFQVKNQEQYHKQDPHSPKCGEKLSLDDLEDSSLSSPTRNNLEFKHEI
                     DAQELPSKTTTIVDTVTSDVDEQGEIICNDQIGEVIAKFNVQQQQQQQQQQQQQQQKK
                     QQQQQQQQQEQQQNHHHHHHHLNQVPHSLSSPESHYNQNQSRQLTNGPNLSQVPGNTS
                     STLLNTPLRYRSQLNQYLAVVEESNEEEYHHYQQQQQQQQDLGVPFTNWRTYSQRANR
                     RYSHYQLVDSQQQLGARVNANAGLGLKMGKEIGVCTNFDKLHQHMNINSKIVDDLNHC
                     WYVVELLVCIVATWEIFQFFYYY"
     gene            611386..611457
                     /locus_tag="PVL30_004095"
                     /old_locus_tag="LELG_06084"
                     /db_xref="GeneID:5231293"
     tRNA            611386..611457
                     /locus_tag="PVL30_004095"
                     /old_locus_tag="LELG_06084"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:5231293"
     gene            <612105..>614816
                     /gene="msp1"
                     /locus_tag="PVL30_004096"
                     /old_locus_tag="LELG_04379"
                     /db_xref="GeneID:5231507"
     mRNA            <612105..>614816
                     /gene="msp1"
                     /locus_tag="PVL30_004096"
                     /old_locus_tag="LELG_04379"
                     /product="mitochondrial dynamin GTPase Msp1"
                     /transcript_id="XM_001524357.2"
                     /db_xref="GeneID:5231507"
     CDS             612105..614816
                     /gene="msp1"
                     /locus_tag="PVL30_004096"
                     /old_locus_tag="LELG_04379"
                     /note="BUSCO:EOG09260KUC"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial dynamin GTPase Msp1"
                     /protein_id="XP_001524407.2"
                     /db_xref="GeneID:5231507"
                     /db_xref="PFAM:PF00350"
                     /translation="MLRTIARDKSLYSKSALYGHGRYNSVMMVPARNIGFIKIIAKAT
                     KLPVYIGGTMAAGGTYVAYKVEQASTYTQDKLSAIKDFTDGVFDKTGEFFKSMKSSMD
                     GDGSGGSGGNGGNGGNGGNGGNGGENDAATAIGATAAAVGLTADDDDDDADDTTVGEE
                     DEDDMETLIDDDDDDDDLESEQETDDHMLNLTRQMIEIRNLLASIDHDGIKLPSIVVI
                     GSQSSGKSSVLESIVGQEFLPKGSNMVTRRPIELTLVNTPESASNVAELPALKMNNIT
                     DFTQLQKILYDLNMAVSEAECISNDPIQVTIRSPKVPDLSLVDLPGYIQVEAADQPTE
                     LKRKIRELCFKYLEPPNVILAISAADVDLANSAALRASRLADPRGERTIGVITKIDLV
                     SPKVARKILTNKKYPLRLGYVGVITKAPSSSRLGGGSGSGGGGGVGGGLFSRAKVTGY
                     QAFVAQQNFEHQYFKEHKEEFLGTTVGTKNLKKKLMKVLEKTMAASLRPTHLAIQQEM
                     EETAYQFKVEFNDRPLTPEMYLANNIDMLKLGTKDLSHDFSRSELRALLKNALDQKIL
                     DLLAERYWNKPFDLSASSGITEPDLKDLTQAIHDGDMYWHKKLDLASGSLTKLGVGRL
                     ATNLITNALLTEVDNLVDNTQLRNHPMAKQAVRDAAKQVLSNKYYSTADQVENCIKPY
                     KYEIELEDREWTTSKENAASLLKEEMRQCEEVYLDLKSQVGGRKLQQVVTYLEKLKQS
                     KSGDIDLTSNETLGFSPTLIQRGKDAIFLKDRLSLLKMRYSFVKNSKKCRSKNSKYQC
                     PEVFLDAVATKIANTSILFLNVELLSDFYYNFPRELDMKFFSNLSKEDIEKFAKEDPK
                     IRKHIELQERKDLLENALSKIESVLAIQRTQKKAGPDDDEHKSLFKW"
     gene            complement(<615034..>617733)
                     /gene="NAN1"
                     /locus_tag="PVL30_004097"
                     /old_locus_tag="LELG_04380"
                     /db_xref="GeneID:5231358"
     mRNA            complement(<615034..>617733)
                     /gene="NAN1"
                     /locus_tag="PVL30_004097"
                     /old_locus_tag="LELG_04380"
                     /product="NET1-associated nuclear protein 1"
                     /transcript_id="XM_001524358.2"
                     /db_xref="GeneID:5231358"
     CDS             complement(615034..617733)
                     /gene="NAN1"
                     /locus_tag="PVL30_004097"
                     /old_locus_tag="LELG_04380"
                     /note="BUSCO:EOG09262E3Q"
                     /codon_start=1
                     /transl_table=12
                     /product="NET1-associated nuclear protein 1"
                     /protein_id="XP_001524408.2"
                     /db_xref="GeneID:5231358"
                     /db_xref="PFAM:PF00400"
                     /translation="MLTGGVPIDFPYSHSSASIYSQDGRYLITTLSHQIRVYFVSTKQ
                     CIRTIDIDLTDVVDIKLDVTNPSQIILFKSIGEIMIVNYKDKNMPEPVVTTTSIQQQL
                     NNHNVLSVVCVKHDRYIAISGKKDKRKGHSPHSRFLISIDRTADSVSVMGEVANVLHY
                     AVSLDCTKVAFVTNDQTITLIDLGVYYDISSGSISNTSVGANNQVTETDAANGKSELL
                     PMETIPFQFRSPITAVAVSNDAVIALGTNSGVIQILYGGILENAEKTQRLFKWHIDQV
                     NALQFSSDNNYLLSGGMEKVLVFWQLETEKKQFLPRLNGVIDKISIDLNKNDYITLLL
                     KTDVANYEILVLSLVDLVSRLAVNTIRPKFANNLKTTLARTKKKLAKDASFQKDFNKL
                     KLKYDYTCSFEPHSKSKNLYFPNESSIQAFDIIRNEQSFIQHAAPIISTGKVRGETKI
                     IDPQLTLLKFSQDGEWMCTFDEVVSSELDSLLSTKDKQYALKFWRYNENKEKEKDRSD
                     KEKDKDNRNGFWELTTKIIDPHGKGTPVLSLIPAPSSYFNGLAFLTADNKGGVRVWRP
                     TFPKDAYKVPASTTNSSSFSQQKQNKSTQTAWTLRRQRTPASNASYDAVSLAWSDDSS
                     TIFLGHECSITCLDLKTFEPIQDFQIPTLTESRIRSLQFLNNYLVVLSKTRFFVYDLV
                     AAKLTELVTKVHTTSGGKNLITIDPKRNLICLAINYYSGYEPSDAENLQIKSKIYLFK
                     PNQLKPIFVREHSSGIAALRSDSGSFIFIDLECRAGSLSSTLLEEIDEAERTKSNNEP
                     GAGVGSLSEEIKQMLITAQGNVELMNYRSTASSVKTKKQSNGGDGGNKGVNGGVGIDD
                     AEIDAAMSTEERVLDLHSFQPIFQNLDGLQVETIFDRITDILR"
     gene            <618493..>618711
                     /gene="RPB10"
                     /locus_tag="PVL30_004098"
                     /old_locus_tag="LELG_04381"
                     /db_xref="GeneID:5231339"
     mRNA            <618493..>618711
                     /gene="RPB10"
                     /locus_tag="PVL30_004098"
                     /old_locus_tag="LELG_04381"
                     /product="DNA-directed RNA Polymerase II subunit L"
                     /transcript_id="XM_001524359.1"
                     /db_xref="GeneID:5231339"
     CDS             618493..618711
                     /gene="RPB10"
                     /locus_tag="PVL30_004098"
                     /old_locus_tag="LELG_04381"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA Polymerase II subunit L"
                     /protein_id="XP_001524409.1"
                     /db_xref="GeneID:5231339"
                     /db_xref="PFAM:PF01194"
                     /translation="MIIPIRCFSCGKVVGDKWETYLEYLQDETMTEGDALDKLKLKRY
                     CCRRMVLTHVDLIEKFLRYNPLEKKEIN"
     gene            complement(<619455..>621200)
                     /gene="CPS1"
                     /locus_tag="PVL30_004099"
                     /old_locus_tag="LELG_04382"
                     /db_xref="GeneID:5231343"
     mRNA            complement(<619455..>621200)
                     /gene="CPS1"
                     /locus_tag="PVL30_004099"
                     /old_locus_tag="LELG_04382"
                     /product="Gly-Xaa carboxypeptidase"
                     /transcript_id="XM_001524360.2"
                     /db_xref="GeneID:5231343"
     CDS             complement(619455..621200)
                     /gene="CPS1"
                     /locus_tag="PVL30_004099"
                     /old_locus_tag="LELG_04382"
                     /note="MEROPS:MER0001269"
                     /codon_start=1
                     /transl_table=12
                     /product="Gly-Xaa carboxypeptidase"
                     /protein_id="XP_001524410.1"
                     /db_xref="GeneID:5231343"
                     /db_xref="PFAM:PF01546"
                     /db_xref="PFAM:PF04389"
                     /db_xref="PFAM:PF07687"
                     /translation="MIGLPLDDASPRTKKYTSVGAASLIIFLIVFFSTNLFEYTKIFF
                     TTIPKDDSNICPVGKPIAPASFYKDNSTVLTILNNEEYREKSIKRLSGAIQIDTQIFD
                     NQPDVDESPKTWEKFENFHKYLKKTFPLVYEQIEVETVNTYGLIYTWKGSAKKLKPIL
                     LTAHQDTVPVQNETLDKWTFPPFEGHYDGKFIYGRGAADCKNVLIAILETLELLVIQG
                     YKPERTIVAAFGFDEESSGLRGASRIAEVLENKWGKDSFYAVVDEGAGLSKDPITKTV
                     FANPGTGEKGYIDILVDLTTPGGHSSIPPDHTSIGIVSELGYLIEKDPFEPILTPENP
                     IFEYFQCLAVHDPKNKIPKFFKKTILRAAYDKFANAKLVEAISKNRITKYLIRTSQAL
                     DIINGGVKANALPENTKLLVNHRIAIESNVADTIKHFNKRVIEVAKEHNLKVVSFNET
                     VYEPKEYNGAGVFNIYSTHGGLESAPVTPSNDTVWKYLSGVTRHVFEDLVFTNISYPI
                     VSSPSIMTGNTDTRYYWNLTRNIFRYSPFYVESFIAGMGIHSVDERLEFDGHLQLHAW
                     FYEYLQAIDTAKADN"
     gene            <624604..>625614
                     /locus_tag="PVL30_004100"
                     /old_locus_tag="LELG_04383"
                     /db_xref="GeneID:5231318"
     mRNA            join(<624604..624852,624914..625172,625238..>625614)
                     /locus_tag="PVL30_004100"
                     /old_locus_tag="LELG_04383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119519.1"
                     /db_xref="GeneID:5231318"
     CDS             join(624604..624852,624914..625172,625238..625614)
                     /locus_tag="PVL30_004100"
                     /old_locus_tag="LELG_04383"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975502.1"
                     /db_xref="GeneID:5231318"
                     /translation="MKFPSLVLLAIATSAVQAAPFNFVKRYTNTTTTTTPSSSSSSSI
                     LEGSLYLTELPTSSGSAASSSSSETEDEWITSTIVEYVTLLTSSTQSSEDITSTIVEY
                     VTITQGSSVITSATNTYTTTTQAALTSASASASDATSDEDVKEEEEDFDDELTTSTIT
                     SIVTITNADAAGATATVAAESVAASTADACVPSTETVTVTVTASGSASTDVSTTEVVS
                     TSLYTTSYPLQAVFTNNDTTTTITSYVDVTQTQFYTLTSSLSQDAVSSSAYTSASVAP
                     TYNNTGYANTTVPLSTAW"
     gene            <626517..>629852
                     /locus_tag="PVL30_004101"
                     /old_locus_tag="LELG_04384"
                     /db_xref="GeneID:5231342"
     mRNA            <626517..>629852
                     /locus_tag="PVL30_004101"
                     /old_locus_tag="LELG_04384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524362.2"
                     /db_xref="GeneID:5231342"
     CDS             626517..629852
                     /locus_tag="PVL30_004101"
                     /old_locus_tag="LELG_04384"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524412.2"
                     /db_xref="GeneID:5231342"
                     /translation="MSSPTRRQPQSDGLYSHVQFTNQYSPSTTSTKHTKETKITGKPI
                     TPRENTSHNSNSNMRKNNTENVIKPHDPPLSTTRKSILNMSSITRSTSRRFARNGRTS
                     IGLPRSSPSKLERSRRYMEISPKRRRTSGFNKESVLEQFTESDRLINSVNGTRRVMHL
                     DQSSVSEVEDLSSPIRNRKMRVDASVGLNEKQNNDNSNNNNNNNSAGGGGVVGIGLTR
                     IPSLRKEEEEQEEQKEQHKEGKQGEENLTRSTSQNVIRSQFELSPAELSEGAKRARTY
                     PNRDNQRAHTSGQSTHLSEGDVNVEDGDIENDGDSSDFEILDDNLYSKDPSQTLNHTQ
                     LTKIIRDSRNSGDKDLTPNRPTEPDAHSPQSHSHSRILSQSPDIANSVSAQDTSPLKS
                     HPTHGHQTHDTTASITSTAAASRKRQYDNGDGDDDDVDDDVDGDDDDVDDDVDGDDDV
                     DGDDDVDDDDDDVDDDVDGDDDDVDDDGDHNNNYNGNTRGDGDEKEQESARYLNSPNS
                     RAVFSTNYVKKLQDSHKARYATIVDKLALKEMDYLKTLQTNNELQAKLLILEQEAREF
                     DETQFNVQESNEQMKIQLRDANERIKELNESLDGIQNKAALLQQQLEDEREYTSQMTH
                     TMARYEEDYKIATKEKDNIEQELVTLRNKDIERNLEMDRLIDERERLTKEVSKVQEEL
                     ESLRIAYKKVEANAEARVDEHQQKLKSLQEHCSEYEEKLKERDLAVFELRQKEKDLSS
                     KLNDQKELVSKLESNIEDIKKTHAQDLTELNNQHETRVQSLELNIAKFCDKEKQYAND
                     IHDLQSKLKSAEQNIQSFTNQKLQWEKVAEQNKELEALNSKLEKQIKESSTNNSISLE
                     EKEKIIKKLTQDRDNLNDVNLKHQNEIQKLEKEIEDKIKTNDSLTKSKEILTADVSHL
                     QQQISDHIKSEEAKDSELQNTLKDKRVYEVKLEELLSTFEKYKSRMDAEEEELSRARA
                     EIEAHEAKRNEILEASSKLRSERQELSKKIDNLTEVNYDLQRELEQVKTSYEDKIANL
                     YKSLYDEYSQKHKRKLQDYEEYYESKLATKEKELRTLTRDFEFAKMQNDKLRSDNNKL
                     IAEKCASPEKPAASNYGSRYSRV"
     gene            complement(<630492..>631622)
                     /gene="BGL2"
                     /locus_tag="PVL30_004102"
                     /old_locus_tag="LELG_04385"
                     /db_xref="GeneID:5231394"
     mRNA            complement(join(<630492..631355,631611..>631622))
                     /gene="BGL2"
                     /locus_tag="PVL30_004102"
                     /old_locus_tag="LELG_04385"
                     /product="glycoside hydrolase 3 protein"
                     /transcript_id="XM_001524363.2"
                     /db_xref="GeneID:5231394"
     CDS             complement(join(630492..631355,631611..631622))
                     /gene="BGL2"
                     /locus_tag="PVL30_004102"
                     /old_locus_tag="LELG_04385"
                     /note="CAZy:GH17"
                     /codon_start=1
                     /transl_table=12
                     /product="glycoside hydrolase 3 protein"
                     /protein_id="XP_001524413.2"
                     /db_xref="GeneID:5231394"
                     /db_xref="PFAM:PF00332"
                     /translation="MQFKIAFNLGVKDNSGNCKTVEEFESDLELLKDTTSIIKTYAVS
                     DCNTLQNLGPAAEQENFQIMLGIWPTDDAHYQAEKDALQSYLPKISKSTIKIFLVGSE
                     ALYREDLTASQLANKIDDIKSFVADIKDKDGNSYSDIPVGTVDSWNVLVDGGSKPAIQ
                     AADVVYANAFSYWQGQTNQNASYSFFDDIMQALQTIQTTKGSTDIEFWVGETGWPTDG
                     SNFESSEPGVDNAKNFWQQGICAMRAWGVNVAVFEALDEAWKPDSSGISDVEKHWGVW
                     DANGKLKYDITCDFD"
     gene            complement(<632777..>634006)
                     /locus_tag="PVL30_004103"
                     /old_locus_tag="LELG_04386"
                     /db_xref="GeneID:5231295"
     mRNA            complement(<632777..>634006)
                     /locus_tag="PVL30_004103"
                     /old_locus_tag="LELG_04386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524364.2"
                     /db_xref="GeneID:5231295"
     CDS             complement(632777..634006)
                     /locus_tag="PVL30_004103"
                     /old_locus_tag="LELG_04386"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524414.2"
                     /db_xref="GeneID:5231295"
                     /db_xref="PFAM:PF02598"
                     /translation="MAKRKATEKVEQKEVKKPTKAPHPRTSISICIPSTVISNKNAHN
                     LEQKTMICYQIAKACLIYNVAEIVVLKVPEKRMGAKGDEEQKTPSAVTVGNKVVFNED
                     FNPVSDGVEEKKNKGNDKANGSFDKSKEDALLLASLLQFFITPPYLIKTVFSPHLNPH
                     MQDILHKFKYAYKLPKITTLPFMQNNEVYRDFKEGIIIPRETPKIKAKSKSKKFRVKA
                     PHKVTVSKYVNIGEREALELDISREIPIYSRVTVDLKNKTIVSPQRAYGVVGHESSFG
                     YLVRVVDDGFHKVFTKSPVVDGYNCTVFVSCDDYFNKLGKVLDEVKEYEDDEESRQQQ
                     QAQVQEEEKDNSKKILVVVGNYKDFQLSFEDDEEAKSTMFEGLDGVSKLFDYKLNIPL
                     GCRTEDGVLIALTKLLE"
     gene            complement(<634647..>636092)
                     /gene="BFR1"
                     /locus_tag="PVL30_004104"
                     /old_locus_tag="LELG_04387"
                     /db_xref="GeneID:5231346"
     mRNA            complement(<634647..>636092)
                     /gene="BFR1"
                     /locus_tag="PVL30_004104"
                     /old_locus_tag="LELG_04387"
                     /product="multicopy suppressor of BFA (Brefeldin A)"
                     /transcript_id="XM_001524365.2"
                     /db_xref="GeneID:5231346"
     CDS             complement(634647..636092)
                     /gene="BFR1"
                     /locus_tag="PVL30_004104"
                     /old_locus_tag="LELG_04387"
                     /note="BUSCO:EOG09264HOY"
                     /codon_start=1
                     /transl_table=12
                     /product="multicopy suppressor of BFA (Brefeldin A)"
                     /protein_id="XP_001524415.2"
                     /db_xref="GeneID:5231346"
                     /translation="MSSDSFSETSASKPSTQRKFIKRPDDKAMKDQIENLRKEIKQLD
                     LASNEITAQIAKHQIDQKIMDERNKLTSELKALQSKQSGSKNERHALNEQIKAIDGQM
                     KKKIAEIQQQTSKNNYKSVAEIDDKINSLDKLIDAGQLKLADERRYVKEMSALRKLRK
                     DFGSIEQTQASIDQDKEKIAELKKKVAATHNKELNAQYDALQKKVDEINESNKTIISK
                     RNELYDKRGELKKQKDAKYDEIRKLRAEFDEKFAHFKKLMAEEKAKREEEYKAQILEE
                     KKAKLKKRIEAELAEASVPAFTEEINSLHNCLSYFDPSYVKPTKQENQINNGSNSNIP
                     STTNNAARTIEFPEDLVIVKKEQEAFFVGNKKKGKGAKKQQQQQQQQQQQSKAKNFSV
                     APEIVVALSDLHIPFPLKEDDVPETIKLLKETLEALQDKQEEQTQKNIERAKARIAKF
                     EAEQANDDENEEEEEEEEEEEGEEEVNTEEN"
     gene            <637359..>638234
                     /gene="IDI1"
                     /locus_tag="PVL30_004105"
                     /old_locus_tag="LELG_04388"
                     /db_xref="GeneID:5231386"
     mRNA            <637359..>638234
                     /gene="IDI1"
                     /locus_tag="PVL30_004105"
                     /old_locus_tag="LELG_04388"
                     /product="isopentenyl-diphosphate delta-isomerase idi1"
                     /transcript_id="XM_001524366.2"
                     /db_xref="GeneID:5231386"
     CDS             637359..638234
                     /gene="IDI1"
                     /locus_tag="PVL30_004105"
                     /old_locus_tag="LELG_04388"
                     /note="BUSCO:EOG0926458I"
                     /codon_start=1
                     /transl_table=12
                     /product="isopentenyl-diphosphate delta-isomerase idi1"
                     /protein_id="XP_001524416.2"
                     /db_xref="GeneID:5231386"
                     /db_xref="PFAM:PF00293"
                     /translation="MSSEYAQLVASLTPEAIQQKWPEITPLKQISGIPRSAGSDTSST
                     QSSTQETELFDGHDEEQIRLMEELCIILDYDDHPLGAGTKKLCHIMENINQGLLHRAF
                     SVFLFNESGKLLLQQRADEKITFPAMWTNTCCSHPLCVPSELGIDVKSGAKDVNSLDV
                     AVQGAKVAAQRKLDHELGISLQDVPIENFTYLTRIHYKSASGEEQTSKWGEHEIDYIL
                     ILRTKDDITINANYNEVKDYKYVSADELKEMFNDENLVFTPWFKLICQTFLFKWWSNL
                     DNLQQFKDDEIHRLL"
     gene            <638954..>640252
                     /locus_tag="PVL30_004106"
                     /old_locus_tag="LELG_04389"
                     /db_xref="GeneID:5231419"
     mRNA            <638954..>640252
                     /locus_tag="PVL30_004106"
                     /old_locus_tag="LELG_04389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524367.2"
                     /db_xref="GeneID:5231419"
     CDS             638954..640252
                     /locus_tag="PVL30_004106"
                     /old_locus_tag="LELG_04389"
                     /note="BUSCO:EOG0926131E"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524417.2"
                     /db_xref="GeneID:5231419"
                     /db_xref="PFAM:PF04055"
                     /db_xref="PFAM:PF16881"
                     /translation="MLPRSINILKLRPTTQVTTTALRALATEAKTTLGATPGSTSTST
                     STSTATTTTLESTSTSTSGDATETTIKETKSIKRKRTFFTDELNKGPSFDDFVSGKAK
                     DMLEDPLELARKDPNAKLPSWLKVPIPKGKSFHNVKNDVRELKLSTVCEEAKCPNIGE
                     CWGGKKSEATATIMLLGDTCTRGCRFCSVKTNRKPGKPDPMEPENTAEAISRWGLGYV
                     VLTTVDRDDLIDGGANHLKETVQKIKFKAPQILVEVLGGDFRGDLEMVKILANSGLDV
                     YAHNMETVETLTPHIRDRRATYRQSLAVLRTAKETKPSLITKTSLMLGFGETDDQIRQ
                     TLKDLREVGCDVVTFGQYMRPTKRHMKVVEYVTPEKFDYWRDVALEMGFLYVASGPLV
                     RSSYKAGEAFIENVLKKRKHNVGESPRMLQEVKPSIFKRA"
     gene            <641281..>643674
                     /gene="HOS3"
                     /locus_tag="PVL30_004107"
                     /old_locus_tag="LELG_04390"
                     /db_xref="GeneID:5231515"
     mRNA            <641281..>643674
                     /gene="HOS3"
                     /locus_tag="PVL30_004107"
                     /old_locus_tag="LELG_04390"
                     /product="histone deacetylase"
                     /transcript_id="XM_001524368.2"
                     /db_xref="GeneID:5231515"
     CDS             641281..643674
                     /gene="HOS3"
                     /locus_tag="PVL30_004107"
                     /old_locus_tag="LELG_04390"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase"
                     /protein_id="XP_001524418.2"
                     /db_xref="GeneID:5231515"
                     /db_xref="PFAM:PF00850"
                     /translation="MSRQRQHSNNPYDTDSEEESLIEAFETTLSIRPSTTDYEDDISI
                     DHTVLPNTTINYTHDLSSIVDIEELEENEQISEQIPKFKTNRRYSLLPRLTAYKKTGS
                     PGLEEYYNQQKLDPKFDEILKPNPLLDEKLIKYHHTFSDFIASNPHINTESPRFSLES
                     EKTLIILSPYSPEHAFGRKWVTKTYLSTIFERPQRLLASCIGVASAITMYPFYYKLIN
                     STKRSSIFSSHVRKIHGRNWPKKLFELCLESHDKLENDELEVPKDWNTGDIYLTPKTI
                     NAIEGVIGTIETAVDQLFKQSTTSSAASASASASGLATATATSTSTAMAAEPLSSKST
                     TSTTAANNNNNIGLNGGSSKKKPNHNLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIE
                     YAFETYGVTHCAILDIDLHHGDGSQDICWERGGFTGDYGQQDEDEIVDPSLNPRDDYG
                     KRFATYPKVGYFSLHDIKSYPTELGFATKENIKNASTCIMDHDLNIWNVHLQSWASED
                     EFYKHYSTKYVAILNRANQFLNNSKKQYEEEYQEYLVQLAKYNKMLTKPKHLLSNNDL
                     KLQKPTPPPPYKPLIIISAGFDASEYENPQMQRHGINVPTSFYANFTRDVVKLAKLQT
                     GGKVISFLEGGYSDGALSTGIFSHLIGLNNDDDLAWNHSWGSEQVVKELCKGCKKNWT
                     PYKHPKTDITIWANEVIKLGRSMMPNAILPANYIYRDASKDNGGTGGVGGDTKPVNRM
                     VKGLMDARGSMGIIESPKLKREKQETGFGGSGGGVDGGSSVAGNVRHTRSYYKRVGG"
     gene            <645452..>649402
                     /gene="BEM3"
                     /locus_tag="PVL30_004108"
                     /old_locus_tag="LELG_04391"
                     /db_xref="GeneID:5231481"
     mRNA            <645452..>649402
                     /gene="BEM3"
                     /locus_tag="PVL30_004108"
                     /old_locus_tag="LELG_04391"
                     /product="Rho GTPase activating protein"
                     /transcript_id="XM_001524369.2"
                     /db_xref="GeneID:5231481"
     CDS             645452..649402
                     /gene="BEM3"
                     /locus_tag="PVL30_004108"
                     /old_locus_tag="LELG_04391"
                     /codon_start=1
                     /transl_table=12
                     /product="Rho GTPase activating protein"
                     /protein_id="XP_001524419.2"
                     /db_xref="GeneID:5231481"
                     /db_xref="PFAM:PF00169"
                     /db_xref="PFAM:PF00620"
                     /db_xref="PFAM:PF00787"
                     /translation="MQVASHNYTSSPSYTSSTTLDMEQSTSRSSHNTNNDNEKRHHLI
                     DQVSKSHTSKNDQRDSTTKSRKDEDIPPSHPKFDRSKLSDKEYIGQLLFENKELRYLI
                     ESQERTIKHLQQQLKVHTQFSNTSTTNEATPKTRNGNHLNSNLNTSNNLKQQQQQQQQ
                     QQRDNFESPLSSSASSSPISSPVLDAPIDSTSIAALVPTPLHKSGSPTRRSRSASLAN
                     KMQSLGEDENKKSVSTTPIQHHQTMSDKDEEPAVKSPYEIPTRSVLRSRDVPGQEKDH
                     NRGKEKEKEKEKENDKQPLLSSAQSASYSTLPNSTSSNSNLSSNVSSHLSSGRGEREK
                     LDTESTYYAYGNAYNDEHDQDDTPDTTRQSNTSDGNIIHSGNVTIDSSTRTDDAYEMN
                     NQHVRGLDVAKLRSHASSAASEKIYKENKHLARSTSSIGSTYKSSRIKPPASASKTST
                     MNSNNNNHNPNNNNSIINSPGNINSPVELAPPTSLKLALGDRTGSRTDTSPSAGPVPS
                     SVSASAYNSPLPPLPTSQSQNSVGIGYLDSSKDASTTLDTLSDTKLDTFQSPSSKFDD
                     PNGQLPSPGIGYDKFDNQATNNTQTSNNTNNLSIQGLGLAPPYNIQSQTINYTTPHQT
                     PPINDVKSSVSASFTSPRTPAFSFNVLNTPKTDLDESSLFIKPDEFQTIFIKVVSTIH
                     INAATNQALKKADDPNLTITINDRETNKEMWRIRKTHSQLCAFDAEIRPIVEYFGLAS
                     LPDKASFMSTTPSKIETRRSILQNYFNSIFLMPHIPHIILYKICLFLSLDFVNPLDDY
                     KSGSRKEGYLVRRYKGLGNSWKVRWCQIEGNALEIYSFPGGPLQEQIPLRNAQIGRQA
                     TDSVADDKGYRHAFLIMESTKASKLHTTTNKHFFCAETDEERDDWVTALIEFTEPSTD
                     SPDASPQNFNTYQDAMTPSDSGKYSYDSYGNSINSGNNNSNNNNNNSNAMQEAPSSSS
                     GSYLSIDQSSTQTSTSIEEQAKKMKKRSYFSFRNRTSSIPEEHNQQQPPLPPPPQPSQ
                     SIHSNQQQSQSQPVVYQQPSLSQPPSASYIHSPSKNFQLQTQSQPQTPNHDTSNSMRQ
                     YLDNMQLGEDLTRAVFGRDVEVAYELSNSEYMGKSIPSICFRCLDYLNKTGAVFEEGI
                     FRLSGSASAIRQLKEAFNREYDLDLFKSPLKPDIHTVSGLFKLYLRELPNPILGSQTY
                     DKLNTIIMNNANKIPPSQIAMLFRDYLNDPLQMDKIHYDLCYVIFKFLRQVISQNQIN
                     RMNLRNLCIVFVPTLNLSLEVLSTILIDFECIFENGKPISDSNREVLDLQIPNF"
     gene            complement(<649756..>650700)
                     /gene="TOA1"
                     /locus_tag="PVL30_004109"
                     /old_locus_tag="LELG_04392"
                     /db_xref="GeneID:5231376"
     mRNA            complement(<649756..>650700)
                     /gene="TOA1"
                     /locus_tag="PVL30_004109"
                     /old_locus_tag="LELG_04392"
                     /product="transcription factor IIA subunit alpha"
                     /transcript_id="XM_001524370.2"
                     /db_xref="GeneID:5231376"
     CDS             complement(649756..650700)
                     /gene="TOA1"
                     /locus_tag="PVL30_004109"
                     /old_locus_tag="LELG_04392"
                     /note="BUSCO:EOG092651HW"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor IIA subunit alpha"
                     /protein_id="XP_001524420.2"
                     /db_xref="GeneID:5231376"
                     /translation="MSNIEASKLYETIVEDVITDSRQDFENMGIDESTLQELRKIWCE
                     KLSQTQVCKFSWDEEEDDDEEEEGKGEEVADSARDNAIDGGSNGLDSENQLPPVTTGD
                     SAVSVPEPGVNNSSSTVAVNDNGTAENGSNDALSYNNNLGIELPSLPKTESQQDGELV
                     LPQINQTDGTFEMVIHSNNGREMMEKLLQDKIQNSQKKKKKGENGALSRRRTFHQVDG
                     ALDDDDDDDDDDDDDDDEDDADIFNDSDDINSDLDDDIDSEKSDDEDGDQEGQIMLCL
                     YDKVQRIKNKWKSNLKEGIANIDGKDYVFHKATGECEW"
     gene            complement(<651556..>654282)
                     /gene="FZO1"
                     /locus_tag="PVL30_004110"
                     /old_locus_tag="LELG_04393"
                     /db_xref="GeneID:5231298"
     mRNA            complement(<651556..>654282)
                     /gene="FZO1"
                     /locus_tag="PVL30_004110"
                     /old_locus_tag="LELG_04393"
                     /product="mitofusin"
                     /transcript_id="XM_001524371.2"
                     /db_xref="GeneID:5231298"
     CDS             complement(651556..654282)
                     /gene="FZO1"
                     /locus_tag="PVL30_004110"
                     /old_locus_tag="LELG_04393"
                     /note="BUSCO:EOG09260RGH"
                     /codon_start=1
                     /transl_table=12
                     /product="mitofusin"
                     /protein_id="XP_001524421.2"
                     /db_xref="GeneID:5231298"
                     /db_xref="PFAM:PF00350"
                     /db_xref="PFAM:PF01926"
                     /translation="MSSFSHLPNGKNNHEHVPNKHDNILNSNENDDDVDDDDNDTKTL
                     IGNNNPAHLVYVPGESQLTHDGSTLVNGQDGSNGIDRGGSSGSSSTSRGDVKHDLSLK
                     HRQHMNASISQLRYNENRISLDRCINHTVQLINELSAENKDRPVFYPTEIEDDQKILL
                     NSAKAHLALVRRNTSIKQLSKQKMAEEQTQKDLPEFRILKINIKGGHGDDNLVANLDK
                     KSIASLLEKKLMSQIKYLHNLKERVDDTSSKVFVTGDLNAGKSTFCNALLRRKILPED
                     QQPCTSVFCEVIDAKAENHGREEVHAVPIEKEYDIKDESTYEVHLLKDLEELVYDCDK
                     FKLLKVYVLDHRSFQESLLHNGVIDIKLIDAPGLNMDSFQTTEVFSRQEEIDLVVFVV
                     SAENHFTLSAKEFIAAAANEKRYVFIVVNKFDGIKDKEKCKRRILDQIKNLSPDTYKN
                     ASEFIHFVSSEEVSNGNNPNGGDDGGDGGDDDDGNNNNDDNRPDHPDFDLLEASLRKF
                     ILEKRSISKLLPAKSYLLNLLQDLQTLSTINEKIYNDEKREKLQELTSQVAPKVNEII
                     HKSHRIADTISALTEATCTKIYNDTTREINYVIDNLGDKPVVEYNGLQFLFEYARESQ
                     LAMIDVVGDAVFKCEDMARQLTAQKVDEIVAFGRNTLNEEFLHDKKFNSDLMFSRIKD
                     DIGKNIEDTIEVSDFFDPSMESFLVFVGLPESYVNHTARQISYFNPVSVITQIPSNAL
                     ALKNQLPTQITLHTIYSSGKLLTAGALVNKIYQFSHYVTPAVVKKVALPVLIGVSGIA
                     IYYLISDIPNALPRKQARKIKRQIHAMNYVHNNSTRISSECRSVLNFPARQVMNNFQT
                     SIDKRVVQKEKLEKYIKDAELSSGFFKQMLSKIHHQQKVLNDIDLESVVSVE"
     gene            <654891..>655535
                     /locus_tag="PVL30_004111"
                     /old_locus_tag="LELG_04394"
                     /db_xref="GeneID:5231333"
     mRNA            <654891..>655535
                     /locus_tag="PVL30_004111"
                     /old_locus_tag="LELG_04394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524372.2"
                     /db_xref="GeneID:5231333"
     CDS             654891..655535
                     /locus_tag="PVL30_004111"
                     /old_locus_tag="LELG_04394"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524422.2"
                     /db_xref="GeneID:5231333"
                     /db_xref="PFAM:PF04115"
                     /translation="MVLKTFELTQRLHIVAEPLTPESFAPYGGVISADHQISGVNTSQ
                     ANYGTAIKLHKVAPVVNNYKIAPSGKEETANWNIFRCKAPTHLIKHGGSKSVYLSKVL
                     ERHPFTTQTFLPLGQDLHKISYLVIVAETDQSTKEKLPNPKKIRAFVCKGNQSVTYGA
                     GIWHAPMVVIDETIPYLDFAVFIHENSVADEDCQECYFEPGNNVEYTTLGSPKL"
     gene            complement(<655553..>656653)
                     /gene="IRC6"
                     /locus_tag="PVL30_004112"
                     /old_locus_tag="LELG_04395"
                     /db_xref="GeneID:5231382"
     mRNA            complement(<655553..>656653)
                     /gene="IRC6"
                     /locus_tag="PVL30_004112"
                     /old_locus_tag="LELG_04395"
                     /product="Increased recombination centers protein 6"
                     /transcript_id="XM_001524373.1"
                     /db_xref="GeneID:5231382"
     CDS             complement(655553..656653)
                     /gene="IRC6"
                     /locus_tag="PVL30_004112"
                     /old_locus_tag="LELG_04395"
                     /codon_start=1
                     /transl_table=12
                     /product="Increased recombination centers protein 6"
                     /protein_id="XP_001524423.2"
                     /db_xref="GeneID:5231382"
                     /db_xref="PFAM:PF10199"
                     /translation="MFPNHILVLGPPNSGKLRIVDAITQRENESIAFDTERNSHSGII
                     EKTRIITKYYDIDLNIFIDEFPEERSVKKEYSQQSQKQQEQPQHIQQSEKIEREGTEE
                     IKEMHVISDDEKLRSFKAWSKSFGDDSMSELRTVLNGVIFTINATSDGLEYIEQALDI
                     LDILRAQLNDDSFCVVVASVPCGAQPLNQKMEEIEDLVMSHAIEFINLQATGKNEFGE
                     KQGKERVREVMESHDWPNIDPASFPNVQDSKMKEERNRAKIKALEDPLVKKQPQQEDL
                     RVEENENEEENELYANREVYNNDNDKYDDQNDDKNDDKNDNKNDNSNNNEDNLEYLLT
                     RLVLARQKAETLSGEERERYAAECVDDFINFL"
     gene            <656933..>659728
                     /gene="SEC15"
                     /locus_tag="PVL30_004113"
                     /old_locus_tag="LELG_04396"
                     /db_xref="GeneID:5231412"
     mRNA            <656933..>659728
                     /gene="SEC15"
                     /locus_tag="PVL30_004113"
                     /old_locus_tag="LELG_04396"
                     /product="Rab GTPase-binding exocyst subunit S15"
                     /transcript_id="XM_001524374.2"
                     /db_xref="GeneID:5231412"
     CDS             656933..659728
                     /gene="SEC15"
                     /locus_tag="PVL30_004113"
                     /old_locus_tag="LELG_04396"
                     /codon_start=1
                     /transl_table=12
                     /product="Rab GTPase-binding exocyst subunit S15"
                     /protein_id="XP_001524424.2"
                     /db_xref="GeneID:5231412"
                     /db_xref="PFAM:PF04091"
                     /translation="MSASLLNGAVSNGHGRSNGKSTNSKRGTEDSESKDASKESAAVD
                     SIQLESLLLLDDDLFQNTLNSDDYVENLAPLIKNAVRQNGLTEMITKLNNFVKLKDEE
                     LNEVSMNSMGEINQCMDTIASIHKEADQLNRQFLSVSQSLGKSAIELMTKKKNYVKYK
                     DVCRRISEAQVVLLECIQVLELMNRILELIKHTKYFSALKLIDELTNIHIQKVNEFSF
                     AKKIVDSIPHLTKMVKDDSFENLTKWLSINLERKLPNIGDSLYDSLYVLQGNWLECKR
                     RNPTYLPYKLNSPVELSVRDSKSNYDVFKDETMQIPLDSVYDAILVYRTLNELENLST
                     VYYKEWMKKYSRIIYPLTSVASNKKDIVFTAKELDEYLRKIAAFFVMDKQLNILTKFQ
                     LRTNAQADELWMSYVSKLKPVLLHNLKNYDFYSLDELSNFKDIIGDFIQIMDSNEYDV
                     SELYEVLMIIFKDHFAPLVVQFFRRKFIESLQSEFYTALQIDEEDYDTIMKRIFYESN
                     ASFAPRNVKSFPVKFPFSEDYVHFCGFVRQLINRTLKFLNEYYSYEVSEINDIIVNQI
                     VEVFLGDKKGFGVAWEIEDFINKNANNKEVIAQSFVNSEYYLLSLYKIGVLLNQRLRQ
                     NTGMGIQNIDTNEAFTLHAVDTFIQLRKYSEDTVYKMIDTKISELLGLVEYDEYLPVE
                     RNTEANFAVKDFAMFLENLFTSIFENFPSQLRTLGLFRSYDFVSQHFLGVLKNADVFN
                     EIFIDNFDLDIKYLEKSMKNLNASTNEDKDSSQGNVSVDSTFSELRQIIDLLKSKNYE
                     EYMSNSSFRMRQYNSIKFEDGKKLIMKMQGVRFVNSSTSNIQANSEAPPLSRAQSPVQ
                     RGGTIKSLSHSISGSNFANILGGGNGNKNRDEDAVSNTSMTSLESSNTAPNINTATTT
                     SNKFSHFTDRFKPSSAR"
     gene            complement(<659927..>660304)
                     /locus_tag="PVL30_004114"
                     /db_xref="GeneID:85890392"
     mRNA            complement(<659927..>660304)
                     /locus_tag="PVL30_004114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119520.1"
                     /db_xref="GeneID:85890392"
     CDS             complement(659927..660304)
                     /locus_tag="PVL30_004114"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975503.1"
                     /db_xref="GeneID:85890392"
                     /translation="MLNRASIYISFPNHSSHLVKRLVTRPYTISIENPRSPQPSKPKI
                     SQFSHAIFNTLVMALGTYLFLNTVWTNSEYYELEKKFKQQSTELEQEIQTLVDLKNNE
                     LQHQQQQQQQQTQRWFRFLKFWK"
     gene            <660695..>661561
                     /gene="COX11"
                     /locus_tag="PVL30_004115"
                     /old_locus_tag="LELG_04397"
                     /db_xref="GeneID:5231390"
     mRNA            <660695..>661561
                     /gene="COX11"
                     /locus_tag="PVL30_004115"
                     /old_locus_tag="LELG_04397"
                     /product="Cytochrome c oxidase assembly protein cox11,
                     mitochondrial"
                     /transcript_id="XM_001524375.2"
                     /db_xref="GeneID:5231390"
     CDS             660695..661561
                     /gene="COX11"
                     /locus_tag="PVL30_004115"
                     /old_locus_tag="LELG_04397"
                     /codon_start=1
                     /transl_table=12
                     /product="Cytochrome c oxidase assembly protein cox11,
                     mitochondrial"
                     /protein_id="XP_001524425.2"
                     /db_xref="GeneID:5231390"
                     /db_xref="PFAM:PF04442"
                     /translation="MLKLLVQTSPLRRSNILRVSASRHLFPMLYTPCFRSFHQSHLVR
                     QVLKSKDHTAQATQEPAHELTHEERKLALERDRLNKPLRDRQEKQKYRNRTATYYSAA
                     VGIFFLALSFVAVPVYRAICQRTGWGGIPITDATKFTPDKVIPVDTNKRIRVQFTCQS
                     SGILPWKFTPLQREVYVVPGETALAFYRAKNMSKEDIIGMATYSITPENAAGYFNKIQ
                     CFCFEEQRLSAGEEVDMPVFFFIDPDFSKDPGMRNIDDIVLHYSFFKAAYSEGELAAV
                     PVGNADLKATVG"
     gene            <666148..>668289
                     /locus_tag="PVL30_004116"
                     /old_locus_tag="LELG_04398"
                     /db_xref="GeneID:5231519"
     mRNA            <666148..>668289
                     /locus_tag="PVL30_004116"
                     /old_locus_tag="LELG_04398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524376.2"
                     /db_xref="GeneID:5231519"
     CDS             666148..668289
                     /locus_tag="PVL30_004116"
                     /old_locus_tag="LELG_04398"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524426.2"
                     /db_xref="GeneID:5231519"
                     /db_xref="PFAM:PF01794"
                     /db_xref="PFAM:PF08022"
                     /db_xref="PFAM:PF08030"
                     /translation="MFGNKLSLLLFIFTSLVLQPAIAASGFEIYHADEFPVSACTGYL
                     AKVVTYFNATAVPKGGYCSVNNQPALATMAECIEILAKNRHKDSRKLFLASCKKSNLT
                     EEEYLEAYNNATSMGFVNSTADPSFNKTKLYYKPILLSTKKVNAAYDAYATRWYNYNY
                     AHWFGIALMCYWMGVLFFAGLINFLSFVAPGFIKSFKGKLVNKFRSWVTLPALFGKTH
                     AHHKTVFSHVHVMFPTRLESLIMFGWFVLFLVTICTNYVHVEGNYIWPQKWNEMGRKI
                     ADRTGIMVVWCLPVLFLFAGRNNFLQWISGWPYARFVYFHKWMSRIVFIVSIIHAVGM
                     TYNGRGIGKYGTRMAAAYVRWGVAALVIMGLMCFQTLAAFRRKNYELFLLVHIVLAIF
                     ATTGLWIHTADDGFDMWMWAAVAVWGFDRAVRIVRLCFFGLRTAQVQLIANETLMVTV
                     SRPAWWKPFPGCHAFIHFMRPTCFWQSHPFTIIDSVEENHTITFYLKVKGGVTHGLYQ
                     YLSNQPGQKASMKVSVEGPYGNPMPINRYESEVFIAGGNGIPGIYYEATSVAKKLGSK
                     RHIKFFWVIRHYRSLEWFYPELQKLQNLPIETTVYVTQPHVGLVEPITSNITDDEVEQ
                     QEQQEKKSDVEESVDYITQIKKQLSHIEFIESKPDFYSIVAQEISNATTPLAIASCAH
                     GSMVDDVRRSVVDNLNNSPHRVELFEQIQAW"
     gene            <670191..>672605
                     /locus_tag="PVL30_004117"
                     /old_locus_tag="LELG_04399"
                     /db_xref="GeneID:5231405"
     mRNA            <670191..>672605
                     /locus_tag="PVL30_004117"
                     /old_locus_tag="LELG_04399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524377.2"
                     /db_xref="GeneID:5231405"
     CDS             670191..672605
                     /locus_tag="PVL30_004117"
                     /old_locus_tag="LELG_04399"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524427.2"
                     /db_xref="GeneID:5231405"
                     /translation="MPNYHHHLRDEIYPTPTLPLLYERSSSKSSDASESSSSSSDYCD
                     ESPNASMCQKPVSNNALTIALSIVLPCIAIFCVLGFFLYRNYRKDKKEGLEHDPDFYE
                     TGEATALPDYPDSKGAYGHEDPFHNRNSVRYPMDQINQDSMPFNDDGRGKGYYKQNYH
                     HQQVSRDPYLDSFVLPYQHQTGSKLSLDDYAKNLGDSQGYRTPNDLQSRTRTNSMTLD
                     KATEAVGVAGGTIATATATTTANANTAGSSTGVVGASSYTHSRKPSSLISPTKKVQGK
                     QYTGVPDEHDHEEVASANPEVSTVMESSDDSEINSPHDKDAFGIEYENESNMAINNTI
                     PQIVVHDESASEHENEDTQESRPTSPFDDDDDTERNPQTMDTIVTSVPEDSHKTNVHH
                     SEKEDQDGEFNFSNQYEAQSKDTPSESITNSSDGDKLRVAEKPISKSPRISAFNLLKN
                     DSDDEGEAEDDEEMDALSPQQQEELRRMKSVYKVYFDREVVSGDHSNFEAEEDQSLPV
                     DNVNSHMQVDTSYGNRYSTGSSVYVDPEQLEPSDEQQQQQQQQQQQQQQYQQQQQHYY
                     DQFNQQYQQQFGSPVDPQLYRQIQQQQYHYYQQQQMQMQQRRQQQQPQRPLPPLQQLR
                     HPSDLRKSTIQTFTDFKPRHKNQNVTSPPMGKQPFVPIESDGVWTSPISSPAMQSQAS
                     FQSQQQQQQQLSQNGQQDYFSQQNYAPQQQMHHHPQQQQQQQQQQPHVKAVPSATQLS
                     RSSVVMLNPVTEITKSRKFKPAGSYPSNANLHAQFGHGDLNGPENDLLPGNRKSDVRR
                     MMNSNF"
     gene            <673485..>673775
                     /gene="MIC10"
                     /locus_tag="PVL30_004118"
                     /db_xref="GeneID:85890393"
     mRNA            <673485..>673775
                     /gene="MIC10"
                     /locus_tag="PVL30_004118"
                     /product="Mitochondrial inner membrane organizing system
                     component"
                     /transcript_id="XM_061119521.1"
                     /db_xref="GeneID:85890393"
     CDS             673485..673775
                     /gene="MIC10"
                     /locus_tag="PVL30_004118"
                     /note="BUSCO:EOG09265PQX"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial inner membrane organizing system
                     component"
                     /protein_id="XP_060975504.1"
                     /db_xref="GeneID:85890393"
                     /db_xref="PFAM:PF04418"
                     /translation="MSSESAQQQTITTQQQIIPTASQNLLNDKWDIVLSNALIKTGLG
                     FGGGVLASILFFKRRQFPVWLGIGFGLGRGYSEGDAIFRSAASAHGLRTVKK"
     gene            <674441..>675508
                     /gene="CWC23"
                     /locus_tag="PVL30_004119"
                     /old_locus_tag="LELG_04400"
                     /db_xref="GeneID:5231330"
     mRNA            <674441..>675508
                     /gene="CWC23"
                     /locus_tag="PVL30_004119"
                     /old_locus_tag="LELG_04400"
                     /product="U2-type spliceosomal complex subunit cwc23"
                     /transcript_id="XM_001524378.1"
                     /db_xref="GeneID:5231330"
     CDS             674441..675508
                     /gene="CWC23"
                     /locus_tag="PVL30_004119"
                     /old_locus_tag="LELG_04400"
                     /codon_start=1
                     /transl_table=12
                     /product="U2-type spliceosomal complex subunit cwc23"
                     /protein_id="XP_001524428.2"
                     /db_xref="GeneID:5231330"
                     /db_xref="PFAM:PF00226"
                     /translation="MDSLVRKIIKDNVNLYGVLGVDKSASLQEIRRAYRKQALIHHPD
                     KQTSRNKTTTSLQSSSLSSSYSSSSPSLSSSSSNALDNSQFDLILTSFQILSDESLRQ
                     QYDTLIDARAQRGQRQRNVNDLISKFQNDLLNAEKGLGKKRYTNIELLRQDGLKRMRL
                     HEEKILNNSNKQHKATTATENRLSSPSPSPSTSLSPSSTATTTTKSTTTIDDFPLPSM
                     LQFPPPMEQRFCAILKYKNKEGVNMDESVLGEIMEIFGPIKKVTLLTSDDRYAYATIE
                     YINSSSFHKALKYDYSTSSAWDGTRVKKLASLLRSLVKSNDNLREEGTTEKSWTNSTI
                     VNKVLENYVGSVSDNTASSTA"
     gene            complement(<675865..>676986)
                     /gene="KAE1"
                     /locus_tag="PVL30_004120"
                     /old_locus_tag="LELG_04401"
                     /db_xref="GeneID:5231467"
     mRNA            complement(<675865..>676986)
                     /gene="KAE1"
                     /locus_tag="PVL30_004120"
                     /old_locus_tag="LELG_04401"
                     /product="putative tRNA threonylcarbamoyladenosine
                     biosynthesis protein kae1"
                     /transcript_id="XM_001524379.2"
                     /db_xref="GeneID:5231467"
     CDS             complement(675865..676986)
                     /gene="KAE1"
                     /locus_tag="PVL30_004120"
                     /old_locus_tag="LELG_04401"
                     /note="BUSCO:EOG0926347W"
                     /codon_start=1
                     /transl_table=12
                     /product="putative tRNA threonylcarbamoyladenosine
                     biosynthesis protein kae1"
                     /protein_id="XP_001524429.2"
                     /db_xref="GeneID:5231467"
                     /db_xref="PFAM:PF00814"
                     /translation="MVVDLDKHLKPGKDSYIALGLEGSANKLGVGVIRHPRGQLTSSN
                     RAEVLSNIRDTYITPPGEGFLPRDTARHHRNWVVRVIKKALATARIAGSQIDCICFTQ
                     GPGMGAPLQSVVIAARTLAQLWDVPLVGVNHCVGHIEMGREITGADNPVVLYVSGGNT
                     QVIAYSKQRYRIFGETLDIAIGNCLDRFARTLKIPNEPAPGYNIEQMAKRGKHLVSLP
                     YTIKGMDMSMSGILAYIDGIAKDLFSEKQKRNLVDEETGEQITAEDLCFSLQEILFSM
                     LVEITERALAHVDSNQVLIVGGVGSNERLQEMMKLMIQDRKNGQIYATDERFCIDNGI
                     MIAHAGLLQYRMGQTNELKNTVCTQRFRTDEVFVNWRDD"
     gene            <677559..>678311
                     /locus_tag="PVL30_004121"
                     /old_locus_tag="LELG_04402"
                     /db_xref="GeneID:5231340"
     mRNA            <677559..>678311
                     /locus_tag="PVL30_004121"
                     /old_locus_tag="LELG_04402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524380.1"
                     /db_xref="GeneID:5231340"
     CDS             677559..678311
                     /locus_tag="PVL30_004121"
                     /old_locus_tag="LELG_04402"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524430.2"
                     /db_xref="GeneID:5231340"
                     /db_xref="PFAM:PF08657"
                     /translation="MSLLEQLNRIETSISNIQSYEFSKPGIFTNAIVNRPPITTLLKD
                     PSTDERNLYTVTTPKIGNQLPNEVEIERVDGRKRYIEHDAIEDSFLYDASTASASQFE
                     DYDLPVARIPTLLPPNSETQSKLLLDLDQQSNSKSCAEKVEQLLSVANKYPNLIENAR
                     ETRNKLVLYLRNVNELENEIAVLENEIDECKVRLRNEHNVATSPVKQRFIREQILQPR
                     VSEQVVDIEELIAKEEEEIQSLEQEVNDKLKH"
     gene            complement(<678543..>679176)
                     /gene="RPL30"
                     /locus_tag="PVL30_004122"
                     /old_locus_tag="LELG_04403"
                     /db_xref="GeneID:5231392"
     mRNA            complement(join(<678543..678860,679174..>679176))
                     /gene="RPL30"
                     /locus_tag="PVL30_004122"
                     /old_locus_tag="LELG_04403"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_061119522.1"
                     /db_xref="GeneID:5231392"
     CDS             complement(join(678543..678860,679174..679176))
                     /gene="RPL30"
                     /locus_tag="PVL30_004122"
                     /old_locus_tag="LELG_04403"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_060975505.1"
                     /db_xref="GeneID:5231392"
                     /db_xref="PFAM:PF01248"
                     /translation="MAPKSAKNQENINSKLALTIKSGKYTLGYKSVVKSLRNGKAKLV
                     VIAANTPVLRKSELEYYAMLSKTPVYYFQGGNNELGTVCGKLFRVGTLSILDAGDSDI
                     LTSV"
     gene            <680108..>680575
                     /gene="RPL24"
                     /locus_tag="PVL30_004123"
                     /old_locus_tag="LELG_04404"
                     /db_xref="GeneID:5231404"
     mRNA            <680108..>680575
                     /gene="RPL24"
                     /locus_tag="PVL30_004123"
                     /old_locus_tag="LELG_04404"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_001524382.1"
                     /db_xref="GeneID:5231404"
     CDS             680108..680575
                     /gene="RPL24"
                     /locus_tag="PVL30_004123"
                     /old_locus_tag="LELG_04404"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_001524432.1"
                     /db_xref="GeneID:5231404"
                     /db_xref="PFAM:PF01246"
                     /translation="MKIEVDSFSGSKIYPGRGTLFVRGDSKIFRFQSSKSASLFQQRK
                     NPRRISWTVLYRRHHKKGISEETSKKRTRKTVKHQRAIVGASLELIKERRSQKPSDRK
                     AARESKLAKDKEAKKAAKAARKAEKAKAAASGASVVSKQGAKGSFQKVKATSR"
     gene            complement(<680799..>681863)
                     /locus_tag="PVL30_004124"
                     /old_locus_tag="LELG_04405"
                     /db_xref="GeneID:5231449"
     mRNA            complement(<680799..>681863)
                     /locus_tag="PVL30_004124"
                     /old_locus_tag="LELG_04405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524383.2"
                     /db_xref="GeneID:5231449"
     CDS             complement(680799..681863)
                     /locus_tag="PVL30_004124"
                     /old_locus_tag="LELG_04405"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524433.2"
                     /db_xref="GeneID:5231449"
                     /translation="MKDLLVIHIGAGNHAVTSNKKYSNLLRKALSHNNILDAASEVEV
                     SNLTNTGYGSSLNKVGKVEIDASFIDSASSFHASWANNCRLPQNGTKPTQPETKAVRI
                     GSITGLKCREPTREMVRIFGELEQQYAETPYLTMPISLNCTSLKSYMKINEDKDEDLI
                     SAKAQRIYEIYNTDGISTTAKEEISDTVGLTQIKEHGFVMVTSSGGNFFKLPGRIGCA
                     GVINAAISHKETNGLKISCMCSGNGEQIIRYNLASFLVEKFSTRFGELEWGPNLSKEL
                     FALDSELYIGFIVIIEPIVNIVNNNGGCEHVKKISLIYGHSTESFHFGYRAGDNETKT
                     ILSFAEKKESFTFGEYCISC"
     gene            complement(<682538..>686758)
                     /locus_tag="PVL30_004125"
                     /old_locus_tag="LELG_04406"
                     /db_xref="GeneID:5231381"
     mRNA            complement(<682538..>686758)
                     /locus_tag="PVL30_004125"
                     /old_locus_tag="LELG_04406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524384.2"
                     /db_xref="GeneID:5231381"
     CDS             complement(682538..686758)
                     /locus_tag="PVL30_004125"
                     /old_locus_tag="LELG_04406"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524434.2"
                     /db_xref="GeneID:5231381"
                     /db_xref="PFAM:PF07714"
                     /translation="MSSVSTSPMPTALAHPTTCPSTSTSTSASASQSQLQSQHSNKSH
                     VNTLQETSSTIHNNEAQPKNVARSNSKVTEHSTKREQEQSNSAFSREPSLVQSHKTNT
                     SNNCSPFTSPRASRPENMYQNDKLNITPGISTIATTAAKPTATTTTTTTTTTTTTTTT
                     DTTTAATLNRSRGVSTSARNANDLLKQNTGNQNFENASRSPSAFPNRMTQTPIINSSK
                     NSTPGYSSPVKETKRVLLEYDPITRRKVLNTYEILREIGKGEHGKVKLAKDLINQELV
                     AIKILNRKYKKERPSLRQRRDSKAPIVNEYERKIKREIAIMKKCRHKHIVALKEVLDD
                     TSSHKIYMVLEYMEKGEIKWKRLQSDLSRKFCSNIDEKDIPCCGSSAEPRQPHHRLSS
                     EEDLLSNKYSPNLTFKQSRKVFRDVLLGLEYLHMHGVVHRDIKPANLLVSADNVVKIS
                     DFGVSFASSLSNCEEGHLINEFDLAKTAGTPAFFAPELCNLDCDDNGVCRTSTKIDHR
                     IDIWALGVTLFCLLFGKVPFNADSEFELFNVIVNKPLKLPESVEEFCSPGPVSQDEFE
                     LACDLLRKMLCKDPDERLTIEQIKEHPFTLMDLGESVESLQELFNLNNENGQPTTLDF
                     NLDDCDIVTNDEINNAIIGVGARIKRSLVRAIKAGGLSESEIRGKFHSMEYQRSKRGS
                     AGSSDESSSGYSNLNSSVKLNQMHNNHSVILSEQPLVASVSPLLLNGDSTTSLSKTGD
                     ESGQNISNSQINPNNHQHNPHIPSQLSHQIPTRSSSSIAFHNPYSLTQLREGGKSILH
                     EMIEPQSANSSRRGSAGGIEAPQIETKRNVGGNLYLKNQSVLETFKGIQQEDNKRRRS
                     SLFNPAHPSTSNKSSISTDGHVAHAHSRLNEEQKGQDLPVQVQKSSGLAPAAEPEPAT
                     TATTATAAPPPPAPPLVTPIPVPAIKPNFEFYQNRINRMDAKSDILSPTDDDEQTGKG
                     GKFKSRGNFDDDDDDDDDEEEEEDGPFFKGSMLKQLGLDDQMESSFMSLPLNESFASL
                     DSFNDDYLSMKYKEFAENGKDPSAIHAKQMLRRKSSFSEADLHRSEIANGLASRFENF
                     NLANQMNRVGDNMTSLHAKKHSDEEGIAPGSGQVEFFSNRSNSDSCSSYSSNSSSSDE
                     EDEVGDDDNNNNESDDESDEEKLTLAFHSKLAPSNRPPFLSPKNRAKSHDSHIPYLHG
                     TMQRVDDVAPVIFHTGSPEFEDVPSALMEAAPISNNLRVQTPTVINGGFEQLDQNIGQ
                     SIGQNIDQSTGQTKANESNKWTSPTKDIKQRRKDSVISKIVANATNRSEPKTQQQLFR
                     ENIYNYQFNNHYKKAPIFSAFPDAVKHLDNDQQAILETSRNKFNNNRPSYYRSNSIAV
                     GVLQHTSDDIVEDMIESRKNSASPEKNA"
     gene            <689195..>689830
                     /locus_tag="PVL30_004126"
                     /old_locus_tag="LELG_04407"
                     /db_xref="GeneID:5231391"
     mRNA            <689195..>689830
                     /locus_tag="PVL30_004126"
                     /old_locus_tag="LELG_04407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524385.2"
                     /db_xref="GeneID:5231391"
     CDS             689195..689830
                     /locus_tag="PVL30_004126"
                     /old_locus_tag="LELG_04407"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524435.2"
                     /db_xref="GeneID:5231391"
                     /translation="MDNPNINLDFDEVELFQQLSAGTTGKDDELTSINARKRQQHSSQ
                     HSSQHSSQKSNHLLNSATSTSSKSKAEVLQMYDQLRKHYVNNNFIEIMFLLPTIAKFN
                     MVPPIFNLIIGCSFIHFGRISSAFREIGFAVCMAPTEHKRKEFLKVLAYTYADLNKTE
                     YVLGCLGEILDISRNNLVNTEDFENMKNEICGLEKELMQRLEMARINNKYV"
     gene            <689861..>691412
                     /locus_tag="PVL30_004127"
                     /old_locus_tag="LELG_04408"
                     /db_xref="GeneID:5231311"
     mRNA            join(<689861..689865,690035..>691412)
                     /locus_tag="PVL30_004127"
                     /old_locus_tag="LELG_04408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524386.2"
                     /db_xref="GeneID:5231311"
     CDS             join(689861..689865,690035..691412)
                     /locus_tag="PVL30_004127"
                     /old_locus_tag="LELG_04408"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524436.2"
                     /db_xref="GeneID:5231311"
                     /translation="MMINKSKSFDDQILDLQIVDKVFPKTSFTGKCQVIVNKIHEADS
                     ILQIWNKERKPLKSNLFKLLVEAIFVLGPDIAYYHMFKMEPIMNQYFEFLNNQPLQPK
                     QKKHTVSTFFAGKTTTVSNAHAWQVKLIKGFIAMLRHEYKEAADLFAESVEIYNNAID
                     NNNNNNGNNSDNNSSNNGNNDSDINNTNNKCNLDFSSKTAFLGCLCQANEANQSKKQL
                     EVLAIKISNSPFNSALNYQVLAKVYHKLHVLEKQKTRKSILKTFKPNNRNMALKCYIS
                     AATLAEEDNLLIAEYYDNILNFLVGEIRECIGSSKNTGKGNNKAHNHLRMRYLVFFYQ
                     VRNLFCLYSDYNYLHIPGLVCDWQVVKQDEKILNKIQQYVDGTNEISDDEEEENEENE
                     DDDRNDENDDNSTVPRDTTMRSIRSTPKSANQSEMPPDKSFDLIDYWVKEYQTYKGEI
                     PDAVKKFMPS"
     gene            <691841..>693397
                     /locus_tag="PVL30_004128"
                     /old_locus_tag="LELG_04409"
                     /db_xref="GeneID:5231309"
     mRNA            <691841..>693397
                     /locus_tag="PVL30_004128"
                     /old_locus_tag="LELG_04409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524387.2"
                     /db_xref="GeneID:5231309"
     CDS             691841..693397
                     /locus_tag="PVL30_004128"
                     /old_locus_tag="LELG_04409"
                     /note="BUSCO:EOG09261DJC"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524437.2"
                     /db_xref="GeneID:5231309"
                     /db_xref="PFAM:PF01302"
                     /db_xref="PFAM:PF13855"
                     /translation="MSQYTINDRISTKDGYLATIKFVGHIAPWGDQILAYGLEWDDAT
                     RGKNNGSVNGISYFKPTISNSASFVKSTNKTITWSRQSFVEVVQSQYLNTEYHDQEIK
                     FGSKILKETGLEELNRRYKNLESIKSLSLDHCLIWKAWSNKEDESIEGGVTDKVFTGL
                     KSLHRLDLSSNLFSDFEQVTKIIARLPALEELILNGNRFTLSSLQSSCPKIMSSDTLV
                     RLKLASTLLPVDKVNQLATKFQELKELILSANDYDNECIAKLSFVQNPQLHYLDLSYN
                     KLQRIPRLGILKEVNLSHNEICILQEQTLDISNRVEALDLRHNCISSWKEIDTLASVA
                     KNLKRLRINHNPLFDDITIDDMTVQLIARFQCGPSNLNELNGSKLSLSEIENSELYFI
                     SKVQSGEYQMPNEDRWTQLLRKYNKHAIREEQPTFKPWLKLSLSVFDSGNHTEPKHYR
                     FLKSATVLSFKGSISKLLLNNMSILKFKVFYYTNEDSEFAVKHEIDNYMATLNDFAFS
                     EGQKVYISVR"
     gene            complement(<693484..>694044)
                     /gene="TMA20"
                     /locus_tag="PVL30_004129"
                     /db_xref="GeneID:85890394"
     mRNA            complement(<693484..>694044)
                     /gene="TMA20"
                     /locus_tag="PVL30_004129"
                     /product="translation machinery-associated protein 20"
                     /transcript_id="XM_061119523.1"
                     /db_xref="GeneID:85890394"
     CDS             complement(693484..694044)
                     /gene="TMA20"
                     /locus_tag="PVL30_004129"
                     /note="BUSCO:EOG09264RQY"
                     /codon_start=1
                     /transl_table=12
                     /product="translation machinery-associated protein 20"
                     /protein_id="XP_060975506.1"
                     /db_xref="GeneID:85890394"
                     /db_xref="PFAM:PF01472"
                     /db_xref="PFAM:PF17832"
                     /translation="MFKKFTKEDIHSRSNIKSSVQRGLKQNFVSKYPDLEPAIDTLIP
                     KKSQVILIKCEEKIQLYAVNNGSDSSNDIVLFQHFDDIAPTLRTVHQYPECFPRVQVD
                     RGAIKFVLGGANVMCPGLTSKGALLPEENWEVGKIVAIYAEGKENALALGKLTMSIDD
                     IKTKNKGIGIELLHYLGDGLWNHSEE"
     gene            complement(<695400..>698747)
                     /gene="MPH1"
                     /locus_tag="PVL30_004130"
                     /old_locus_tag="LELG_04412"
                     /db_xref="GeneID:5231516"
     mRNA            complement(join(<695400..698667,698710..>698747))
                     /gene="MPH1"
                     /locus_tag="PVL30_004130"
                     /old_locus_tag="LELG_04412"
                     /product="3'-5' DNA helicase"
                     /transcript_id="XM_061119524.1"
                     /db_xref="GeneID:5231516"
     CDS             complement(join(695400..698667,698710..698747))
                     /gene="MPH1"
                     /locus_tag="PVL30_004130"
                     /old_locus_tag="LELG_04412"
                     /note="BUSCO:EOG092614O9"
                     /codon_start=1
                     /transl_table=12
                     /product="3'-5' DNA helicase"
                     /protein_id="XP_060975507.1"
                     /db_xref="GeneID:5231516"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF04851"
                     /translation="MPYNKSESESKSRSDDELDYSDWEDDVGVVAQQAHKQSSLDSGM
                     DQTIQLQLQHVQEQQSGTATTTSTTATTTSTTATTTSTTATTTSTTYQTRIHIPTHHE
                     MNFEELKTYIYPTNLEVRDYQFSIVRSAFYHNLLVALPTGLGKTFIASTVMLNFLRWF
                     PKSKIVFMAPTKPLVAQQIKACCSITGIPASKVAILLDETRKNRGEIWNSRQVFFTTP
                     QVVENDLAFGSVNPKSISLLVIDEAHRARGNYSYNNVVNFLKRFNDSFRILALTATPA
                     ADVEGVQNVIDNLMISKVEVRTEDSDDIVKYMKTKKVCRRVLAVSDEIRECIDLLATA
                     VAPVLKSANEKGLLDVTDPTRINAFKCMEASRRLLANKNVPEGLKWAQYFILQLLGTV
                     GQCYRRLNIYGVNSFYSYFQEKHKEFTAKWNSKKSKNKLNADFYFSEPIKKLLEAREK
                     VISNQAYSHPKIEALMEELEDFFQAKDTSSSRVIIFTEFRESALEIVKAIENAKNGSK
                     PHIFIGQAKEKDKFDEENFGKKKKNSKGKQGKGKNKEEEDRVAARSSSEKAQISGMNQ
                     KLQKEIIRQFKNGDYNVLVATSIGEEGLDIGEVDLIVCYDSTSSPIKNIQRMGRTGRK
                     RDGKVVLLFSSNEEMKFDKAMAGYQYIQNHIMQGDLITLYNQNRILPQEFTPEVVRTK
                     IEIPEENMIIKCEDDEDEIIRIATQYMLGNTPKSPARKAAKSTSGIKGTKGTKGSTSK
                     KGSSKLKAEKPQKRFFMPDNVETGFQTVGKMLNEGTRSSEVNQHSESVLLEPQIHPRK
                     TKTVLDKLIDSGSDDDDDDDDDEQGILSSPFHPADKNSLPKSFDNQNKIEHTSQQNRN
                     SNTNNSGNNTNNTNNTNNNTNNSDNSTTNNNNSINEQEGEENATGNFTRTPSTSFMDT
                     HELEPASKKSSGPVVAQPIIGDILDDSFSFSDDDDDDEIPEIDPKEPSAIPHIKFDYQ
                     KGHSKTLGIPHNPILLEKNIPKKRMLIDENEQFYPALSTDAKSQNNCVHPQVKKKKKM
                     SLGVKRITIPSDSSHSKQLCNVPLKENGQVQEKLVRKEAKEDSFRSTDMEDPFDDDLD
                     EVIANYTSARRSQ"
     gene            complement(<699159..>700697)
                     /gene="NUG1"
                     /locus_tag="PVL30_004131"
                     /old_locus_tag="LELG_04413"
                     /db_xref="GeneID:5231511"
     mRNA            complement(<699159..>700697)
                     /gene="NUG1"
                     /locus_tag="PVL30_004131"
                     /old_locus_tag="LELG_04413"
                     /product="nuclear GTP-binding protein nug1"
                     /transcript_id="XM_001524391.2"
                     /db_xref="GeneID:5231511"
     CDS             complement(699159..700697)
                     /gene="NUG1"
                     /locus_tag="PVL30_004131"
                     /old_locus_tag="LELG_04413"
                     /codon_start=1
                     /transl_table=12
                     /product="nuclear GTP-binding protein nug1"
                     /protein_id="XP_001524441.2"
                     /db_xref="GeneID:5231511"
                     /db_xref="PFAM:PF01926"
                     /db_xref="PFAM:PF08701"
                     /translation="MREGIKKKAAAKRRKDKKLSKKDITWKSKHRKDPGIPASFPYKD
                     QIITELEENRRAEKEKREELKLKRQMEKEAGLMSAELGDEEMDVESDTESDDGANGLG
                     ALLESAKQAAKEYEGGSFDDNDDDDNKMVDDDDDDEADIEYSISDVDDGDEEDRGALD
                     KSRKSYDKIFKTVVDASDVVLYVLDARDPESTRSRKVEQAVLQNPGKRLILLLNKVDL
                     IPTESLNQWLAFLKSSFPTIPIKAAPGATNAASFNKSLSFASTADVLMKALKAYANKS
                     NLKRSIVVGVIGYPNVGKSSIINALTKRHNNHSKACPVGNQAGVTTSMREVKIDNKLK
                     ILDSPGIVFPDEIMNTKKQTKSQQNAKLALLSAIPPKQITDPTGAVQLLLKKFSQNTE
                     MADGLKKYYDLPPLPSSDLNEFLKHFLIHIARTKGRLGKGGVPNLEAAALSVLNDWRD
                     GRLIGWTLPNASKQKATIVDPEAPKSSLRGEKEPPKVEQTTIVSAWAKEFDLDGLLGE
                     DFQN"
     gene            complement(<701426..>701876)
                     /locus_tag="PVL30_004132"
                     /db_xref="GeneID:85890395"
     mRNA            complement(join(<701426..701674,701826..>701876))
                     /locus_tag="PVL30_004132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119525.1"
                     /db_xref="GeneID:85890395"
     CDS             complement(join(701426..701674,701826..701876))
                     /locus_tag="PVL30_004132"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975508.1"
                     /db_xref="GeneID:85890395"
                     /translation="MFVNYKQHVIVEYYYPKRLQSCKKKRERNAQLIPFLRVGLVVKS
                     VELKDLSNDTIKGAPSQLMNAKAIIYYYKSVVIDGDEDEDEDEDDDDEEEVEENK"
     gene            complement(<702162..>704264)
                     /gene="YND1"
                     /locus_tag="PVL30_004133"
                     /old_locus_tag="LELG_04414"
                     /db_xref="GeneID:5231367"
     mRNA            complement(<702162..>704264)
                     /gene="YND1"
                     /locus_tag="PVL30_004133"
                     /old_locus_tag="LELG_04414"
                     /product="Golgi apyrase"
                     /transcript_id="XM_001524392.2"
                     /db_xref="GeneID:5231367"
     CDS             complement(702162..704264)
                     /gene="YND1"
                     /locus_tag="PVL30_004133"
                     /old_locus_tag="LELG_04414"
                     /codon_start=1
                     /transl_table=12
                     /product="Golgi apyrase"
                     /protein_id="XP_001524442.2"
                     /db_xref="GeneID:5231367"
                     /db_xref="PFAM:PF01150"
                     /translation="MSDVPTMVPRSEANKYKYGIVIDSGSSGSRIQIYKWEDPSLQKS
                     SNDQNVLRSPPKITQEDNWTKKITPGVSTYNTKSKITQIWSKHYSELMKFAESIIPAD
                     KHQDTPVFVLSTAGMRLLPKRTQKAILQETCNSIRQNTNFQISSCRLNVQTIDGSTEG
                     IYGWLGLNYLMGQFNNYDPSSSSHETIGFMDMGGASTQIAFVPSSAEQIERHREDLSR
                     VTLRTVEGQTVEWNLFVATWLGFGANEARKRYIKQLINLASVNENLHDRINDPCLPKG
                     ATFTHEFDGKKFTIEGVGNYEMCVRSIYPLLMKSIPCAEEPCLFNGIHGPKLDFQKDK
                     FVGVSEYWYTANDIFQSGGEYDFKGFNSRVKEYCESPWGTILQNSKDGQYSGLDPEKF
                     LKDACFKASWVMNVLHDGFELPRIGFELDQDGADDVGKDDSSKAIMNKHVPFKSADSV
                     GGKELSWTLGRILLYASSQIEPLKNDDLEIGIYPSEISGTEFISGGHNSGYISEDDSD
                     DEKDGPFGHFIYSSIFVFLMFFFIYHFGKHHFKRWGKGLNYLPIPLQVSNFVARVAQK
                     IPGFDSFAVHSRAYNELEQSISLEEGYRVTDSPRQSTNYSPDSSVLRTRSAIGLNDEY
                     ENSVRDIPVPASASSSIGAGTGGGNNNSHFAPRVNNFLSKPFMIPKASSNFQISRENS
                     AESLSKKASIARSKSSLE"
     gene            <704678..>706117
                     /locus_tag="PVL30_004134"
                     /old_locus_tag="LELG_04415"
                     /db_xref="GeneID:5231297"
     mRNA            <704678..>706117
                     /locus_tag="PVL30_004134"
                     /old_locus_tag="LELG_04415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524393.2"
                     /db_xref="GeneID:5231297"
     CDS             704678..706117
                     /locus_tag="PVL30_004134"
                     /old_locus_tag="LELG_04415"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524443.2"
                     /db_xref="GeneID:5231297"
                     /db_xref="PFAM:PF17306"
                     /translation="MIVLPNTPPRPISFVEPTLEIDDASLHTLRASIQSSNSQNSDSI
                     RYVLDLEQYLDSLYSKLKENFDLHTVICSNIPWSNLNRVKPKLLKSVAKISTTNRVDL
                     LKWTLLNEVVVTAVSVGLLYVRIASDLLNNTINIDVSSTTQKLEEVNENWKRIVNLYK
                     KSISFFLFAEKLQAKVFNYDTNVFINKAIAPILIKVSEMCIQVSILAKSLWLNRSAFE
                     RNENFGTENNTTLSKVAISCVNESESCLNLLNALSNDKATPRRAISDNNDNTYSNNNN
                     NKNDNENNEVNAPVVVNLNYDGWYEYLTLFKRYVNAYAALFLAIQSYKEGKIGNALGL
                     IHFGLLSLQSKKDVTSNSLESNIKSRKPFQKLREKTAKRKNEKLLSTLDSISTLKIKD
                     SSFNDKSGIVLNDLAFLFDQLINYNNKFTSENNKLNYEEVVHWSAVGTDTKWPIGCKI
                     PISNINPYEPGETTNTMKESDYAGRGSYF"
     gene            complement(<706428..>709466)
                     /locus_tag="PVL30_004135"
                     /old_locus_tag="LELG_04416"
                     /db_xref="GeneID:5231351"
     mRNA            complement(<706428..>709466)
                     /locus_tag="PVL30_004135"
                     /old_locus_tag="LELG_04416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524394.2"
                     /db_xref="GeneID:5231351"
     CDS             complement(706428..709466)
                     /locus_tag="PVL30_004135"
                     /old_locus_tag="LELG_04416"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524444.2"
                     /db_xref="GeneID:5231351"
                     /db_xref="PFAM:PF02170"
                     /db_xref="PFAM:PF02171"
                     /translation="MSDQANQGRGRGRGGGGGGGGRGRGRGGSNSNSGNGDRGERGGA
                     RGNERGGRGDGRGGFGNRGTSGGRGGRGGSGGGSGGRGGSSLTKLNNIKVEFTDKAVN
                     ADNLKSIAVYEKDYAKQISVDPNPILLRHDYGSAGAPVDIATNFLKYNVSNLKVYLYH
                     ADIQEEGDEGEGAETGNSRAKNKKEKSVSGIRKPKMTVKQAVENYLFDLEPFKSKRPQ
                     IYYRDYNIMYSSVPLPIEDTVIYPIKEKQLAIKVQFVKELQFNDLFKISTLKTYTRDF
                     QEATEYTNALIAIIGSKALKNHGAVGVGANKFFLFEKNTPVEDFQKGLFIALGTFVSV
                     RCSFGNVRVNINPTPAIFYKAFKPDGNPMSVVDLVQDYLQIKGVPNESDVKKVQSFLK
                     GLKVYRNYLKKISGKAIQGFNFRENSNTLKFEDSDGKLTSVAAYFKSKWNIALKYPQL
                     PLLKIGPTAYLPMEVAYVVPNQQYKGEVYDTRTLIRLTALRPMDKAKFLTQEGKKLLS
                     EVDFGKIDTKFTKIPSRILPAPAIEYKDNKFVTYKEEQFNGKNEKKKGNWNLEKMQFY
                     SSPKGKKSYNFGVFVLVDRFFQKKREHLGEACEIFFAELNRLGIKNAGSKYQRYSVDL
                     ESPAVADEQSLEKSLVDLFSKAKNKDKCDFLLVVLPSKDARFYRAVKRAGDLKVGINN
                     SCVIVDTFTKRKFDKFDMTLFAQVGMKVNLKLGGSNHKLSDANSKGLVDEKKVPVFIL
                     GADVTHPTGESNEESVSIASVVGSEDAIFNSFPGSLRVQGGGQEVIAEIKDMVYERLE
                     NFHKKVGKLPSKVLFYRDGVSEGQYYTVLKEELPKVKAAFSEYGKAKNIKFNPKITFM
                     IVVKRHQTRFIPLSENAVSLATKKNIAATANDNVIPGTVVDRDITSIAFFDFYIQSQQ
                     ALQGTGIPAHYYVLHDENSYTSDEIQRITYNLCHTFGRATKSVKVVPAAYYADLLCTR
                     GRCYVGPPSRDAPSKNVIDYYKAKLGDNVAKSIKNTMFYI"
     gene            complement(<710404..>714957)
                     /gene="TFC3"
                     /locus_tag="PVL30_004136"
                     /old_locus_tag="LELG_04419"
                     /db_xref="GeneID:5231452"
     mRNA            complement(<710404..>714957)
                     /gene="TFC3"
                     /locus_tag="PVL30_004136"
                     /old_locus_tag="LELG_04419"
                     /product="RNA polymerase III transcription initiation
                     factor complex subunit"
                     /transcript_id="XM_001524397.2"
                     /db_xref="GeneID:5231452"
     CDS             complement(710404..714957)
                     /gene="TFC3"
                     /locus_tag="PVL30_004136"
                     /old_locus_tag="LELG_04419"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase III transcription initiation
                     factor complex subunit"
                     /protein_id="XP_001524447.2"
                     /db_xref="GeneID:5231452"
                     /db_xref="PFAM:PF04182"
                     /db_xref="PFAM:PF20222"
                     /translation="MSFSCTPYELVAFTEEKLSFSGSKGLLLSELWQHIQDKLHQTNY
                     LDDFQKQTIWKWLLFDVRAYDDHEEVKYYVTYDKDPITIESDYQSFINKQKKPLDLRI
                     RATDDTQCFHLTGQSNYKRCIQTLGVFPYQLLVEIAKYGDKGAWSVEVSDATGQDKRS
                     MTGRLNKLEESGLIVKEQRYWKEKKIHTSWVVHYKLTSRVGADKPPQSHEDEMDKTPD
                     KIRQFIVNALKDATNHIRTFRDLKVEMKMHLVQHMSRLFEGVVDTLVESGCVERIDVP
                     HHHYPERMVYALRYLKDLPLGDDAIFDNDSLLSRLREKKSLIDKGKEMFGEDFKMEEK
                     EEKKEKENRDMVIDEEDNDGHKDHFPSATFNDIYTLATQVYQTIEDAGSAGTTSRQLI
                     QAIMGEGKHRGIAKILESFPTFLVNDDVLIPQQEYPGEDPHHAIVRQSETDGRTKYYR
                     YYTKQNFNSARVKGSHKKSRPRAQLEHASLLDLEIQHRTRLEKTPSGDLVEIPNSILT
                     KRPLNNAEEEEEEEEEEEEKEREEREQDSVIIELLKNNEPTVLGNICGTPAAGPKRGR
                     PRKTPKKEEILHKDDQDKVKLENESENENEKERERERERKKVRDKKVGEEGDHYDGDE
                     VQIRKKAKTTKAKEVKRQRKEHTEKEPKELARTAKPEIESSKDTNGNKLNLTNTSEVD
                     IHATEPMVSKRLTRGMARKEKETHVVEARKEQDGKTGKRKLSNDSDNKDDVLTTKIKR
                     RPNILDFFKSVSPEKSKQKLDYDDALATENNSVDGVQNKRNIEENENKQHSEQKQVQE
                     HEQGHEQGEMDLQSPTDKAPASQENVEATENESNVIQKEKSISVKMEPNENHSNSMNL
                     NKPQSQTFTPTLKQPIVKARSRKVLEKSMQRSADVTGSSRRKVLLEVIKNLGGVTFAR
                     AKLAKLLDERMGSDTTTDLKTIVRDIHKLVESGDLEVQLVQVKENGQDMTRRLMILTD
                     PKERPSDEMIEKVKTNSSVWGRSGYMASQKTRKLIGETYDVVNPQEALGRRLPRLSSL
                     KSKEPRTVRLVGDGEKQYPARPPKEKASNRKAPSEKNFRSRRKERKKEINMSIDFPIQ
                     FDRNDVTQIFRAVCICKSFKKNVIDFEAIAALFLNADADTIKRLWNQVRRQLGGMSSV
                     KKGEEAFEQIVLQKIEENYIGVDDLNDIQLPFFLNLWDSSDPSKIYMSERYPLYNSIE
                     DNLSYYNKSNPEQTQDLFDNLELPSMKLKEEALVSKSFDYNDLDTTIVVEPKSAQIRT
                     AIKALFITRPSQQSKVDIDRILKDFDESELEQVSVAMNQEGDLLFQNENPTTKFSITE
                     KVFEPIQDCVSKSFFKTANQFRENLLEITSSKKGLVITQGLEDSNAAQLLSLLSSNMV
                     SMTHIDHPYKFEGYESRAVDKDCLECDMLVYKDSGSNAAQEPSIKNVPVPVGKPCSYV
                     WVDSHGQINSELWRNIIAALVYFIHSRPGIPSVFLYKKYQRLLSYKELNVVLDWLKKS
                     QFIVHGPFDGYSTTSNWFSILGS"
     gene            <715758..>716519
                     /gene="EFM5_2"
                     /locus_tag="PVL30_004137"
                     /old_locus_tag="LELG_04420"
                     /db_xref="GeneID:5231462"
     mRNA            <715758..>716519
                     /gene="EFM5_2"
                     /locus_tag="PVL30_004137"
                     /old_locus_tag="LELG_04420"
                     /product="Protein-lysine N-methyltransferase efm5"
                     /transcript_id="XM_001524398.1"
                     /db_xref="GeneID:5231462"
     CDS             715758..716519
                     /gene="EFM5_2"
                     /locus_tag="PVL30_004137"
                     /old_locus_tag="LELG_04420"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein-lysine N-methyltransferase efm5"
                     /protein_id="XP_001524448.2"
                     /db_xref="GeneID:5231462"
                     /db_xref="PFAM:PF10237"
                     /translation="MSDSDDEPITLSAHALAALQEFKSEEKQRLEKFESLYQASEDKF
                     ADQQQQQPGHIITIDDFKEDWQLSQFWYADETAKILGKALLEGADEDTVVVIASAPSV
                     YAAIKQLPEDEIPTKHIYLLEFDPRFKVLAGEQYFSVYDYNKPDEIPAHLKHKCHRLL
                     IDPPFLEEVCQNKSAEAAKNLLVEESERSAKTASGDNKFKLISSTGERMHKVVERNYP
                     GVHVTNFLPEHKNGLSNEFRCYANFEGSFWKFDKS"
     gene            complement(<716803..>717976)
                     /gene="EFB1"
                     /locus_tag="PVL30_004138"
                     /old_locus_tag="LELG_04421"
                     /db_xref="GeneID:5231509"
     mRNA            complement(join(<716803..717370,717897..>717976))
                     /gene="EFB1"
                     /locus_tag="PVL30_004138"
                     /old_locus_tag="LELG_04421"
                     /product="Translation elongation factor 1 beta"
                     /transcript_id="XM_001524399.1"
                     /db_xref="GeneID:5231509"
     CDS             complement(join(716803..717370,717897..717976))
                     /gene="EFB1"
                     /locus_tag="PVL30_004138"
                     /old_locus_tag="LELG_04421"
                     /note="BUSCO:EOG092644ZU"
                     /codon_start=1
                     /transl_table=12
                     /product="Translation elongation factor 1 beta"
                     /protein_id="XP_001524449.1"
                     /db_xref="GeneID:5231509"
                     /db_xref="PFAM:PF00736"
                     /db_xref="PFAM:PF10587"
                     /translation="MSFSDFNKVETVKSLNHFLADKSYIDGAAPTQADVKVYKAFQKE
                     YPAFTRWFNHIASFTDEFAELPAGNDSPAPAAAKKEAAAEEDDDDVDLFGSDDDEVDE
                     EAEKLKQQRLAEYAAKKAAKGPKPAAKSIVTLDVKPWDDETDLEELLSNVKNISMEGL
                     TWGAHQWIPVGFGIKKLQINLVVEDALVSLDDLQAAVEEDEDHVQSTDIAAMQKL"
     gene            complement(<718585..>720903)
                     /locus_tag="PVL30_004139"
                     /old_locus_tag="LELG_04422"
                     /db_xref="GeneID:5231403"
     mRNA            complement(join(<718585..720742,720848..>720903))
                     /locus_tag="PVL30_004139"
                     /old_locus_tag="LELG_04422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119526.1"
                     /db_xref="GeneID:5231403"
     CDS             complement(join(718585..720742,720848..720903))
                     /locus_tag="PVL30_004139"
                     /old_locus_tag="LELG_04422"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975509.1"
                     /db_xref="GeneID:5231403"
                     /db_xref="PFAM:PF00172"
                     /db_xref="PFAM:PF11951"
                     /translation="MSGAKITRVRTGCWTCKKRHRKCDETKPVCINCSSTNRQCEGYD
                     RKITFEVFQHDPNGELGRVKRVRNTNNITESKKKSSKRVQIDGTFKNETVPRALIQPT
                     QQISNLRGIKSHKKQEHAEESEEEGKGKERQENPIAKRAKTEHTMNESFSQQRENIAT
                     ATATATYPSTSTSNLNQFSTDLFEDLQTLLSSAFADITPPPPEQRVTNDTRIVDSSTS
                     EDYKYHQHHQHHQHQHHHHHQQQQHSLDFDSQIMDIIGKSKIFDESHKKLLNSPETHE
                     DSNTTNNNNNNNNNNNNNKSNNNNNNNNNNNSSSTHDSKTKITSPQDTSSLFAMSHQE
                     ENNMLKHFFKKLLPLLDGHPKSPWPDLALQYCDFDIARSCFISLACIHMYESKAGGSE
                     YYQKGLAHINNTMDHLIRYIRENASRVNSPNNPMSNGLENDEDQSKKHVSYFVILVLM
                     NVHILFAVVEKGKSSLARDFFKVFSEICKDPIFYNEVLTNNSKQRSLLVVLSWYDTVC
                     AVVSPDYRLPYCLPQWYGTVSDSVSSSKMMGCPGEIFTAMSEVCTLRHQIRHDPMLTF
                     EHIRASYLRIKHILLNYRDYVPLNTSGVGKEEDKEEESYVLRMNCALCWAIAVWITLN
                     RSCSELPTRQSSLLLSPTTDKLVTEFISIYDRLDPKTAIVTQMVWPLYAIGCECKSVF
                     ERNRLLKYITALYEVTKMGTILSMKEIVEKVWHSRLSQEECLSEWLAEGVDYLPL"
     gene            <721284..>723230
                     /locus_tag="PVL30_004140"
                     /old_locus_tag="LELG_04423"
                     /db_xref="GeneID:5231336"
     mRNA            <721284..>723230
                     /locus_tag="PVL30_004140"
                     /old_locus_tag="LELG_04423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524401.2"
                     /db_xref="GeneID:5231336"
     CDS             721284..723230
                     /locus_tag="PVL30_004140"
                     /old_locus_tag="LELG_04423"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524451.2"
                     /db_xref="GeneID:5231336"
                     /db_xref="PFAM:PF00262"
                     /translation="MKYILYILSFLTLTSSALCLSYEPIDFSKLHPDSIFEQFEYPSL
                     KNSPWKPSNSKKYDEGRDEIVEYKGKWSIETPHKYPGFSNDSGLVMKSRAAYHSIAYK
                     LPHLITNNKIDDDDDGAGAGGAGGADGANNIDYDKRDYAKQDKRDLVIQYEVKVQSDK
                     WSCGGAYIKLLDATSSSSSSSSNYIFFNSETPFQIKFGPDVCGSENQVHFVINKKLPN
                     GTIEAKTLKNPPMARINDMSNLYTLILKSTTSEFEIRINGKTVTSGNALAELNLFSPP
                     MVPPKTIVDVNDEKPLSWDDREYIPDPNVQPPEGYEEKHAHPTIPDPDAVKPVDWDES
                     EPRYIPDPSAVRPLDVDHHAGENGDDGWAPPLVINPKCSTSGCGKWTPPMIVNNDYLG
                     PWFAPEIRNPNYQGKWKPRMIPNPDYHELQASPLVLDNPIGGIGFELWTMDGDTLFDN
                     IYIGHSIEEAEWVGNQTFVPKLELEYANKLENPPLVKNQPLKAPPINFDDIISDNSVG
                     NFKQFVIFIKLFCWKEYMEFKDFVIQFLIDPIHTVQRYPFLTVIYALIFLFTSTIGFG
                     VLSVVLFLIQTVLAGTTNGGDGNSEENEEQEDKYAAHRVRKSDDGDDIIVVNRAVDIS
                     KSADIEILEETHGDDNSNNVRLRK"
     gene            <724168..>725490
                     /locus_tag="PVL30_004141"
                     /old_locus_tag="LELG_04424"
                     /db_xref="GeneID:5231416"
     mRNA            <724168..>725490
                     /locus_tag="PVL30_004141"
                     /old_locus_tag="LELG_04424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524402.2"
                     /db_xref="GeneID:5231416"
     CDS             724168..725490
                     /locus_tag="PVL30_004141"
                     /old_locus_tag="LELG_04424"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524452.2"
                     /db_xref="GeneID:5231416"
                     /db_xref="PFAM:PF03372"
                     /translation="MDETTPLISSNPAEDASTSQVFKSTRTIKSSKSFSWSRGIAPRT
                     KKFLRFLLVPILLLVFIIYKFYNLELRLTSSSNHSLLGPSLTLRLYTNNIRFDNFRHP
                     DPHEKPWSKRRVESIDSMHFNTGLGHANVICLQEVLHNQLLDIINGLNDRTGVRTESV
                     FESDYKRESHELVEMEEEGNVKDKVKEKEKGEWTYYGVGRTDGVAAGEFAPIIFKSRD
                     FIILENTTFWLSETPHVPSKGWDAALERIVTLVTFQSKINPLIKFNVFNTHYDHRGHE
                     ARRKSSQLIVDKMKNYNAYPSFLCGDFNTEPRDEPYHILTNAGFKDSRVTIDRQFAYG
                     HETTFTAFDKNNEPYSIIDYIWSPYFTKSVVSNAKEQEYSDLNPGSNNNSDKDEFFGN
                     NFFNLDHHQYYSIVIKQFGILGNFFKGFYFSDHRPVVATYELTRTRLF"
     gene            <728845..>729711
                     /locus_tag="PVL30_004142"
                     /old_locus_tag="LELG_04425"
                     /db_xref="GeneID:5231512"
     mRNA            <728845..>729711
                     /locus_tag="PVL30_004142"
                     /old_locus_tag="LELG_04425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524403.2"
                     /db_xref="GeneID:5231512"
     CDS             728845..729711
                     /locus_tag="PVL30_004142"
                     /old_locus_tag="LELG_04425"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524453.2"
                     /db_xref="GeneID:5231512"
                     /translation="MKSFLIASVLTLSSTALAAVRNVQLYVNSENAGINGLGLYSTHE
                     GAGVNYFFLGEAAQTVQYDDEAKNLFIELNTQPPARQSLAFEGQFLGLTVGQDPLPVE
                     IQEDGSVVFEGSTALAAAKNVDDPYRYSEASWAVVNSAPEGSIPLSIQAVFVEETESE
                     NQEQQQEDSLVASTEDVTEGTVVPEETLAPQVVTVFTTYCPVATTLTLTVCEEVCQES
                     QYVVSEPGTVTIANVVVTETPAPVEEPVVAVETPQPEVPADVSVYEGSAAKFGGAASI
                     AAIALAVVGVAF"
     gene            <733045..>733713
                     /locus_tag="PVL30_004143"
                     /old_locus_tag="LELG_04426"
                     /db_xref="GeneID:5231369"
     mRNA            <733045..>733713
                     /locus_tag="PVL30_004143"
                     /old_locus_tag="LELG_04426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524404.1"
                     /db_xref="GeneID:5231369"
     CDS             733045..733713
                     /locus_tag="PVL30_004143"
                     /old_locus_tag="LELG_04426"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524454.1"
                     /db_xref="GeneID:5231369"
                     /translation="MKYSSIASVFAFTSSALAAVRQVQLFAESDNDEISGQGLSSIHE
                     GAGTNYFFLGEAGQTLQYDDEARSLYITLNSQPPAPQQLAFQGQFLALTVAQGALSVD
                     IQEDGSVSFDGSDSLYAAKNVDDPYRYSENSWAVVNTESDGAIPLRVQARFVGENEET
                     SSSTEEPTEEPTEEPTEGPTPAPVDNSTTPETTISTFEAAGVKVSGGLSIAAVAFAAL
                     GLAF"
     gene            complement(<733942..>734934)
                     /locus_tag="PVL30_004144"
                     /old_locus_tag="LELG_04427"
                     /db_xref="GeneID:5231384"
     mRNA            complement(<733942..>734934)
                     /locus_tag="PVL30_004144"
                     /old_locus_tag="LELG_04427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524405.2"
                     /db_xref="GeneID:5231384"
     CDS             complement(733942..734934)
                     /locus_tag="PVL30_004144"
                     /old_locus_tag="LELG_04427"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524455.2"
                     /db_xref="GeneID:5231384"
                     /translation="MLQLISGLVTSINNSIDYGLRIILHILTFIFLLITVQKIRVRNQ
                     LRIARQCKHNIEVLNNHQAYSNTVNGVNNIANGAQVLPILGTSNDHSNVRFTSSQTQG
                     NFTTAISIGETHTYSNGGGINVGGESVGNNENRPNLLSTTTAKLRSSSSGKKISQAWS
                     TITKRNKSNSALASNTNTTTTLASSILHTNEQVQRPRISSTFSFTRKFKLSHLKQLKS
                     KQRIDNNLVDEANNLLRNPDNYTVSSINQADSSMYTPTSLISSVDSSLSGNSTAPPSF
                     ADALQLDQPPPYSQRDTLSSGISLNTSDGNIYNMSPEELDAEISRLEQLVQSWI"
     gene            <739203..>741482
                     /locus_tag="PVL30_004145"
                     /old_locus_tag="LELG_04428"
                     /db_xref="GeneID:5231554"
     mRNA            join(<739203..740634,740688..740716,741474..>741482)
                     /locus_tag="PVL30_004145"
                     /old_locus_tag="LELG_04428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524406.2"
                     /db_xref="GeneID:5231554"
     CDS             join(739203..740634,740688..740716,741474..741482)
                     /locus_tag="PVL30_004145"
                     /old_locus_tag="LELG_04428"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524456.2"
                     /db_xref="GeneID:5231554"
                     /translation="MKSGLLALATAAALFPTTMGAVRDVHLFAQSEDEDVDGKGLYLA
                     HKGKGIHNFFLGTPQKLSYDDEKKTLLVDMGKNQPNEHLFDYIGEILGLAVGSGPLSA
                     EILEDGSVVFAGMDTLSASKNGNARKNQLVGVNNNWAPADTTVPLGIRAVFGSRNMKK
                     RADEDEENPTDPENPEDPENPTDPEDPTDPENPTDPEDPTDPEDPTDPEDPTDPEDPT
                     DPENPTDPEDPTDPENPTDPEDPTDPENPTDPEDPTDPEDPTDPEDPTDPEDPTDPED
                     PTDPEDPTDPEDPTDPEDPTDPEDPTDPEDPTDPEDPTDPEDPTDPEDPEDPTDPEDP
                     TDPEDPTDPDDPTNPEDPEDPTEPTETEEPSPEPPITYTTSSTVTTYTTYCPEPTTLT
                     LTVCEDYCHQTTYTVEKPGTITVTNVQVPPSPTVTPIPTPIEPPKENKEPPKDNGNQV
                     GNQGGNQGGNQGGNPPSGGYCQKGDGKVKRAAEEYPKCE"
     gene            <744569..>746590
                     /locus_tag="PVL30_004146"
                     /old_locus_tag="LELG_04429"
                     /db_xref="GeneID:5231303"
     mRNA            <744569..>746590
                     /locus_tag="PVL30_004146"
                     /old_locus_tag="LELG_04429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524407.2"
                     /db_xref="GeneID:5231303"
     CDS             744569..746590
                     /locus_tag="PVL30_004146"
                     /old_locus_tag="LELG_04429"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524457.2"
                     /db_xref="GeneID:5231303"
                     /translation="MKPFLLAIALSLSSTALAAVRDIELYAISDDKDINGQNVYVAHT
                     GRGVHGFYLSTEAQRLQFDDKKKTLLVEKSLTHENKAHGSSLGEVLNIAVGSGPLIVE
                     FEQDGTLLLDKQNLFEYVKNTKQNHYGFKRDTIDSFASKMKIGARFAKRQIRKRAEGD
                     GTTPPAEGDGTTDEFIDEGDDTIDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDG
                     TGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTG
                     GGGDDGTGGGGDDGTGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGG
                     DDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDD
                     GTGGGGDDGTGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTG
                     GGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGG
                     GDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGGGDDGTGGTGN
                     TGGTGGTGNTGGTGGTGGTGNTGGTGGTGGSGNNGGTVGGGNNGGSKTTTTTSPRGGA
                     SSTTKSSSTSKTSSKTGTASATSIEGVGATYGGYASVLALALAAVGFVM"
     gene            complement(<748637..>750205)
                     /locus_tag="PVL30_004147"
                     /old_locus_tag="LELG_04430"
                     /db_xref="GeneID:5231383"
     mRNA            complement(<748637..>750205)
                     /locus_tag="PVL30_004147"
                     /old_locus_tag="LELG_04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524408.2"
                     /db_xref="GeneID:5231383"
     CDS             complement(748637..750205)
                     /locus_tag="PVL30_004147"
                     /old_locus_tag="LELG_04430"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524458.2"
                     /db_xref="GeneID:5231383"
                     /db_xref="PFAM:PF00083"
                     /db_xref="PFAM:PF07690"
                     /translation="MVESSAESILTFKEAVVEEHNKHIIHAPTFTSHAIKHYLKTRIS
                     SLWVSWDELKQYSWNEILNPFQPLTEMNLHQWNYFLMAFWCWTMDAFDFFVTSLNVRH
                     MAETFGVSTKDMTWGITLVLMFRTVGAVIFGFIGDQFGRKWPYIVNLCLLIILQIGTG
                     FVKTYAQFLGIRALFGVAMGGIFGICAAEALGDAPKKARGVLSGIFQEGYAFGYLLAV
                     CFQRAFEQTKNTWNNMFFFSAGVSVIFVIWRFCFPETDNYQRQRARFDRGAEQKHSKI
                     AEFKSEAKNALKTYWLIIIYMILMMSGFNFSSHGSQDLYPTVMTEEYSYGHDRTTVVN
                     VCANLGAIVGGMILSHLSTYIGRRTAILCGNVIAGAFIYPWAFKPMWITAFFMQFGIQ
                     GSWAVVPIHLSELSPPQYKAFIGGVAYQLGNLVSSASSTIEATINETLDDYGKTMAIF
                     IGAVLIYMICIILIGPENRGADLGVERDDEFSIYDVDDEGDYQGDEEHFKHLDELAAV
                     KYEEKKDDDLEIKG"
     gene            complement(<752516..>755191)
                     /locus_tag="PVL30_004148"
                     /old_locus_tag="LELG_04432"
                     /db_xref="GeneID:5231337"
     mRNA            complement(<752516..>755191)
                     /locus_tag="PVL30_004148"
                     /old_locus_tag="LELG_04432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524410.1"
                     /db_xref="GeneID:5231337"
     CDS             complement(752516..755191)
                     /locus_tag="PVL30_004148"
                     /old_locus_tag="LELG_04432"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524460.2"
                     /db_xref="GeneID:5231337"
                     /db_xref="PFAM:PF12550"
                     /translation="MVATRRSSTQHVDVELSLNGKEAKKVIPIAEQRKSSLREYSSEN
                     DDNEEPPKPVKKETRGRKRKTITTHFAVTGESNAPKKKTTTTKNGAALGGHSIENVVD
                     SSKFSQPPVDTIKKVETRGRKRKNPESNPNTTTTTTTTPRTTTTTTTTTTPRAASTSK
                     TTASKTTSTSARGVNTRRKSAIASASNDNNASAGVGRSSRKTAISTNKGDTSSGVAAS
                     ATQDTLGPISSPAITGSNILAGINVNKHNINHLLTKDSPPPLGGLYGRHPGGVGGIGG
                     PTVAVTSGAHNSYERSTSPAMASYQQQQQQQQLYQQQQHLQHTQPNFFHQQQQQSQIH
                     YQHHLQQPQQFHPAGTQLPPPPITTTRSQTNVASQQPGGRIPITSIISQKIDASDIPL
                     MMMEEDDTGPEDKKTKRRYRVDKDNIKINKRIMSQDTEDVIKMFKKFDDEILTNPEAR
                     QRLLSLGFETRKRYITTFKHFIRFCCRKKLDNFFVTGELMKEFYQEQFANSTSSKPVI
                     RLRKMDPAFSKLQEINFLVYHLENKEIPNRHIALEYLVYKEIGKDSPPSSHSSVEETS
                     SSETNSKKKRRMVKKIYKAQQLSGVAQNGGDEKQPTEASDIDEGLQSQDRAAAIGAPV
                     PDSNNQFQQNPPFASSPLYQQQPIQYGQHLQTYSQQAVANLPHHEQSSQQSQQSQQQQ
                     QQPVSSLSSSSSQLPHQSPSLQEPPIYTKKITKKNVEEIRKSFAELRQEIRYALQKTV
                     AVDPAFVSSLSDRINGSLDRFELELNGPPPARQQQSESGVPIYDLNHEIYTVFEIVEE
                     WYKIDPPIAQRIQQFGEDWIRDEIDHNTFTERRSIVEFVEKMAKECNVDIYVIANDCD
                     RYIRDKSILDEFISEIELDYDDLYKRIMRYRQRRS"
     gene            complement(<758374..>760095)
                     /locus_tag="PVL30_004149"
                     /old_locus_tag="LELG_04433"
                     /db_xref="GeneID:5231505"
     mRNA            complement(<758374..>760095)
                     /locus_tag="PVL30_004149"
                     /old_locus_tag="LELG_04433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524411.2"
                     /db_xref="GeneID:5231505"
     CDS             complement(758374..760095)
                     /locus_tag="PVL30_004149"
                     /old_locus_tag="LELG_04433"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524461.2"
                     /db_xref="GeneID:5231505"
                     /db_xref="PFAM:PF07716"
                     /translation="MNDEATSSALLEQLVYIDNYINGQSNTDSSIATPNIDVDGQLSL
                     DLAAFADDSFVFPDEEKPKNLFFDDEEDEENGGGRDGGLDGKRETKDAGGKKTGDAKS
                     LRNKDKKQLKRDIDHLSGWNVSDFTGANTNNNGSNNNGNSNNHNTIPMNNVGSSSIHG
                     KSKFNGNSDFFIKQEPEMEPFVQQQQLQQQQSHSQLHSQSHPHLQHFHHGQHPQSQTH
                     LLPQFQGVDDHVQPSLALPPDNINNNNIEHGYSQGAEEDGHNILNLRELPKFPVPPGA
                     KSSLVSAGLSQNQIDLLSALVAQHQASMGKRIPPREQQLQQLQHQLQHQQQQQQQQHG
                     PQVANIDPTLQGEFVADTAATSATAAIANGSFSQQQHQQQQQQQQQQQQQHQLLSNSY
                     IAPITPNVSVSPAEIPANSNNQVNSILQLSQPNVSQFLQSQSNLQQSTNPRPHNHRQN
                     SLASIPDTIVANSNMGHLSNTASASRLSIASTSSNLSSPDAAELDKKRRNTAASARFR
                     IKKKIKEQQMENKISSLQGLIDQLETKLNNLEMENKLLRNLIIEKGSQKGDDEVKLVK
                     EKAKSNQ"
     gene            complement(<762284..>762553)
                     /locus_tag="PVL30_004150"
                     /db_xref="GeneID:85890396"
     mRNA            complement(<762284..>762553)
                     /locus_tag="PVL30_004150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119527.1"
                     /db_xref="GeneID:85890396"
     CDS             complement(762284..762553)
                     /locus_tag="PVL30_004150"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975510.1"
                     /db_xref="GeneID:85890396"
                     /translation="MFKRSFSQLSRQSFQRGIVNKAVKAPTTTTATTAPPANSATAAT
                     QSAAHGSNGTYKSFAEYRLKVSNQSPLAVRSKTFNANLRTKHAVA"
     gene            <766901..>770440
                     /gene="PYC1"
                     /locus_tag="PVL30_004151"
                     /old_locus_tag="LELG_04434"
                     /db_xref="GeneID:5231400"
     mRNA            <766901..>770440
                     /gene="PYC1"
                     /locus_tag="PVL30_004151"
                     /old_locus_tag="LELG_04434"
                     /product="pyruvate carboxylase"
                     /transcript_id="XM_001524412.1"
                     /db_xref="GeneID:5231400"
     CDS             766901..770440
                     /gene="PYC1"
                     /locus_tag="PVL30_004151"
                     /old_locus_tag="LELG_04434"
                     /codon_start=1
                     /transl_table=12
                     /product="pyruvate carboxylase"
                     /protein_id="XP_001524462.1"
                     /db_xref="GeneID:5231400"
                     /db_xref="PFAM:PF00289"
                     /db_xref="PFAM:PF00364"
                     /db_xref="PFAM:PF00682"
                     /db_xref="PFAM:PF02222"
                     /db_xref="PFAM:PF02436"
                     /db_xref="PFAM:PF02785"
                     /db_xref="PFAM:PF02786"
                     /db_xref="PFAM:PF07478"
                     /translation="MTSIASSNTQDGRINQMRRDSTVLGPMNKILVANRGEIPIRIFR
                     TAHELSMQTVAIYSHEDRLSMHRLKADESYAIGKKGQFTPVGAYLQIDEIIDIAKKHN
                     VNMIHPGYGFLSENSEFAKKVEQNGIVWIGPSHKTIDAVGDKVSARTLAIENDVPVVP
                     GTPGPIDDVSDARKFVEKYGYPVIIKAAFGGGGRGMRVVREGDDIEDAFKRATSEAKT
                     AFGNGTCFIERFLDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEIAPAKNLP
                     REVRDAILTDAVKLAKSANYRNAGTAEFLVDEQNRHYFIEINPRIQVEHTITEEITGV
                     DIVAAQIQIAAGASLQQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGKIEVYRSA
                     GGNGVRLDGGNGFAGSIISPHYDSMLVKCSCSGSTFEIARRKMIRALIEFRIRGVKTN
                     IPFLLALLTNQTFVEGDCWTTFIDDTPSLFQMISSQNRATKLLLYLADLYVNGSSIKG
                     QIGYPKLDTEALIPELHEPRTGIAIDVNHTPPPRGWRQVLLEEGPAKFAKKVREFKGC
                     LITDTTWRDAHQSLLATRVRTIDLLNIAPTTAFALNGAFSLECWGGATFDVCMRFLYE
                     DPWVRLRQLRALVPNIPFQMLLRGANGVAYSSLPDNAIDQFVKEAKENGVDIFRVFDA
                     LNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLKPGKKYNLEYYLNFVDEVVKMGTHFL
                     GIKDMAGTLKPAAAKLLVGEIRKRHPDLPIHVHTHDSAGTGVASMTECAKAGADVVDA
                     ASNSMSGMTSQPSISAILASFEGSIESGLSEQLVRELDEYWAQMRLLYSCFEADLKGP
                     DPEVYSHEIPGGQLTNLLFQAQQLGLGTKWLETKKAYRIANKILGDLVKVTPTSKVVG
                     DLAQFMVSNSLTEEDINRLAGELDFPDSVYDFMEGLMGQPYGGFPEPLRTNMLGNKRQ
                     KLTQRPGLSLPPVKFDEIKQELQSRYGTQVSETDIASYVMYPKVYEAYRKQVEKYGDL
                     SVLPTRYFLKPANIGQEIVVDIEQGKTLIIKLLAVGELSEKTGSREIFFELNGEMRSV
                     TVEDKTASVETKTRPKAQQPNDVGAPMSGVVIEVRTHKHQEVKKGDPIAVLSAMKMEM
                     IISAPVSGVVGDILVKEGDSVDANDLITSILKH"
     gene            complement(<770796..>771326)
                     /locus_tag="PVL30_004152"
                     /old_locus_tag="LELG_04435"
                     /db_xref="GeneID:5231406"
     mRNA            complement(<770796..>771326)
                     /locus_tag="PVL30_004152"
                     /old_locus_tag="LELG_04435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524413.1"
                     /db_xref="GeneID:5231406"
     CDS             complement(770796..771326)
                     /locus_tag="PVL30_004152"
                     /old_locus_tag="LELG_04435"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524463.2"
                     /db_xref="GeneID:5231406"
                     /db_xref="PFAM:PF08651"
                     /translation="MTSPQRTPIQLHPQSQEDPISLREKALEKELTHLRMINTTLDTL
                     VTTIESTTSDINTFNNGTSNAKRMMDKWTEILTQASFTGQMLDDEEWTPQGDEGGREG
                     GLREESAVEEELRILQRRLMTVESENIVLNKKLEKEMQEKRERWNRAEELANKRKREL
                     GLNVAGTGNTRRKLNR"
     gene            <771879..>772562
                     /gene="SOH1"
                     /locus_tag="PVL30_004153"
                     /old_locus_tag="LELG_04436"
                     /db_xref="GeneID:5231437"
     mRNA            <771879..>772562
                     /gene="SOH1"
                     /locus_tag="PVL30_004153"
                     /old_locus_tag="LELG_04436"
                     /product="suppressor of hpr1"
                     /transcript_id="XM_001524414.2"
                     /db_xref="GeneID:5231437"
     CDS             771879..772562
                     /gene="SOH1"
                     /locus_tag="PVL30_004153"
                     /old_locus_tag="LELG_04436"
                     /note="BUSCO:EOG09265KF9"
                     /codon_start=1
                     /transl_table=12
                     /product="suppressor of hpr1"
                     /protein_id="XP_001524464.2"
                     /db_xref="GeneID:5231437"
                     /db_xref="PFAM:PF05669"
                     /translation="MTEVQNVNLDAASKQSPEKSQQEDEYQKLITSLPTRWEIELEFV
                     QSLSNIPYVNYLAQNNYLQDPSFINYLKYLEYWSEPEYSKYLVYPNCLHILKLLSSSE
                     QFRRDIVNPEVMNTLMNDMVKKWQSVDQVEKAELNEQGIVSSSETVKEVADIPPSNNE
                     NGGPTIVVNNSEESKNVENPHIIVEEEEEEKEKEKEDAEKEVKKEAEEKINGTEALDP
                     VSAEDVQMQ"
     gene            <776714..>779173
                     /locus_tag="PVL30_004154"
                     /old_locus_tag="LELG_04437"
                     /db_xref="GeneID:5231546"
     mRNA            <776714..>779173
                     /locus_tag="PVL30_004154"
                     /old_locus_tag="LELG_04437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524415.2"
                     /db_xref="GeneID:5231546"
     CDS             776714..779173
                     /locus_tag="PVL30_004154"
                     /old_locus_tag="LELG_04437"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524465.2"
                     /db_xref="GeneID:5231546"
                     /db_xref="PFAM:PF13480"
                     /translation="MLQFKQRFTLQNFRFSLRNLYDPIALIIYALAFNTTSAIQYSNL
                     SKRLHYVNFVPITSIAMIIFILILELYSRFFEKIQLRSKWAKASHWVIQNIFKKLFWL
                     CLFVMCILTVVQLSQGQTTNPLIVSDHEVQELNLNKGQRAGYMIIELICVILNCAVLS
                     IWWNTTMSTVHLLFAGLNVFQILISISIIQINLNLINLSQDSPAKKMHNLFVLCGSFM
                     IGQSIMGLCITISLNEKNRLSILIGRLIFTYDVFIFFLGLLYIACTAVASVKFDYKPK
                     EGLNEVPISLPVLFGVSVGISLVAFCCTRYFRIRVQQNVYQVEEYDLGSLTQHQKQGW
                     SKLIDLNKKYNGGVTGDYVLSLMENYTHADLPGMRCKVLRVYSKSEKSEKEYNEKDKK
                     LRNNDNNDNDLERQVSQKTFVHKGELHEKSMNHHKNRGKLSTPYDDLDHESLLFANEP
                     TLAEADISMMSLEEEYKPLSKNQLKKLAKKNKKAKKEAELQSLENNTEKFYQELMNTQ
                     ALVLLTIVEEFDLSERIPGWIGKKLNKCFGKNSKWPLLCIKFGLLGFHWPFKRSTFYC
                     SSTKKPVARSASVLYAISQWNAKNEKCTVMLDPGYKDANFEAGVDYSGWIKINLPNSH
                     IIDLRPYHNQTSADFFKAIKYRNQDNAFKQASGVVDESYNFNFENCQEIIVMNDHIAR
                     SRQESGQSSQLLHPDWEFIYNLGNYTNDQKYRSLLFLKVGDEIIASCVIFRLGETMTS
                     DIQGLDHEISKKYKAYFVMMQEVIKIGMRENVSFIDFGPTTEDAKVAIGCSVVPLIGS
                     LYPRYKLMGPIIRFAASKVDV"
     gene            <781518..>783299
                     /locus_tag="PVL30_004155"
                     /old_locus_tag="LELG_04439"
                     /db_xref="GeneID:5231504"
     mRNA            <781518..>783299
                     /locus_tag="PVL30_004155"
                     /old_locus_tag="LELG_04439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524417.2"
                     /db_xref="GeneID:5231504"
     CDS             781518..783299
                     /locus_tag="PVL30_004155"
                     /old_locus_tag="LELG_04439"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524467.2"
                     /db_xref="GeneID:5231504"
                     /db_xref="PFAM:PF13480"
                     /translation="MLGLGLLLIINDKNRLHQIIGKFIFSYDMLLLLLGMFYLACTAV
                     AGVAYGSISTGEIAELPLTIPILFFLSFLIIIIKFGCTRYFRRRAAPNKLQVVEYDLC
                     QLNKHQKRGWAKLIDLNKKYNSGVSGDHVISLMENYVHAKLPGMKCKVLRVYNKSVKA
                     EHNYESEKENANKNEAKSQGDVDIALQNNTSKNDKADVHVKEKSIVKTPYDELDQETV
                     LFQNAPTLLSSELSIQSLEEEYKPLSKNQLKKLAKKKQKAKKDMELQALENNTEEFYQ
                     ELMTTQALVLLTIIEEFDLSERIPGSIGKMLHKLFGKNSKWPLLCIKFGLLGFHWPFK
                     RSTFYCSSTKKPVARSASVLSAISYWNKKNEKCSVMLDPGYKDASFEAGVDASGWIKI
                     NLPNSHIVDLRPHHNQNSTEFFKAIKYRNQDNAFKQASGVVDESYNFNFENCQEIIVM
                     NDHIARSRQESGQSSQLLHPDWEFIYNLGNYTNDQKYRSLLFLKVGDEIIASCVIFRL
                     GETMTSDIQGLDHEISKKYKAYFVMMQEVIKIGMRENVSFIDFGPTTEDAKVAIGCSV
                     VPLIGSLYPRYKLMGPIIRFAASKVDV"
     gene            <783619..>784692
                     /locus_tag="PVL30_004156"
                     /old_locus_tag="LELG_04440"
                     /db_xref="GeneID:5231700"
     mRNA            <783619..>784692
                     /locus_tag="PVL30_004156"
                     /old_locus_tag="LELG_04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524418.2"
                     /db_xref="GeneID:5231700"
     CDS             783619..784692
                     /locus_tag="PVL30_004156"
                     /old_locus_tag="LELG_04440"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524468.2"
                     /db_xref="GeneID:5231700"
                     /db_xref="PFAM:PF10261"
                     /translation="MNSEGLDKSSIYDAHYNKLKHVSDTFKRRYKVTLNEVLFLASFV
                     ANFILSRLIHFGSPQEEVYNYYNDKRNVLNQWFVKRGWGWTTLAVVLFYSLFAVPQIL
                     NSNLTTATAARTTATARRVDENEDDSVSVSGKKEKKLYTTKSERLSKYLFGAIVRYLL
                     STIWWVLFTQWCFGLPIMDKIFVVSGGACVIEPPQFAASQQKISNSQHLFGKFIQDLE
                     TLVWRSSSVSSYHCRKLRGNWEGGHDPSGHVFLMIHSSLYLYLECAAWFDWKSLVRCV
                     SYVYRKLQNYGGKSLVRGFEHNEKLFVGELAQLSVVLLISLWWFMLLMTNMYFHSIAE
                     KLVGLVFGYVGVFAIYFVPRWVK"
     gene            <786392..>788320
                     /gene="AXL2"
                     /locus_tag="PVL30_004157"
                     /old_locus_tag="LELG_04441"
                     /db_xref="GeneID:5231593"
     mRNA            <786392..>788320
                     /gene="AXL2"
                     /locus_tag="PVL30_004157"
                     /old_locus_tag="LELG_04441"
                     /product="polarity establishment/cellular polarization"
                     /transcript_id="XM_001524419.2"
                     /db_xref="GeneID:5231593"
     CDS             786392..788320
                     /gene="AXL2"
                     /locus_tag="PVL30_004157"
                     /old_locus_tag="LELG_04441"
                     /codon_start=1
                     /transl_table=12
                     /product="polarity establishment/cellular polarization"
                     /protein_id="XP_001524469.2"
                     /db_xref="GeneID:5231593"
                     /db_xref="PFAM:PF05345"
                     /translation="MGFPFNEQLPNVARVNEAYTFTFAKSTYKSTSEGGSDNIQYNVT
                     SLPSWLSFDSESRTFTGTPDSSDEGEFQITLVGVDQSDDSSMENSYSMVVSSSPDLDS
                     NSFNLYDELTSMGQTNGGDGLVLKQGDEFSFTFPKIDDSVAYYGRSSDRTSLPNWVKF
                     SGNTFSGTVPYATSENSPSQAFNLNYIATDIAGYAAVVKTFEILVGGHQLSTDLKEAI
                     EIEGYKNEEVEEDVPLSHVFLDGAQIAKENISSVIGDDLPDYLELDTSDYTISGTLPN
                     DESDGSNSTTFNVQIEDIYGNKVQIPYSVRISKETSSSSIYESSYTASSSSSSSTTSS
                     SSSSSSRSSTTSSASASATSSSSSTAETSSAAAAAATIHNKSSNNNLAIGLGVGLGVG
                     IPLLALLILGLCCCCRRRKNKDKTASASTAAGAGAGAAAAAADMEKGTYDDASPGSNY
                     TATSTSFAPLTQLTPASVSQLNLMKLEKSAAANDSDLSLSSLTTHVNDEDQQLQQQQQ
                     QQQQNHLDSQGEQQQPVVTSWRADAKTDNKEVTSQAQDPLRFSTATTSTVNTDNLFTV
                     RLVDDNNGDNSARSSNQVYSRQSGNTSKTASQLMLVPEANLVEFTTRRGSLRDSSFEP
                     DHVHMEERASFHSNDDSV"
     gene            complement(<788628..>790268)
                     /locus_tag="PVL30_004158"
                     /old_locus_tag="LELG_04442"
                     /db_xref="GeneID:5231477"
     mRNA            complement(<788628..>790268)
                     /locus_tag="PVL30_004158"
                     /old_locus_tag="LELG_04442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524420.2"
                     /db_xref="GeneID:5231477"
     CDS             complement(788628..790268)
                     /locus_tag="PVL30_004158"
                     /old_locus_tag="LELG_04442"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524470.2"
                     /db_xref="GeneID:5231477"
                     /translation="MLRSIRCSIAKQATHQSSLIPVYTHIRFNSQAPVPINDDAASTS
                     TPAPRFHRIDKAGSQEPADAADAAATILADLRDLQTNPNKATWIDALKEREKLEAQGK
                     KIGSFTYVNPITTDVIEKTREDSFSYLLLPFKKDKWLCDAYINAFGRLRAGQLFQDLD
                     ALAGRIAYRHCSPAEPVNVTASVDRIYMVKKVDEIMNYNFVLAGSVTWTGKSSMEITV
                     KGYAFETDIEESSLTNEGALPDENVFLTANFTFVARHPVTGKSFPINRLLPITEQDWI
                     DYRKAESHNAKKKLMAKNHRMIEPTPEESKLIYDMWRSTKALIADDKVEHITKSTGVS
                     FMKDTSQESTLFMQPQYRNRHSYMIFGGYLLRQSFELAYCTAATFSGAGPRFVSLDST
                     TFKSPVPVGSVLTMNATISYTEHLHDDTAKAELKEQDGNSHSPFNFKLPPMNKISSNP
                     DAFLNEAGTLIQVKVDTWTQQLEGGPTGKPSKEGGKTAAGTFIYSFFVPKDSYSESEV
                     GYCSVIPQTYSEMMTYVGGRRRAGDTAQYVETLPPSIR"
     gene            <792980..>794131
                     /gene="PDB1"
                     /locus_tag="PVL30_004159"
                     /old_locus_tag="LELG_04443"
                     /db_xref="GeneID:5231639"
     mRNA            <792980..>794131
                     /gene="PDB1"
                     /locus_tag="PVL30_004159"
                     /old_locus_tag="LELG_04443"
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /transcript_id="XM_001524421.2"
                     /db_xref="GeneID:5231639"
     CDS             792980..794131
                     /gene="PDB1"
                     /locus_tag="PVL30_004159"
                     /old_locus_tag="LELG_04443"
                     /codon_start=1
                     /transl_table=12
                     /product="pyruvate dehydrogenase E1, beta subunit"
                     /protein_id="XP_001524471.1"
                     /db_xref="GeneID:5231639"
                     /db_xref="PFAM:PF02779"
                     /db_xref="PFAM:PF02780"
                     /translation="MSPVSSVARTAQLAAQAVRYNKPLSQLGQNQALRMNFSKNLVSQ
                     RLNNSKAGPQEMTVRDALNSALAEELDRDDDVFLMGEEVAQYNGAYKVSRGLLDRFGE
                     RRVIDTPITEMGFTGLAVGAALHGLKPVLEFMTFNFAMQAIDQIINSAAKTYYMSGGT
                     QPCNITFRGPNGAAAGVGAQHSQDYAAWYGSIPGLKVLSPYSAEDYKGLLKAAIRDPN
                     PVVFLENEIAYGESFPVSEEALSSDFILPIGKAKVEREGTDLTIVGHSRAVKFGMEAA
                     EKLEKDYGVSAEVINLRSIKPLDVPTIIESLKKTKHLITVENGFPAFGVGSEICAQIM
                     ESEGFDYLDAPVERVTGCEVPTPYAKELEDFAFPDTETVLRASRKVLGL"
     gene            <794641..>796302
                     /locus_tag="PVL30_004160"
                     /old_locus_tag="LELG_04444"
                     /db_xref="GeneID:5231568"
     mRNA            <794641..>796302
                     /locus_tag="PVL30_004160"
                     /old_locus_tag="LELG_04444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524422.2"
                     /db_xref="GeneID:5231568"
     CDS             794641..796302
                     /locus_tag="PVL30_004160"
                     /old_locus_tag="LELG_04444"
                     /note="BUSCO:EOG092624UF"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524472.2"
                     /db_xref="GeneID:5231568"
                     /db_xref="PFAM:PF13000"
                     /translation="MSDNGSYEEVDSTNNKLNYRHAAFGEENDGLLPMAQQDLKPKPN
                     SKSVRTKSQKNLLPQDRTYFIVLILLYLLQGVPVGLAFGSVPFILKDKLTFSQVGVFS
                     LAAYPYSLKLLWSPFVDSMYSKKVGRRRSWIIPVQTISGIILIYLGFIMDDLMLDPRK
                     HLKIITGCFFILVLCCATQDIAVDGWALTVLSPESLSFASTAQTIGMNCGYFMSFTIF
                     LALSSPEFANKYLRSAPSQKGLFSLGEYLTFWGVMYLLITIIVVFIPEDPKHLVEVNR
                     ERMAKEKQYALSTYNEKKRNKLTQLTDVYSSMYEVLKLPNVQTFVVILLLAKLGFQVN
                     EAGTNLKLLEKGLSKEDLSITVLIDFPFEMIFGYYAGRWSTGKTPLKPWLWGFLGRLL
                     AATLAQFVVYFFPQDRQVSKVYFLAIILQHLLGSFMSTIQFVSLCAFHTKIADPAIGG
                     TYMTTLSTLSNYGGTWPRIFIYFLIDKITLSKCQLPGDGHFLVNSDETKKQCEYSGGK
                     IAIIRDGYYYTNALCIGLGIIIWFWVKRKAAYLQSLPNSAWRVKR"
     gene            <796733..>798160
                     /locus_tag="PVL30_004161"
                     /old_locus_tag="LELG_04445"
                     /db_xref="GeneID:5231522"
     mRNA            <796733..>798160
                     /locus_tag="PVL30_004161"
                     /old_locus_tag="LELG_04445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524423.2"
                     /db_xref="GeneID:5231522"
     CDS             796733..798160
                     /locus_tag="PVL30_004161"
                     /old_locus_tag="LELG_04445"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524473.2"
                     /db_xref="GeneID:5231522"
                     /translation="MVLLGDIVRQQQTLNNLNTSVPTLDELITRTSTVRNKIYDFQSS
                     PSCHGMYIVTASIIASHLARGRKVVIIDTLNKFPIDLLLRQEKFNKNEHKRLITHYYC
                     DTFGKLFTTLTKLKVHTDTVIIINEFHLLVDVYKLEMSSTFEEMILKHHVECNATYIN
                     NKRNGVKTTLPEIPPGSDLLKVSPIVKLGQHLDKLFRVLNRICIQTKSMVFLLGYMDT
                     KYRPFQANTTREEMPLSLSSIASTSSSTTTTTSASASAAKTATPATTARTTLTPLSTN
                     TGYSSFIESGRVVLAPYEFHRSITNRFLFYHEWYHKTPHFLQNYPTENGREKVLYVNQ
                     SMLRFVNAVKLETPRESFSPIYFDIDSSFYYDVNEADEKKRKLLAIRDLSQRRAEATL
                     GTNDDSLCEVNIESVPKSTQLSSSQPNSLLDSTVIDVTNNDYENTAALNNDYESPSNQ
                     HNIGEVNVSEGVKEVIEDSEEDEAI"
     gene            <798414..>800021
                     /gene="RSA4"
                     /locus_tag="PVL30_004162"
                     /old_locus_tag="LELG_04446"
                     /db_xref="GeneID:5231610"
     mRNA            <798414..>800021
                     /gene="RSA4"
                     /locus_tag="PVL30_004162"
                     /old_locus_tag="LELG_04446"
                     /product="ribosome assembly"
                     /transcript_id="XM_001524424.2"
                     /db_xref="GeneID:5231610"
     CDS             798414..800021
                     /gene="RSA4"
                     /locus_tag="PVL30_004162"
                     /old_locus_tag="LELG_04446"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosome assembly"
                     /protein_id="XP_001524474.2"
                     /db_xref="GeneID:5231610"
                     /db_xref="PFAM:PF00400"
                     /db_xref="PFAM:PF08154"
                     /db_xref="PFAM:PF12894"
                     /translation="MATVIPPPSKKQKREAQKVREVDLVPEDVGNVLIRFQASDTGEA
                     TGGSIRVPGGITEKQLEELLNNLRGESDDPVPYTFSLLHKEKEEKGKEKAEAETEAVE
                     EGKEAQGKLIDIKDTIYHSVLKPGLKTTEDFLTLVYTPRAVFKVKPVTRSNAAIAGHG
                     ATILCCSFAPNDSGRMVSGAGDSTARIWDCNTSTPMHTLSGHTNWVLCVAYSPDGTMI
                     ATGSMDNTIRLWEADTGKPIGKPLTGHSKWVSSLSWEPLHLVAPDSKPRLASSSKDGT
                     VKVWDTASRICTLTMSGHTNSVSCVKWSGSNIVYSASHDKTIKAWDISAGGKCIQTLK
                     SHAHWVNHLSLSTDYVLRRGGFDHTSSRNSTKLAPEELRKKAKEQYEKVAKLNGVISE
                     RLVTASDDFTMYFWEPLKSSKPLLRMTGHQKLVNHVNFSPDGRYVVSSSFDNSIKIWD
                     GIRGTFITTLRGHVAPVYQTAWSADNRLLVSCSKDTTLKVWDIRTKKLSVDLPGHADE
                     VYAVDWSLDGKRVASGGKDKMIRLWSH"
     gene            <800679..>804518
                     /gene="MYO1_1"
                     /locus_tag="PVL30_004163"
                     /old_locus_tag="LELG_04447"
                     /db_xref="GeneID:5231750"
     mRNA            <800679..>804518
                     /gene="MYO1_1"
                     /locus_tag="PVL30_004163"
                     /old_locus_tag="LELG_04447"
                     /product="class II myosin"
                     /transcript_id="XM_001524425.2"
                     /db_xref="GeneID:5231750"
     CDS             800679..804518
                     /gene="MYO1_1"
                     /locus_tag="PVL30_004163"
                     /old_locus_tag="LELG_04447"
                     /note="BUSCO:EOG092608L0"
                     /codon_start=1
                     /transl_table=12
                     /product="class II myosin"
                     /protein_id="XP_001524475.2"
                     /db_xref="GeneID:5231750"
                     /db_xref="PFAM:PF00063"
                     /db_xref="PFAM:PF06017"
                     /translation="MAIVKRGGRTRAKQQQAPAKVNNGSGAGAGAGGGIQKAEFDITK
                     KKEVGVSDLTLLSKITDEAINENLHKRFMNDTIYTYIGHVLISVNPFRDLGIYTLENL
                     NKYKGRNRLEVPPHVFAIAESMYYHLKSYGENQCVIISGESGAGKTEAAKQIMQYIAN
                     VSVDSGNAEISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFSEGSYQPIA
                     AHITNYLLEKQRVVSQITNERNFHIFYQFTKHCPPQYQQQFGIQGPETYVYTSAAKCI
                     TVDGIDDGKDFKDTLNAMNIIGLSQAEQDNIFRILASILWTGNISFVEDESGNAAIRD
                     DSVTNFVAYLLDVNAEILKKAITERTIETSHGMKRGSTYHVPLNIVQATAVRDALAKG
                     LYNNLFDWIVERVNLSLQGNQGQSEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQ
                     IFIQLTLKAEQDEYVQEQIKWTPIDYFNNKVVCDLIEATRPQPGLFAALNDSIKTAHA
                     DSDAADQVFAQRLSMVGASNRHFEDRRGKFIIKHYAGDVTYDVAGMTDKNKDAMLRDL
                     LELLGTSSNAFVTQTLFPPNLLSELVDSKKRPETASDKIKKSANILVDTLSQATPSYI
                     RTIKPNQTKKPRDYDNQQVLHQIKYLGLKENVRIRRAGFAYRSTFQRFVQRFYLLSPA
                     TGYAGDYIWQGDDLTAVKEILRACHIPTSEYQLGTTKVFIKTPETLFALEDMRDKYWH
                     NMAARIQRAWRRYIKRKEDAAKTIQRAWRMKNHGNQFEQFRDYGNSLLQGRKERRRFS
                     MLGSRAYMGDYLACNDKTGFGRFVVNQVGIKEPVVFSAKGVILLSKFGRSSKRFPRIF
                     VLTKSNLYIIAEVLVEKRLQLQREFALPVHSIKSVGLSQLQDNWVAVCLSSPTTTTPD
                     VFINLDFKTELVAQLKKLNSGLSILIGPTVQYQKKPGKYQTVKFAIGSGPHIPPLIDS
                     YKSGTVTVNQGLPPTSKNPKRPRAKSGKVDYSKYYNRGVRSSAQPAFQSQPTASYRSE
                     PAYPQPTTQSYATQHQPQQPQVPTRTASRKAPPPAPSTQTAAQVSTSPQAARKPAAPA
                     RPAKKIAPQPPVKKAVSPQPPAKKTVAAPPPPPPPPALSKPKHPTYRAMYDYDGSVAG
                     SVPLVKDTIYYVLQINGKWGLVKTMDETQEGWSPIDYLQEESSPSASAATQSYAPTTA
                     SSNPVSTASSNTYTNTTQATTMSNGSLGNGLADALKAKKSEETTLAGSLADALKKRQG
                     VTRDDSDAEDDDDDDDW"
     gene            <805071..>810395
                     /gene="SRB8"
                     /locus_tag="PVL30_004164"
                     /old_locus_tag="LELG_04448"
                     /db_xref="GeneID:5231736"
     mRNA            <805071..>810395
                     /gene="SRB8"
                     /locus_tag="PVL30_004164"
                     /old_locus_tag="LELG_04448"
                     /product="RNA polymerase II mediator complex subunit"
                     /transcript_id="XM_001524426.2"
                     /db_xref="GeneID:5231736"
     CDS             805071..810395
                     /gene="SRB8"
                     /locus_tag="PVL30_004164"
                     /old_locus_tag="LELG_04448"
                     /note="BUSCO:EOG092605ZA"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II mediator complex subunit"
                     /protein_id="XP_001524476.2"
                     /db_xref="GeneID:5231736"
                     /db_xref="PFAM:PF09497"
                     /translation="MLSKTKSRNRLSLSNHKSNTGGSATRDELLRLKYSMIKPDLSVY
                     TLDDTTTTVVSTPRTATEPKITTEPTYPDFTPWKDFTQVSEQKESTGTETKTGTGTGT
                     GTGSIDQSRSQVPPSGEAAEKEHVYFNKGYAEAPQVNNEYYSARNLLQSTLLKSNDNC
                     NTVISELSQHLTNSFRSRNEVINRIKSDSAHFRLPQRVTLTAAKRDMWLTELSNPNIP
                     LQKIGEKIPHGMKNKTLIDAVITKKIPIDRALWLTKCILYGEIIALRRKIQSRLNLNG
                     GGNGSVSGNTGMGVGSSALASEWTVFEKYEIHWFHDWTQQVTEYIFKFSKEMNSITNH
                     EYKGVYMSRLSYLLDYVQHLYIEALVDPSYFQIQILKPFRDNIPKDKKLLESITINTN
                     QDDDEADNCEDGQDEKEVHDASDRQRALVKVDFSQTLFALTLLKIFWKDLLQHENVIK
                     EVAELLLLNYMIIANSVLITGIRLPQTLGSKLTGSIKDLIVYLFKHDVNIFVIPESWH
                     HVESLLNEILLSHSEACTLEQKGKLLKQLDLIKFRNESLVLNTKGETGSASGSGSEGE
                     GVLGNDTHSPKDGASLLTTNIRHKRESSSNAALIINNLDNGRLNDKMAEMFLPYNNGN
                     VTVAESSFTWKQNLSILIVWCCTKWRSRSNKSEEIQIACSFLEKSISKIGLDRYQRNE
                     LENEILENIFALIDDKEELIFIDQSQLYCLINELYRAKICSVSSYMRKLISSGVLSSP
                     ELFSDDEQIPMVIQAHLNILQCLPVENNRQRNNLLKKWRCGTLEPEKLQETKQLFALN
                     FIDRIAKNEDILSHIIDLSNAVTHLTYGSKIQLTNWFAKELNAVFKRTTKLIRLSPTI
                     VYAMYLLHKDCNNLLAFFKFVVPTILKNESGIIFLHHNALYLVARLVMKHFRLIKQFS
                     SSSETSALTLFSLILQNYREAEEYSSYYNFEQVWNFMDHAISRTNAKSNSVSNQDHNQ
                     KRRKVDNNSIGTNDSVQSVPPTVRSTSEFPDTPMRINVEDISNTTMVNANAGSQTINT
                     ADDFFESLANLRRLSSNYHLENDSASFSSQHLSLSVDVLLESWILQNSPNSKDYNVPA
                     KEKEEKEIQTVQLLKLKLANESASDEDNSNANSNANNNANNNANNNANNNANNNANNN
                     ANNNANNKSVVNSKENIIFKMKNLLNQVDNSEQRCAMLKKLVIYDIVSVGDIIKIMFS
                     LDKAFSINYKLFNSMLLNSGSGSSSGYENNLYSNFNSDRNQFISPIQQELFDIAVGFY
                     KRKNRKEFFHLILKSLTSDGPLFTNDLMINHEFVTLEYLRDILARDASFLNESLFAQL
                     SRDDSIELLNLLLGRNNNNYILSLEGFENEIRHLNEFNIGGYQILVALLSKLLDVVDL
                     SVRKLRWEQFVAAMLNCSEDFQKSSSNTDVDYNDERIKTAFKLFEFVSWDQKAILLEV
                     FEEVFLSQGNDARGENQGVVMLSKPRLLGIDSFFTNFIYNSSHKVGISEHLINSISNF
                     VKSMLSTLDIAKSEVVLGDRSREYLLATLFKILIIHRESLCNTLSSSLSSSLSISSSS
                     PSVLSSTSSPSSISGGTCETLVGNLIEMLSARYLAEPNNKWKVLLFDMLSLMKSSIST
                     RRNSITNIDFATSPNSGSTPNEFHPVATSNVTTTVSAQIGTLFELPKMKDVNELKSEL
                     DDDMIRSIIMLDLEELKYGGDVSTFNDPSLVIDSTRRDVFAMSPFVSNLLSVNKSGDY
                     QKTSNGIDIKPFQMKSYEIIEDITVSTVNDACLNLSLFDSYLTRENPV"
     gene            <811061..>813058
                     /gene="zrg17"
                     /locus_tag="PVL30_004165"
                     /old_locus_tag="LELG_04449"
                     /db_xref="GeneID:5231723"
     mRNA            <811061..>813058
                     /gene="zrg17"
                     /locus_tag="PVL30_004165"
                     /old_locus_tag="LELG_04449"
                     /product="cation diffusion zinc membrane transporter
                     Zrg17"
                     /transcript_id="XM_001524427.2"
                     /db_xref="GeneID:5231723"
     CDS             811061..813058
                     /gene="zrg17"
                     /locus_tag="PVL30_004165"
                     /old_locus_tag="LELG_04449"
                     /codon_start=1
                     /transl_table=12
                     /product="cation diffusion zinc membrane transporter
                     Zrg17"
                     /protein_id="XP_001524477.2"
                     /db_xref="GeneID:5231723"
                     /db_xref="PFAM:PF01545"
                     /translation="MNVPNIVLPNQSNPLGIITDDNDSININEPSKSTQMASNSRRSS
                     LGFLASANFSADSLVDAQTLSGITPTTPKHGANSTRRYSNNSLLNSPVLQPPSHSTRG
                     RSRPLSAFLMDSTNAIEEDGDESSFANYATSPEGAHSFCINNDGVNGAINNSPQNVSI
                     STYGNGFYNNNSINNYSRRGSSPTRGPPPSPPRSPSPVRVNKNFRAKSPVRRSLSPTK
                     SGPFNFKPQEIMVHGNGSNSSLQVKPAHRKGHRYKHSSVSMNMFQEPPLADLAEKAPL
                     KSIADSYPIPNYKETFASISKSQKGRLAWSACHFATSLLVFYTGFNLGVGSLSTLAHL
                     IFYDSLGSLFIVLVDVMANFEVWKKPSISFPFGLERLEVLVGFALSASLVMLGFDLFS
                     HFFEELVLSLMSHDNEDHGEHDHLSHHVHEESGPVGNIVAYEVVLLISLAVSLVSSNV
                     ILAYDRINDMLNSTSDKAQQYNGFSKGKINYYKGGSTTMNSATMSSRILNMIKAWRSY
                     PTYLITITYIIFLIVVPIIPGSWVQELAYDIQKCANILVACLLCYNGWNLVKFLGGTL
                     LCAFPYSDYQNSVTKSNIMDQITGLDCFKHGYSIQKLFVTKFSYSLYVIGVSIEMKGA
                     NADDEVRMKFETNRIIENEVKKLERGLKVAKCEITIDIDRF"
     gene            <813421..>814848
                     /gene="ARG8"
                     /locus_tag="PVL30_004166"
                     /old_locus_tag="LELG_04450"
                     /db_xref="GeneID:5231563"
     mRNA            <813421..>814848
                     /gene="ARG8"
                     /locus_tag="PVL30_004166"
                     /old_locus_tag="LELG_04450"
                     /product="acetylornithine aminotransferase"
                     /transcript_id="XM_001524428.1"
                     /db_xref="GeneID:5231563"
     CDS             813421..814848
                     /gene="ARG8"
                     /locus_tag="PVL30_004166"
                     /old_locus_tag="LELG_04450"
                     /note="BUSCO:EOG09262OX9"
                     /codon_start=1
                     /transl_table=12
                     /product="acetylornithine aminotransferase"
                     /protein_id="XP_001524478.2"
                     /db_xref="GeneID:5231563"
                     /db_xref="PFAM:PF00202"
                     /translation="MLRSVSYKVAGPLKASIGKSLLLARFASSDPKTTTASASSSSSS
                     SSSSTKKPIFEGIPDAGDDSHSGEYIKTVSKPYTVTTYARPNLVLTHGKGSHIYDLED
                     RKYIDFTSGIAVTCLGHANEEISKIIQDQSQKLLHCSNLYYNLPAGELANKLVTKTRE
                     LDGMSDAARVFLCNSGTEANEAAMKFARKYGKMVSGGSEEKVEFITFENSFHGRSLGA
                     LSLTPNPKYQKPFAPLIPGVNVAKPNNIESVKQLISRDKTCAVIIEPIQGEGGVNPID
                     GEFLVQLRQLCDENDVVLIYDEIQCGLGRSGKLWAHSHLPKEAHPDIVTMAKALGNGF
                     PIGATMITERIENALAVGDHGTTYGGNPLGSRIGSYVVDQIANEEFLAKVNEKSNLFT
                     DKLEKLANEFPEKILKVKGKGLLLGLQFDEKVDINKIVEKCRENGLLIITAGLNTVRL
                     VPALNIPEGDITEGLAVLEHCIRNS"
     gene            <816043..>817212
                     /gene="PPG1"
                     /locus_tag="PVL30_004167"
                     /old_locus_tag="LELG_04451"
                     /db_xref="GeneID:5231561"
     mRNA            <816043..>817212
                     /gene="PPG1"
                     /locus_tag="PVL30_004167"
                     /old_locus_tag="LELG_04451"
                     /product="Putative serine/threonine protein phosphatase"
                     /transcript_id="XM_001524429.2"
                     /db_xref="GeneID:5231561"
     CDS             816043..817212
                     /gene="PPG1"
                     /locus_tag="PVL30_004167"
                     /old_locus_tag="LELG_04451"
                     /codon_start=1
                     /transl_table=12
                     /product="Putative serine/threonine protein phosphatase"
                     /protein_id="XP_001524479.2"
                     /db_xref="GeneID:5231561"
                     /db_xref="PFAM:PF00149"
                     /translation="MTVPFSIPISDLDYCLEQLLDHKPPKILPPETIHQLCHQLKTQL
                     LQDPNIISLQSPISVVGDIHGQYHDLLEIFKIGGSPPNTNYLFLGDYVDRGYYSVETI
                     SLLLVLKLRYPNRISLIRGNHESRTITTNYGFYTEVLNKYSGSADVWTYITDLFDYLP
                     LGATIDGTIFACHGGLSPSCQQLDQIRAVDRFREIPHDGIMADLVWSDPDVEITDFKS
                     SPRGAGYLFGSDIMNKFCHDNNLVQMIRAHQLCNEGYTSYWKGKCLTVWSAPNYCYRC
                     GNKASVLEITHSCYTQKANLHSNDMSDPDNVLNSGVAMYDKTRTQIEQGVLPGQYFNI
                     FEASQENDEDTINGKSVNGVNFDNDLLDSPSNNNSDFFAAYFQERPKRQHVEYFL"
     gene            complement(<817553..>817774)
                     /gene="HUB1"
                     /locus_tag="PVL30_004168"
                     /old_locus_tag="LELG_04452"
                     /db_xref="GeneID:5231536"
     mRNA            complement(<817553..>817774)
                     /gene="HUB1"
                     /locus_tag="PVL30_004168"
                     /old_locus_tag="LELG_04452"
                     /product="ubiquitin-like modifier hub1"
                     /transcript_id="XM_001524430.2"
                     /db_xref="GeneID:5231536"
     CDS             complement(817553..817774)
                     /gene="HUB1"
                     /locus_tag="PVL30_004168"
                     /old_locus_tag="LELG_04452"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-like modifier hub1"
                     /protein_id="XP_001524480.2"
                     /db_xref="GeneID:5231536"
                     /translation="MIEIQANDRLGKKIRVKCLPTDTIGELKKVLALQIGTPYEKLIL
                     RKGHQVYKDHITLDDYEVHDGFNFELYYS"
     gene            <818227..>822795
                     /gene="SSK2"
                     /locus_tag="PVL30_004169"
                     /old_locus_tag="LELG_04453"
                     /db_xref="GeneID:5231518"
     mRNA            <818227..>822795
                     /gene="SSK2"
                     /locus_tag="PVL30_004169"
                     /old_locus_tag="LELG_04453"
                     /product="Suppressor of Sensor Kinase (SLN1)"
                     /transcript_id="XM_001524431.2"
                     /db_xref="GeneID:5231518"
     CDS             818227..822795
                     /gene="SSK2"
                     /locus_tag="PVL30_004169"
                     /old_locus_tag="LELG_04453"
                     /note="BUSCO:EOG092605FC"
                     /codon_start=1
                     /transl_table=12
                     /product="Suppressor of Sensor Kinase (SLN1)"
                     /protein_id="XP_001524481.2"
                     /db_xref="GeneID:5231518"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /translation="MGESGLDEFISDSIKLAEHVLEAAENDHQHEPHEPHEPREHHEQ
                     GSRNNSDTLSVPVSEDVSPIEDIKEQLQSPRQAHLQNSVFSSRKNSTGSNKSRGSSFA
                     SISSTSSAASSRQPPLLRAQTASNAVPLVNSQSHVKRSLSNGNNEVGIQPGASTLALG
                     NKKPASPQTKSRSGSGSSVGGGIGAPPMTKPSVSRSPSGSVIRTRSRTATHSSSSYNS
                     HQLDAQYLAQEKSYLRKLKNQTVDDYYTKGITGADDDGGAKSIAEEDEDGSDDEDDDD
                     DDDYVDGNGNRGMSNKNSENATLLAAIDEDKYQIDYSMALSLMKNSNVNLTKITNFKN
                     QKADDPAVIERLDWQSMLTSVLTGDVVRSEKTKLINNNNPDNPLERYFHTTFKENIWI
                     GIRAKMFNRTEDDQRKIVAYRRTLVEQLIDDIMQFEVDYSSASGISIREQVESILNRY
                     DEACNLWRNLEDMRSDKPACRSEEFQNRLDALTAWLTITDGINRETETLRVWIGNDEL
                     DITKSPVEFHSNPAHPENASATSPDSSSKIVKEIFDEDHKSLAERLMKEKDVHTIFKK
                     RIFKLISPWMIKSKETYIRLGHMFEIMKLPDYLHDLIQICVIPIKLIKEIIIVRLGYA
                     IKLQNPTLMMIDQMLEDFKSYITIALEVKSGIQEYKRPDPSKNWLLGDLFDNEIADFD
                     TVILRSIRYYLVLLNKKLLDSSRSPTNFRTFKEPEELEEAWTFLKSLGYFVDGGSAVV
                     AEEVANLTSRLNHRLLAYFNHAIRSPSYSGDPRDLVRWYSATLDNFGQTRRKLARFTG
                     DISRSFSNSLVFEIPVSAHQNSTKILLDILKATNHFLVYTNTVEAHGTYFFASAELEG
                     NEHEILKILNGDYVGLDPSATQAAFSELLSLIQPTDGWIMQDQQLQDPTKYAYVMALC
                     PMKPIVWEGAVVNVTIDSVPITDLKNGQLLVVTKSPHTEMHETRNKLLDLLSDVLMVG
                     GGMKPIEQRCSLAKVHSELTKTNKAFFRMSLSVLDSVRIARDQFKQLDTRGDYQAVIN
                     NYFVFARDYGKNAAKNLDASRKSAVIMKLIQLAIDWVKFICDDCIPTDRKTFRWCVLA
                     LEFAMDMTRGVNILFLNDEQFSKLKVKVARCMSLLISHFDIMGARSSEAEKNKLLKWS
                     SQRGNIENSNDEYAHKLYREEVMQQIAEIEKYREELSNEYQSTGKVIDNSDSEYQFVT
                     LLASSFSSVSIRWQKGKYIGGGTFGQVFCAVNLDTGGIMAVKEIRFHDSQSIKSIVPQ
                     IKEEMTVLEMLNHPNVVQYFGVEVHRDKVYIFMEFCEGGSLASLLTHGRIEDEMVLQV
                     YTLQMLEGLAYLHQSGVVHRDIKPENILLDHNGVIKFVDFGAAKVIANSGRTRVSTQS
                     IRPAVAGAGNNNQENLNSMTGTPMYMSPEVITGASGDRSGVVDIWSLGCCVLEMATGR
                     RPWANLDNEWAIMYHIAAGHKPQLPSPDQLSEEGRRFVSRCLEHDPKKRPSAVELLND
                     PWMVSIRQLAFGSGSELSTPSSENGSVN"
     gene            complement(<823150..>823527)
                     /gene="IMG2"
                     /locus_tag="PVL30_004170"
                     /db_xref="GeneID:85890397"
     mRNA            complement(<823150..>823527)
                     /gene="IMG2"
                     /locus_tag="PVL30_004170"
                     /product="54S ribosomal protein img2, mitochondrial"
                     /transcript_id="XM_061119528.1"
                     /db_xref="GeneID:85890397"
     CDS             complement(823150..823527)
                     /gene="IMG2"
                     /locus_tag="PVL30_004170"
                     /codon_start=1
                     /transl_table=12
                     /product="54S ribosomal protein img2, mitochondrial"
                     /protein_id="XP_060975511.1"
                     /db_xref="GeneID:85890397"
                     /db_xref="PFAM:PF05046"
                     /translation="MKPTSTCLIGIIKAPKPELVRYSIPDIKSISVKDLPGRGFGSGN
                     YFIPKTKFNHWPVYKKVQNTKIQTEIKRIQGDLQQLKRDLLKFDPELVITMNQTAGIM
                     NVKGDVVKQLMALFEEQSAKAKN"
     gene            complement(<824158..>826905)
                     /gene="SUR1"
                     /locus_tag="PVL30_004171"
                     /old_locus_tag="LELG_04454"
                     /db_xref="GeneID:5231510"
     mRNA            complement(<824158..>826905)
                     /gene="SUR1"
                     /locus_tag="PVL30_004171"
                     /old_locus_tag="LELG_04454"
                     /product="zinc-finger protein"
                     /transcript_id="XM_001524432.2"
                     /db_xref="GeneID:5231510"
     CDS             complement(824158..826905)
                     /gene="SUR1"
                     /locus_tag="PVL30_004171"
                     /old_locus_tag="LELG_04454"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc-finger protein"
                     /protein_id="XP_001524482.2"
                     /db_xref="GeneID:5231510"
                     /db_xref="PFAM:PF00096"
                     /translation="MSKHIEVSPRIQSVASATPDASQDPSQDPSQGSKQESSLNGLTI
                     EQILTHGYVHGHIHKHGDHTHIHGHIHNHDHDQHFKYQQGSLPNNFQASGNNNNNNNN
                     DNTASNSSISSCNANFHNPDNSSYESDEKFCNELENFVNCEDVFCDDLDDCFFYNCFD
                     GNNNNNNNNNNNNINNCNNICNSSNNISRSSIACNGMQCDQVSNGVPGVCCNNINCTN
                     IQRPITGGNTLASAVSTESKDGSSTADRLQCCNDPHCLNLDYNSGSGSQSSQHSQTCY
                     DPNCTIGSTSTIGTTTAPTAPTAPTASTASTASTASTISSFMHSEEDNLCNLQTAKRP
                     LFEDLINNVHQNMQLQFPKIGGSFSSGQKETEPPARKKLKQEKNGGTNGEKGGDGKDG
                     GERGGEEWGRGGNKNGINSGANDRTISSGGNNSLFQLHFPHECHATDVAESSKHHHVH
                     QSCFHTTIPNDIDFQNSSDEKMSISDYEFMVRFNNFNNLMSNTGFVDGGSDHVNGNGN
                     GNVGNGGNGGNGGGGGGDANGNYSNTERLINSNLENEENEAQNKQLSQYPCQWERCFK
                     KLSDENFMSHMNDHLSQEQTTGKHPSSFQCEWNDCNFTDSSLDALLGHLQSHKQSNNA
                     SHYPTNTSNYNYPANFLSPISSSSPHPNSESPKDHHFSLPSQNHHHVIHDVNITSMQI
                     KPKKIKTPISNSCCIQQSPLPSQIVPTEPTEPTARTVPTTEKVTSNIITNQETRKKLN
                     RMMATKTSHCCHWEIGVDQDGKPVSCDNVYHSEGDLQQHIIENHIGSGKSSYKCCWIG
                     CERHNGKIFTQRQKLYRHIHTHTNYKPCKCPECGASFAVESMLQQHLRTHSGEKPFVC
                     NICKKSFATSSSLSIHNRVHTGEKPLKCKWPGCNKSFSESSNLTKHMKTHTKNIIVRP
                     M"
     gene            <830904..>832340
                     /locus_tag="PVL30_004172"
                     /old_locus_tag="LELG_04455"
                     /db_xref="GeneID:5231506"
     mRNA            <830904..>832340
                     /locus_tag="PVL30_004172"
                     /old_locus_tag="LELG_04455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524433.2"
                     /db_xref="GeneID:5231506"
     CDS             830904..832340
                     /locus_tag="PVL30_004172"
                     /old_locus_tag="LELG_04455"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524483.2"
                     /db_xref="GeneID:5231506"
                     /translation="MLFKRNKQAGVFTSNINSNSTTSGGERTIKRVHSARNLFKKLTI
                     STPVSLAEQRNERNDHLVYHHNQNHYLPHTPDTGSFNQHSRNNSNNNSSSNNNNNNNY
                     NNNQYTDVRTAGTNIFSTPSQPSLPLTDNSSIIPPSEPIPDINDFENDSIFALYTPRK
                     PVIANNQLPRMDSQCASLLDQLDGPPLTSTSSHVSHISKVSCNSHNFHNFHNSHNSDH
                     YAGSATSNQPITMCEGEISTSTSLEHTPTKDTDAISITDANIQIYKRAHVKSKSNSLH
                     LIEGAFKVNANGSPVRLVKKSTTTHITSIPNSKSEKLKEVRKDTTENKIVITPVDAEP
                     VESLDANLESIYQFEMMLLKDKHHYELKQQQREIRNLRKKLQQQTLLCHDLTNRLASY
                     ESVNPSPSYSYPYPSSSSVSPLPPPPPPPAQQQQQLSRTAPPSLVVVSSSQLLPPFKL
                     EKPKSGYASSISSQDSLMSFNGTGLKAT"
     gene            complement(<832497..>835091)
                     /gene="PAT1"
                     /locus_tag="PVL30_004173"
                     /old_locus_tag="LELG_04456"
                     /db_xref="GeneID:5231457"
     mRNA            complement(<832497..>835091)
                     /gene="PAT1"
                     /locus_tag="PVL30_004173"
                     /old_locus_tag="LELG_04456"
                     /product="DNA topoisomerase 2-associated protein pat1"
                     /transcript_id="XM_001524434.2"
                     /db_xref="GeneID:5231457"
     CDS             complement(832497..835091)
                     /gene="PAT1"
                     /locus_tag="PVL30_004173"
                     /old_locus_tag="LELG_04456"
                     /note="BUSCO:EOG09260S3L"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA topoisomerase 2-associated protein pat1"
                     /protein_id="XP_001524484.2"
                     /db_xref="GeneID:5231457"
                     /db_xref="PFAM:PF09770"
                     /translation="MSFFGFDPTQPPAGTRNDEAYDFENTYDGLGELEEDDAFNSETF
                     GTSTNEIRKDFEFGHTDNNTGTGAGYQATPHASHTSTAAAAAAATATPQSTSISYAQA
                     AQSAPVNDDEFMQELWGESNAPSKSAGVSTSAKGDSQSSERKVLSLEEIEAQLTAIDQ
                     SQMPNFAHQQPGSFPPQGYGVPGMMPPPPHIPPQHFNGYMMGGFIPPNQFGMPGMPPQ
                     PMPPMQPPIPSSQPLPHSQPVPPPPQQVQQQQQQQQQPLVSIQQENQQPRNAIKANEQ
                     NASQQARTKPQKVDLSQFPVLGSKEATQQQQLAQHQPQAQQPHYQQQQHQQQQQQQQH
                     QNFLRGQENQQFDAHQQSPRHHHQRLQDLSPEERDKALKRQEKVSRIMRYSGIMNPKD
                     KDFVTRFQLSQIVTEDPYNEDFYAQVYKVIHPKSANGTQLQAPAQQNNSIAQAYLDHS
                     GHRLGGRYKRADVALQRMQQQVQKAVAVAKDRPKPNQLSKEGALGKISFASGKKPRQQ
                     LEIISKAAEREKENKSGNKGDDANSSSSNNNNKNNNNGSGSGIGAGDEDVRKYGRKDI
                     LGILENIISELMNVESESRTSVDIDTSKLWEAMKVLEQTSSSGDPESEVNPFVQCLNY
                     NKMLKILMRLFKFLNREQILTIAALIMSNLENLSVIKNGSYTTYPDKKVPEKVLKLVD
                     AYSLTFSKVLMNAVLEFKFSEIIGLIVILIEHNNVAFVSTTKIGLTILTTLLSRAELI
                     IGEAQISATDLAEWSSCYDELFTALESRIAAIFPPNPIEVDDGSSRENYIWQFLATLS
                     VGGKLSHQRIIVDELRDEIFGVMKRAREIDPRDMANLYKKQNLLNNLNMFLVVMGLVA
                     DENEIKEL"
     gene            complement(<835461..>837908)
                     /gene="ABZ1"
                     /locus_tag="PVL30_004174"
                     /old_locus_tag="LELG_04457"
                     /db_xref="GeneID:5231493"
     mRNA            complement(<835461..>837908)
                     /gene="ABZ1"
                     /locus_tag="PVL30_004174"
                     /old_locus_tag="LELG_04457"
                     /product="para-aminobenzoate synthase, (PABA)"
                     /transcript_id="XM_001524435.2"
                     /db_xref="GeneID:5231493"
     CDS             complement(835461..837908)
                     /gene="ABZ1"
                     /locus_tag="PVL30_004174"
                     /old_locus_tag="LELG_04457"
                     /note="MEROPS:MER0045095"
                     /codon_start=1
                     /transl_table=12
                     /product="para-aminobenzoate synthase, (PABA)"
                     /protein_id="XP_001524485.2"
                     /db_xref="GeneID:5231493"
                     /db_xref="PFAM:PF00117"
                     /db_xref="PFAM:PF00425"
                     /db_xref="PFAM:PF04715"
                     /translation="MILLIDSYDSFTNNLAHLIKSTTSVNVDIVHNDAIDAKDYEAFY
                     KQAAEKYQCIVIGPGPGHPAIKEDIGIIGWLIKRITQDGPEHAVPILGICLGFQSLCY
                     EFGNEVSRLRNVKHGQIYSVEPTGESGLYLSKEGFDSVRYHSLHVKTPFSSNIEPLAY
                     CNEIDISDNDNHFNGDADEKEKEKEKEKEKEKEKEKEKRKDDIKGASKILMAMKIRDF
                     PFYGVQYHPESICSQKGKDLVKNFIKIANEYNSKYRRLKCPSTRVCDSTQTMLRNGTS
                     NDSSKGTSNSTPKGTSNGSSNGFTHRYQDIQFIKLNLNEKITPIDICDHFYKEDGAAN
                     FILLNSASTPGEWSIIGFPTPGKSPVITHSVDDINHVSISTYKSKNKDVQTIKVDGKE
                     GMWSFLEEKLREKFISRDDLKSKIKNYHSREIPFFGGYMGLASYEEGQHVMIKKLSPI
                     CRENTTTPDLKLVYVENSLVYDHITKEWFLISLENSDWAKDMSQTLQSITPINIDSVP
                     LTVKDLAKKCDSNLIKFDFPCSESYKAQFEKCQEYLHSGDSYELCLTTQSKIVLPSYI
                     EPWDIYKVLTLHKNPSPFSCFMDFDDCCLISSSPERFLSCKQDGTEKVVELRPIKGTV
                     KNTPDVDIAKATKILKTPKEMGENLMIVDLIRHDLYQFTDDVSVTQLMAVEEYKTVYQ
                     LVSVIRGVLPEAPNHFQGLDLLRYSLPPGSMTGAPKRRSVELLQDIEEMQSNVVKGGR
                     RGIYSGIVGYWSITDDSDWSVVIRSIFSYKDDVENSESTNIWRIGAGGAITVLSDCKG
                     EWEEMNLKLTSALQAFR"
     gene            complement(<838417..>843012)
                     /gene="USO1"
                     /locus_tag="PVL30_004175"
                     /old_locus_tag="LELG_04458"
                     /db_xref="GeneID:5231436"
     mRNA            complement(<838417..>843012)
                     /gene="USO1"
                     /locus_tag="PVL30_004175"
                     /old_locus_tag="LELG_04458"
                     /product="Vesicle-mediated ER to Golgi transport protein"
                     /transcript_id="XM_001524436.2"
                     /db_xref="GeneID:5231436"
     CDS             complement(838417..843012)
                     /gene="USO1"
                     /locus_tag="PVL30_004175"
                     /old_locus_tag="LELG_04458"
                     /note="BUSCO:EOG09261B18"
                     /codon_start=1
                     /transl_table=12
                     /product="Vesicle-mediated ER to Golgi transport protein"
                     /protein_id="XP_001524486.2"
                     /db_xref="GeneID:5231436"
                     /db_xref="PFAM:PF04869"
                     /db_xref="PFAM:PF04871"
                     /translation="MEYINNILGSQSQVQSVEEAIPTLCSRLQHATLVSDRRSAVLGL
                     KSFSRQYRESVVEHGLRPLISTFKKDSENIALAKALLETFLILLIRGEDTEEDATRGW
                     ISQQSRQQNGKYPSPLLMEEFSLDQLSLWIADAILQDPEMLSLLIQELTEDDYHLKFY
                     ALQLLEFLVLSRSSRAKDVLLHAPTAMSSICAVLNDTNEPVRNEAILLLMALVNNNFN
                     IQKLVAFENTFETLFNIIDEEGGIRGSILVQDCLTLITNLLLYNASNQKYFMETQCVP
                     GLTRLLDEAVFDESAPGSSGFDSSEELNPNLNGALDAPVPMVWTEQRVQNMRICLEIG
                     RLLVAENNELIMQNQDKLFKEGFHYVILKLIFSSSTENSVRATALLTAADAIRGNHNI
                     QYEFSKIDVPYIDPCLPVQTQANNPPVSVPLALLNWCLFINSVHSFDVRISASYCLQA
                     YFKNNQEAKSAFLKDQISAYHSENYYPLNEESNEELNKEEKEEEKKKEQGKDKQEYMD
                     MNGHGTATKDIPYGNIFKSLMEYDAEVKLNPYKVWFSACILMYIFEDEPENKNIARAV
                     MTGNENSGEEVMASIQAMSELLVTTFEDMDQRVSIGYLMLLTTWIFEDFDAVNDFLND
                     ESTVKSILAFLSNNTSETNSIVHGMTAMLLGIAYEFSSKDSPIKRQDLHALLVKSIGM
                     DNYAHKINQLTANPVFKYFDETSNFVSVQDESGLPDVYFDQCYVELMREHMTRIKRAL
                     FHDPAAEPRGRISYEVFEEVDMKLAEVSNRLEQERADSATKEDSHKSEVEKLTTTTKE
                     LQQKLEETNVDLEKVKVELSTFRDKHSTSSKELLELKKIKEGLEKNHLDYKKELEETK
                     TKISQLKSQLSSTETKLKTTEEAKKKLEDGVNGMTKDLFQLKKQNSEWDNKVKVSEKE
                     TRNVRNEAEKIKKDLEYRLRKIQEERDAANKVVSESKEEISILKKSITSLESQLANKT
                     VDANKLTMEKDHFAAKIKEQEKQLSLLSGQLQEKSSQFTELESSLTEVKEQKASADIE
                     VEKLSSKLKRAREDLIHHESEMKEKLDRAKDDIENLEEKIKNFETEIQKKEKELEKHN
                     DLEKQIDRLNTELTNRDEEIKKHQASLSEKEKEVDSKKLLEAKILELEGELKEAKNEA
                     LTLKKEHDKTIEDLKQNEKTINEESKVLVKKIAALESDKKSLQNEISELKEKLSQSEK
                     VQEDLKDSKKQFAELEKSKSKLESDLKSLQKVLDDKSKLEQATSNELTDIVEKLKKEN
                     SAMEEKISGLEKEVESGTSLKDENQGLKTKIDELEDKIKGLDTDKGKLESTFQEVKVE
                     KAQLDKEIEALTADKKRLIKEAESFKSLQTDNQNRFEKRIDKLEEEKIDLSNQIEKLQ
                     EEKDAYKAKQLADEKKITNLSKEKSDALSQLEKLQLDLKSTKEEAKTVSDQNLELEKN
                     ISESKTKSDAVFEKVSTLESKNAGLEEEIKNLKQRITSLVPKSEIDDLMLLMADLDEK
                     KNKYAKRLKQLGHEISDDDDSSEEEEDDEDDEEDEDE"
     gene            <843411..>844184
                     /gene="RAD59"
                     /locus_tag="PVL30_004176"
                     /old_locus_tag="LELG_04459"
                     /db_xref="GeneID:5231435"
     mRNA            <843411..>844184
                     /gene="RAD59"
                     /locus_tag="PVL30_004176"
                     /old_locus_tag="LELG_04459"
                     /product="mitotic recombination and DNA repair protein
                     rad59"
                     /transcript_id="XM_001524437.2"
                     /db_xref="GeneID:5231435"
     CDS             843411..844184
                     /gene="RAD59"
                     /locus_tag="PVL30_004176"
                     /old_locus_tag="LELG_04459"
                     /codon_start=1
                     /transl_table=12
                     /product="mitotic recombination and DNA repair protein
                     rad59"
                     /protein_id="XP_001524487.2"
                     /db_xref="GeneID:5231435"
                     /db_xref="PFAM:PF04098"
                     /translation="MLVQDLHQHNHTHNQDLEDGGDNIRESTESLLPTTVTLFPDIAN
                     LEDFFNDGEDETHQGMTIINEWALSKISTLQSKLEQMQHTRDAKFYRGNSGGFQKFSS
                     SSIYQLANEVFGFNGWSTEILSCVMQEIRVSNEEQDDQVARTHTTLEANSNNLDLSTR
                     ESSSGKTLSSGKRYSAKSSCLVKLVLLDGTCREDFGFGTATNVPSKHACFAKCKKEAV
                     TDAIKNAILGLRDVYNCYESNQFFQMSSLIKKNELQKNR"
     gene            complement(<844391..>848425)
                     /gene="ELP1"
                     /locus_tag="PVL30_004177"
                     /old_locus_tag="LELG_04460"
                     /db_xref="GeneID:5231385"
     mRNA            complement(<844391..>848425)
                     /gene="ELP1"
                     /locus_tag="PVL30_004177"
                     /old_locus_tag="LELG_04460"
                     /product="Putative elongator complex protein 1"
                     /transcript_id="XM_001524438.2"
                     /db_xref="GeneID:5231385"
     CDS             complement(844391..848425)
                     /gene="ELP1"
                     /locus_tag="PVL30_004177"
                     /old_locus_tag="LELG_04460"
                     /note="BUSCO:EOG09260JO5"
                     /codon_start=1
                     /transl_table=12
                     /product="Putative elongator complex protein 1"
                     /protein_id="XP_001524488.2"
                     /db_xref="GeneID:5231385"
                     /db_xref="PFAM:PF04762"
                     /translation="MKNLIVLNRGYIKPESRTYPDLHIIDSVYDTVSDAITFVLSSDE
                     SPVIEVQQFHKNGNVTVLASFEANSKLLSTAHFVDSSQLVFVFANGDIVTATYDSQQP
                     VQDYENVVIEIVGTIDVGIQAAQWSVDEETLAMITNENKLLLLSRILEPITEKLLDSA
                     DIKITDSKHVSVGWGKKETQFKGKGFKALEREKEKEKGKEKGKNINGHSHDHAHGHDS
                     VTEPLRDPTVNEVEKGSLSRMDDGTVRISWRGDSNYFAVSTVEPVLVEDSGEMYDRRV
                     IRVFDREGELDSVNEAVDGLEHNLGWKPQGALIASTQRHIDDEDGEEVLDLVFYERNG
                     LRHGQFNTRLNPEDEVVQNVIWSSDSEILLLQMNDRVQLWTSKNYHWYLKQELFAEGI
                     IFTKFHPEKPSNFMIGTANGLQIVDLTHKVVTGPTRSGDDVGMTLVVDGATAKMTPLS
                     VANVPPPISYRELDVLGNITDLAVSKSNEKYAILTSDNDLYFSQLSLEEMKAGAQPKV
                     VSHLDAKKYINESNEVAKQIAFIRDDFIAVVIDAPMYSRIVLFEVDDISNPKMNESVD
                     ITPKVVLLKSRADFATVIIETVDNKIIELSSTQDSREITRFPQLCREIEVSYNEATDE
                     FEAFGISRTGKLFRNEVPVVSGVTSMLITESHLLFTTVLSKLCFVHLNSRHENFEVFQ
                     NLSNENIHDERVRQIERGSFLVNTMPSKYSVVLEAPRGNIETICPRIMVLTAIRKFIS
                     QKDYKSAFIACRTHRIDLDILHDYDTVSFFNNIELFVNQIGKIEYLDLFVSCLHEEDV
                     TASKYKETLTDAGINESELKKEGETLQPAFKKKFNVSDKNQKKFEKFEDSKVNRICQA
                     ILAVLLKPEYFEKYMQTILTAYACEKPPNLVAALELSESFTDEKQKETAITHLCFLQD
                     VNKLYQTCLGLYNVKPTLLIAQQSQMDPKEYLPFLQNLHVQTDLERKFLIDDYLKNHD
                     KALQWLHEMGDEAYERFDNYVVKHELYKLAMKIYTYDKKRTNDVMSLFANYLHDQTNF
                     GESALTYEYLEDLDSALENYILAKKWRQALSIAEKPNFKTKLIETANSLVATLTADHK
                     YSDAAEIEYYCLQNVREAVRLYCKQYWFDQAILLAERTQNADLIESVVDVQINEGFGV
                     IAELLADCKGQMNSQLRRLRELRTKKQDDPYAFYGNPDDLDTPDNVSVAASETSTAPS
                     FFTRYTGKTAGTAKTGASRRTAKNRKREERKKAQGRKGTIYEEEYLIRSVGRLIERLD
                     STEQDAIRLIEVLIRRQMKEQAYQIQKSWCELIALIKENIDEVHNMSERDRERIDDNG
                     EIYLIDEIPKPNIREFPKFSILDY"
     gene            complement(<849112..>849915)
                     /locus_tag="PVL30_004178"
                     /old_locus_tag="LELG_04461"
                     /db_xref="GeneID:5231380"
     mRNA            complement(<849112..>849915)
                     /locus_tag="PVL30_004178"
                     /old_locus_tag="LELG_04461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524439.2"
                     /db_xref="GeneID:5231380"
     CDS             complement(849112..849915)
                     /locus_tag="PVL30_004178"
                     /old_locus_tag="LELG_04461"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524489.2"
                     /db_xref="GeneID:5231380"
                     /db_xref="PFAM:PF04564"
                     /translation="MIPNFKFVFNSKPQPKKAPRGKQVRGSYEELIPHVRHDIEMTKA
                     QLHQYDGNTLLNKLTALMESDHEKMIQQLQKECERECDCGSESKRGKSSSSSSSSSSS
                     SSSSSSYYEKLFLYLNTQLEELSNLLGVFKNNYIHSLYNDKMSSKKTTPLQTTRKYST
                     SASFSSDSSTKSSLSLVNSNNDLMEDAPDHLLDPISYEVFTDPVITPSGITYEKETIL
                     NHMKKKGKYDPISKQELSKDQLYPNLVIKDSVEAYKNDSVMKKLDSVQL"
     gene            <852100..>854592
                     /gene="VPH1"
                     /locus_tag="PVL30_004179"
                     /old_locus_tag="LELG_04462"
                     /db_xref="GeneID:5231307"
     mRNA            <852100..>854592
                     /gene="VPH1"
                     /locus_tag="PVL30_004179"
                     /old_locus_tag="LELG_04462"
                     /product="H(+)-transporting V0 sector ATPase subunit a"
                     /transcript_id="XM_001524440.2"
                     /db_xref="GeneID:5231307"
     CDS             852100..854592
                     /gene="VPH1"
                     /locus_tag="PVL30_004179"
                     /old_locus_tag="LELG_04462"
                     /codon_start=1
                     /transl_table=12
                     /product="H(+)-transporting V0 sector ATPase subunit a"
                     /protein_id="XP_001524490.2"
                     /db_xref="GeneID:5231307"
                     /db_xref="PFAM:PF01496"
                     /translation="MADREEKEEAVFRSADMSLVQLYIPTEVSRAIVYKVGQLNVLQF
                     RDLNSKVTEFQRSFVKELRKLDNVERQFRLFKKELDFRDIHIKLYPYEFSIPQQSDID
                     ELVENSQLLEDRVVQLRDSVDTLHNNENYLKQLRYTIRAVDRFFNVEGERTTSEESAL
                     LSELEHGATSHVHSASSFISGVIDTEKIGVLQQILWRTLRGNMYYHSEALEEEIYDAK
                     HNAFVPKSSFIIFSHGSMIHDRIKKICESLDAIIFDIEGSAEDRSKQLSKTNIKLNDL
                     STILSESENALTSELIAISHDLYKWWELIAREKAVYQTMNMCDYDGGRKTLVCEGWTP
                     TDSIQDLNNTIQDYDQAQAIPTILNVLNTNKTPPTCNRTNKFTYAFQSICDAYGVAKY
                     KEINPGLPTIITFPFMFAIMFGDMGHGFIVFLAALAMVLNEKRLDGMKKDEIFDMAYT
                     GRYILLLMGIFSMYTGFIYNDIFSRTMTFFPSGWEWPENFKLGETIVAKSVGTYIFGL
                     DPAWHGTENALLFSNSYKMKLSILMGFIHMTYSYFFALANFLYFDSVIDIVGNFIPGL
                     LFMQSIFGYLSLCIVYKWTVDWFAVGKQPPGLLNMLISMFLSPGTVEEPLFAGQAQIQ
                     IVLLIIALICVPWLLLVKPLYLKRQLDRKAKTHGAYSQLPNDGENNVDGEGFVFDNES
                     NNENNNNNEDVADNGEEDEDHEEHGFGDIMIHQVIHTIEFCLNCVSHTASYLRLWALS
                     LAHAQLSTVLWSMTISKAFGPTGLMGVIAVVFLFAMWFVLSVCILVVMEGTSAMLHSL
                     RLHWVESMSKYFEGGGAMYEPFGFVGLLDNVF"
     gene            <860283..>860864
                     /gene="PGA62_1"
                     /locus_tag="PVL30_004180"
                     /old_locus_tag="LELG_05794"
                     /db_xref="GeneID:5236007"
     mRNA            <860283..>860864
                     /gene="PGA62_1"
                     /locus_tag="PVL30_004180"
                     /old_locus_tag="LELG_05794"
                     /product="Flocculin type 3 repeat"
                     /transcript_id="XM_001528762.1"
                     /db_xref="GeneID:5236007"
     CDS             860283..860864
                     /gene="PGA62_1"
                     /locus_tag="PVL30_004180"
                     /old_locus_tag="LELG_05794"
                     /codon_start=1
                     /transl_table=12
                     /product="Flocculin type 3 repeat"
                     /protein_id="XP_001528812.2"
                     /db_xref="GeneID:5236007"
                     /db_xref="PFAM:PF13928"
                     /translation="MQYSTVAVLAAIAGSALGSYNTTSTATDIHTTVITITSCEENSC
                     TPIPITTGLTTVTSDQTFYTTYCPLPTTSSSCTEESTVSKLSSTTITITSCEEDKCTP
                     VPITTGLTTVTEGKTTYTTYCPLPSTTTTNKVHPTSSPSSVDDTSKTSVAPYSSSSTG
                     SAEPSSATIPVVDGAAANAIPIIGGLLALGAFI"
     gene            <863538..>865261
                     /locus_tag="PVL30_004181"
                     /old_locus_tag="LELG_05793"
                     /db_xref="GeneID:5236008"
     mRNA            join(<863538..864694,865075..>865261)
                     /locus_tag="PVL30_004181"
                     /old_locus_tag="LELG_05793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001528761.2"
                     /db_xref="GeneID:5236008"
     CDS             join(863538..864694,865075..865261)
                     /locus_tag="PVL30_004181"
                     /old_locus_tag="LELG_05793"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001528811.2"
                     /db_xref="GeneID:5236008"
                     /translation="MSSSTKDSKTSNPTPRSINPGPSKPDLAGVDSSSISGQSISTSG
                     RADMSEGEDESPGLKRTEAPQINQVEINEILDLKSEMMMMQEQMKQMTAMFKAAMIQT
                     VPQLSTPVPARNDEANKAQISDDNNSITSPTDVQMKVHPEEHTFSPGRNFPTSRPHSL
                     ASPLTHQSRQSGTPSAYGSDRSVASYDGILYHGEVVHSGFWVEGHEEACQIINEARQR
                     YPHGEDVRVIPYIRVPDIAVEKAFMAYYDKLLAKQGRTQNDNMALGQYDIAKRVPLKF
                     SDEEGFMFWLKSVLWHKHTYGVPDKLIINELRNGANLTKSESLKDMIEMSCKSEGPFE
                     QPVVDYLPILGNGGTPPETNQVTDVMTAIHDALKKKHNPRVKMTIIGIAVKNSRGVFN
                     RSLDISSTNSEQTDPGARLVDGEKLFTSPNVLSTSTRNPHGAKDNYIPTIIEQNP"
     gene            <865754..>866011
                     /locus_tag="PVL30_004182"
                     /db_xref="GeneID:85890398"
     mRNA            <865754..>866011
                     /locus_tag="PVL30_004182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119529.1"
                     /db_xref="GeneID:85890398"
     CDS             865754..866011
                     /locus_tag="PVL30_004182"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975512.1"
                     /db_xref="GeneID:85890398"
                     /translation="MEVDLDYEYEEPDASDARFDPSASAMNKELENLAMEDVVNPDEE
                     HKSFLSGGEGNRNEPVPTSHESGNMQSQILEIRKAYLCERS"
     gene            <869674..>870360
                     /gene="PGA62_2"
                     /locus_tag="PVL30_004183"
                     /old_locus_tag="LELG_04464"
                     /db_xref="GeneID:5231689"
     mRNA            <869674..>870360
                     /gene="PGA62_2"
                     /locus_tag="PVL30_004183"
                     /old_locus_tag="LELG_04464"
                     /product="Flocculin type 3 repeat"
                     /transcript_id="XM_001524442.2"
                     /db_xref="GeneID:5231689"
     CDS             869674..870360
                     /gene="PGA62_2"
                     /locus_tag="PVL30_004183"
                     /old_locus_tag="LELG_04464"
                     /codon_start=1
                     /transl_table=12
                     /product="Flocculin type 3 repeat"
                     /protein_id="XP_001524492.2"
                     /db_xref="GeneID:5231689"
                     /db_xref="PFAM:PF13928"
                     /translation="MQYSKVAVLAAVSGSAFAAYSNSTVTDIQTTVVTITSCEEDKCS
                     TVPVTTGLTTVTEWDTTYTTYCPLSTVTEQESTTVTITSCEEDKCSTVPVVTGLTTVT
                     EGETIYTTYFPLTAETKAPQESKAPSSSAPAVAPAPESTTTTAKAGESSAAAPAPSTV
                     AEESKAPAASTEANTEAPAATTPTTVAAQSESSAVAAESSPAVSAVEGGAASNAIPVV
                     AGLLALGAFI"
     gene            complement(<871059..>872096)
                     /locus_tag="PVL30_004184"
                     /old_locus_tag="LELG_04465"
                     /db_xref="GeneID:5231475"
     mRNA            complement(<871059..>872096)
                     /locus_tag="PVL30_004184"
                     /old_locus_tag="LELG_04465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524443.2"
                     /db_xref="GeneID:5231475"
     CDS             complement(871059..872096)
                     /locus_tag="PVL30_004184"
                     /old_locus_tag="LELG_04465"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524493.2"
                     /db_xref="GeneID:5231475"
                     /translation="MRNATAGLTKDSIQRWASHIQKQSFVLNDVYKPQPVKQLHDFFE
                     RILNHQNHLIETVSQSSSSSSPSTQNAWYWGSHFLYNTQLNKTLGTDGYDNYQAPVVE
                     DSQVFSRRLWTRGSLRFHRFPLSESPLKCCEKINSIKHIQENLFLQVERKICDESSSK
                     LLLTEMRGFVYTNQKHKPEMIKSRIYNNNNNNNNNNNSSSSQNIDTPVPSFRLSPRDL
                     LYYSQLTNNLHKIHLDPVYCRHFEGLPDVLVHGPLQVSLLLYYFAKLHPLIVPQSFTY
                     RTYEPCYAQEELGIVVSEKLGGEGGEGGYYMQGEGKTDKVFELTLLNVKDYRIYMQGS
                     YKGTLQAQVKL"
     gene            <872409..>873293
                     /gene="RPF1"
                     /locus_tag="PVL30_004185"
                     /old_locus_tag="LELG_04466"
                     /db_xref="GeneID:5231527"
     mRNA            <872409..>873293
                     /gene="RPF1"
                     /locus_tag="PVL30_004185"
                     /old_locus_tag="LELG_04466"
                     /product="Ribosome production factor 1"
                     /transcript_id="XM_001524444.2"
                     /db_xref="GeneID:5231527"
     CDS             872409..873293
                     /gene="RPF1"
                     /locus_tag="PVL30_004185"
                     /old_locus_tag="LELG_04466"
                     /codon_start=1
                     /transl_table=12
                     /product="Ribosome production factor 1"
                     /protein_id="XP_001524494.2"
                     /db_xref="GeneID:5231527"
                     /db_xref="PFAM:PF04427"
                     /translation="MSTSEALKNIKNKQRRQKVYGDIKRAKEKQRHQLRAERAKEERL
                     NPELREQRIAENVPDTIESKRIYDETIAQEVEGNDEFAEYFENLTKEPKILLTTNVNA
                     KKAAYEFADMLMDFLPNVTFIKRKKDFSIQDMAKFCSNREYTTLIIINEDKKKVNGMT
                     LINLPEGPTFYFSITSIVDGKRIKGHGRATDHIPELVLNNFNTRLGKTVGRLFQSIFP
                     HRPELQGRQVITLHNQRDYIFLRRHRYVFRNEEKVGLQELGPQFTLKLRRLQKGVRGD
                     VVWEFKPDMERDKKKFYL"
     gene            <874136..>877936
                     /gene="MSN5"
                     /locus_tag="PVL30_004186"
                     /old_locus_tag="LELG_04467"
                     /db_xref="GeneID:5231665"
     mRNA            <874136..>877936
                     /gene="MSN5"
                     /locus_tag="PVL30_004186"
                     /old_locus_tag="LELG_04467"
                     /product="karyopherin"
                     /transcript_id="XM_001524445.2"
                     /db_xref="GeneID:5231665"
     CDS             874136..877936
                     /gene="MSN5"
                     /locus_tag="PVL30_004186"
                     /old_locus_tag="LELG_04467"
                     /codon_start=1
                     /transl_table=12
                     /product="karyopherin"
                     /protein_id="XP_001524495.2"
                     /db_xref="GeneID:5231665"
                     /db_xref="PFAM:PF19273"
                     /translation="MDSDGVRQIISALEAVYDPKSSNDQRREAQAFLETIKSNEESPY
                     WGFQLALPENNGANYIVRHFGLSLMQTSLKYKYHTFDSIKITAIRNWIIELSNKVEEK
                     DPHYIKEKIALLWVSLVKRIWGSYLVKSEHQQNARQELDNKAQENNNINTTNNNNNNN
                     NNTNNNNTEYTHQTPVSAQEKEDGWVSMDSDLWNLWQSNITCRELSLTILRTLFEDIY
                     LLDDPIASRNSVILNQLSVLIVTPNSILDTIYEENPRLTICKASADGWFKAWSTFLVE
                     ILSSGAEYQNEPYQKFIPRILSTFKTCLHWIHPTVLREQNIMQTLLGILSSSDVKVRT
                     LAVDCLHILFTRTYQDETDFNFFIGSVFSTEGINKFSEFYNSLVLDPDDIDEQVYALL
                     KKTVEMIVSLSEYLNITSKYKINWDERDVSGYLRLVLSTTDHPSLIISGLSLQMWVTI
                     LRFDELSAKQQVLDIMMSLLEISADRTINYTWDEEHVSKKFFDVDFDSTPDANSFLQN
                     YRKFNEDIVRITICKKPEEGFMWLENRLQNFFSSELGNACINEYNIGEKSKALNYGLS
                     QFNIIENSIRGISRWRIWYNGEDYDIINDRLSKLVIQLGERLLAMNLASPLLIRKQVQ
                     TLVQFAPLLKDVEGSPLMFQVLEKILTSATFPYPPDITDEERELIRDLRASCGTELNR
                     LAYIMPEALKKIFNDLENVVANILSLKKVSDHENVAFKSFLLVIASRSSIDDKNDLFA
                     KIVDPDLAAWSAPETEKGLLDLHWFMERIGIVQIATYFQKRGITATTNLLEATMDEEG
                     KALKNSLKDHWSSIFPIRATRIFIQYSIEKLNHESPEYLNLLKLWKPRVQPIVPHILQ
                     LLTQIQAYHDPANWVDLPTEVQSFVKYSCTERFWQQGVSIQSKETFIEENVKAALTLR
                     DFADSVGHLIRYTREYAFLTVGSLAQLEDTLYEIPNIAAMIWKAVAGDTVGVTLHSWK
                     HMINSCLRVVVKFCPVKYVEVFMSELLPMALSDIDELIVTRWDKVYKSGLQLSGNEDG
                     ETLSEEMMEEHMLRQLTATVVRFLMDIVGQYNSKTMSDIQFASRKLVIGRKVVLAPFL
                     QLCCHLITLKDTKCSFNTILVVRNILNEITLKDDEVDKFLSDNLVKALLQVLLDDYFI
                     ETHGEAALALTTLYCQLRSKNDYAARVLIQTLPNIKAQHISNFESLLVSSKSLRHQRA
                     ALLELVKISKDNGNAGYEEDEMSKRKRQLDQAAKRKKVGGDGDVMNDPYLENGALGNL
                     FGEE"
     gene            complement(<878074..>879105)
                     /locus_tag="PVL30_004187"
                     /old_locus_tag="LELG_04468"
                     /db_xref="GeneID:5231548"
     mRNA            complement(<878074..>879105)
                     /locus_tag="PVL30_004187"
                     /old_locus_tag="LELG_04468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524446.2"
                     /db_xref="GeneID:5231548"
     CDS             complement(878074..879105)
                     /locus_tag="PVL30_004187"
                     /old_locus_tag="LELG_04468"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524496.2"
                     /db_xref="GeneID:5231548"
                     /db_xref="PFAM:PF01987"
                     /translation="MKLTNDIPLRSIYKQQMRTVATVMGTVPTVPIARQQITGAGPFR
                     ASPQFTTVGNPSTLLSISMPQSSEIYLSQSSIIALNGDFDNVYADNCSIYGVPYQKLV
                     SSAASNIIVSGRTNYKILDLTKHWTIQDSSKVVGWAGIDVKVQKVKTPLTIHNSIELS
                     GKGTAVIDGSSQIFEIDVQDGEKTYVNPNALIAVSGAGSNAGIVATANANANAGARRG
                     KISVSLLPHPTYELSRLDVPRIHWSWPHWIVNPVNNIKAAVKEHISALNTYRIWYKTN
                     VYPYWAPISEMIYTCWRKSYSYINGRLIRRKPLFIEIQGPCTVLLDNSAMLRNGQMFT
                     SAKISKVFK"
     gene            complement(<879497..>882031)
                     /locus_tag="PVL30_004188"
                     /old_locus_tag="LELG_04469"
                     /db_xref="GeneID:5231439"
     mRNA            complement(<879497..>882031)
                     /locus_tag="PVL30_004188"
                     /old_locus_tag="LELG_04469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524447.2"
                     /db_xref="GeneID:5231439"
     CDS             complement(879497..882031)
                     /locus_tag="PVL30_004188"
                     /old_locus_tag="LELG_04469"
                     /note="BUSCO:EOG09260BFE"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524497.2"
                     /db_xref="GeneID:5231439"
                     /db_xref="PFAM:PF00752"
                     /db_xref="PFAM:PF12246"
                     /db_xref="PFAM:PF12247"
                     /translation="MPIKTLEPYLFERKQVFQASIDILANATLGIDVEYYLNKIYTQK
                     KEQFLAAIGGAPTSLGDYIKSDLKHFQSYNIRPIFVIPGLKTATQLDDAGKVEESVQY
                     EKNIENVWNKLMNPPLHDGVPNLQAMENFRTYTEKFSLDSIVNDLIKCFIELGIDYLV
                     TPYDTSFQLSYLLQSQAIDAIYGSTDVLLSKVDKLIIGMDFQTKEFKFVDKRKLLQEI
                     GLNERQFIDLSLMVGCALQPHTFPIFPPQPRHVPGQPYPILNYFKLGLDMVFQYISFS
                     GVTSDLYGYILNFNDPKLVDLYVRGQCAIKYVPVLTANGYVELYNVQMAQLGFKTDID
                     YLADDDDNEEDANDGLKEREEETEKETGKETESDKGKVVGNISKKESVKQGGKEKSTR
                     IVKVPTNLHEVISQRLPPELYLYQSLGLLPVEFLTSIARGVNKVRAPPELSGQNNDSY
                     QKLVSSKFYLDILDYQYNLITQLVARYYQVKKIAVKFWFKKDTIELNNRITPPIGKRV
                     EKLFVNNAESSDLFSLSRFFIKPAGTNEDKKDREVKHIGDIVSTGLLRTLYLYGLANE
                     KGELSALGKIIQEFAATNQIEREDQEKELESLIYLALLLKTKTFKLNALEPANSGLSK
                     VYTQLQFPNNASSTLTAEEEKYISLISRVFSLQKLSTTAINYHGPVSRGLLSFRTHVE
                     FIRTTLLHTLKCLLIDFIVRSESNNIKATYENKQDWLKLIDQLPFYSSSNNTLMGVFA
                     EIFFKVAIKQQRGADAKASEAADFAKVYLADHVLHCEVAGHNVNYKGEQTFSQTQLNN
                     DFKKAVKWWKSFYSFMTLINEKEKSICDDTLFKDIKGADILLSQYV"
     gene            complement(<883172..>885100)
                     /locus_tag="PVL30_004189"
                     /old_locus_tag="LELG_04470"
                     /db_xref="GeneID:5231651"
     mRNA            complement(<883172..>885100)
                     /locus_tag="PVL30_004189"
                     /old_locus_tag="LELG_04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524448.2"
                     /db_xref="GeneID:5231651"
     CDS             complement(883172..885100)
                     /locus_tag="PVL30_004189"
                     /old_locus_tag="LELG_04470"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524498.2"
                     /db_xref="GeneID:5231651"
                     /translation="MGAGAGAGTGLGLLAFAYNCQSQNLYNDVHALDTSIHELNPVKD
                     ADTYEQGLYQASQNEERQQYEEHRRKKTHHPVFLVRIAYQILFAIDDYIVDPLLTFGR
                     FIELSCIFLPVLIASPMCWFGHKHKNEGGNMVRTGASLWYRYLRWTLESAGASFIKLG
                     QWAASRTDIFPQEMCDELATLHSNAKAHSLAQTKKILVKSFGNLPFEEIFDEFNENPV
                     GVGAIAQVYIAKLSKKVLQQAKDEEKRLESDLNAKDQQRANKKGRNKEEKFFDQLVVT
                     EHLNSNETVAIKVLHPNVEVKINRDLKVMKFFADFINIIPTMEWLSLPDEVEQFSILM
                     RLQLDLRIEAMNLAKFRQNFKNQLDIHFPKPYLNFTTRDVLVEEYMYAIPLSKLLNLT
                     ENFGKNLSKEVSDKGLDAFLKMLILDNFVHADLHPGNMMVRFYKNELSPHKKEYKIVK
                     ASDDEDTDRITKELLQLGNDQNAWCERLAKLYEDGYHAEICFLDVGLITELNHTDRIN
                     FIDLFKALSEFDGYKAGELMVERSRTPETVVNKEIFALKVEKLVDRMKDRTFTLGNVS
                     IGDLLEQVLSMVRTHHVRMEGDFVTVIVAILLLEGIGRQLDPNLDLFARFVYALLLGL
                     PTEEISLATIISLGDLVI"
     gene            complement(<885819..>887591)
                     /locus_tag="PVL30_004190"
                     /old_locus_tag="LELG_04471"
                     /db_xref="GeneID:5231484"
     mRNA            complement(<885819..>887591)
                     /locus_tag="PVL30_004190"
                     /old_locus_tag="LELG_04471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524449.2"
                     /db_xref="GeneID:5231484"
     CDS             complement(885819..887591)
                     /locus_tag="PVL30_004190"
                     /old_locus_tag="LELG_04471"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524499.2"
                     /db_xref="GeneID:5231484"
                     /db_xref="PFAM:PF05057"
                     /translation="MSSFNSSNSNNNNEYEYKYKNKNNNHSAIDDANSHEKSTHLFVL
                     IHGLWGTPKHMSTIEDFIKESINDEVTKDQIITLKPSCFGFWKTYDGLDLNAKKIIQE
                     MFYEIESLKQKNKLIVKRISFIGYSLGGLFSRYIIGLLNEIGFFELVEPVFFCTFATP
                     HLGIHFFRNNFFDTIANNLGPYMFGKSGGQLFIADHEKILVAMADPQQKYMQGLRKFK
                     KHILMANIKNDRTVAFFTSYITSYSPFDELDKIKVKYLKNLPHSEIATKSVRPKFVDL
                     TRSRKIEPNDAKSFIGNLQEETPVFRRYKIVKFCFLVLICCFVVPFWIPFVLITSSIV
                     SIYSYIKVKVHSIPDIKSHWERASDYLYGGDAIDSDDAKAGQERRERRNRLVKHESFK
                     GDTSQLAENTMEGIMYAEEKFGSGKRSAGADISDEEDEDEKDEEYEIEAKAGDVDEKT
                     FSSDISNRTNENGEFIRNVGNVGNVNGTKLNPKLINLDYQLHDEKMNEHLSTLQEYDR
                     FILFKDEAKLELDEDRAFIERSLNSLNWIKIPVFLDVWNAHDGIVSRRGVKSNPKGAA
                     TIGLWASILRNYLREQTEPPEGKS"
     gene            <888304..>888639
                     /gene="TIM13"
                     /locus_tag="PVL30_004191"
                     /old_locus_tag="LELG_04472"
                     /db_xref="GeneID:5231655"
     mRNA            <888304..>888639
                     /gene="TIM13"
                     /locus_tag="PVL30_004191"
                     /old_locus_tag="LELG_04472"
                     /product="protein translocase subunit"
                     /transcript_id="XM_001524450.1"
                     /db_xref="GeneID:5231655"
     CDS             888304..888639
                     /gene="TIM13"
                     /locus_tag="PVL30_004191"
                     /old_locus_tag="LELG_04472"
                     /note="BUSCO:EOG09265PJ3"
                     /codon_start=1
                     /transl_table=12
                     /product="protein translocase subunit"
                     /protein_id="XP_001524500.2"
                     /db_xref="GeneID:5231655"
                     /db_xref="PFAM:PF02953"
                     /translation="MAFWNKSTTSEGTDSLAPSSATDSAVSAQAQKIKSDIQASISQE
                     LAAANAQELVRTISENCFEKCITQPKGFLDAEENACIDQCREKYMRSWNVVSRAYINR
                     IQEQQSFAR"
     gene            <889216..>889950
                     /gene="PRE7"
                     /locus_tag="PVL30_004192"
                     /old_locus_tag="LELG_04473"
                     /db_xref="GeneID:5231325"
     mRNA            <889216..>889950
                     /gene="PRE7"
                     /locus_tag="PVL30_004192"
                     /old_locus_tag="LELG_04473"
                     /product="Proteasome subunit beta type-6"
                     /transcript_id="XM_061119530.1"
                     /db_xref="GeneID:5231325"
     CDS             889216..889950
                     /gene="PRE7"
                     /locus_tag="PVL30_004192"
                     /old_locus_tag="LELG_04473"
                     /note="BUSCO:EOG0926457R; MEROPS:MER0005692"
                     /codon_start=1
                     /transl_table=12
                     /product="Proteasome subunit beta type-6"
                     /protein_id="XP_060975513.1"
                     /db_xref="GeneID:5231325"
                     /db_xref="PFAM:PF00227"
                     /translation="MSGQTTVASEYSAEVHSVPIEHRFNPYSDNGGTVLGIAGEDFAV
                     LAGDTRQVEGYSIQSRYEPRVHNVGDNILMTANGFAADGVALIDRFKQSFKWYKFDNE
                     NRKLEISSAARYIQHLLYGKRFFPFYVSTLIAGLDEEGKGAVYSYDPVGSYEREQCRA
                     GGAAASLIMPFLDNQVNFKNQYVPGTDGKEKKPLKYLSLEEVIQLVRDAFTSAGERHI
                     YVGDGLEIMIVTKDGVRTEYFPLKRD"
     gene            complement(<890238..>890876)
                     /gene="ERD2"
                     /locus_tag="PVL30_004193"
                     /old_locus_tag="LELG_04474"
                     /db_xref="GeneID:5231671"
     mRNA            complement(<890238..>890876)
                     /gene="ERD2"
                     /locus_tag="PVL30_004193"
                     /old_locus_tag="LELG_04474"
                     /product="endoplasmic reticulum retention protein"
                     /transcript_id="XM_001524452.1"
                     /db_xref="GeneID:5231671"
     CDS             complement(890238..890876)
                     /gene="ERD2"
                     /locus_tag="PVL30_004193"
                     /old_locus_tag="LELG_04474"
                     /codon_start=1
                     /transl_table=12
                     /product="endoplasmic reticulum retention protein"
                     /protein_id="XP_001524502.1"
                     /db_xref="GeneID:5231671"
                     /db_xref="PFAM:PF00810"
                     /translation="MNIFRFLGDLSHLASVFILLYAIEQNRSINGLSLKTQALYVVVF
                     VTRYLNLFTKFYSLYNTLLKIVFIASSIYTVYVMVYKYHKSITNHVDTFPVKYLLGGS
                     VLASLIFTHKYTPGEIVWSFSIWLEAVAILPQLFILQRTGEAENITTHYIFALGLYRA
                     LYIPNWIYRYFAEGHLDYVSVLAGLLQTAIYSDFFYIYYNKVMKGKKFELPV"
     gene            complement(<891425..>892471)
                     /locus_tag="PVL30_004194"
                     /old_locus_tag="LELG_04475"
                     /db_xref="GeneID:5231540"
     mRNA            complement(<891425..>892471)
                     /locus_tag="PVL30_004194"
                     /old_locus_tag="LELG_04475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524453.2"
                     /db_xref="GeneID:5231540"
     CDS             complement(891425..892471)
                     /locus_tag="PVL30_004194"
                     /old_locus_tag="LELG_04475"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524503.2"
                     /db_xref="GeneID:5231540"
                     /db_xref="PFAM:PF00085"
                     /translation="MLYFPTITWLVLVFCSKFLQADLISSTTSKSFVTVENKQEVNSQ
                     SPTGLLSSYQSFSPSLKKEHDYENDYEVDDDTILETLKRSRYSLIYFYSDSCKYCLQF
                     NPTFENLQSLYSSTEEKELQILKSNGRLNKKLSQLFSVPHYPTIKLLNYKTSEIKTFD
                     EKRDLSKLVDFIVRETKINPDFSVLDSPFLKTFNNVDTLLASDTDSVLILTMSYLHDW
                     KDVDYPTHFIQHVARDHSDINFYVLKTDVMEDFDIAEKFGVSGFPSLIYLRNKQFKGL
                     HTDAESFKSNGYLDEQKIRRFIESIKNGEETNSGWRDYKERVRSSLNQSEHEYEVDHN
                     DEDDDDYEIEHIEL"
     gene            <894792..>897071
                     /locus_tag="PVL30_004195"
                     /old_locus_tag="LELG_04476"
                     /db_xref="GeneID:5231555"
     mRNA            <894792..>897071
                     /locus_tag="PVL30_004195"
                     /old_locus_tag="LELG_04476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524454.2"
                     /db_xref="GeneID:5231555"
     CDS             894792..897071
                     /locus_tag="PVL30_004195"
                     /old_locus_tag="LELG_04476"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524504.2"
                     /db_xref="GeneID:5231555"
                     /db_xref="PFAM:PF13928"
                     /translation="MRGHLFITALFAIAQVQGALKYDPKLDTNNALPTTTNNGPKTAQ
                     TTLATSNQTSSKKKVDTTSTDSGPKGSPSLSTYAITLDGKLTSLVTTYYYVTDSTPVL
                     VPTGKDLSAVEGPKFDTTTTNNAAGQTTSSTSTTTSTTTTSSVKDKASSSLSTYYVTV
                     DGKLTGIVTTIYAQPETTELVGGTTTCMTPIGGGQDNGNTTSTTSIMVPFTTDTASTE
                     KKPLGSASLSTYVITLDGTVTSIVTTIYEQEETTPSAIPTNTDKTLSSISTTTTTTTT
                     TGESSVDTTWTSAEPLASELISTYTITVDGSLMEIVTTITEGEKENTFDDNTTTTVKT
                     TSQTVNIASTVSENESAASTPSGEDESKGEVSSETNGNQDTVSLDGPITSESPISMEG
                     PVPTNEGEKEDEEEEEEKDDETYSSDPFYTSDSITSIDSPVSTEKVIDTTVITITSCE
                     EEGEGESKGEKCVETEVTTGLTTVTLDSTVYTTYCPTDEEEATLTKTKYLTTVVTVTS
                     CDEEQVCTEIPKTTGVKIVSDTHTIYTTYCPTDEIPKPTKKPKNKKPSTTTKYLTTVV
                     TLTSCDEESSCTKVKKTTGVKIVSDKTTVKSTYCPTDEIPKPTKASTPKAKTTAKKPA
                     PAPAPTPKAKTTAKKPAPAPAPTPKAKTTAKKPAPAPAPTPKAKTTAKKPAPTPTPKA
                     KTTAKKPAPAPTPKAKTTAKKPAPAPKAKTTSKKLDKTSTKTVNTYVTEYQGAAVGST
                     IGANTIFGSLISFVFFFFI"
     gene            complement(<897393..>901535)
                     /gene="CFT1"
                     /locus_tag="PVL30_004196"
                     /old_locus_tag="LELG_04477"
                     /db_xref="GeneID:5231695"
     mRNA            complement(<897393..>901535)
                     /gene="CFT1"
                     /locus_tag="PVL30_004196"
                     /old_locus_tag="LELG_04477"
                     /product="mRNA cleavage and polyadenylation factor
                     subunit"
                     /transcript_id="XM_001524455.2"
                     /db_xref="GeneID:5231695"
     CDS             complement(897393..901535)
                     /gene="CFT1"
                     /locus_tag="PVL30_004196"
                     /old_locus_tag="LELG_04477"
                     /note="BUSCO:EOG092604KQ"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA cleavage and polyadenylation factor
                     subunit"
                     /protein_id="XP_001524505.2"
                     /db_xref="GeneID:5231695"
                     /db_xref="PFAM:PF03178"
                     /translation="MDAYNEILDPSRISSCVGCNFISPKEKNLIVAKGTLLQIFDVVL
                     LKSSTIQKPQYRLALVQQFKLQGLVTDLKAIRTSENPHLDYVVVSTKFAKLSIIRWDH
                     VQHTIATVSLHYYENCIQNSTFEKLAMSELTVEPTYSSVACLRYKNLMCFLPLEGIED
                     EDEDDEIDDIDDNDNDDDDDDDKDKDKDKNIDIQMKDGAKNGPTSNKNTNTNGHIKES
                     RQFFDSSFIIEAGNLDSSIDTIIDLQFLHNYRDPTIALLSSRSHSWAGSLLKSKDNVH
                     LEVMSLDLSTKSSTSIFKIENLPYEVDRIVPLSAPLNGCLLVGCNEIMHVDNGGIAKR
                     ISVNDFTSLTTASVKSNQDQSNLGLKLENCSVVQIPDDHRVLIVTEQGSFYFANFELD
                     GKSIKRVFIDVVDKNMYDKIKFTFPGEIAVLSKNLLFMSNLNGDSPLVQVKYRNSKIL
                     EDTRGTRRVEKGKGAEKNKNNVSSNEVDDDDDDDDDLYKEEEEEEQQKVLSKSHIEFI
                     LQDRLINNSPISTFTLGLCSKERFKSNLPNPSFNEVSVIFNSGSHEQSKINVMTPTIQ
                     PIISSSLTFSQVNRMWNLNQKYLVTSDDVNEKSEIFQIEKSYARMKSKDFINNEITIN
                     VHELNNGKFILQVTPKQIILYDTKFRKRLALSDEIKKDDEVLSSTLRDELLMIFLASG
                     DVKIFSINTYNETYSNVSIPKILDDTIITTGYITSSHLLNAVSRNAQLLLNPRKRRHG
                     SVTPFVPTADPTPPKSTKQKIIILVTGDNRIVAFNRHHNEKCYQLDDVSKFSDVLNLN
                     CFSIEQYPPDPFIKQVILNDLGDKDHKEEYLTILTIGGETILYKLFFDGENYVFKKEH
                     DLKITGAPENAFSMGTSIERRLVYFPNLNGYTCIFVTGVIPFIIIKSLHSIPRIFQFS
                     KIPAVSISAFSDSKIKNGLICLDNNKNARICELSLDYTYEFNLPIKRVDLGESVRSLA
                     YHEQSDTVVASTFKEVPYNCVDEEGNIIPGVDKEKLPHASTFKGSIKLISPHNWTVID
                     SFDLEDNEVGMTVKSMILDRGSGASSLKKFKSKREYIVIGTGKLRMEDLAANGSFKIY
                     EIIDIIPEPGKPETNHKFKEVFQEDARGAVTAICDLSGRLMVGQGQKIIVRDIEDDGV
                     VPVAFLDTSVYISEAKSFGNLLILGDPLKSVWLVGFEAEPYRMVMLGKDRQHLDVECA
                     DFIIKDEDIFILVADNNNCIHLIQYDPDDPKSINGTILLNKASFELNSATTCLRSIPK
                     GEKGDYQIIGSTLDGALYNVFPVNEFTYRRMYILQQQISDKVYHFCGLNPRLNRFGGS
                     VTLRDRETNTKPILDYGLIRRFSKLNLDRQQQLAGKISVRGVTQELWKDLIECEYSLE
                     DL"
     gene            <902018..>902755
                     /gene="GPI11"
                     /locus_tag="PVL30_004197"
                     /old_locus_tag="LELG_04478"
                     /db_xref="GeneID:5231611"
     mRNA            <902018..>902755
                     /gene="GPI11"
                     /locus_tag="PVL30_004197"
                     /old_locus_tag="LELG_04478"
                     /product="Glycosylphosphatidylinositol (GPI) anchor
                     assembly protein"
                     /transcript_id="XM_001524456.2"
                     /db_xref="GeneID:5231611"
     CDS             902018..902755
                     /gene="GPI11"
                     /locus_tag="PVL30_004197"
                     /old_locus_tag="LELG_04478"
                     /codon_start=1
                     /transl_table=12
                     /product="Glycosylphosphatidylinositol (GPI) anchor
                     assembly protein"
                     /protein_id="XP_001524506.2"
                     /db_xref="GeneID:5231611"
                     /db_xref="PFAM:PF06699"
                     /translation="MNGKPKPAKKTVSFRHDVNGDSSSTEIDQKSNTQNAVPQIKDSL
                     LLIPIHNILILGSMFYFGITQNIEGVLLRSFVTSLPIQAVYDYILIQSLKKRPKGDNV
                     PLLIVSSLLVSLVLSVPMFLSIVILGAPVFGYTFKTFLLSLHLSQLVFGPLTVLYSLD
                     FEKFKKLFECEDIYYTIFSHPILSQVLLTLGGCWLGVIPIPLDWDRPWQQWPITLLGG
                     SYVGGVVGGLVSLLMRTYRKWNKLSSE"
     gene            <904362..>904901
                     /locus_tag="PVL30_004198"
                     /old_locus_tag="LELG_04479"
                     /db_xref="GeneID:5231712"
     mRNA            <904362..>904901
                     /locus_tag="PVL30_004198"
                     /old_locus_tag="LELG_04479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524457.2"
                     /db_xref="GeneID:5231712"
     CDS             904362..904901
                     /locus_tag="PVL30_004198"
                     /old_locus_tag="LELG_04479"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524507.2"
                     /db_xref="GeneID:5231712"
                     /db_xref="PFAM:PF00578"
                     /db_xref="PFAM:PF08534"
                     /translation="MSSTNEKFPTNVTPKYIPFDKDHEGILSNGDPKPLDLAKEFKDS
                     TVIVTAIPGSFTKVCSTKHIPAYIEHIKQFKEKGVKNIIVFAVNDPFVQASFGKALGY
                     KDPENFIIFATDPDGKISQELGEDYVLDLSKAGMGLRLERYAAIVVDGYIKYLASEQE
                     GNFTDVSSPENLLKRLPNV"
     gene            <905325..>907445
                     /locus_tag="PVL30_004199"
                     /old_locus_tag="LELG_04480"
                     /db_xref="GeneID:5231590"
     mRNA            <905325..>907445
                     /locus_tag="PVL30_004199"
                     /old_locus_tag="LELG_04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524458.2"
                     /db_xref="GeneID:5231590"
     CDS             905325..907445
                     /locus_tag="PVL30_004199"
                     /old_locus_tag="LELG_04480"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524508.2"
                     /db_xref="GeneID:5231590"
                     /translation="MSGNGFTRRNGNTMIPRFLNDSDEENSVHLHHVIGKAQPLRSSP
                     KYRNTTTTLPNKSTRINNTSGTHYSNRFDIPSRQYDIDQEISDALYRDNIGGETIAPI
                     DEQELNESYKMFLNGEIDSDYIEDEDDDYNLEAEDYDLTDEDTYNEELSEYNSPSEDD
                     EIAHEVNGLEDIRTYQKKSGSLNKATHSFETTKSNRFNKARAPKENEIYEEKPERELQ
                     NQGKLNIDEDESSRHLPQQKNGRIKKWLIYILIGSISFLLTLYLSIFARDVYPRQDSK
                     YTDTALNERLNQLTTLIESYHYSTLEKFDKLDSQLSYLEEKTRLNSDQAVALSNGQVQ
                     VSPEFHQFLTNFVDSYRSSSSSSISNGGSGNGSSSSNNNDDSDEKDKYLLLDERLRKL
                     ESLSDFQSLKQHVNMAIEDVANTIKVDVQSSIDEIFDGITIINDTLVPQHATTSQIWV
                     NSMVDLISKCSKHKNYAEFTNGARILGFLTSKPESEKSWFFQALLPGGASHDFLTDPH
                     NANHVILDDDIVWAGGDELGIRLSSSIIPTDILIECGDIPQETQVSIGFKPDSKAGFD
                     KLRFETMASSSNKYASKYKSLKTNKLYASSINHIKLPVRFINSQVTGRSLYFKFDKHV
                     NISSIKVYGITDLDATNFKSRLEMLVDKFHEDETVSAVQPQQEPQQKQIQHQNQRSNK
                     LDGNEMRDKVLSEEVYDINEDLYL"
     gene            complement(<907676..>909175)
                     /locus_tag="PVL30_004200"
                     /old_locus_tag="LELG_04481"
                     /db_xref="GeneID:5231660"
     mRNA            complement(<907676..>909175)
                     /locus_tag="PVL30_004200"
                     /old_locus_tag="LELG_04481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524459.2"
                     /db_xref="GeneID:5231660"
     CDS             complement(907676..909175)
                     /locus_tag="PVL30_004200"
                     /old_locus_tag="LELG_04481"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524509.2"
                     /db_xref="GeneID:5231660"
                     /db_xref="PFAM:PF00070"
                     /db_xref="PFAM:PF07992"
                     /translation="MSDIKSSNSSEMFKSILTKTKTLQTLSQPTKLPKLSHKATSLKT
                     NILIVGGSFSGLAVLRLLQTNLQEHFNQARLSSGASNDETAKRISITLVEPRNGLLNI
                     LGIPKSIVDTEFAKTQYLPFNKLNHVRFNNIVSSEKPEVYADKENGESWYVDDAPKFP
                     NVEVTFVQGTVTYLDDHKAEYVLNDTKDDTAEGSTATATATAASAASAANETGSIDFD
                     YVVMASGRDRNWPTTPSANTMDEYLQDMNKSRSMIENANIISVVGAGAVGIEIAGDIK
                     SRFPEKIVNLVHPHEVFPPEPLSLEFKRLIQDSIERAGVNIYLNTRIDKTKSSDTGDL
                     ITTETGKAIPSEINFWCTAKHNNIAFLSPKIASKYVTHGQINVNEYLQLQSQAAQGQS
                     TNTTLTTTTVPNFFVLGDLVNLPIIKSAGWAMYMGRQTANNITSLIFEDTLIEPLPNL
                     KEMPRGMVLVGGQEEIVSELAGEVSLNHEGYKKEYLDYCIGKIRATLDA"
     gene            complement(<910645..>912825)
                     /gene="VTC4"
                     /locus_tag="PVL30_004201"
                     /old_locus_tag="LELG_04482"
                     /db_xref="GeneID:5231532"
     mRNA            complement(<910645..>912825)
                     /gene="VTC4"
                     /locus_tag="PVL30_004201"
                     /old_locus_tag="LELG_04482"
                     /product="vacuolar transporter chaperone"
                     /transcript_id="XM_001524460.2"
                     /db_xref="GeneID:5231532"
     CDS             complement(910645..912825)
                     /gene="VTC4"
                     /locus_tag="PVL30_004201"
                     /old_locus_tag="LELG_04482"
                     /note="BUSCO:EOG09260KCW"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar transporter chaperone"
                     /protein_id="XP_001524510.1"
                     /db_xref="GeneID:5231532"
                     /db_xref="PFAM:PF02656"
                     /db_xref="PFAM:PF09359"
                     /translation="MKFGEHLRKALIKNYSFYYIAYDDLKHNLKKGLKDNDYVWNNEL
                     EEDFLNQLEVELDKVYSFTKVKNTEVNRRIKESEKYVHEVVNQLHRYQRHDSGVTQPP
                     QEQDFEDLEEELSDIIADVHDLAKFTRLNYTGFQKIIKKHDKTTHYHLKPVFQARLNS
                     KPFYKDNYDNLIVKLSKLYDLVRTRGNPVKGDSSAGGSQQNFVRQTTKYWVHPDNITE
                     LKLIILKHLPVLVFNADKEFEPEDSAITSIYFDNKEMDLYYGRLRKDEGAEAIRLRWY
                     GGMKSEQIFVERKTHREDWTGEKSVKARFGLKEKKVNSFLSGELKATEVFDKMKREGK
                     KSPQEIENLERLAQECQYRILKEKYRPVMRSFYNRTAFQLPGDARVRISLDTELTMVR
                     EDDFDGYDRTHGNWRRMDIGVDYPFNQLPERDVCRFPYAVLEVKLQTQLGQEPPVWIR
                     ELINSHLVEAVPKFSKFIHGGATLLTDYVDLLPFWYTQMDVDIRKPKIVEEYGIRRHH
                     GQGRDQQRLGDSTSGVDLDDEELTGSSYAGGVHFSNDTNPLEDDLDEQTPLLLPNNYS
                     SRHTNSPVRNCLYHLYGKFLYYFNDDRTFTVKPGTNYDLNATFKDKLPPGKTICVPVR
                     IEPKVYFANERTFLSWITIGMILGFTATTLLNYGSNSALTASIGFFITALFTLGYATY
                     RYIWRVLMIRDKKPVQYGDKFGPNMICAFIFLSTFATFVFRALD"
     gene            complement(<914192..>914791)
                     /locus_tag="PVL30_004202"
                     /old_locus_tag="LELG_04483"
                     /db_xref="GeneID:5231476"
     mRNA            complement(<914192..>914791)
                     /locus_tag="PVL30_004202"
                     /old_locus_tag="LELG_04483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524461.2"
                     /db_xref="GeneID:5231476"
     CDS             complement(914192..914791)
                     /locus_tag="PVL30_004202"
                     /old_locus_tag="LELG_04483"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524511.2"
                     /db_xref="GeneID:5231476"
                     /translation="MTHIETHIIIDAPPEKVRDVLFNYQDYKNWNPFFVSFQKYTNTK
                     VPELHVGDELQIDMKLKDTHHTSTMYPKILEKTDYKLKWKGVLLSAWVFYGVHTFEID
                     PLNDEEEEEEEEEDNDSNKDDDNDASLVKHKDSHVHQVKTARAKSATKTAQKTIFGQS
                     EQFGGLLVYVLQILGVYRKTQESFKLFNEALKEQVEKSL"
     gene            <916105..>917661
                     /locus_tag="PVL30_004203"
                     /old_locus_tag="LELG_04484"
                     /db_xref="GeneID:5231584"
     mRNA            <916105..>917661
                     /locus_tag="PVL30_004203"
                     /old_locus_tag="LELG_04484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524462.2"
                     /db_xref="GeneID:5231584"
     CDS             916105..917661
                     /locus_tag="PVL30_004203"
                     /old_locus_tag="LELG_04484"
                     /note="MEROPS:MER0001524"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524512.2"
                     /db_xref="GeneID:5231584"
                     /db_xref="PFAM:PF00450"
                     /translation="MKLSTSIASIAAIGLVLATQIPLLLPPIDKELQSQKNHIVAPNV
                     FNEYDLSQLSSTDQLNLQNEWVRLENQLGNFQMLSQFSQFRKIFNKPKTNLTYSITTN
                     QSTPESIGFDSVKQISGYFHIKETHKKFFYWFFESRNDPANDPLILWLNGGPGCSSTM
                     GLALELGPSIINASIQLDFNPYSWNSNASLLFLDQPVAVGFSDGDDDEIPFSTEQAAM
                     DFGKFVELFRNQYPEYAKLDFHIAGESYAGHYIPSFASTIVNNGVPLKSIMIGNGITD
                     YVVQLGEKANIGCGKGGLGKIYKDDECSTFDQRYKRFLPFGELCYKFPNPITCYISLL
                     ASPTTPDKGDLNPYDARLKCNNDAPWCYPEFTYIDQYFNTPKVQHALLGSNALQKNYT
                     VCNKKIEQKFFYDLALPYQQYVAQLLNDGVAVLIYAGDKDLTCDWLGNLAWCNKLDYS
                     DQKHFNSSVFRPWTISDDEKVVHAGEVKNHKQFTYLRFFNAGHMVPMDQPQNSLNMVN
                     SWIQGNYALL"
     gene            <918309..>919844
                     /locus_tag="PVL30_004204"
                     /old_locus_tag="LELG_04485"
                     /db_xref="GeneID:5231663"
     mRNA            <918309..>919844
                     /locus_tag="PVL30_004204"
                     /old_locus_tag="LELG_04485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524463.2"
                     /db_xref="GeneID:5231663"
     CDS             918309..919844
                     /locus_tag="PVL30_004204"
                     /old_locus_tag="LELG_04485"
                     /note="MEROPS:MER0001524"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524513.2"
                     /db_xref="GeneID:5231663"
                     /db_xref="PFAM:PF00450"
                     /translation="MRLFNFVLTIACASALQIPFTANKPKAANIVQEDSIAPAYPFNE
                     VDLSSLNIHQQLHLQNEWTKYEHQLGLEQMLGQYNKFKKLFEKPKTDMTYSITSDPES
                     TPEILGFDSVKQISGYFHIKETHKKFFYWFFESRNDPANDPLILWLSGGPGCSSNIGL
                     AMELGPSWINATIQPDFNPYSWNSNASLLFLDQPVAVGFSDGDDDEIPFSTEQAAIDF
                     GKFVELFRNQYPEYAKLDFHIAGESYAGHYIPSFASTIVNNGVPLKSVLIGNGITDFV
                     VQIGQVANMGCGQGGIGQIYTDEECSSYEQYYKNFVPFGELCYKFPNPVTCFVALLAT
                     PNAPDKGDLNPYDSRVKCGDNPLCYEQIGYINEYFNLPQVEKALLGNVPEKNFTSCNS
                     KVGQKFIFETMRPYQQYVSELLDKEIPVLIYVGDKDLVCDWLGNLAWVNKLDYSGHEN
                     FNATKFAPWFTTEGIQAGEVKNYKHFTYLRIYESGHMVPLDQPKNALSMVNQWVSGNY
                     ALS"
     gene            complement(<919932..>921065)
                     /locus_tag="PVL30_004205"
                     /old_locus_tag="LELG_04486"
                     /db_xref="GeneID:5231711"
     mRNA            complement(<919932..>921065)
                     /locus_tag="PVL30_004205"
                     /old_locus_tag="LELG_04486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524464.2"
                     /db_xref="GeneID:5231711"
     CDS             complement(919932..921065)
                     /locus_tag="PVL30_004205"
                     /old_locus_tag="LELG_04486"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524514.2"
                     /db_xref="GeneID:5231711"
                     /db_xref="PFAM:PF01266"
                     /translation="MPHIVVVGAGVLGLTTALTLAENLPQSTTQISVIAEWGPHSPSM
                     NTSLTTSNEYVSPWAGAHFRPFPSATEKEFEESKLTRKTLQYFQKLASDHPESSVKFV
                     KGVEYLEDPSELYKTCARGYTEDLQNFKKLGVDERGFLGFEYDTWVVSPPMYLQYLYR
                     KLQTIYGVKFITLKLDSLQQINTLFSEKPKRPIIVNCTGKGLQYSGGTDPAYEPIRGQ
                     TLLINPPPDCPYLNKTITYQLANKSWIFTIHRPLYGGVILGGTKQVGDTFLGIREEDT
                     KHLFKLGERYFPSLMKSEARNGKEDNINKESRNGEKYFDVMKVNVALRPARRGGLRIE
                     REKINGQNVIHNYGAGGMGYELSYGASLKVYSLVEEILNESKL"
     gene            <921674..>922396
                     /gene="CSH3"
                     /locus_tag="PVL30_004206"
                     /old_locus_tag="LELG_04487"
                     /db_xref="GeneID:5231487"
     mRNA            <921674..>922396
                     /gene="CSH3"
                     /locus_tag="PVL30_004206"
                     /old_locus_tag="LELG_04487"
                     /product="Protein csh3"
                     /transcript_id="XM_001524465.2"
                     /db_xref="GeneID:5231487"
     CDS             921674..922396
                     /gene="CSH3"
                     /locus_tag="PVL30_004206"
                     /old_locus_tag="LELG_04487"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein csh3"
                     /protein_id="XP_001524515.2"
                     /db_xref="GeneID:5231487"
                     /db_xref="PFAM:PF08229"
                     /translation="MKYKEVVPIGTALIVGATTFGLGVIYGNWPYDLDTLWRHSVTDG
                     FDKSLAHYQTWGNAPMYIHYTLHTVGFLGLVGHFIKLYKPDEEAKYFEYGSLGLFMIA
                     IIIYLTNLRTGVTSCLSGQWGDVDYKTGLNVMAASQVMIILVLVGVLVLQGGLYYAQW
                     YDEQLKLEFYENERREAAAAAEAQAREEESLSKKSGKRGKKDVVVEEGDVADEADAVI
                     EKDAGSTSVSGKKKSAAKKRRS"
     gene            <922796..>923770
                     /gene="N19M"
                     /locus_tag="PVL30_004207"
                     /old_locus_tag="LELG_04488"
                     /db_xref="GeneID:5231652"
     mRNA            join(<922796..922852,923576..>923770)
                     /gene="N19M"
                     /locus_tag="PVL30_004207"
                     /old_locus_tag="LELG_04488"
                     /product="n19m, NADH-ubiquinone oxidoreductase 9.5 kDa
                     subunit"
                     /transcript_id="XM_001524466.2"
                     /db_xref="GeneID:5231652"
     CDS             join(922796..922852,923576..923770)
                     /gene="N19M"
                     /locus_tag="PVL30_004207"
                     /old_locus_tag="LELG_04488"
                     /codon_start=1
                     /transl_table=12
                     /product="n19m, NADH-ubiquinone oxidoreductase 9.5 kDa
                     subunit"
                     /protein_id="XP_001524516.1"
                     /db_xref="GeneID:5231652"
                     /translation="MVNEKVWGDKPDVFRQPYRWLRYHAHVNPALFVSVALGAAAPVL
                     LTLVLPLRKSLLYSDHEPIPWVYPLPQRPRDKNLKGYDD"
     gene            <924549..>925454
                     /gene="mrpl22"
                     /locus_tag="PVL30_004208"
                     /old_locus_tag="LELG_04489"
                     /db_xref="GeneID:5231471"
     mRNA            <924549..>925454
                     /gene="mrpl22"
                     /locus_tag="PVL30_004208"
                     /old_locus_tag="LELG_04489"
                     /product="39S ribosomal protein L22, mitochondrial"
                     /transcript_id="XM_001524467.2"
                     /db_xref="GeneID:5231471"
     CDS             924549..925454
                     /gene="mrpl22"
                     /locus_tag="PVL30_004208"
                     /old_locus_tag="LELG_04489"
                     /note="BUSCO:EOG09264LC7"
                     /codon_start=1
                     /transl_table=12
                     /product="39S ribosomal protein L22, mitochondrial"
                     /protein_id="XP_001524517.2"
                     /db_xref="GeneID:5231471"
                     /db_xref="PFAM:PF00237"
                     /translation="MNRWTTLARPFFRSNTASFAQFRCISNTRVCHNNPFGKLTSTTA
                     DESVSNDSAKSPNTNTPAKATSSEIRNKDGDIDVNLITPQNDEQLIEYYKKQAEEDRS
                     RRIESLVHPLKVQLYDKVVEANGFFKNGQTVTHEGCAYKLHLTDEELEVLEPSIFIES
                     LRIKSSMKKATVVNRFVRKMDVKTAITQLHFNHKKMATELEKLLKQGLEKARQMGYDE
                     DKLYIARLWTGSDGEWRKRLDIKGRGRHGIIQHRYVHLKAVLKTEQTKKRLAWEKKQK
                     EIARKPEMPLNNEPLNLSVRPWYKW"
     gene            <928983..>929798
                     /locus_tag="PVL30_004209"
                     /old_locus_tag="LELG_04491"
                     /db_xref="GeneID:5231503"
     mRNA            <928983..>929798
                     /locus_tag="PVL30_004209"
                     /old_locus_tag="LELG_04491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524469.2"
                     /db_xref="GeneID:5231503"
     CDS             928983..929798
                     /locus_tag="PVL30_004209"
                     /old_locus_tag="LELG_04491"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524519.2"
                     /db_xref="GeneID:5231503"
                     /db_xref="PFAM:PF03226"
                     /translation="MGLKCTDYFETSKYDSPDIQIITCKSCSSHLCLSDLILSDNFSG
                     STGPAYLVDNLINVQINPKTEDTQMKTGAYKINKVECHQCLKTLGWYYKKSYSYSETY
                     KEGKFVIEKSFIKFSDNLSTTQLLKEKAMQSKFRRFSNSSSHNSSAISIEANDCIIDA
                     KSETKETHDGTNGPKYIISTHYPSKNLKKNRRASSSSSAVSAASTSSSASFSASSTSP
                     TNGDTNGHGGSFFNRIRFPYRSSEVELFTSAVNFADGNEAIHEDHNDDIFLDT"
     gene            complement(<931174..>933801)
                     /locus_tag="PVL30_004210"
                     /old_locus_tag="LELG_04492"
                     /db_xref="GeneID:5231543"
     mRNA            complement(<931174..>933801)
                     /locus_tag="PVL30_004210"
                     /old_locus_tag="LELG_04492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524470.2"
                     /db_xref="GeneID:5231543"
     CDS             complement(931174..933801)
                     /locus_tag="PVL30_004210"
                     /old_locus_tag="LELG_04492"
                     /note="MEROPS:MER0002652"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524520.2"
                     /db_xref="GeneID:5231543"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF13423"
                     /translation="MYAAPIPIPPPTPPPSSSSSSSGPPSEPKVSNPIVHHLKGNKKN
                     KKKTDSSNSSSATTTNPILQRYLTTPINFKPAKRPESISSIDKLPSSYIVLSKNSLNR
                     DNTENDSMKTRGNSNGTLLGNDSPQSKKKSNVNRPKSLAEAVASYKGNKYERAKSRKR
                     KRKLEELVREDSDNKDDHDDYDDVYDDDDDDDDDDDDDDDRDEDNEKEEFGGEPGWKT
                     RMNGENVETGDNKSLGSIYKQQQFKHQKDEHNGQPPLKKPKGIWGSLKSLFGSTPPAS
                     TDGEDGDEDVGEEYVEGEDLDIDGSDSNSSKHKSFGLTEIVKKVTGGRCDGEDYDNDY
                     DNEDLSTSSSSSSAGEVYDENSPFTGFSEAEKSDANQSERDDLEEEDIEESSENEDES
                     EDVEYKDDNSEDEEDEKDEFSPGSSSQEHSPDVDADLSKLRADLKLDELINGSGRDVA
                     DSNVVDQGTKERKDKVRGEANLVNNALKAGKRTSVGIKINSTPPTSPEEFAEDGGKIA
                     FYNINELDSDRGSNGSKRIYKNWRGVQQQTKGPIGLLNHGVTCYMNSAIQSLIHIPAV
                     QHYLDEISQGKVSNLKPRSVSHVLAELSRKMWAPKNSKAMYINPKKLIQRLDEINCMM
                     SEWQQEDSHEYYMSLMSRLQEDSTPKGKKLNESIIYDIFGGLLNQKITCLRCGNISIT
                     KQEFYDLSLGLNKRKLLNNGGSGGMSNDIPALSSSKFSIEKSIADFFSNETIKKTDAD
                     KKSGYYCEQCHEFTQANKISSIIRAPETLTVHFKRFKFNGNSSSKVKQSIGYSKYLDL
                     SAYMEHETDSAYYRLISVIVHEGRSISSGHYITHVLQPNGQSWATYDDEYINPIEERK
                     ALNDPNAYVLVYTKLTPKH"
     gene            complement(<934394..>936622)
                     /gene="RRI1"
                     /locus_tag="PVL30_004211"
                     /old_locus_tag="LELG_04493"
                     /db_xref="GeneID:5231623"
     mRNA            complement(<934394..>936622)
                     /gene="RRI1"
                     /locus_tag="PVL30_004211"
                     /old_locus_tag="LELG_04493"
                     /product="COP9 signalosome catalytic subunit rri1"
                     /transcript_id="XM_001524471.2"
                     /db_xref="GeneID:5231623"
     CDS             complement(934394..936622)
                     /gene="RRI1"
                     /locus_tag="PVL30_004211"
                     /old_locus_tag="LELG_04493"
                     /note="BUSCO:EOG09263RDD; MEROPS:MER0022069"
                     /codon_start=1
                     /transl_table=12
                     /product="COP9 signalosome catalytic subunit rri1"
                     /protein_id="XP_001524521.2"
                     /db_xref="GeneID:5231623"
                     /db_xref="PFAM:PF01398"
                     /translation="MTGYDKLINALSIQNDSDYNTLTGNNKIDKQATTTTTTRTTTTP
                     ASTIGEEKSKSGDPRFSTTDGFQPINSDLYSLPPISPTMAAQKPWKTDAKYFSKCKIS
                     SLALLKMCVHAQRGGSIEVMGMLVGKVVDRTIVVMDTYRLPVEGTETRVNAQGEAYEY
                     MVQYLDLNKKAGEGNSTEQGQGQRRKKRDENIVGWYHSHPGYGCWLSGIDVSTQALNQ
                     NFQDPYLAIVVDPVKTLKSGKVDIGAFRTLPDGYMENVSGTTGLGSASTSAVSKSSKL
                     QRLPKSKRAEFGSHANQYYSLDVEIFESPYDHEMLQLLANDDNAAWMKLISVDIKPEI
                     KAFNTGDLKFLNYLSNFQVVDDGTSQDEEIVDIIKKLENHAKNKNRGLIANNVLKQVG
                     SDFENIMYRKLLQGDSKEKEGIRTRRVRTYEEAEREDHDDDDDDDENDELMDESNLDK
                     GDREGKELGRNIGSDDDYDYDDDDDDDDDDDDDDDNDENAKTQDSAQTENEDDADNGV
                     DYDNRSGGNDEYMSDEDESRAKTPRYRSLGRRGLVNSRRYPSSRSPSRLTREMKLNRE
                     TPLSSTLAPDRYLYERLARPGNEFMPLDPSLVPNSRFSQFLGDVRSRGRRLLHHQYSA
                     REGPIFERVTGMEVDGASRYTEEPSYGLSMPPTSTTASASITGSGTPYASLRGYHNSA
                     ANSTTAAAAAAAANTNTTTTTTTDSMKRNYGLLLPVQNLAAKCMCELVNIEAQEKLLE
                     QV"
     gene            complement(<936926..>939196)
                     /locus_tag="PVL30_004212"
                     /old_locus_tag="LELG_04494"
                     /db_xref="GeneID:5231411"
     mRNA            complement(<936926..>939196)
                     /locus_tag="PVL30_004212"
                     /old_locus_tag="LELG_04494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524472.2"
                     /db_xref="GeneID:5231411"
     CDS             complement(936926..939196)
                     /locus_tag="PVL30_004212"
                     /old_locus_tag="LELG_04494"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524522.2"
                     /db_xref="GeneID:5231411"
                     /db_xref="PFAM:PF00076"
                     /translation="MTKKVDYSVLRDLLHSSATSASSDSDYSDNMNLSNGKESLVLMH
                     ENLNSLYSTAWETKRATTLSSITDHDDDDDNDGDDDVDGERGSIAAKTSVNFKKDNAS
                     VYDQEEEEEEEDQQQQQQQDGQNCILDEKKIELEEKEEKDAEEHEEKEFEHNNCNGDD
                     QDEKEPSSLTHGDCKKTATEKTVFVRGRPAACVFVASLRSNMTDDDLCISVTDHFKQW
                     GPLATVKVLRDTSNRPYAFVQYLSEQNSKLAIKMAHNSILNGRSIRCEAAKVNRTLFF
                     TARSFLTEDVVKRIMSRFGEIEELIPSNIRGQIFTHSPFGRGHRNWFCKFVYRDDAIK
                     AFASLTEEGAYNVDWAKNVDGSNQRTTQFSIAHVENEHDDPDMELKVKFDKLSVFVGQ
                     LSPNVTEVELRKRFERHGEITVLNLIKKINNTFAFISFKDESSAASSVEAENHSMLCG
                     KTMHVQYREVQMRTKSSRGAHVALAPPPINISKRSMGNNEKSRQFFSGAKTRFTNFTS
                     SGLRGRGFRLLKGRDESENENEDGKEKEREIEKGEGMEKGGNNLPTVHDQKSGNHICQ
                     ASDLSLKDVKEQKDIEKLYFASQSINSEVKVSNKKVKESFVKEERATTATSDNVNTED
                     YKSPLLGIGGGNRDVGTFDTAANYIAPPTSGFPLFYYVPAENVNFANANAIHPQSPPF
                     YGIYPQYFPPQSAFDSLGLNRSTCSDFAPMANAQQQQQQQQQSPTPLPPPPHNFVMPN
                     FIYYPNDAEVFYRNKK"
     gene            complement(<941245..>944199)
                     /locus_tag="PVL30_004213"
                     /old_locus_tag="LELG_04495"
                     /db_xref="GeneID:5231692"
     mRNA            complement(<941245..>944199)
                     /locus_tag="PVL30_004213"
                     /old_locus_tag="LELG_04495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524474.2"
                     /db_xref="GeneID:5231692"
     CDS             complement(941245..944199)
                     /locus_tag="PVL30_004213"
                     /old_locus_tag="LELG_04495"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524524.2"
                     /db_xref="GeneID:5231692"
                     /db_xref="PFAM:PF10182"
                     /db_xref="PFAM:PF13928"
                     /translation="MKLSLASLTAIAVLLSSTDATFCLLDDSLFKDVVPKTVKPQCTP
                     DQLYYDPSSSGVSKRTYGTSNFNAAFVVSNAQKNSDGTYNVVGNFQCDQADQLNQYFA
                     KSVKGLSLQGTGCKDIKLFGADCDKPVENPFKWAANFQVQAEIVKGKCCIPKSLQIVT
                     NFDEGCSEWSSLKQKFGSASISYKVSTIVNGIKTFDASSVFNSQLSLFKREEEADVLD
                     DISGTSTYDKRTLGLLSDLLDKVTKGSKNCEIKQFCWDCECPGTSTESTGSSTVPPTT
                     SCPPPVSSSIPPVSSSVPPVSSSVPPVSSSVPPVSSSAPPVSSSAPPVSSSVPPVSSS
                     IPPVSSSVPPVSSSIPPVSSSVPPVSSSVPPVSSSVPPVSSSVPPVSSSVPPVSSSVP
                     PVSSSVPPVSSSVPPVSSSTPVKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVE
                     SSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSP
                     VKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSPVKSTPVES
                     SPVESTPVESSPVESTPVESSPVESSPVESSTAPGESISTSLEGTASTLSSVPPKTVI
                     THSTTIVTVTSCSENACSEQTHVTGVTVVTEDTTVYTTYCPLTEEVTASTEKTQPSEE
                     APSSTSPGAPESEASSESAKTSPGAPESEASSESAKTTPETTPIVKTVTAHSTTEITL
                     TSCANDVCSEVTTSTGVAVVTEGTTVYTTYCPLTEEATITVQPSKEANEESAPGSAVE
                     TTSTAIVPPAATTEGSAPAPVSASSSSSAEGPKGTTTTTPAEWSEETVAAASSEAPKK
                     TATAEKPESEETTVAAPSKGSEETAAASVAAPSKGSEETAAASAAAPSEASEGTIVVT
                     EGTTIVTQTLGSHGTAVAAQSEAPQGPTVAEQSSVSSSPSTEAVSAYEGAGNTVSYSF
                     GTVLMVAAAILL"
     gene            complement(<949120..>951624)
                     /gene="APL6"
                     /locus_tag="PVL30_004214"
                     /old_locus_tag="LELG_04498"
                     /db_xref="GeneID:5231489"
     mRNA            complement(<949120..>951624)
                     /gene="APL6"
                     /locus_tag="PVL30_004214"
                     /old_locus_tag="LELG_04498"
                     /product="AP-3 complex subunit beta"
                     /transcript_id="XM_001524476.2"
                     /db_xref="GeneID:5231489"
     CDS             complement(949120..951624)
                     /gene="APL6"
                     /locus_tag="PVL30_004214"
                     /old_locus_tag="LELG_04498"
                     /note="BUSCO:EOG09260VHV"
                     /codon_start=1
                     /transl_table=12
                     /product="AP-3 complex subunit beta"
                     /protein_id="XP_001524526.2"
                     /db_xref="GeneID:5231489"
                     /db_xref="PFAM:PF01602"
                     /db_xref="PFAM:PF12717"
                     /translation="MNDSISKISSILESVKDLSIEASSTLAPLIDTNGVATDPQEISK
                     LLNSRATRDVSSGMKCVISIISKGGDGLPFFADVVKNITSDNAKVRQLVIIYLTKYAD
                     AEADTALLAINSIQKSLGDKTPINRANAIRSLAGIKITSIVPIVTLSLKRCSSDPSPL
                     TRSAAAISIGKIYLEAGKSRKQIYEILGQLLADNDVMVVGSAIKSYYRIRNHLGKKAS
                     KKWQFIHGNFRRFCSLITRFDEWAQIYTIDILTEYCRTFISKPIEHKRGDGSKDDDVD
                     DEEQEGYEEEESKSMDQDLHKFLVSIKPLAQSISDAVVISVAKATYLLSPNSFQNFSL
                     QSQLMKIAFSTNTESAIVSLWMVAYICEKNPFMFASHFTSFFPFPNEMDEIANVKLDI
                     LASVINDVNVKYIFEELKYCACNAEPKIAKKALRKLTSCAISSEWNDHILNWCLYKLG
                     SFSAELAGEAITVIRYILQQKYDVTTTTQEKQITNTITRLAILLEDGKREIEDDAKAS
                     LIWTIGEYSLASENSVGPDVLRKSLKSFAKQSEVVRYQLLVLAAKVYAFELIRQANEM
                     ESTGEDRTLVNVKLEASIESQMFQHALHLAKYDTSYDIRDRARMLDVLLSSGVDRAQL
                     ASLLLQVPKPIPELGSINDGDISSIRSYFAVPKWSEDSSTLPPPSIRNEVAINYNKLS
                     AQPVYAHEGTTRSPSPVVIPSSDLATRQGNQSNEVGQQKSKTYKLQSLDDFFGSDEDE
                     EDEDEEEDDSEEDDSEEDDSEEDDSEEDDSEEDDSEEDDSEEDDSEVEEEEEEEEEEE
                     EEEEDSEEDETEGRETGERSDSPSFTSVKGSDAERK"
     gene            complement(<952114..>955545)
                     /gene="RAD2"
                     /locus_tag="PVL30_004215"
                     /old_locus_tag="LELG_04499"
                     /db_xref="GeneID:5231459"
     mRNA            complement(<952114..>955545)
                     /gene="RAD2"
                     /locus_tag="PVL30_004215"
                     /old_locus_tag="LELG_04499"
                     /product="DNA repair protein rad2"
                     /transcript_id="XM_001524477.2"
                     /db_xref="GeneID:5231459"
     CDS             complement(952114..955545)
                     /gene="RAD2"
                     /locus_tag="PVL30_004215"
                     /old_locus_tag="LELG_04499"
                     /note="BUSCO:EOG09260B3H"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein rad2"
                     /protein_id="XP_001524527.2"
                     /db_xref="GeneID:5231459"
                     /db_xref="PFAM:PF00752"
                     /db_xref="PFAM:PF00867"
                     /translation="MGVQSLWDIVGPSARPVRLEALSRKKLAVDASIWIYQFLKAVRD
                     KEGNALQSSHIVGFFRRICKLLFFGIRPIFVFDGGVPVLKKQTIAERKNRRQQKAEST
                     RETAQKLLAMQLQKQLQGEPTNWKRQRKNVLQSSKKAVGGAANADDEKRGKYEYLVND
                     SDKHDDDPDDEDDDDIIYFEDLPGNNAPSTAQTQSSESLSPEQLKSIKFRKKDEYHLP
                     DLHEFKVSRTDQRIMADEDERVPEDDDFDHVDGININEVDPKSKEFSKLPIATQYMIL
                     NHLRLKSRLRMGYQKEQLQELFPSSMEFSKFQIQQVQKRNFYTQKLMNVTGMNDDVNV
                     ERRIAGDKDRKYALVKNEDGWTLALQGEGASATNPISLSDEESNKDVSLTEKPKIELM
                     EKEKRIDSDAESDSDFEDVPLEEQEETEEEKQLQKALIMSIYEQYNEPEHSIGIEQQQ
                     QQQQQQQQKQQQQEQQQSKGLQGFNTSMEDAVEASKAEYYKMVKEEADLEKQIEASSH
                     SSLSYLNSSASKTNFGASLLFPNSQLTKEDVNANAMPSTLDKTADSAQNEHTIIGSKS
                     ELGRSFIFSADNHETGKVQLKKGTGNNINDNTQFKTQAGNKNGAITDFDMGRKSKKLQ
                     IDEAKETECLPIVKNVPRKEEHVVVDEVDDDDIASELSDNDEQITKNRPAGQEKLPDW
                     FRNEVSQTLNPHNEKFVSSIIDRKMNKNIEDGDVEEYEDEEKAAGLIPWFEAKEYFET
                     NDNEDDYKSNGDGYDNDADVVDVAEVAPPPPPPPSQLPSLPPHSPSIIEADAPSKEQE
                     LPEKEPERKAAVIDYDFEEEDEDMLIEQMRTEEVDHELLKSKIKATHTVPPISSINTR
                     ITEEHLLQEKLQKAKRDSDEVTETMIYDVQELLKRFGIPFITAPMEAEAQCAELLKIG
                     LVDGIVTDDSDCFLFGGDKVYKNMFNQKQFVECYFKDDIATKIGLSQDNLIELALLLG
                     SDYTEGIKGVGPVLAMEILAEFGSLTKFKEWFDRHTKTAEVKSNLTSLEKNLLSKVKS
                     GKLYLPDNFPDRIVFEAYKRPEVDPDKTDFVWGVPNLDQIRSFLMYNVGWSQERVDEV
                     MIPLVRDLNKKSAEGVQSTIGEFFPQSYIQSNKELKLGKRMKTAANKLNKRKKVV"
     gene            <956788..>958557
                     /locus_tag="PVL30_004216"
                     /old_locus_tag="LELG_04500"
                     /db_xref="GeneID:5231616"
     mRNA            join(<956788..956792,956829..>958557)
                     /locus_tag="PVL30_004216"
                     /old_locus_tag="LELG_04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119531.1"
                     /db_xref="GeneID:5231616"
     CDS             join(956788..956792,956829..958557)
                     /locus_tag="PVL30_004216"
                     /old_locus_tag="LELG_04500"
                     /note="MEROPS:MER0094876"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975514.1"
                     /db_xref="GeneID:5231616"
                     /db_xref="PFAM:PF01019"
                     /translation="MKGMVASTQPLANSAGLKILEKGGNCVDAAIAVSAALCVTEPAS
                     TGIGGDCFALYFKRDGTAKSPLGSGKVLGLNGCGRAAKKVTPQHVWDEHNDGKPMPRI
                     PYTSVFSVTVPGAIAGWYDAFEKWGSGKVTFEQILEPAVTLAEHGFPVSELSSKSWKA
                     AIPKLKAQNPNLSNNNPFIILDGENGARGPNEGEYVKNTPVAECLKLIGKQGKGAFYE
                     GPIAEAIIETTSKRNHQLTAQDLQAHTSTIVEPIKLNFQNHNVWEIPPNGHGLVALLA
                     LGLIQELHNEGKINIHELKHNSAEYLHILIEACKLGFHDSDEYVTDPTFKDIPVEALL
                     HHQYLKTRAQLFDPSKIIDGESMTHGVPDSKYKSDTVYLTVTDSNGEACSFINSVYEG
                     FGSGILVEKYGFCLHNRGANFNLSPGLSNCLEGGKRPYHTIIPGMITNAIDDTLYASF
                     GNMGGFAQPVCHVQHVLNMVIFGMTPQQSLDAPRFVLNSNNDVLRDRGRGADGPVRTP
                     ITIVQIEEGVGNETVEKLKQLGHSVEVLTGYNRQTVGRGQIIKNESRNGQLVYAGGSD
                     MRGDGAAAPFV"
     gene            <959259..>960302
                     /locus_tag="PVL30_004217"
                     /old_locus_tag="LELG_04501"
                     /db_xref="GeneID:5231635"
     mRNA            <959259..>960302
                     /locus_tag="PVL30_004217"
                     /old_locus_tag="LELG_04501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524479.2"
                     /db_xref="GeneID:5231635"
     CDS             959259..960302
                     /locus_tag="PVL30_004217"
                     /old_locus_tag="LELG_04501"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524529.2"
                     /db_xref="GeneID:5231635"
                     /translation="MAQTTTSEGTTTTKLDLSDPPAYLNGSIAKEKSTIYHSEEKQSF
                     LGQDDALNAAKSYKMVIANQCWSSNYKVFVSQDSFEKFKTFKKTKKEKKSNEITIPLQ
                     SEGVGIPLFKVKAHCWFGFLTFYKCVPSVDKSAFDIAKDKFEFCKVKKHTHVGYDSFV
                     FEFTPDPENRSSDFTLTLFSSGVFPINDYEYNGKRYRWVDESRCGGVTKQVARKFAFT
                     HTVLQSNQPSMLDNWDGKNHSLDKQKGNPLLDGLLKKRFKWGTKKIKEEYYGENDNTQ
                     LSETVATCLKSGYAMLQTESLHNNNACEVNQESILSVNLDVLVLVCVATVLKRKKDIV
                     EQANIAAAAAAAS"
     gene            <961107..>962153
                     /locus_tag="PVL30_004218"
                     /old_locus_tag="LELG_04502"
                     /db_xref="GeneID:5231714"
     mRNA            <961107..>962153
                     /locus_tag="PVL30_004218"
                     /old_locus_tag="LELG_04502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524480.2"
                     /db_xref="GeneID:5231714"
     CDS             961107..962153
                     /locus_tag="PVL30_004218"
                     /old_locus_tag="LELG_04502"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524530.2"
                     /db_xref="GeneID:5231714"
                     /translation="MKDPIGVNASADTYAYADADADAPPSYTNDSPSYSAVQVSEKKK
                     SYREPVYFQSASPQGWTVIITNKFWTDGFQIFISRDSYEKYNVFRKSQNQDIPAIQQQ
                     GVGIPLFKVINTFFSIGTTFLTFRKYCPPPLDSQGVPQRFDPKRDYHEFCIVKKRFHV
                     GYDSYIFEFHPDPYDSKKRSFTFTMFSHSVLPIHDYIYKDERHRWIDESRMEEIVSLW
                     QVKYGFKHTVLRPDQPSMCDNWDGQNDKLIKSTPNPLLNGLWKKKLSVRAHYPESSQY
                     GQHCSAILGEAANWFQLGYAEVKVDDIYNNLNGNNVNYESILSVNEDALVMICVATVL
                     KRQKDIVEDRKKRS"
     gene            complement(<962552..>965179)
                     /gene="OSH3"
                     /locus_tag="PVL30_004219"
                     /old_locus_tag="LELG_04503"
                     /db_xref="GeneID:5231645"
     mRNA            complement(<962552..>965179)
                     /gene="OSH3"
                     /locus_tag="PVL30_004219"
                     /old_locus_tag="LELG_04503"
                     /product="Oxysterol-binding protein 3"
                     /transcript_id="XM_001524481.2"
                     /db_xref="GeneID:5231645"
     CDS             complement(962552..965179)
                     /gene="OSH3"
                     /locus_tag="PVL30_004219"
                     /old_locus_tag="LELG_04503"
                     /note="BUSCO:EOG09261QYO"
                     /codon_start=1
                     /transl_table=12
                     /product="Oxysterol-binding protein 3"
                     /protein_id="XP_001524531.2"
                     /db_xref="GeneID:5231645"
                     /db_xref="PFAM:PF01237"
                     /db_xref="PFAM:PF15409"
                     /translation="METLEIHSKDFLIKWITAPENSVIDWQVRPLKKSINFAFYQKTD
                     VTSANSQNSTSTPESNSGASTPTADSPHLNSRLRANSTASVNQFKKANDVYRSKSRTS
                     TLSSIGESNLELVKNYNKLVANELVKGKFETTTGGTFAFVFDNSFSKTIAKSVQFSVE
                     VELQKPLPQQENNTIRQNDQHVFEDTQSGNGTISAGEILQSVMLKKRRKKLQGFVKRY
                     FVLNFKRGTLSYFKVDDNKLRGQMPIKDAIVSANASSRQLIIDSGMEVWQLKTINKAD
                     FNAWVNAFNAIKKEDSQQPAVLPTGSSSSSSHAFAQASGSAAPIQSLSLIASKISKLQ
                     LEQPSPLVDEIHQEITTLLEKFRSDTGSASSDSQSLFSSEFHDAEEHFDDEGVVFLDD
                     GGYPSQQDDEEDQVAEESSDDDDDDDDDDDDDDNNDYYSKGAAPDAAGGAAAVGTVGD
                     QQQQQQQQQSQQQIPPQKQDLPQPTISEEDNLWPLPHEPVSRNSDVPVCTHTPPSLLS
                     FVRKNVGKDLSTIAMPVTYNEPTTVLQKFAEMLEYPEIVTNALGSDFPDGSGEKLLRI
                     AAFALSSLSSTRSKERNKRKPFTPLLGETYELVREDLDFRLVSEKVSHRPPVFAYHVD
                     TENWTMDFAVSPSQKFWGKQSEVTTKGLVVLTDKHTGEEFTWTQATQMIKNIIAGETY
                     AEPTGTVSIKSSNGYKAVAEFAKGGMWSGRSEGVTIKVYDNKKKELPYTVFGNWTESF
                     TLKTNSTEKSIWEAGELVPNEKKKYGFTVFAGTLNKITDMEKGQLPPTDSRLRPDLQA
                     YEKGDVDTAENLKVKLEQDQRDRRKQLEDVGQEYVPQFFRFSGKGPLDEGKWEYITGE
                     RSYWSRRKRQDWAGLTKLW"
     gene            complement(<967380..>969086)
                     /locus_tag="PVL30_004220"
                     /old_locus_tag="LELG_04504"
                     /db_xref="GeneID:5231529"
     mRNA            complement(<967380..>969086)
                     /locus_tag="PVL30_004220"
                     /old_locus_tag="LELG_04504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524482.2"
                     /db_xref="GeneID:5231529"
     CDS             complement(967380..969086)
                     /locus_tag="PVL30_004220"
                     /old_locus_tag="LELG_04504"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524532.2"
                     /db_xref="GeneID:5231529"
                     /db_xref="PFAM:PF00097"
                     /db_xref="PFAM:PF13445"
                     /db_xref="PFAM:PF13923"
                     /translation="MAYEGIEHIRYDDSVSIRNYNTSFNRLNSKDIPDLRSLKYITST
                     DHLNCPICQQPFIDPLTTICGHTFCRDCILEYLKSLSNARGSISSNNTSTNSGNNGNN
                     TGITSTGYCPLDRTPIDAANINDLFPTPLIVTNLIDDLKVLCFNSERGCEWRGSRWEV
                     EHHVMEDCGYTGVKCGGKRIVYSIAEDDVEEKNGNEEKKEDYEADKEKEKEKEKEKEK
                     DEDYDEEKEEKESEEENQDLEESESTKPSTTTKEPEDSNLSIMADKTQSRKIIEKEEV
                     CSLVVERRFLSGIEHQECIHRIFQCEFCDTELTKLTRQMHLEQECLHNYKTCELCGND
                     SIAEKNMAKHQENCIKMGKIKCPAHEIGCKWIGSNETALEIHLQNGNCQLNQFLPYHS
                     KTMERLSSLESENQFLQRQLHKILDSIIQGKVSNLGYNDNLEEINKFQDSVENQDKLM
                     YLNFEVDRLKFEINEKLIPFMNKYGSSMRYDQDNSNTTLMKNLINDNFMMREDMNVQR
                     MMINSLRKQLQFMLFARNQKMGLAGNMMNMHNLGSDDMMPGDFYDAVSRSSSEERLNL
                     KL"
     gene            complement(971362..971452)
                     /locus_tag="PVL30_004221"
                     /old_locus_tag="LELG_06085"
                     /db_xref="GeneID:5231647"
     tRNA            complement(971362..971452)
                     /locus_tag="PVL30_004221"
                     /old_locus_tag="LELG_06085"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:5231647"
     gene            complement(971542..971615)
                     /locus_tag="PVL30_004222"
                     /old_locus_tag="LELG_06086"
                     /db_xref="GeneID:5231315"
     tRNA            complement(971542..971615)
                     /locus_tag="PVL30_004222"
                     /old_locus_tag="LELG_06086"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:5231315"
     gene            complement(<972351..>977072)
                     /gene="CDR3"
                     /locus_tag="PVL30_004223"
                     /old_locus_tag="LELG_04505"
                     /db_xref="GeneID:5231620"
     mRNA            complement(<972351..>977072)
                     /gene="CDR3"
                     /locus_tag="PVL30_004223"
                     /old_locus_tag="LELG_04505"
                     /product="Opaque-specific ABC transporter cdr3"
                     /transcript_id="XM_001524483.2"
                     /db_xref="GeneID:5231620"
     CDS             complement(972351..977072)
                     /gene="CDR3"
                     /locus_tag="PVL30_004223"
                     /old_locus_tag="LELG_04505"
                     /codon_start=1
                     /transl_table=12
                     /product="Opaque-specific ABC transporter cdr3"
                     /protein_id="XP_001524533.2"
                     /db_xref="GeneID:5231620"
                     /db_xref="PFAM:PF00005"
                     /db_xref="PFAM:PF01061"
                     /db_xref="PFAM:PF06422"
                     /db_xref="PFAM:PF14510"
                     /translation="MGRNRESQPYHGYYTGRKPEGQPYHGYYSGFNNDASAQIHHLAR
                     TITRGAPSYFDETFSRSNSRRVVSNAQGHYYHQSSHQQSTQDPHQHHQQEQQQQYPQQ
                     DQSHHSQQFTGISTPHGINPVLDKTDPTLDPENPLFSSKRWVQNMWRLYQSDSEYYKP
                     GKLGVAYKNLRVYGDAIESDYQTTVANGVWKYTKKFINKFRKHTEEDEYTFDILKPME
                     GLIKPGEVTVVLGAPGAGCTTFLKTIACHTEGFKVADGSIISYDGITPEEIKKNLRGE
                     VVYCAETEVHFPNLTVGQTLEFTALMKTPRNRPLGVSRTDYAKHIVDVVMATYGLTHT
                     KNTKVGNDFIRGVSGGERKRVSIAEVSLVQASIQCWDNSTRGLDAATALEFISSLKTS
                     ASILNDTPLIAIYQCSQDAYELFDKVIVMYEGYQIFFGSSSRAAAYFQRMGYVMQDRQ
                     TTPDFLTSVTNPAERIIRPGFEKIVPRTPKEFYRYWRRSPERQALLEEIDEYLDNCEN
                     YDQKQEIFEAMIAKKSKHTHTKSPYTVSLPMQVRYIIGRNFDRMKGDPSFPILTVFGN
                     VAMSLILASVFYNLKPDTNSFYYRGAVMYYALLFNAYSSVLEIYAIYESRPVVQKHRE
                     YALYPPMADAIGSILGDIPLKLVTSICFNLALYFMVNFKREPGAFFFYLLINFLSTLM
                     MSHLFRTIGAYTTTLAEAMTPSSLLLFALSTFTGFAIPITYMHQWCKWIHWVNPLSYA
                     YEALIANEFHGRDFNCTYLVPSGFGYPTSGPSVVCASMAAIPGSYFVNGDLYIKEAFG
                     YYWKNAWRNFGILLSFVIFLFITTLVCVEYNRSQINKGEILVFKKKDIKNMRRDQIDE
                     EKGLAIAGNGSGGSGGSYLEEKSHHMNYSGSTEFSDYSYDYLDRKILETSNIFHWRNL
                     SYNLRVKGEDRTILNGIDGWVKPGEVTALMGASGAGKTTLLNALSERLTVGVITSGSR
                     MVNGGPLDNDFQRSIGYVQQQDLHLETSTVREALQFSAYLRQPKDVSKSEKDGYVEKI
                     IDLMEMSSYANAIVGVPGEGLNVEQRKRLTIAVELVARPKLLVFLDEPTSGLDSQTAW
                     SICKLIRKLANHGQAILCTIHQPSAVLLEEFDRLLFLRKGGETVYFGEFGYNCQTLIN
                     YFESHGAPRCPPDANPAEWMLHVIGAAPGSKANQDYFQVWRNSNEYKMVQRELDMLEA
                     QGGSNGGLENGANRYVDPDRDNSYASSIWFQYYYVLKRLFQQYWRTPSYIYSKFAMAI
                     LCSLFNGFVFYKSANSMQGLQNQMLSIFMLFVVMTTLSQQYVPMFVTQRDLYEARERP
                     AKTFSWFAFILAQITAEIPYQVVAAAISFFTWYYPVGMYRNAGDATAQRGALMWIVMT
                     LMFIYSSTLAQLCISFNQLADNAANGISLLITISMTFCGVIATKDFMPRFWVFLYRFN
                     PFTYLVSAMLSIGVGNSHVRCAENEYLHFPTEQPGIQKCKDYMGAYMSIAGGYLTNPE
                     ATDNCQFCQMNSTNQYLQRLNISINNFGRDTGVFIGFIAFNMIFTVLLYWLFRVPKGD
                     RQKNNNWLSKLVFHNGYNDQA"
     gene            complement(<982787..>984304)
                     /locus_tag="PVL30_004224"
                     /old_locus_tag="LELG_04506"
                     /db_xref="GeneID:5231364"
     mRNA            complement(<982787..>984304)
                     /locus_tag="PVL30_004224"
                     /old_locus_tag="LELG_04506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524484.2"
                     /db_xref="GeneID:5231364"
     CDS             complement(982787..984304)
                     /locus_tag="PVL30_004224"
                     /old_locus_tag="LELG_04506"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524534.2"
                     /db_xref="GeneID:5231364"
                     /db_xref="PFAM:PF07690"
                     /translation="MVYDDNALGDIEKATHAHYENSTNSDLSQHPVENEMKLSPEHYD
                     YLMQRHGTIDLDPLPSADPKDPLNWPNWQKNYEILNIALSTFSSTFMAAGVNSAYEPL
                     AELYGVSMSDASYFTSVMICVFGVMPFIWVPLMNTYGRKPFLTTGALFCCALNIGSGF
                     AKTYGQQIAIRVLIGVFIATATSAGAAIVNDLAFAHERGKKNGWWSLGYVMGTAAGSF
                     LTGFIQYHVGSKWIFFVFAIMNFVQFLGWVFSRETVYTRSSPQNEATGLAKMLGFRKS
                     HARKFSWWSFLRPWKQAMYLDISLAVMTTAVIFAYGNIFFSVEMPQTMSHLFHLNAQS
                     MSLQFLSLVIGCGLGEVLAGPPSDWWMQRSIKKRHGKKVIVDRLWHSYLGFLLVIVGI
                     IVFCIMMAQATPNHWTIKPLVGVTIAAVGNQIVTTVVITYAIDNNPKEAGDVGIYLGF
                     WRQMFGFVGPFYFPKMVANLGFGGSAGLMCGIIALFSLAPTVFCHVRGEIKQRRD"
     gene            complement(987058..987128)
                     /locus_tag="PVL30_004225"
                     /old_locus_tag="LELG_06087"
                     /db_xref="GeneID:5231332"
     tRNA            complement(987058..987128)
                     /locus_tag="PVL30_004225"
                     /old_locus_tag="LELG_06087"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:5231332"
     gene            <987867..>989030
                     /gene="NIF3"
                     /locus_tag="PVL30_004226"
                     /old_locus_tag="LELG_04507"
                     /db_xref="GeneID:5231557"
     mRNA            join(<987867..987870,988219..>989030)
                     /gene="NIF3"
                     /locus_tag="PVL30_004226"
                     /old_locus_tag="LELG_04507"
                     /product="NGG1 interacting factor 3"
                     /transcript_id="XM_001524485.2"
                     /db_xref="GeneID:5231557"
     CDS             join(987867..987870,988219..989030)
                     /gene="NIF3"
                     /locus_tag="PVL30_004226"
                     /old_locus_tag="LELG_04507"
                     /note="BUSCO:EOG09263UQF"
                     /codon_start=1
                     /transl_table=12
                     /product="NGG1 interacting factor 3"
                     /protein_id="XP_001524535.2"
                     /db_xref="GeneID:5231557"
                     /db_xref="PFAM:PF01784"
                     /translation="MIQKFYPIALADKTWDNTGLLVDSSYDDSSSALSTSSSATNLKI
                     LLTIDLTQAVAEEAIDQNVNLIMAYHPFIFRGLKSITQQDPQQRSLIKLIQNNISVYS
                     PHTAVDSAKGGVNDFLVDVITKGLNIESSKPIEEDKNTPENGMGRLVTLSGSSSTLKS
                     LVESVKNGLQLKHVQVAESIKGPSQEIKTIAVCAGSGGGVFKGIQADLYFTGELSHHE
                     ALFFKESGSSVICCNHSNTERSFLRVIQEQLQKELPQDKIVISENDKDPFETW"
     gene            <989591..>991813
                     /locus_tag="PVL30_004227"
                     /old_locus_tag="LELG_04508"
                     /db_xref="GeneID:5231491"
     mRNA            <989591..>991813
                     /locus_tag="PVL30_004227"
                     /old_locus_tag="LELG_04508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524486.2"
                     /db_xref="GeneID:5231491"
     CDS             989591..991813
                     /locus_tag="PVL30_004227"
                     /old_locus_tag="LELG_04508"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524536.2"
                     /db_xref="GeneID:5231491"
                     /db_xref="PFAM:PF00651"
                     /db_xref="PFAM:PF01344"
                     /db_xref="PFAM:PF13418"
                     /translation="MAEAELQAPILRPSSPPMRTTPPAKLLKTNGPVIPTCSTRSTIV
                     ACSGTPYFFLYGGFDERENLDSNVYLLNTETMQWEVDDKVDTLYREGHSAAYIGNGNV
                     LVFGGIPFEDDIPSAHRVGRNNSSRLSGSTSRNGNGNGNDNGNESESVNLNENGNVII
                     SETSFNVAGSTALQDFRNDSLMMIYNVFDRKWTGAPEFALQNAPTQRSRHACCLSPDG
                     TKMYISGGQYKSQTFNDLYCYDLSTGVWTGPIEFVTRFSHTIMCSGDRIFSFGGLGKE
                     MNRVNAIIYLSLKDQSIGEMSVSNFPTYNPDGFLHTLEILEYRAQTSLAISVLLPTEI
                     ARHRRVTLRSFNLCDFETNVFLNNESDRIFLQDPEQRDKEYVWYHLLVDNQGYLNLLG
                     NELHEYPMDEESMTGLTDRIDPQTWKLNLLLRINLSAFGLKKGKEKYGLNDREADKLS
                     SDFKSILGTSEFSDFQIETVITEQDRSNFELQQPYQTKSIPVHKAILAARWPHFNRMI
                     SSGMAETVTNKVLIPEPYHRVMAIISYLYVGYVDEDGIRNNGHSLELHDYASLVGLAN
                     LYELQDLKVMIIQKVFVLLKQLALQLHQGSTGSIATLLSVWKDISLANEPLLLSKIMY
                     LVRQYWAAITRSQAFTNELSREQIVKLCQDFSDYHPDGFKRQDEVQASSIFSTLLEVE
                     SSSRNSRNSRTSRASRNSRNSTDSLGLTPSPGTPAPRTHSPFVFNSPAFDSSHISSNL
                     "
     gene            complement(<992009..>994147)
                     /locus_tag="PVL30_004228"
                     /old_locus_tag="LELG_04509"
                     /db_xref="GeneID:5231582"
     mRNA            complement(<992009..>994147)
                     /locus_tag="PVL30_004228"
                     /old_locus_tag="LELG_04509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524487.2"
                     /db_xref="GeneID:5231582"
     CDS             complement(992009..994147)
                     /locus_tag="PVL30_004228"
                     /old_locus_tag="LELG_04509"
                     /note="BUSCO:EOG09261G4Z"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524537.2"
                     /db_xref="GeneID:5231582"
                     /db_xref="PFAM:PF01663"
                     /translation="MSSGRAGLPHAVDVPVTDMDDPEDDVIFNTKHSAQSTLPPDYDR
                     NQNLNQHDVLRNLDYETSDSTPQNTSVFDKVKSLFVSSANTANNTYEMLSRSDSAETP
                     DQDWLDDHDFIEPPIDLRDRRLKLLEKKVKNRTIVGGITLIMVVLVFLVLYLTKKQNL
                     PINSQSSSGVVKTVYSNSTHNFYKTTIVVSLDGFHPHYISKEDTPNLHEMLINDYGAP
                     YMEPSFPSSTFPNHWTLVTGLFPSEHGIVGNTFWDPKLKKEFVNTDPKRGGLDPDFWR
                     GGGEPIWQTAKSQGVKSAVHMWPGSEVPHVGPEFDFDKFNGSEVLSAKVDRVMQWLDR
                     DIKSRPELILTYVPTVDTYGHQFGISGPNLTESLTYVDSFVALMNAEIKKRNLENIIN
                     LIVVSDHGMAPTSKDRVLYLDDLVDLDEIEHIDGWPLFGLRPKGDLNETYNIIKANFE
                     KLDAKLTQNYHLYKVEEFPKRFQFGGQLRDHRFNYRLAPIWLVPDVGYSITTHQQMKD
                     NGFEYKPKGVHGYDNSHLLMRAIFLGKGPYFEEKLSKSKKIQPFANTEVYNIICDTLD
                     LSPAPNNGSIPTKAIFSNILPETWSDDLTFPNLPFEVDHIVRNNATYDFLWRSGRIEN
                     PEDNDKGNEDSPPSPTPSSVTISYGSSALDVPTSLRTVTTENETNKATSTAHAGLGDI
                     FEDILDGIEDGLDAIGDKIHGFIDDTFGEE"
     gene            994830..994938
                     /locus_tag="PVL30_004229"
                     /old_locus_tag="LELG_06088"
                     /db_xref="GeneID:5231600"
     tRNA            994830..994938
                     /locus_tag="PVL30_004229"
                     /old_locus_tag="LELG_06088"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:5231600"
     gene            <995359..>996726
                     /gene="ALG1"
                     /locus_tag="PVL30_004230"
                     /old_locus_tag="LELG_04510"
                     /db_xref="GeneID:5231524"
     mRNA            <995359..>996726
                     /gene="ALG1"
                     /locus_tag="PVL30_004230"
                     /old_locus_tag="LELG_04510"
                     /product="mannosyltransferase"
                     /transcript_id="XM_001524488.2"
                     /db_xref="GeneID:5231524"
     CDS             995359..996726
                     /gene="ALG1"
                     /locus_tag="PVL30_004230"
                     /old_locus_tag="LELG_04510"
                     /note="CAZy:GT33; BUSCO:EOG09262Z2S"
                     /codon_start=1
                     /transl_table=12
                     /product="mannosyltransferase"
                     /protein_id="XP_001524538.2"
                     /db_xref="GeneID:5231524"
                     /db_xref="PFAM:PF00534"
                     /db_xref="PFAM:PF13524"
                     /db_xref="PFAM:PF13692"
                     /translation="MVDIIKYQGFDHLWQYSGPWLYYLLALYISLPVLAYKVLPLLFH
                     TRRNRSRKTILIFVMGDLGHSPRMCYHALSFSKLEYSVSLCGYIESQPNYEIIDDVNI
                     DLRPITVVKNEKDSPFLLFAMRKILVQIQDISKILWSHREDADYVMIQNPPSIPILLV
                     VILFKLFISRHLKIIIDWHNLNYTILNLRYNNLHHPLVRITKAYEQVLARFASLNITV
                     TKKMKSFLVDEFALEKSKIVTLYDRPGKQFQPLNEVKESGLYRKHEIFNEIKGIENYK
                     VLVSSTSFTPDEDFNILLEALKSYEKESNTPPLLLIITGKGPLKNEFLNKVQDFKFSE
                     KVVIKTAWLSSEDYPKILASADLGVSLHTSSSGIDLPMKIVDFFGCGIPVVSLDFPAI
                     GELVKEGKNGVIVKTSKELGKAISNIFTNETSFRQLKAGAMEESRYRWDENWTSTLRP
                     RFEVQ"
     gene            complement(<996843..>998075)
                     /gene="HOS1"
                     /locus_tag="PVL30_004231"
                     /old_locus_tag="LELG_04511"
                     /db_xref="GeneID:5231566"
     mRNA            complement(<996843..>998075)
                     /gene="HOS1"
                     /locus_tag="PVL30_004231"
                     /old_locus_tag="LELG_04511"
                     /product="histone deacetylase hos1"
                     /transcript_id="XM_001524489.2"
                     /db_xref="GeneID:5231566"
     CDS             complement(996843..998075)
                     /gene="HOS1"
                     /locus_tag="PVL30_004231"
                     /old_locus_tag="LELG_04511"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase hos1"
                     /protein_id="XP_001524539.2"
                     /db_xref="GeneID:5231566"
                     /db_xref="PFAM:PF00850"
                     /translation="MRDQVILVDVDILTELADKLPSNHGRSSLVQELIRVYALHKYCQ
                     IIDVVAPVDKRVLTQYHDADFINHIFAPRLDIDKQDEHYNSLSKRLDSTFPFDKECLI
                     PQDQTEEELVSLDENYGLTHDCYVFPFMRHYVALTAASTIELATHIARMVVNSRDSDD
                     LHIRPIGINWYGGRHHCHRAKCSGFCYINDVVLGINALRKLTSATVFYLDLDLHHGDG
                     ISQAFQYSKKVTTCSIHRFDVGFFPGTGDVRASVNGDYNIPTKRGLNDESLRWIVENI
                     VQPLIQKHQPQYLFIQCGCDGLSTDPHKEWNLTICGYAKVIKSLLDAIRIPVILLGGG
                     GYNFTEAAKFWTYLTALVTEIPISDTLDDIPEHKCLDSYENDGYRFWTDRNTQRGKMN
                     DENDPRYLESIRDHLLNL"
     gene            complement(<998453..>1002358)
                     /gene="REV1"
                     /locus_tag="PVL30_004232"
                     /old_locus_tag="LELG_04512"
                     /db_xref="GeneID:5231444"
     mRNA            complement(<998453..>1002358)
                     /gene="REV1"
                     /locus_tag="PVL30_004232"
                     /old_locus_tag="LELG_04512"
                     /product="deoxycytidyl transferase"
                     /transcript_id="XM_001524490.2"
                     /db_xref="GeneID:5231444"
     CDS             complement(998453..1002358)
                     /gene="REV1"
                     /locus_tag="PVL30_004232"
                     /old_locus_tag="LELG_04512"
                     /note="BUSCO:EOG092608WI"
                     /codon_start=1
                     /transl_table=12
                     /product="deoxycytidyl transferase"
                     /protein_id="XP_001524540.2"
                     /db_xref="GeneID:5231444"
                     /db_xref="PFAM:PF00533"
                     /db_xref="PFAM:PF00817"
                     /db_xref="PFAM:PF11799"
                     /db_xref="PFAM:PF16589"
                     /db_xref="PFAM:PF16727"
                     /translation="MEEDKVEQENEAFQESQYSTFLKSLDNENLISHINHISQTQELR
                     HNSFQGVSTPKKITSQVSNASSDPFNDGLDDQIINLLGGPSPPELDAKKSVDAIGGIE
                     NGEDNVDCCNSGNSGNSGNSGNNNNEDEVAMVVSEHSPLLHQTGAIFHALPAEESDAS
                     ESDKDEASIGALHEFNDYGTYLDSKLKKQQRQDEAYIAWDQQRRRQQKLDSQPKQMFK
                     GCTIFVNGHTKPSINEIHRLVILHGGKFLSYMANKSVATHIICDRLTPRKNVMFKNYK
                     VVKAQWIVDCVEAGELLDWQRYRLIMDVAYDQKRLNFPQRRERTISEEESEYEDVFQN
                     GDNVARDIDQDNNEQVHKKNKTENKECRENYGRDNGSKDDLNDNLIDDLNDNLNDDLN
                     DDGEENQVLSILAEEPDILERQQMLESQRSILSNSTYEDNLDDDEEIVDLAITNDNGE
                     PPSEGKGVHKVKGKYVLDARHPDFLRGFFANSRLHHLSMWKADLRLKFLRRIVKEHLH
                     KPNPQDRFAASSINNLVQNNNDNKGKRIIMHIDFDCFFATASCLKHPNLDIDRDPIAV
                     GHGGETSDVASCNYVARKYGVRNGMWFRSAQALCPNLTLLDYEFEIYEKCSSEFYNYL
                     VTSDYFDTIFPVSIDEVLVDASSYCFKSEKPIEEAVTELCSLIRKHVFQLTKCSVSIG
                     ASFNVLLAKLAIKRAKPNGQFFLHKDIEKELFEVPIKDLPGFGKGILEKLEPEIDKTN
                     PKISDIINLPRSRLILLVGEKTGTKLHEYARGIDNTSIEVDTSNPEAVLGRKSISVDV
                     NFGIRFDTVEELDEFFMRLARELYERMVNLGLCGSILTLKLAKRAPGADVVTAKFLGL
                     GQVEFVNKSSRLGVATNDWGVIGNEIKVLYRMINIPVKDLRGISVSMTKLKDVDSMKS
                     SKQMTLPFGRAATNRNKVSYENGSPFKNTSISTTESKLQVRAPIEAPSFKNLKTRPRV
                     GEKLVFSREDIARRRKRPKTTSSDPLNNADDIDWDVFNSLPIDIRRELECELKRRGML
                     PEQRSPPKGKSYLQQVFSTQVGGKPKYVRVIESPTKTTKKKRKTSASPSPSPGPGPGP
                     GLGLGLGQVLGPSPAKSKQNVVYEESQSYDTMIVNELPSSIRADVLKDMEYKKKIRNF
                     DLVPMREKMNRKMEEAKVDVDLVTLEWLDKQPKLNEMPLFLNENVTPRQMKTRLCQWV
                     DTSLSQEGPHEEDVAYFIAYIAQMIEAGQISRAIVVVETIRDHLQYHISMLNCGVPSN
                     NTSLQTTLNAIEDWRVQLNTKVYPALKQNCKNRNISIEF"
     gene            <1003008..>1003647
                     /gene="CMD1"
                     /locus_tag="PVL30_004233"
                     /old_locus_tag="LELG_04513"
                     /db_xref="GeneID:5231755"
     mRNA            join(<1003008..1003010,1003201..>1003647)
                     /gene="CMD1"
                     /locus_tag="PVL30_004233"
                     /old_locus_tag="LELG_04513"
                     /product="calmodulin"
                     /transcript_id="XM_001524491.2"
                     /db_xref="GeneID:5231755"
     CDS             join(1003008..1003010,1003201..1003647)
                     /gene="CMD1"
                     /locus_tag="PVL30_004233"
                     /old_locus_tag="LELG_04513"
                     /codon_start=1
                     /transl_table=12
                     /product="calmodulin"
                     /protein_id="XP_001524541.2"
                     /db_xref="GeneID:5231755"
                     /db_xref="PFAM:PF00036"
                     /db_xref="PFAM:PF12763"
                     /db_xref="PFAM:PF13202"
                     /db_xref="PFAM:PF13405"
                     /db_xref="PFAM:PF13499"
                     /db_xref="PFAM:PF13833"
                     /translation="MAERLSEQQIAEFKEAFSLFDKDSDGKITTKELGTVMRSLGQNP
                     SESELTDMINEVDINSDGSIDFPEFLTMMARKMKDTDSEAEIAEAFKVFDRNGDGKIS
                     AAELRHVLTSIGEKLSDADVDQMIKEADTNNDGEIDIQEFTQLLAAK"
     gene            <1004084..>1005331
                     /locus_tag="PVL30_004234"
                     /old_locus_tag="LELG_04514"
                     /db_xref="GeneID:5231702"
     mRNA            <1004084..>1005331
                     /locus_tag="PVL30_004234"
                     /old_locus_tag="LELG_04514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524492.2"
                     /db_xref="GeneID:5231702"
     CDS             1004084..1005331
                     /locus_tag="PVL30_004234"
                     /old_locus_tag="LELG_04514"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524542.2"
                     /db_xref="GeneID:5231702"
                     /translation="MDDCLQSLIKSYNLDNTDFDNSQNYRNKVSRGDSNDTEASFAVG
                     VSGKKDEIRNGGDSLHSSKDIYKPPHRKQARMGRHFTKKDNGDSRNSDINIHSNSHGF
                     DTIDEEKLAQRRARFAKESKQQVNTNKYNYGFISRGEDTRLKDSAQAREEFFQYILQQ
                     FTQYTLANSTLELREFFQKLKSDDLECTTNSEVLTKNKKERNNETNISENGENNEVTL
                     DSITMSIRKLRESLISIPPSPFHKRVFLFSVRFSQYFNHHQTYIPSVNYLLQYRAHLK
                     LDESEVMEAAVILVLHMCHANNDPASATSLYFKYIPKRKDVLRILRCWILNDFYTWMH
                     IYNYEVECIAIKSMMRIGLGRMLNLMVKTVSQSYFTLSKKVIQECFLPHELSYEEFHR
                     QYSPNWQDEKNDGMITVRQRARR"
     gene            <1005442..>1006574
                     /locus_tag="PVL30_004235"
                     /old_locus_tag="LELG_04515"
                     /db_xref="GeneID:5231542"
     mRNA            join(<1005442..1005450,1005882..>1006574)
                     /locus_tag="PVL30_004235"
                     /old_locus_tag="LELG_04515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524493.2"
                     /db_xref="GeneID:5231542"
     CDS             join(1005442..1005450,1005882..1006574)
                     /locus_tag="PVL30_004235"
                     /old_locus_tag="LELG_04515"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524543.2"
                     /db_xref="GeneID:5231542"
                     /translation="MTKRQSRFAMFKFNKNGDASRPKLPDLIKIDDITSGRIDPNLIY
                     EEIEMLKAEINVLRNDMSSFLKALATIPEDGSRNEYYQNVIQRLQTVQNDIAEYCERY
                     NKLLPIINLAQIKLGHEVEAPPSSAKKSIPSTSNNTPLLGNKGTPNIITGSPASDATT
                     ATPAGSGVGTSGVGVGIGTGTGSGANNNNTSTATKNTKKPTKKNNNNNNNNNNTPATS
                     VTKAGTGGSNSPIVL"
     gene            <1007351..>1016851
                     /gene="VPS13"
                     /locus_tag="PVL30_004236"
                     /old_locus_tag="LELG_04516"
                     /db_xref="GeneID:5231490"
     mRNA            <1007351..>1016851
                     /gene="VPS13"
                     /locus_tag="PVL30_004236"
                     /old_locus_tag="LELG_04516"
                     /product="Vacuolar protein sorting-associated protein 13"
                     /transcript_id="XM_001524494.2"
                     /db_xref="GeneID:5231490"
     CDS             1007351..1016851
                     /gene="VPS13"
                     /locus_tag="PVL30_004236"
                     /old_locus_tag="LELG_04516"
                     /note="BUSCO:EOG09260075"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar protein sorting-associated protein 13"
                     /protein_id="XP_001524544.2"
                     /db_xref="GeneID:5231490"
                     /db_xref="PFAM:PF06650"
                     /db_xref="PFAM:PF12624"
                     /db_xref="PFAM:PF16908"
                     /db_xref="PFAM:PF16909"
                     /db_xref="PFAM:PF16910"
                     /translation="MFESLVANLLNRFLGSYLENFDPKQLNIGIWGGDVKLTDLRLKK
                     ESLDKFKLPIDVKFGHLGVLTLQIPWSNLKGKPVQIVIEDLYLLASPIVLSDYNEEEE
                     QKRQQAVKESKLKEVEEILEAKSEDLGKDLANETFAESLVTKIIDNLQVTIKNIHIRY
                     EDESVLTEQPYTFGASLKELSAVSTNEDWEPSFISITQAFTRKLLKLNSLSLYMDTQT
                     PELFSHSSREQILNDFKSLEPSEEYLLKPVTGSGKVTIHKSGTTNTVPHIESHLAFEE
                     FGVELNSKQYNDILSTASQFQWITKTAKFRKFRPKTSPSEDPKEWFRYAAKCVLNEIH
                     EKNYKWSWDYIKKRRDQRISYIKLWKLKLLRTISESDLKELKQLEWDLPLADIKLYRA
                     LARTELRKENKTARLYDTETSKKEEQSKGWFGGWWGGGANRNNNNNNNNNSSYRGNQE
                     TEKEKEQTYNADGEHTDLSLTEDQKKALYDTIDYDENATTATIELPDNYVTMKVNASL
                     KKGGFVLKESNGANLAEVIFEGCSTQYLQRPNSFVAGFQMQEFRIEDGTNMSIYKHVV
                     SVKEATGDDTNATKTPFFQVMFEQNPLDHKADSSLSAQLKSMTIFYSPKFVEKVISFF
                     SPPTTHFDTVGAIMNAAEESIESITANTRMGLEYAIDEHKTINLMMDLQAPLLIMPLD
                     PASFKSPVAILDAGHVSIVSNFAERSKIQEYKDKSSYTAADWKEVGNLLYDRFDLHLS
                     DIEFYVGHTIKSTMEQLYATEDARPARVLTNLNLNLGLGVSILPDALNLAKFKLEGNI
                     PKLAVNLNDFQYKTLMQIVDKAIPQSVASDADKESVFKAYGGEQDEKEFEFEKIHNGN
                     NRKDVTTNADQKVFESNLSIDTIVLSLRRCISGKGMNDEPLIEILGDSLEISLSQTDS
                     EMLINLSLLDFTVFDKVQKSKIAEFEKMMSSSIEKEKGQKLLSMKLARKRRTVLLKGE
                     NVDVFDQDIDMQIATVKVVVTRMTLLDVLTFSMNTFADPNAPPVPADELIHNSEEDDA
                     AAPQKLNLSIKLESIVVIFNDDGFKLATATLETAQINMNILPESMDIEGRLGSITVLD
                     NMSSLQANDLQEQKLIHMNGDNLAELSYKTYDVHVEDRPSELVFKTGALTINFVESSF
                     NRLVEYFDQFLKMKAIYDGARMAALNEDTQLPVKLKFDILIKAPTVYFPVQQDNRFVA
                     NFGELYAKNDYKGANMKNCITAGIRNVSFASYIKFSNVVQNLNIVDNLDLTFDVEWTE
                     NYIKDVPTFVVQGKVPELKVDLTDMQIRLLNELSNSITYAFSVETQEESLEEVKESAK
                     YANRALEENTQKSSARSGGKLTTQKDVQDLVTQQSAQKNPAVASSLSVDNETPPPDHK
                     MVDLRFEVPLVALTLYQKTEDKTSVEDLKLSQFSLNRIAVVFQQNQNSQFDANLKVGS
                     FVVQDVRKFTDSKFDTIIPAADGVKDQFVLTANSTGLSESKNITVILNVENPKVILAL
                     DYIFDLQSFIESSTHLEAPKKLPNKPRRSIVSLSQQSTTKMQSISKSESKSQETLDDE
                     NKQKGAAAAAAAASATTNIWFSVNVNRPSIYLLADDTRSTTEALVFKIEQLSVSKQNV
                     ISVASSNIGLYLTRMDDPKNSRYRLIDDFSVSFAADDKDSTDTVVSNNIQASIEPIVV
                     RVSLRDIRLGLAIVQRANDMFAKYQSPARDGVESAQDTLKRRLSSISSTFSEDANNNG
                     DDEDNKSITNAFVQTGSSSDLSETMYVSFGGLRFVLIGDVSELPVVDVSLKAFDLRAL
                     NWSTDLNAEVHLETHINIFNYANSCWQPLLEPWPVAILASRAQNGSNPKLLVEVVSRK
                     LAEITVTSRTVALLSQIQSLLSTDEELKPRGQDYPFVIFNDTGYDLKIWTSGQKNDSE
                     TTLVYGESKPWAFEDWRTIRENLDADSTSALGISFLGKKTNASSTSTNATLSSSEPAP
                     AFEPIESLHVGCVGEEIYVLDPPIDDVHSRLLVNIKLRDDNVKIITLRSTMLIENDAD
                     VPISIDIFADNKSTLQINSKESRSVPIDSVYDGKLRVKPVLHTEYGWSNEIIHWRDIM
                     KRQLPLKCPPVSQNETNYFFQGEAIFDKDEPLAKVYPHLNLVISAPLEIENLLPYDFK
                     YRLYDKNSRREWTGSVKKGVKSYVHVVSLKNLLLLSVEPDLSPGFGRSEFAIINGPKA
                     SEFSRESSLTIHGKNNLKLKIHYPRKHADSTSLKVTIYSPYVILNRSSLDLAVSDRGN
                     VFEVPGKNIKGQELMPVMFSFDRGDDRGNRAMLKTRESSWSPPISFDAIGQSNQLKLQ
                     KRGEQTEISLGVTIMEGEGKYNLTKTVTIAPRYVFINRIANSLVISEEDSETSSIATT
                     NELLPLYGFRSSSQTNVVLKFEESSKWTQPFCINDVGQLFVKIQDKNSRQSLLKVTML
                     LENATMFIQIEDANNQWPYSIKNYTNEEFYIYQNNPNINANGEVVRKNRTFKPIYYRI
                     PPKSVMPYAYDFPNAIVKELIVRSRGRERAVNLSEIGNLRPFRLPPGDFNEQQQQQQQ
                     QQQQQQQQQQQQVVDLSVRADGPTQSLVISPYDPSKSLYRIASGNNSSSSSSSLAKNQ
                     GFEAVDVEDNYGIQVVTKFDGVGISLINTNDKELSYITIKGVEFRYNESNIYQNFSVK
                     LRWIQIDNQLYGSIFPIVLYPSVVPKTGKELNEHPAFSASICRVKDDSYGVFYVKYAT
                     ILLQELTFDLGEDFLYALLDFAKFPGASWNKLPVDQLCDNNLDIPEPQNLNNTSDIYF
                     EALHLQPIQANISFVRTDSVEAEDKTSAQNIIMFCFNVLTMAMGNVSDAPIKLNALFI
                     ENIRVPTPILLDSIQTHYKQAFFYQLHNVVGSADFLGNPVGLFNLLSSGVVDIFYEPY
                     QGFILNDRPQELGIGLAKGGLSFVKKTVFGVSDSFSKITGSLAKGLSVATMDSRFQER
                     RRIQLKRNRANYFAGGANSLFESITSGIGGIAVDPLEGAAKDGAVGFFKGLGRGVIGL
                     PTKTAIGVFDFASNLSEGIRNTTTVFDGETLDRARLPRYINTNGAIKPYSEKEAQGQF
                     WLYSINGGEFYNETYLAHVILPGGDMAVITSYRKIILFDIKTLASKWVIKFDQIKSIS
                     VEPTGLTIDLKNRRGPFIPIPDRQNRSFLYQKIGVAVKEYNKHCRVVL"
     gene            complement(<1017059..>1018216)
                     /gene="FMT1"
                     /locus_tag="PVL30_004237"
                     /old_locus_tag="LELG_04518"
                     /db_xref="GeneID:5231603"
     mRNA            complement(<1017059..>1018216)
                     /gene="FMT1"
                     /locus_tag="PVL30_004237"
                     /old_locus_tag="LELG_04518"
                     /product="Methionyl-tRNA formyltransferase"
                     /transcript_id="XM_001524496.1"
                     /db_xref="GeneID:5231603"
     CDS             complement(1017059..1018216)
                     /gene="FMT1"
                     /locus_tag="PVL30_004237"
                     /old_locus_tag="LELG_04518"
                     /note="BUSCO:EOG092631ML"
                     /codon_start=1
                     /transl_table=12
                     /product="Methionyl-tRNA formyltransferase"
                     /protein_id="XP_001524546.2"
                     /db_xref="GeneID:5231603"
                     /db_xref="PFAM:PF00551"
                     /db_xref="PFAM:PF02911"
                     /translation="MRLNTNRRWLSLLIVPQTRRLHTQIKANANANAKSKFKLDPLRI
                     AFFGSDHFSTESLRQIKSLHDQDSSLIDNIKLITRSLKPTGRYMKSVSELPVGVFAKE
                     NQIDILRADTQEDIINFLQSNSFNLVIAVSYGKLIPAEFIAKCKYGGLNVHPSFLPKY
                     SGSSPLQYALLNDDQETGVTVQTLHPTKFDHGNIVAKSHAVPILENDNYDSLAKKLGR
                     IGGELLVSVIKDASFVNPKSILEFGEQKRTLAPKISKNESQVLWSESSSRHIKRQFDA
                     LGPLFTFLNVKIKRKKQTIEEKQRAILYNVTELKMDPAVVAKQHNLTKPGDFTLVKDG
                     LCIKANTGFILAKGIKMQARAEMTPETFIGSYHKYAGNVPQQFISTLEENK"
     gene            complement(<1018664..>1021021)
                     /locus_tag="PVL30_004238"
                     /old_locus_tag="LELG_04519"
                     /db_xref="GeneID:5231701"
     mRNA            complement(<1018664..>1021021)
                     /locus_tag="PVL30_004238"
                     /old_locus_tag="LELG_04519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524497.1"
                     /db_xref="GeneID:5231701"
     CDS             complement(1018664..1021021)
                     /locus_tag="PVL30_004238"
                     /old_locus_tag="LELG_04519"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524547.2"
                     /db_xref="GeneID:5231701"
                     /db_xref="PFAM:PF10214"
                     /translation="MWPQKDGVGTRISYGVNGNALIQAKSTKNEGDDRGKKEEIDYSG
                     DTRNAFSSPIFPRQQYGARAFSMQAGSLETTIDTTKLSTYDALPNNSSLSMKLQTGLV
                     PRNMLSSLSVESRAFDTKKTYIPNTGETLNILQFYLRNSSQSIKASVYATGETSSTMR
                     ISTIKEDNTHSFSLDMDFRENIEQIEVSQCKPKGKENLVLVKTTNRVYLCLCKVREGN
                     SHHRHKHLKLKVNILQDMKLQSPQSHLTFCKRNCRKFASIDHKGLFTVYQVSDDLSDF
                     QKTFEVSLDLANIETNGTMSSWINLCWPKDKKRVLISTRTNVYEFDWKSSHSFRTLIT
                     SNTWSRIHGICSTTKFVFILTSKELIWVSYRKRFQRLLSWKHYLMESDPTKRMTLLEN
                     GDNFHIFLTSQISPIIIVYTFGLIAGRPCSLVDPYLIDIGARSTRQLKCIWNNEKKTE
                     ILLLHTSVDNTMSTCLLTSEDFDNSTMQTVPNSTSSPNSPMSFILKDNSRIDIGLFKK
                     TFTNIKTSSIKQNSAEASASTTQSIETKMIFEIQQLPSTSSHGTYSSIFYQLKSVPFH
                     INYLPSFDKLIESLNNGSQDGLVDGQRSFRFKNFIYTALETRGAKSRAGPQETKSFSD
                     LFHSMTSTNSDTDHQAQKAETAICLGTSLIKYRDAEQPKLEIEFQETKNNSNQQVQLI
                     LDAWDEPVDQVQESPVKRRKMLSTGVTDSVPVLRASQTVTQHNLYSSQSFQDTYFTQS
                     QPLSSQEKHENSQSKFGLSQRSSQRPSQASSQRSIKKKKKKKGGF"
     gene            <1021308..>1023968
                     /gene="CWH41"
                     /locus_tag="PVL30_004239"
                     /old_locus_tag="LELG_04520"
                     /db_xref="GeneID:5231545"
     mRNA            <1021308..>1023968
                     /gene="CWH41"
                     /locus_tag="PVL30_004239"
                     /old_locus_tag="LELG_04520"
                     /product="Processing alpha glucosidase I"
                     /transcript_id="XM_001524498.2"
                     /db_xref="GeneID:5231545"
     CDS             1021308..1023968
                     /gene="CWH41"
                     /locus_tag="PVL30_004239"
                     /old_locus_tag="LELG_04520"
                     /codon_start=1
                     /transl_table=12
                     /product="Processing alpha glucosidase I"
                     /protein_id="XP_001524548.2"
                     /db_xref="GeneID:5231545"
                     /db_xref="PFAM:PF03200"
                     /db_xref="PFAM:PF16923"
                     /translation="MDYESVRLGRNDKFRVDLHKFLQPYSYKTTNCVFSFNLSLVMMK
                     CHIFQIVSVLFYVLFSIAQNVEFDLFDQDPLNQDQLANDYTVQAENSLLWGPYRSALY
                     LGIRPRLPRSLLSGLMWFSMDDYRSIGSIRHFYEQNDNMAKANWVSYDPRYGGTQVIQ
                     DNDCHTNITIDFVKSKDGLSWAVKIKSEPHKGFEQSKISFVWYSGLEGEKEASIDDLG
                     EIERTGILKLENQKNVLGYKGSVKLSGVSEELGAFQVEINDGPKTNRHPSGKSDLPLE
                     FSPALAHHYSLRVPDDNVWQARDIFMTMLQESVQSLKGTTDSMEDIPPENLYIIRDLN
                     DFEGNLHLVQKVYQGSCEFDVIYHNEKTPDTEKITSKNIHEKIEANHNLFDEKFSEYF
                     ELQYPYNGTQNDSGTANYKAFAKEILSGLLGGLTYMYGDHLVDRKTIFDEDTFESYEL
                     NGSPEGPHQLFTLVPSRPFFPRGFYWDEGFHLMPLKEYDSDLVLDIIKSWFNLIDSEG
                     WIAREQILGPEARSRVPTQFQVQSPQIVNPPTLTLMLTMLLEHLSEERFGDVMKPIDI
                     DRDNELSDVTDSTNTTKFGSYILKHPDVLFKYAEEVYPKLKSHFQMLRKTQQGHFEEF
                     DRNYDNSEVFRWRGRTETHCLASGIDDYPRASPADVAELNVDLISWIGIMAKSLRLMA
                     GILNKYDDVVYFQDIEEKISKNLDKVHWSKNEGIYCDVSVDEDDENVHVCHKGYVSLL
                     PFVTKLIPKDDVDKLEKVLNIITDPEELWSPFGIRSLSKSDSNYKTGEDYWRSPVWIN
                     MNYLVLKGIEDYYYESRQFMSLALQKKFQVAYHDLRINVVDNVYRQWVKTGFVWEQYN
                     DETGDAKGAKNFLGWTSAVLLMMKMPGNLE"
     gene            complement(<1024239..>1026359)
                     /gene="TRP5"
                     /locus_tag="PVL30_004240"
                     /old_locus_tag="LELG_04521"
                     /db_xref="GeneID:5231636"
     mRNA            complement(<1024239..>1026359)
                     /gene="TRP5"
                     /locus_tag="PVL30_004240"
                     /old_locus_tag="LELG_04521"
                     /product="tryptophan synthetase"
                     /transcript_id="XM_001524499.2"
                     /db_xref="GeneID:5231636"
     CDS             complement(1024239..1026359)
                     /gene="TRP5"
                     /locus_tag="PVL30_004240"
                     /old_locus_tag="LELG_04521"
                     /note="BUSCO:EOG09260XOG"
                     /codon_start=1
                     /transl_table=12
                     /product="tryptophan synthetase"
                     /protein_id="XP_001524549.1"
                     /db_xref="GeneID:5231636"
                     /db_xref="PFAM:PF00290"
                     /db_xref="PFAM:PF00291"
                     /translation="MSQHLRETFARCKKEGRNALVNFITVGYPTVEDTIPILKGMQDA
                     GTDIIELGVPFSDPIADGPTIQTANIKALENGITVPKVLELVTKARESGVTVPLILMG
                     YYNPILKYGENQFLEDAEKAGANGFIIVDLPPEEAVKFRSSCAKYGLSYVPLVAPATT
                     DERLKVLGQIADSFIYVVSKMGTTGASSKVSSGIDELCARVRKFAGAETPLAVGFGVS
                     TREHFLEVGKVADGVVIGSKIVTLIGESAPGKRGETAYNYVKSILGQDYKSNAPSTYS
                     RSDLSKEQRESKPILEEAHKFNPRFGDFGGQYVPEALHSCLAELEKGFEDAVADPEFW
                     KEFRDLYSYIGRPSSLHKAERLSEHAGGATIWLKREDLNHTGSHKINNALAQVLLAKR
                     LGKKKIIAETGAGQHGVATATACAKFGLECTVFMGAEDTRRQALNVFRMKILGATVIP
                     VKNGTQTLRDATSEAFRYWVSNLETTHYVVGSAIGPHPYPVLVRTFQSVIGQETKEQF
                     KQLNDGKLPNAVVACVGGGSNSTGMFSPFEKDVEVKMLGVEAGGDGIDTERHSATLTA
                     GIPGVFHGVRTYVLQDSDGQVHDTHSVSAGLDYPGVGPELAFWKSTGRAEFIAATDAQ
                     ALQGFRLLSQLEGIIPALESSHAIYGGVELAKKLPKDQHIVINVSGRGDKDVQSVAEV
                     LPKLGEQIGWDLRFDEDPSKKNEV"
     gene            <1027651..>1030311
                     /gene="SPO75"
                     /locus_tag="PVL30_004241"
                     /old_locus_tag="LELG_04522"
                     /db_xref="GeneID:5231646"
     mRNA            <1027651..>1030311
                     /gene="SPO75"
                     /locus_tag="PVL30_004241"
                     /old_locus_tag="LELG_04522"
                     /product="sporulation-specific protein 75"
                     /transcript_id="XM_001524500.2"
                     /db_xref="GeneID:5231646"
     CDS             1027651..1030311
                     /gene="SPO75"
                     /locus_tag="PVL30_004241"
                     /old_locus_tag="LELG_04522"
                     /codon_start=1
                     /transl_table=12
                     /product="sporulation-specific protein 75"
                     /protein_id="XP_001524550.2"
                     /db_xref="GeneID:5231646"
                     /db_xref="PFAM:PF02714"
                     /db_xref="PFAM:PF12621"
                     /db_xref="PFAM:PF13967"
                     /db_xref="PFAM:PF14703"
                     /translation="MSSLDDHPHDYKALTKTYMEIFSSSKFTNLLNTTQTGYAHSSHG
                     IEFRIFFKTLFASVFLCTIEITLFCLLRPIFTELYQPRCFCVPITERIERLPRGLLQW
                     IMPTLRTNINTYMSLGLDAYFFIRFLSVLLLFFILIGTLNMLILIPINFTGNSATFSA
                     QGLDKLSISNIADANVPRLNAHFIMGLLIVVIFHWLIIYEFQSFVLIKQSYLLSEYHK
                     RLTMSRTLLITNVPSHLQYEQVLKDIFQTIPGGVKKLWFVYEFEEIDFHVQRAKNALQ
                     LLEESQILQMKKYYSSTTRRTMMSRWMSWRLTWTLPWENLCKISWSKFSFKKYPEKKN
                     LEVKFYPPIEYRFTKIPKINCSCHIKLPGWLRIFALQRRVSLIEWALSVLQESQSFID
                     GEIQKMTNDQLGKHNNVFIEFQDYKGACMANQCLLSQSQGCFDKTFMEVHPQDIIWRN
                     VSRTDGIMCKFENYLVTILFIIITILYVVPVSLVHSISELAVITHMIPFLDWIYQFPE
                     EAKQTISGFLPSIFLTVLTEIVLKMFRFLICFKGKVTGAEVEVGLQKWFFVFLFVQQF
                     LVVTISSSITVVLRQIIDQPTSIPVLLATNLPKSATFFFRYICLRAFALCGNNFLRFT
                     QLVLRNTYYKIIDITPRQKFHRLTKLSSIKWGTTFAVYSIYACIGIAFSIISPLISLF
                     IIFFLSLSILYYKYALNYVYSHINISETMGRLYPNALLHMYTGIYCSECCLIGILFLS
                     KDSSGKCVMQTQGWIMTGVLFVTIFINAIIYNIYSPYFANLPILSDRVCMKEKETKHE
                     SSEEATPIDSGVSLTGYNTLYLHPAFKYHKPIVWLPKDPHEMCKLQLEEIEIRSNTMF
                     KGDTKGATLHVSPQFGNIQVTVSGAPPDML"
     gene            complement(<1030347..>1032456)
                     /locus_tag="PVL30_004242"
                     /old_locus_tag="LELG_04523"
                     /db_xref="GeneID:5231501"
     mRNA            complement(join(<1030347..1030409,1030477..>1032456))
                     /locus_tag="PVL30_004242"
                     /old_locus_tag="LELG_04523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119532.1"
                     /db_xref="GeneID:5231501"
     CDS             complement(join(1030347..1030409,1030477..1032456))
                     /locus_tag="PVL30_004242"
                     /old_locus_tag="LELG_04523"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975515.1"
                     /db_xref="GeneID:5231501"
                     /db_xref="PFAM:PF03835"
                     /db_xref="PFAM:PF10403"
                     /db_xref="PFAM:PF10404"
                     /db_xref="PFAM:PF10405"
                     /translation="MTGLFLDDDDESENESFLIENVPKIKKQRLDEESSTVADSDLDS
                     LSDSDFEEVYLQPPEAIQQFDQVTNQITNQVTNQVTNQVTNQVTNQVTDLQGSIEGDQ
                     HPYTTTQNEFNITLNPINDEEEKKRKEKIKQLVREKRQRISLQNLSVISYMLNARHRN
                     KILSHPKVLKCLKKLLPESFLKHYKKFKKQSEKKHSQNSFQNGDQLLIYLLKYLIKWF
                     RKNFKHDSNGLRVLGYLPKSSDSVDYAKFFPNNAKPISDVTDMCRIIRKFQHNRDTGA
                     QLFTALLRSLGFEARLIYSLPLLDTSKPFIKWQPKVKQDIIKVNKDNDLLYPYFWTEM
                     INPLNNSEVLVMETQCFMQEERQLIRLQRFKGTDNSQNNYTNIYYPIQSELSQMSMHY
                     VLAFSNKNQIMDVSSRYMANISYRWFSKLDLRTESGKLALLMQSTIRILNGNTFYSKL
                     DNLELDELRRLALTNFKVPETFSAMKKSPNFTTESTLRYNEVIVPGSKKVSTVRLDGK
                     KKAVYFRNDVIIGKSIRQWEFLGRSVKSDEVSLPTKSVLATPKTLYNRRIYHQNMMEN
                     QQLNFTNLYSFNQTCPYIKQKISPDGKLPTNKYGNIEIYRPNMIPEGCTWLKLSDIEK
                     HISQKGQSSTKFQYVPVVVGFAFKSGQAYPVKNGLLTSSMLKIWLVSKLGNFFLDG"
     gene            complement(<1032971..>1033399)
                     /locus_tag="PVL30_004243"
                     /old_locus_tag="LELG_04524"
                     /db_xref="GeneID:5231468"
     mRNA            complement(<1032971..>1033399)
                     /locus_tag="PVL30_004243"
                     /old_locus_tag="LELG_04524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524502.2"
                     /db_xref="GeneID:5231468"
     CDS             complement(1032971..1033399)
                     /locus_tag="PVL30_004243"
                     /old_locus_tag="LELG_04524"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524552.2"
                     /db_xref="GeneID:5231468"
                     /db_xref="PFAM:PF08615"
                     /translation="MSSIKVDADKVVPKVTASLLPMHIQHNGAANTAEYFTPSHTTET
                     LRDGSTISTAFFRGCRLIGKDLNLSEQNLQGFVMNSSESLIREENLEDGTETIKSVKS
                     YTPVATFDKLVLFGHDEEVEPNDQWRLITEYSKISNVLHS"
     gene            <1034404..>1036305
                     /locus_tag="PVL30_004244"
                     /old_locus_tag="LELG_04525"
                     /db_xref="GeneID:5231502"
     mRNA            <1034404..>1036305
                     /locus_tag="PVL30_004244"
                     /old_locus_tag="LELG_04525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524503.1"
                     /db_xref="GeneID:5231502"
     CDS             1034404..1036305
                     /locus_tag="PVL30_004244"
                     /old_locus_tag="LELG_04525"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524553.2"
                     /db_xref="GeneID:5231502"
                     /db_xref="PFAM:PF07690"
                     /translation="MTKQNSNKGGTSSKSNPTQSQRRPSQHLTLSPNIIQDPSAETSG
                     LIANELAAESDILTPFDNPNKSTTYGSIDAESANNIAYTNIKSTGTTGTTGTTGTIGA
                     TSEIPNDENDDPYNGYALPKAQLYTVVSSLFMASFLAALDATVVTTLLSLIASELHAV
                     QNISWIATAYLLSSAAFQPIFGKISDIFGRKVLICGCSILFSLGCLICVTNSLFWLVI
                     GRFVTGIGGSGMTSIGTMTMSDLVPLRDRGLFQGLANIFFGLGSASGGVIGGVIADTL
                     GWKYVFALQVPLGLFVAFAIYSYLNLPAGSPGLGYHDEDVWSKLKRVDFLGSFVLISA
                     LLMFLTAASMGGREFAYSSRTFLGLSIGSAILFLAFIYVEAYISEEPIIPIHLLGNRT
                     VLSSSLTNWFFTMAVFTTLFYVPIYFTSVMNLTASENGLRLVPNFFGVSLGSVGAGYY
                     MKHYGKYYNLAVVSGILVILGITRITMISPKIPLWQQMVLLLPSGLGYASILTITLLA
                     LISATPMKFQACTTSIQYTFRSTGSTLGVSVASAIFSNVLLQQLTKKINAIVTNDPEK
                     ARKIIAKALDSTDYVNEAPKYVRAAIRDSYEAGCKGAFYFALLTVVLGFVSSLFMREN
                     KLHTSLNRD"
     gene            complement(<1036655..>1038331)
                     /locus_tag="PVL30_004245"
                     /old_locus_tag="LELG_04526"
                     /db_xref="GeneID:5231707"
     mRNA            complement(<1036655..>1038331)
                     /locus_tag="PVL30_004245"
                     /old_locus_tag="LELG_04526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524504.2"
                     /db_xref="GeneID:5231707"
     CDS             complement(1036655..1038331)
                     /locus_tag="PVL30_004245"
                     /old_locus_tag="LELG_04526"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524554.2"
                     /db_xref="GeneID:5231707"
                     /db_xref="PFAM:PF00892"
                     /translation="MPHTPLLLVRSPIVRSHTSTTTNNNNTPLLLTQKISNVPSEFHS
                     IITSPEQRNYRLGIILLLVSIATWITGLELVNGVLKTNEYKKPILFAVITGSCFVVNF
                     VPDLALLCRRQRKSHGDGMGDGDGDVNGGKKDLERQPLLINNSGGKDGINFDEEKTLD
                     NEMTKLEVMVLALQIAVIYLCYNIFLLEALQFTSASNSTVIGSTTAVFTLIIGYFLRT
                     EQLSILKAICVVFSCLGVVLVNNSSPSTSHNDNPDPVFNNIGGTGDDIGGGIGGFEPK
                     NPKLGNILALAGAFLYACYLLIMRIKCGSSSSKKTNERRLFGYVGIMTIILGFPLLYA
                     SHIFQFETFELPPRGDRNIMVFILINGVFSVISDFTSILAMLLTSPLVTSLTLTSSIP
                     ITIIIDSLILKWNHEPNLNMNLDYILGITSILTAVVLVNFSSTPDEYGNDFLEESVLE
                     NVIINDEILSPILSPLFERPSLSTKPLTIQSPLLRKLFTSSETNYMEAEEVHQKVPMF
                     NLNANDESPPTHNANHHPNLYHSPDLHSHPLLTHQVRKSSTISTNPSIEH"
     gene            1039859..1039932
                     /locus_tag="PVL30_004246"
                     /old_locus_tag="LELG_06089"
                     /db_xref="GeneID:5231630"
     tRNA            1039859..1039932
                     /locus_tag="PVL30_004246"
                     /old_locus_tag="LELG_06089"
                     /product="tRNA-Val"
                     /db_xref="GeneID:5231630"
     gene            complement(<1040247..>1041335)
                     /locus_tag="PVL30_004247"
                     /old_locus_tag="LELG_04527"
                     /db_xref="GeneID:5231649"
     mRNA            complement(<1040247..>1041335)
                     /locus_tag="PVL30_004247"
                     /old_locus_tag="LELG_04527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524505.2"
                     /db_xref="GeneID:5231649"
     CDS             complement(1040247..1041335)
                     /locus_tag="PVL30_004247"
                     /old_locus_tag="LELG_04527"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524555.2"
                     /db_xref="GeneID:5231649"
                     /db_xref="PFAM:PF03171"
                     /db_xref="PFAM:PF14226"
                     /translation="MTASNPLQIVDISQETRVAAAELLDALTTQGFVFIDGHDFTQIE
                     VDSLFNLSKQFFQLPREYKEKYIIDSSSGKNTGYISFTQENLDPSKKNDFKEGLNMSE
                     LNLLTGEPDCNGPIPDWLKNDTERYGLITSSIKKLNLLNLKLLELVAIALNVEDQNNG
                     ECKGKDWFTSRYKPTEKSGSTFRWLHYPVVNSEHPDAEIRAGAHTDYGSMTLLFQREN
                     QEGLEIYSPMSKSWEKVPFVKSERTNSGTANAGGSAVATEEKMAPPIVMNIGDLLSYW
                     TAGLLKSTIHRVRFENSAGKQQRNEDRYSIVFFAHPSDDTLLEPVPCDMIRHRSKMGR
                     GVAKDEEKGEYITALQHLQKKLANTYTR"
     gene            complement(<1041881..>1043489)
                     /gene="TRM5"
                     /locus_tag="PVL30_004248"
                     /old_locus_tag="LELG_04528"
                     /db_xref="GeneID:5231474"
     mRNA            complement(join(<1041881..1043274,1043486..>1043489))
                     /gene="TRM5"
                     /locus_tag="PVL30_004248"
                     /old_locus_tag="LELG_04528"
                     /product="tRNA(m(1)G37)methyltransferase"
                     /transcript_id="XM_001524506.2"
                     /db_xref="GeneID:5231474"
     CDS             complement(join(1041881..1043274,1043486..1043489))
                     /gene="TRM5"
                     /locus_tag="PVL30_004248"
                     /old_locus_tag="LELG_04528"
                     /note="BUSCO:EOG09262I0R"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA(m(1)G37)methyltransferase"
                     /protein_id="XP_001524556.2"
                     /db_xref="GeneID:5231474"
                     /db_xref="PFAM:PF02475"
                     /translation="MAVTHWFMKRLSRFRILPEYKSIMSNYRPPVNHDMQTLDRSFFK
                     KDIPLIAAKFSKPQYLPKFMKSCADEIINVPNIKHIVTINDSKAILLKDSITKLEDCS
                     PETQEKFKEFGIELEPYTLHLDYWFWKSDEILNAIIPKVGNEDVPSGFTAAGHLAHLN
                     LRDEYKKYGKIIGEVILDKNPAIKTVVDKKNTIKNEFRTFPIELLAGEENYVVEQTES
                     GCKFTFDFSKVYWNSRLAREHERLIEKFGPGEVVGDVMAGVGPFAVPSGKKGTIVLAN
                     DLNPESYKYLQQNIEQNKVESFVKAYNIDGRKFIEDAAQILSQFAQRPIEKRVTKRVK
                     DKSGHKSIKQTETITVQVPKFYHHFVMNLPDSALTFLDAYIGLYSKTPEIKDEPGFKL
                     PWIHVHCFEKFEPQEEPTDEELHRRIWVKICKLVNYELDMSKMEFHEVRMVSPTKPMF
                     CVSFQLPEEVAFRNV"
     gene            <1043631..>1044755
                     /gene="RRP4"
                     /locus_tag="PVL30_004249"
                     /old_locus_tag="LELG_04529"
                     /db_xref="GeneID:5231609"
     mRNA            <1043631..>1044755
                     /gene="RRP4"
                     /locus_tag="PVL30_004249"
                     /old_locus_tag="LELG_04529"
                     /product="exosome non-catalytic core subunit rrp4"
                     /transcript_id="XM_001524507.2"
                     /db_xref="GeneID:5231609"
     CDS             1043631..1044755
                     /gene="RRP4"
                     /locus_tag="PVL30_004249"
                     /old_locus_tag="LELG_04529"
                     /note="BUSCO:EOG09263IQ5"
                     /codon_start=1
                     /transl_table=12
                     /product="exosome non-catalytic core subunit rrp4"
                     /protein_id="XP_001524557.2"
                     /db_xref="GeneID:5231609"
                     /db_xref="PFAM:PF14382"
                     /db_xref="PFAM:PF15985"
                     /translation="MEVADVISITKPIPRSDLGDVSDFDDFDENEDIEISDVEMDEQQ
                     GQHQRQQQRQQRNLAQNAIVTPGELITEDPMWMKGHGTYFINDKTYSSVVGNISRVNR
                     LLSVNPIRGKYQPETGDHVVGRITEVANKRWKVDIGTKQDAVLMLGSVNLPGGILRRK
                     SESDELQMRNFLKEGDLLNCEVQTIFNNGIASLHTRSLKYEKLRNGIFLKIPSSLVIK
                     SKNHSYDLPGNVSVILGVNGYIWLYKTKASVFSANTSAKNQGSTTVNPNGSKITQGVK
                     DYTPGSGSVSITRLEEESSWEIYSDKNDEISTLIRNNIARYYNVIKALAYGELGITEQ
                     RIIMGYEASLSFANVGSLVDRESMESLCREVLNSEKMRGQ"
     gene            complement(<1046066..>1046836)
                     /locus_tag="PVL30_004250"
                     /old_locus_tag="LELG_04530"
                     /db_xref="GeneID:5231713"
     mRNA            complement(<1046066..>1046836)
                     /locus_tag="PVL30_004250"
                     /old_locus_tag="LELG_04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524508.2"
                     /db_xref="GeneID:5231713"
     CDS             complement(1046066..1046836)
                     /locus_tag="PVL30_004250"
                     /old_locus_tag="LELG_04530"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524558.2"
                     /db_xref="GeneID:5231713"
                     /db_xref="PFAM:PF01105"
                     /translation="MIPPIKNSSKDKKSSLKNLQNCVSYETTKKDIMFVTISNVEQFT
                     SQSLNLLILDDQGNTLRNQQDIGKFNREVELLITNSESLKSIVLEEKREEGKANSNNN
                     VEEIAKDTKMIHVCFDNVYSDLSWSFQPRIFEFEVTVNIKNDIESTDYGMYRQYFTYL
                     QDENSKEGQAEINAMSFEAKMLLVEMDLQTVVDKLLESDETLKLLMENEFKLRDANEE
                     IFSGYTLISIVLCVTILVCGLLQLIYFKFYLRRKNVLR"
     gene            complement(<1048336..>1049514)
                     /gene="MRF1"
                     /locus_tag="PVL30_004251"
                     /old_locus_tag="LELG_04531"
                     /db_xref="GeneID:5231552"
     mRNA            complement(<1048336..>1049514)
                     /gene="MRF1"
                     /locus_tag="PVL30_004251"
                     /old_locus_tag="LELG_04531"
                     /product="Peptide chain release factor 1, mitochondrial"
                     /transcript_id="XM_001524509.1"
                     /db_xref="GeneID:5231552"
     CDS             complement(1048336..1049514)
                     /gene="MRF1"
                     /locus_tag="PVL30_004251"
                     /old_locus_tag="LELG_04531"
                     /codon_start=1
                     /transl_table=12
                     /product="Peptide chain release factor 1, mitochondrial"
                     /protein_id="XP_001524559.2"
                     /db_xref="GeneID:5231552"
                     /db_xref="PFAM:PF00472"
                     /db_xref="PFAM:PF03462"
                     /translation="MFCHQIRRLSCFSRLLQHAESHTTLSGLPQLHPLLVRRAHSLQE
                     EQAQLSSKLDTYDPELQITYDRNSHVLKTYDEFSRILSEIRELSTIRDPDLISEAQEE
                     LQELVPKYTSIIEELNNKLLPPVKYAECGCMIELRPGVGGNEASLFTDDLMQMYLNFA
                     SIQSWPASVISRSTNSSGFVNEIILSINQPGAYDVLRHESGVHRVQRIPETENKGRVH
                     TSTSAVIILPKMSDGNENSLRADEMQFKPGEVRIDTMRAGGKGGQHVNTTDSAVRLVH
                     IPTGIMVMQQDERSQPQNKAKAFAILRARLAEKERVEELNRQRQMRTSQVSSTDRSDK
                     IRTYNYPQNRVTDHRCGFSLHDIAGCMGGNKLNEIIDKVREVEYKERLQEMLENSGAN
                     "
     gene            <1050518..>1050913
                     /locus_tag="PVL30_004252"
                     /old_locus_tag="LELG_04532"
                     /db_xref="GeneID:5231549"
     mRNA            <1050518..>1050913
                     /locus_tag="PVL30_004252"
                     /old_locus_tag="LELG_04532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524510.1"
                     /db_xref="GeneID:5231549"
     CDS             1050518..1050913
                     /locus_tag="PVL30_004252"
                     /old_locus_tag="LELG_04532"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524560.2"
                     /db_xref="GeneID:5231549"
                     /translation="MSTYPILTQEQFKDAIKDISQYELEAKKAQQLAFIFKLIDTNNE
                     LHRELSTDGNDESLSPDDVKLYKETIDENKESLSNQIERIHLINIELVRRGILSESKA
                     SAEEKKLHDDVKKRTEPNESANETEGVVL"
     gene            complement(<1051062..>1052408)
                     /locus_tag="PVL30_004253"
                     /old_locus_tag="LELG_04533"
                     /db_xref="GeneID:5231640"
     mRNA            complement(<1051062..>1052408)
                     /locus_tag="PVL30_004253"
                     /old_locus_tag="LELG_04533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524511.2"
                     /db_xref="GeneID:5231640"
     CDS             complement(1051062..1052408)
                     /locus_tag="PVL30_004253"
                     /old_locus_tag="LELG_04533"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524561.2"
                     /db_xref="GeneID:5231640"
                     /db_xref="PFAM:PF01209"
                     /db_xref="PFAM:PF08241"
                     /db_xref="PFAM:PF08242"
                     /db_xref="PFAM:PF13489"
                     /db_xref="PFAM:PF13649"
                     /db_xref="PFAM:PF13847"
                     /translation="MLSRGLRSQLRVGGTFFAKDISSSRQTFQSLSSRYSSSSSKQTK
                     SSKSWFGRLVETTQSRRFQDKTMPKIYLTAIVVAFVPMYFYMRDRYHEDKQLKVIHAK
                     YAEDPSSLSEYEYLAMKSLSQNSQDKLRPLEAKKYKIYQLMRKEFRRKNLFNGEMFNP
                     SPEELEEWYSKQARFGSKKVKAPVLSKNITDEENQYKINEENSAIVKAEDTTDFYDSK
                     AKEYDDAVKWEERGIFMGGKRRWLMSNIHGDVLEVACGTGRNIPYMSYFLDKVNTYTF
                     LDSAQNMVEIAQEKFTQKFPNFKKVAFTKGKAEDLLQMAGDDDNLKYDTIVEAFGLCC
                     HEDPVKVLQNMSKLLKPGGRIVLLEHGRSKWQFMNNHLDFRSAKRWDTWKCRWNLDIG
                     ELVDAAGLDIVKEKRAHLSTTWMLVLKRPEDPITQDEKPFLDKLFGKKTQPPTIAK"
     gene            <1052804..>1054090
                     /gene="RPN6"
                     /locus_tag="PVL30_004254"
                     /old_locus_tag="LELG_04534"
                     /db_xref="GeneID:5231567"
     mRNA            <1052804..>1054090
                     /gene="RPN6"
                     /locus_tag="PVL30_004254"
                     /old_locus_tag="LELG_04534"
                     /product="26S proteasome regulatory subunit rpn6"
                     /transcript_id="XM_001524512.1"
                     /db_xref="GeneID:5231567"
     CDS             1052804..1054090
                     /gene="RPN6"
                     /locus_tag="PVL30_004254"
                     /old_locus_tag="LELG_04534"
                     /note="BUSCO:EOG092630YS"
                     /codon_start=1
                     /transl_table=12
                     /product="26S proteasome regulatory subunit rpn6"
                     /protein_id="XP_001524562.2"
                     /db_xref="GeneID:5231567"
                     /db_xref="PFAM:PF01399"
                     /db_xref="PFAM:PF18055"
                     /db_xref="PFAM:PF18503"
                     /translation="MSEALLNEARIAVNNKDYEKAVSKYEQIIEEGKKEQNTASTSSK
                     SLQLQEHAILELGKVFKTLDQPSQLAKLITDSRELMGKFAKSKTAKIVKTLIEDFDNL
                     TEALDTQIEVTRQSIDWAVESKLSFLRQSLQLKLSELLYKKHQYHEALTYINSLLTEY
                     KKLDDKSSLVEVQLLESKIYHALRNIAKAKAALTSARTSANSIYCPTLLQAELDCQSG
                     ILNMEDKDYKTAFSYFYESFEGFNSQSSEESLKTSGRVLKYILLSKIMLNLIDDVNSI
                     LKNKNVVQYQSREIDAMKAIAVAYSNRSLKEFEHSLIAYKQELTSDEIVKNHFNSLYD
                     QLLQVNLLKIIDSYECVELDHIAKIVGINVKQVEGKLSQMILDKVFYGVLDQGNGWLI
                     VYDEPKKDKSYEAALELVKNLSGVVDLLYEKASALN"
     gene            complement(<1054165..>1056825)
                     /gene="NUP84"
                     /locus_tag="PVL30_004255"
                     /old_locus_tag="LELG_04535"
                     /db_xref="GeneID:5231757"
     mRNA            complement(<1054165..>1056825)
                     /gene="NUP84"
                     /locus_tag="PVL30_004255"
                     /old_locus_tag="LELG_04535"
                     /product="Nucleoporin nup84"
                     /transcript_id="XM_001524513.1"
                     /db_xref="GeneID:5231757"
     CDS             complement(1054165..1056825)
                     /gene="NUP84"
                     /locus_tag="PVL30_004255"
                     /old_locus_tag="LELG_04535"
                     /codon_start=1
                     /transl_table=12
                     /product="Nucleoporin nup84"
                     /protein_id="XP_001524563.2"
                     /db_xref="GeneID:5231757"
                     /db_xref="PFAM:PF04121"
                     /translation="MESLVPYNETVSTEVQFAKALEKYKFDLLHAKSNFHDQDQEQNT
                     ADVNNQHLQTQAQSSSPFDIVQKFADIAAANAYSVLPDQSSSNIDDDVYDQDFTNWDL
                     EMKFWRLVENLNYYRVFCYENEVFGKEKEIGELYAILDWLQYHSAGEREHDQILKDQL
                     GNEDENGNGDEEEKLSGTRSKWINTRLSIENGVYDALSGKNSNDQLIQEMDVDAPLRS
                     GMHVDAKDAELDSKNFQAIYKLVVLGEYTDAIEFANETGNHALAVILAGAISFVEDDD
                     QVMELANEVEGEGNIKLSASTRDKTIWVRLVYKLSKNTNLDPNERLIYSYLSGGDISE
                     NLKRASDSYEESINILVRQLLTYSELQKMHSNSFVEFTPPAPQANSMKDILNIVSNSL
                     GSRAAEESRHPVRILMAAIMLDDLDPIISDLNDSTNDNILRILVHASLFLALLRSPQN
                     PEQLNALITLYISKLTENNQTELVPLYLSFIPDERDARETYSLILASITDKEQRRKQL
                     EIAKGISQSHQQSPLPLLQSQPSSHSNEDTEMVPIDDVEQDKLVNVLRRTVERVMDET
                     EEYYNPGNEPFAIVDSGSNNDENDSSAAIDQVDLKLSSAVEWFYENKMYKDAISATII
                     VIRRFLLNGKLQSLKSFAKGKNFKQLINEYNLQNFSNDSGVEYNGSAALPYSFSSSST
                     TTTKFVPEHEIISEDQKLELMDYQNFVKGLNLISEWKEFNGNPYTGPNVGASLDKTGH
                     VLNNLLDTWLVDLVNKSSNSKKRKKNNNNNSGNGNGGRNETKKEDGNEEDDYGDDDDD
                     DKLILKQFRSIYVPYIIMELVSIYQNARSLDWKYITLALKLIHSVAEEESNDLLQCFK
                     ESGRLNEFLTKIAELSTIACERGVKGLYCL"
     gene            complement(<1057573..>1059153)
                     /locus_tag="PVL30_004256"
                     /old_locus_tag="LELG_04536"
                     /db_xref="GeneID:5231463"
     mRNA            complement(<1057573..>1059153)
                     /locus_tag="PVL30_004256"
                     /old_locus_tag="LELG_04536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524514.2"
                     /db_xref="GeneID:5231463"
     CDS             complement(1057573..1059153)
                     /locus_tag="PVL30_004256"
                     /old_locus_tag="LELG_04536"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524564.2"
                     /db_xref="GeneID:5231463"
                     /translation="MSIGLGMHNIDVQKKVRFENGVTKDFHSPKVELNFERSKKCKET
                     IREQLEEIKRSKTPSELNFKEKYVQLGGHFKRSNELDGETSSLLDERESIDREDLKVL
                     HSRRSLQQRSATLGDKITSQTENLQIQALKEQIKALNDKLQVIEEQREAEKQDMAEDF
                     KQKLKKTFDTYTSTIQRLEAEKRKDARKIDRQQKRIAYLESKQLKEKEGDKIKNLVIT
                     RLSNEKQASLNEIEALLEKTEMLQNKNKVLLSENETLFNERNQMKEELEAIQKSMIHI
                     QKQNHELRIKQDKFSVCSKLQSKNENEKLAEPTEPESKSSEYKKLEPVLSKGKDSILD
                     KGIKGDVEERLIADNGNDNDGNDSDDKNKNNKNNNNMDNTNKKIIGDADGLTESVDEN
                     IDSIASFDSHRTCSLGKVENAAHVSRDGELANEPEHENGIENTPQLLREAFNYNPHRL
                     NPYDATFDLPKTPENRDTLNLLRQQYDTHIYQGIGSHKARENNNDWSSPGLTTKELLK
                     ENNFLQMDASTLKQMHFV"
     gene            <1059783..>1061510
                     /gene="NUR1"
                     /locus_tag="PVL30_004257"
                     /old_locus_tag="LELG_04538"
                     /db_xref="GeneID:5231634"
     mRNA            <1059783..>1061510
                     /gene="NUR1"
                     /locus_tag="PVL30_004257"
                     /old_locus_tag="LELG_04538"
                     /product="Nuclear rim protein 1"
                     /transcript_id="XM_001524516.2"
                     /db_xref="GeneID:5231634"
     CDS             1059783..1061510
                     /gene="NUR1"
                     /locus_tag="PVL30_004257"
                     /old_locus_tag="LELG_04538"
                     /codon_start=1
                     /transl_table=12
                     /product="Nuclear rim protein 1"
                     /protein_id="XP_001524566.2"
                     /db_xref="GeneID:5231634"
                     /db_xref="PFAM:PF10332"
                     /translation="MAPKRLVRRQSLISKVKSFPFDTYLYLNEIRLSIDWDDHAPTIA
                     LPFGIFTSILSLIIQTILCYYASISSRSKNVLFNSDYYQYENIKKLLLSGATESPEAT
                     RAEEISIDIQKNTFANNKTNALIWALNILQYLIIGISIVNAIYILRSKKKYQLLYHRD
                     KPHYKSATHPASNESFIYMVIYFISSIFSSNKEGEEDDEDTGLNSENDCTSQLNDKEY
                     WELHVWNPSKFCLYIYVGLNPINAFLVYTLTSKGSTLNAITSLALISVFNYLFISKFL
                     NLVQDKQIVYQEMFSEYNNKFVKPKVNILKKDASIDATMGPMRSNVQVNKKPFSFVKS
                     RVFTTHDPKGKVVTEYTNMNQEEPDGQYRASSSPYTVKKSVSRPSVYLPNSRPTYVPS
                     SRSQSRRSSVYSQQYSMALPLSFPHDLQYNSSTPYRSLNNYRNTYNDYQPVPGYGYDQ
                     QYDQQYDQQYDLHNSLPHPHLEMPADAELHSRSPSPTHSNRSRFYARQSPQRFTPVRP
                     DLSHGGRRSSIDQYDHANTVVHHNLNHTTSQQRSPSPHKNTIFYRSPSPSKPSNNMND
                     GHNSYPEWR"
     gene            complement(<1061711..>1063270)
                     /locus_tag="PVL30_004258"
                     /old_locus_tag="LELG_04539"
                     /db_xref="GeneID:5231473"
     mRNA            complement(<1061711..>1063270)
                     /locus_tag="PVL30_004258"
                     /old_locus_tag="LELG_04539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524517.2"
                     /db_xref="GeneID:5231473"
     CDS             complement(1061711..1063270)
                     /locus_tag="PVL30_004258"
                     /old_locus_tag="LELG_04539"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524567.2"
                     /db_xref="GeneID:5231473"
                     /db_xref="PFAM:PF05172"
                     /translation="MSTLFNRQPSNQFFTNSSTFGFGNQQQQQQPSQFAQQQVPQQPQ
                     QQQQQLLQQQQQQQQQQLLQQQQQNNQPQLIGSQNPQEQPTWLQSQHNHKKRIIPNHL
                     IPHKKTAFHINAPNSNKSGNKKSQNANSSVLVSNEQFNIVSFGSNNKHNSLGHGSLLD
                     RNNTSLSALFDSVGGDLSRFDETLNDSFHQSQDDDGGANSGASTIAGSGIVTDLPPLR
                     SIYDLNEERFSSKPERDTLSNVANKAPQEFKNLFNRNNNFVDNSKKKNNNNNKDFDQT
                     DEKNTPVDFDNDTETSIIVFGYPENSVSQIIQFFKQFGTILEQFTDFSLEGRDGAKSL
                     LTIEKQRRNVPIFTGPGWIKITYDNTNSALNALQENGSIFSGNLLGVVPFHKSVIEKL
                     EKNKAFLNEDIGNGNLSTPLQQIYNEKQKNGADSVRATGIITPPASSAFSNSSSSSSS
                     SSSETRFASSSSSSASGMNKSSYVDVKEGSRFFINPDEKKSNKKDGDANKPKLGLVGS
                     ISKYLFGFHDL"
     gene            <1063909..>1064787
                     /gene="RRP42"
                     /locus_tag="PVL30_004259"
                     /old_locus_tag="LELG_04540"
                     /db_xref="GeneID:5231694"
     mRNA            <1063909..>1064787
                     /gene="RRP42"
                     /locus_tag="PVL30_004259"
                     /old_locus_tag="LELG_04540"
                     /product="Exosome complex component rrp42"
                     /transcript_id="XM_001524518.2"
                     /db_xref="GeneID:5231694"
     CDS             1063909..1064787
                     /gene="RRP42"
                     /locus_tag="PVL30_004259"
                     /old_locus_tag="LELG_04540"
                     /codon_start=1
                     /transl_table=12
                     /product="Exosome complex component rrp42"
                     /protein_id="XP_001524568.2"
                     /db_xref="GeneID:5231694"
                     /db_xref="PFAM:PF01138"
                     /db_xref="PFAM:PF03725"
                     /translation="MILSPAEKQYLYDSLSHPQLIRPDSRSTHQYRPLEATTSFLPGS
                     NGSARIRLSDGSECIVSVKSKVVTYDARINHNAVELDIDIVGYRDDSNYVANLRYQLS
                     NLLQQNFPHDVLKLTSRYAFKLFIDCIVISHTSYPLSLISFATYLALKSTKLPLLISD
                     VNDEEVAELPTFSDDWDNATSLSQILQEKQIASADFQPPVLVTIGVVGNNLIFDPSLE
                     EEQVLENSLIVGFYNGKVITPILNANFSSNNYKGFDKSLMIRALTLSNKFCPYIIKAL
                     DTLVEQESYETEGSIF"
     gene            complement(<1064973..>1069232)
                     /locus_tag="PVL30_004260"
                     /old_locus_tag="LELG_04541"
                     /db_xref="GeneID:5231709"
     mRNA            complement(<1064973..>1069232)
                     /locus_tag="PVL30_004260"
                     /old_locus_tag="LELG_04541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524519.2"
                     /db_xref="GeneID:5231709"
     CDS             complement(1064973..1069232)
                     /locus_tag="PVL30_004260"
                     /old_locus_tag="LELG_04541"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524569.2"
                     /db_xref="GeneID:5231709"
                     /db_xref="PFAM:PF00588"
                     /translation="MDTLALIGRFLDDDKQNELLEKYASRLEESNENVDNLADLLTII
                     KIKDDHHVITTIQSFINRHILDKSYNAAIAKLVQTVPTLQSSIFDHVTSLITSFISRN
                     KNFFNPSFYQLFSFTKPTTEKEEIAEEELLAILDLVDLICQTNSSETTTLASNTCPKS
                     TQLDTLLLILLGIDDQTIAETASKIFKWRITALSADDSKFDITWKVVFALQSSSSKIF
                     HTQQAYILWLRYLNNSASNIASNKQFAELIQNDYYWSAIQIGLTSNSHEHRKYSLSIL
                     TMSIKSINLDFENKFVKWDTKEQDLYLNEWARYITLYEIIAVDTSLHQAEAGINDMTA
                     LISSNSRIFSSWGWALLSTGFKATIDSVRKFTMRLLLSIPLENLYLIKSALPILEKDI
                     LPNLMTASHLHVKTIDGVVNCAYVEKLQSFIMHMFQNLKDPNDVQNVAKSVLKVLVDL
                     KDGFAPSRILVLQGMLQGLGENRKLLQYGGVHDTLLLELFDKTAEDEFHESYCQALNL
                     RLLLHFEPNSKKFFELLAKFVKYNGYATLRRDWSLVSDYVTELQNDGCGVIDITDIDQ
                     QVLQICFSRNNNVLNTTNDLLQAKLLEAGYLQMSCENLANLPLSDNIEVIEALDRIEF
                     KSGIDISSSIMTQLWRKIEMELQSADIEVLKDSVAKFKLFNKLFANSNYVFENPLEVF
                     NFKNELLLNEKEASKRDRFFYKLKDAIEGEYLTCLSTSYCKQPIDFQNLLGIFSSSIL
                     SLDGRCSMIKAIINYLQSNPEPALVSDIVAFLIEVWSQLASQRLNLIDRKLHLLVIEA
                     MLHERIVYETREEKERDFDDEDDNNDNDNDNDNDNDNGNYNDYGQDLRNFCISVLENS
                     KTRRTLLPALASCLSKLHISNTNKFESLDWMPEVLVKMYLVYQPKNAHFNLVNVLAEK
                     FDKEIAVNKESSDIYKRVFGVHEISARIDTIVLFNSINNKDFAQKIYAFIIENEKEFH
                     LFNALKRTDAYEEWNRIQLYSIILSIVDQIDIDFNLFITRVATDPSPLVRSYIEWIIA
                     YKMLQNPTLSDEMFNELTENYKDIKPTVCLSYKRILFLMIAQLERDTEVDYLSKYINV
                     IIAGATAQKRLIRHFSLSMIISIWNEIERKDLSSMSSSEQKSLDPRLKQLVYTLYQTA
                     VNSEIFTSYRSGDDLIWDIKRDLNLTYIAGGNLLRLTDRDDMDFITKEQFEQYLSTDQ
                     KEILRRPIGETQDINKLRETYKRHIITPEQVVEQASPLQTKSGAWNSVMNIDNPRSAK
                     DLSRSDLIVVASLVDKPPNLGGICRLSDVLGVGLLTIHDMEVAKHPQFKNVAVTADQW
                     MPMHEVKPEEIKNYLLEKKRDGYTLIGLEQTDKSVQLNKNLEFAKKSLILLGKEKEGI
                     PGELLAELDFCVEIKQVGIIRSMNIQTAAAIIVHAYSSQHC"
     gene            <1070600..>1071850
                     /locus_tag="PVL30_004261"
                     /old_locus_tag="LELG_04543"
                     /db_xref="GeneID:5231641"
     mRNA            <1070600..>1071850
                     /locus_tag="PVL30_004261"
                     /old_locus_tag="LELG_04543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524521.2"
                     /db_xref="GeneID:5231641"
     CDS             1070600..1071850
                     /locus_tag="PVL30_004261"
                     /old_locus_tag="LELG_04543"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524571.2"
                     /db_xref="GeneID:5231641"
                     /db_xref="PFAM:PF11927"
                     /translation="MNSTLASTVQNALNKPFDPTLVTVVAFIFASFYLYTKSKVSSIG
                     KNANKTISEAKPAKSSFYNKHNSTQLQITPLTEFKWNEDNEPLKSMPFKNAPYKLTMG
                     IRSLEAQDWLLIEPTYLSRLEHKRRILNNCHPAYPKTRDLRSSTLFASEEAREAVVEF
                     YDIVMDYCLRKYPTCFATTTDSESEYHNQTLIHNLITNKKYPLKGNGIEPKVLEEYLS
                     QNIEEDFIILLKDPLRAHEEYGEEYWFKAGVFGFAAGFDPKERFNKPLTSIHQLIPGY
                     TTKLKTSMNRFFDRLSPGQFVTRSNWSMQTHKNFYVDDQNKGHNLPNGHEQKAIPYES
                     LNFDDVRYRSERQVLTKLPKSGAVVFTIRTYLIPIEEIRNEGPEVCERLIGAIKGFPD
                     DIKQYKAAGEWGPAIIQYLSKKLD"
     gene            complement(<1072068..>1074803)
                     /gene="ATG20"
                     /locus_tag="PVL30_004262"
                     /old_locus_tag="LELG_04544"
                     /db_xref="GeneID:5231697"
     mRNA            complement(<1072068..>1074803)
                     /gene="ATG20"
                     /locus_tag="PVL30_004262"
                     /old_locus_tag="LELG_04544"
                     /product="Sorting nexin, cytoplasm-to-vacuole targeting
                     pathway/endosomal sorting"
                     /transcript_id="XM_001524522.2"
                     /db_xref="GeneID:5231697"
     CDS             complement(1072068..1074803)
                     /gene="ATG20"
                     /locus_tag="PVL30_004262"
                     /old_locus_tag="LELG_04544"
                     /codon_start=1
                     /transl_table=12
                     /product="Sorting nexin, cytoplasm-to-vacuole targeting
                     pathway/endosomal sorting"
                     /protein_id="XP_001524572.2"
                     /db_xref="GeneID:5231697"
                     /translation="MPKQSANSKKHSKTKSDKLSNNNNNSSSSSSGNSSSNNSNNTIS
                     NCEATYSDQQVIQQPHSTLVDDNEEDNNPFSYHEGVTSFVQQSQLHSKNKDTQFATSL
                     VNDNTDFEDESMLLYKTEKKSSNINNSTSQQSQQSQQSQQMQKPSLPHLQSKSESFNT
                     VHMNFESRVTRMLKPQVQVRINITEAGNSNEGMANSSKKYIVYTIRLADLNSINNEII
                     TRRRYSDFESLREILTKIFPLIIIPPIPPKNYFDFSVFNLVGGQNTGTTSTGFTNGNI
                     GANINMNLNANGSGSGSGIGGGSGSTDGSKTTQGSNYPHTQYQHHNHNHDTSSLTGAT
                     PHAASQQPQHTHTSSSSLSPIAIPNNQITSSTYSYINSSHLNKTKLIEHRKRLLTNFL
                     NNCLEIPQIRSLEFFAKFLDPNANWSDEITLIQNQLPKSKYLLNPENGLKTDAIYRNL
                     PNPSTKKTMNFFKDNKRKFTKKTNQLISNSVAATLPDLSKDTDLPQQQQQKQQQQQQH
                     EEAESLDPESLQKQHQNSFIINTSGLDDINKRIMANFMGLSNDYADLGSQLNSFSLMF
                     SETIHSRHEGNDNYNNSRKSHNIKNNNGNNNDDDNGNGGVGGVGGKGLNSSSKNDNSN
                     GGTGAGAGAGADNDDLGSNDNDDDLNYILDKVGQAFDRSYITINSMIGELETQFSEPL
                     GEAVQYTEMLHHVTKYQSKKLKQKQMLESELKSKRKELDDLLKIEGDAGNSNILTHNE
                     DRNGGGKSPEFALPKEQGKNGADANGSSVNSVSRATNNKNDDNENVNANVNVNTNGSK
                     NSTATSSSRFKLPSLKKLTQYVSEIIDQNPQQTRKTKIYELSDKIHIFERCQEIMLAD
                     LSYIFDEVDKNLRAFHARQLRTIYGILVYYNRVMIYWARKNTEIWEEIKDEIKRF"
     gene            <1079311..>1081686
                     /gene="PTP2"
                     /locus_tag="PVL30_004263"
                     /old_locus_tag="LELG_04545"
                     /db_xref="GeneID:5231443"
     mRNA            <1079311..>1081686
                     /gene="PTP2"
                     /locus_tag="PVL30_004263"
                     /old_locus_tag="LELG_04545"
                     /product="tyrosine-protein phosphatase 2"
                     /transcript_id="XM_001524523.2"
                     /db_xref="GeneID:5231443"
     CDS             1079311..1081686
                     /gene="PTP2"
                     /locus_tag="PVL30_004263"
                     /old_locus_tag="LELG_04545"
                     /codon_start=1
                     /transl_table=12
                     /product="tyrosine-protein phosphatase 2"
                     /protein_id="XP_001524573.2"
                     /db_xref="GeneID:5231443"
                     /db_xref="PFAM:PF00102"
                     /translation="MSSSNSSHEPQQFDFNPPSSQPQQPQQQQQQKPQEQKNVNSFQR
                     PPSITTTAAPPSMHFNSPPKSPLYNSGSISGSFPGAFSGSFSGAIKTPSPTTPTFATS
                     FPQTIKQQDPITLSNNMYDFIFDVRPFNLYSKSRIQQASNLSVPTTLLKRSSFSLGDL
                     LNMVSLDSVLKDRLTTQLNNDSSSSSSGNNSNTNDKKLTLLFYDQATTKDAITFPLYQ
                     TISKFEKFSDKFDIYYLNGGFSKALSGNPQIVENTPSVFMTSGSGGLNNSSNNNNNQN
                     QNQNQNQNGADNNHRKAKSLSGFTLPSATNFKSKFVQSIKKNNDYSRANTLGNGRVAP
                     TKDSIKSYKYKLAHVPQDLTLPNWLTFMKTQSNEEIIKQLDEKFDKVEEIEKNRLNQM
                     CSDFKKPLSSESGSNDDATASSSENVLSPCCSTCSEIEFRLPRGIEFGYKNRYNNIWP
                     YEHSRVKLSLAEQQQQQQQQQQQQQQQLHNHNHVQAGDDYFNGNYISTNPIVENKQIY
                     IATQNPLASTIDDFWSLINSEHIQIIINLDAKPVSYFNHPSIKNIECIKTNSPDFKLR
                     RINNNIYHFHYLSWPDFGVPQSFKSIIELVKFKDELIKSQNLSQKIIVHCSAGCGRTG
                     VFITIDALIQGFLADAEKIMSTQVDLVYKLVQHQRRQRISMVQTLDQFIVCYEVFIKY
                     LELVKTRAEVEAKMAGNADAVDAFDFKVENEGHNDHSTQSMQMANILEFINNNVEEFT
                     QRSSTNAHTPRDVSEGFNFGNGGVPTPAPSAVGERGDYFQFQSNSLPVSSR"
     gene            complement(<1082014..>1083765)
                     /gene="RAM1"
                     /locus_tag="PVL30_004264"
                     /old_locus_tag="LELG_04546"
                     /db_xref="GeneID:5231350"
     mRNA            complement(<1082014..>1083765)
                     /gene="RAM1"
                     /locus_tag="PVL30_004264"
                     /old_locus_tag="LELG_04546"
                     /product="CAAX farnesyltransferase (FTase) subunit beta"
                     /transcript_id="XM_001524524.1"
                     /db_xref="GeneID:5231350"
     CDS             complement(1082014..1083765)
                     /gene="RAM1"
                     /locus_tag="PVL30_004264"
                     /old_locus_tag="LELG_04546"
                     /codon_start=1
                     /transl_table=12
                     /product="CAAX farnesyltransferase (FTase) subunit beta"
                     /protein_id="XP_001524574.2"
                     /db_xref="GeneID:5231350"
                     /db_xref="PFAM:PF00432"
                     /translation="MALQSKEQERKEQKKKEKGAKEKEEAKINYILRLLGRKRKPIEE
                     VIHHEHEEQQSLNSVQEEPITATGDQDYENLTEEIATAHNPLLSGVSSQPTEFITSSY
                     WQMSTETNNLPIKVNYTSLTTESQRLTSKEILKTYNETSDLAFYTLDHLAYIIDHLNE
                     PMPGAYKSLDSNHSWMTYWLLNAYSLIKRSGASEANEKEDKSEPETNKTSKAQQNDDT
                     QFTITPTMLELINDKIERLILANGYGGVAGGINQLGHAASTYSAILTLVLTQNYTLLN
                     KLRPGIYSWLLSLKRKHFIAPDKSASSFVMHEHGESDTRSTYCVLVIASLLGILTPEL
                     CAGVEDWILQCQTYQGGFAGVPGVEAHGGLTYCALGALFLLNSSPEKIREKMDQGQSG
                     VGVGKGFDKLVKWCVDRQTDEGGFNGRSNKLVDACYGFWIGALFPMLDILRTSKSSSK
                     LYSSLHKESTIFNREAMLNYMLRIAQITDGDGGFRDKPGKWPDFYHTNYSLCGVSLCQ
                     HQYYYDCYKDVNCDEKKPSNFCNNERDTPLAFKIKTKPVDGSGKSTYPVHPVFGVPVS
                     YINAACMYVEQGLGSVL"
     gene            <1084363..>1085886
                     /gene="ucp10"
                     /locus_tag="PVL30_004265"
                     /old_locus_tag="LELG_04547"
                     /db_xref="GeneID:5231479"
     mRNA            <1084363..>1085886
                     /gene="ucp10"
                     /locus_tag="PVL30_004265"
                     /old_locus_tag="LELG_04547"
                     /product="UBX domain-containing protein 10"
                     /transcript_id="XM_001524525.1"
                     /db_xref="GeneID:5231479"
     CDS             1084363..1085886
                     /gene="ucp10"
                     /locus_tag="PVL30_004265"
                     /old_locus_tag="LELG_04547"
                     /note="BUSCO:EOG09262E4T"
                     /codon_start=1
                     /transl_table=12
                     /product="UBX domain-containing protein 10"
                     /protein_id="XP_001524575.2"
                     /db_xref="GeneID:5231479"
                     /db_xref="PFAM:PF00789"
                     /translation="MSLNTRIRDYFRNSSYHRLGTNESGSSSSGGVDDGSNSTTATTA
                     TNNGIIHNNSNNNNSRSNNRNNNLPGAFPEEEVLPQPSRTAINSHTIRNSANRVNLWF
                     SYIIIQPIILIMLIVFSVLAKITNLLYINPSNSKARDDLVEEPVDKANKFVRNLEDNL
                     PPSLDQGVNLPPFFQGSYTQALYMATQRGKFLFVYLSNPNNENSSFIFDEIIINPKFT
                     KIFTNSQLNNEVIIWGGDLTNPEAYQLANSLNVTKFPFLGLLCLTRSTKMTPEGPQKE
                     PAKMSLIGKIQGGNPLYVPPSPSPSPSQPPSSSPVSRSQTHIGSNLIKNKFISKINKY
                     EPELKLIRQELKDKYMTEVLKRQQEYNYLQSVHKDMQKKAEKQQQAKTKAYLEYKASE
                     FLNLNLESQAPNTAKIAIKFPDSTRKTFYFPQNMKIDDIYIYVELYKRNMLQGKSRMS
                     KITPAEAETMFENFQVKFNFKLSSPLPPRMDLSNMRNEFIQNVDLVYPNGLLIVEDD"
     gene            complement(<1086062..>1086499)
                     /locus_tag="PVL30_004266"
                     /db_xref="GeneID:85890399"
     mRNA            complement(<1086062..>1086499)
                     /locus_tag="PVL30_004266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119533.1"
                     /db_xref="GeneID:85890399"
     CDS             complement(1086062..1086499)
                     /locus_tag="PVL30_004266"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975516.1"
                     /db_xref="GeneID:85890399"
                     /db_xref="PFAM:PF02290"
                     /translation="MTRLDNSQFLKQLNDLVVKNQGKSSIYLTQKRLSTPDFTTTTTA
                     SKSSNTHDYKVPNDLPTNVIESNSREEIPHNDETYPILIRIAMNSADNKKLKKEKVKL
                     STVVEIAQLNQFWTEYIQVIKNGFVGLKKKEKKNKSKKNKVSK"
     gene            <1087338..>1089134
                     /locus_tag="PVL30_004267"
                     /old_locus_tag="LELG_04548"
                     /db_xref="GeneID:5231626"
     mRNA            <1087338..>1089134
                     /locus_tag="PVL30_004267"
                     /old_locus_tag="LELG_04548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524526.2"
                     /db_xref="GeneID:5231626"
     CDS             1087338..1089134
                     /locus_tag="PVL30_004267"
                     /old_locus_tag="LELG_04548"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524576.2"
                     /db_xref="GeneID:5231626"
                     /db_xref="PFAM:PF06813"
                     /db_xref="PFAM:PF07690"
                     /translation="MPEESPQHRNAGVSPYSMPGRLFKLFGVKEHHHHIASAHLPLRL
                     LALFVSIFVALASGTPYLYGVYSPQLIKRIGLTTSDSATISLASNMGSSIGGLPGGLL
                     IDHYGPQLSIFIGSICIFLGYFVLFKIYQHQYAHLLVICVAMIFVGFGSITSYFATLK
                     ASQANFPKNKGVAGAIPVSCYGFAATVFSIISAAFFNDNAGELLEFLACFCGAVNFFG
                     SFFVHVYHADEEDGGGDIEDQEIFNPSSSQSQYSRDRHGSNYLPEDEISLLTEIEPPA
                     QSVSKAESLKGSFSFWGIGDRTPRASMSLQESEANSIVGDLRGGNATNGNNNSDNNKN
                     TNNTNAITNSGNAEEVTVAKVKARLQTPYQTIKERLTDKVFLTHYLIVSVASGIGQMY
                     IYSVGFVVIAQYYYNKKHGIDMSSRNVASTLAHDPEAASIQAIQVSIISIASFVGRLL
                     SGFISDYIYKQWHIQRLWIVAFTLILLASGQFIAIQNVSSFHLTSVVSAIIGGSYGLI
                     FGTYPAVIADSFGTKTFSTNWGLICTGPLLILFVLNKYFGWIYDLNTDKETGICYLGN
                     KCYMGAFEASLVLCGVCFVVVVALMFTQRKRN"
     gene            complement(<1091306..>1092262)
                     /locus_tag="PVL30_004268"
                     /db_xref="GeneID:85890400"
     mRNA            complement(join(<1091306..1091382,1091914..>1092262))
                     /locus_tag="PVL30_004268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119534.1"
                     /db_xref="GeneID:85890400"
     CDS             complement(join(1091306..1091382,1091914..1092262))
                     /locus_tag="PVL30_004268"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975517.1"
                     /db_xref="GeneID:85890400"
                     /translation="MQLMTIISSAATCLTVIAQADATYAYQKRVDEAPKTVGPPGLTS
                     GFDPVSAVHPLTRSGAESLTMPSAETFTSDAHKSTSSISHKQSSHSAKAGSAAVVQHQ
                     EPFTAMAFSIFIIYMGEPVCEARSDFAVVVGGVTNLWML"
     gene            <1093924..>1094430
                     /locus_tag="PVL30_004269"
                     /old_locus_tag="LELG_04549"
                     /db_xref="GeneID:5231759"
     mRNA            <1093924..>1094430
                     /locus_tag="PVL30_004269"
                     /old_locus_tag="LELG_04549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524527.2"
                     /db_xref="GeneID:5231759"
     CDS             1093924..1094430
                     /locus_tag="PVL30_004269"
                     /old_locus_tag="LELG_04549"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524577.2"
                     /db_xref="GeneID:5231759"
                     /translation="MSSSSSSSSSPPQAIPMNKVNNAQSYNTQPSTTEKENTQQPRHS
                     LSDETITNEPKRGEQMIPIKQEQHQQMQQKPEPRRSNASDSSHSHSQSHSHSSSSSAS
                     RTSEDTDESDLSLYSGYDREGNECTEFCIELFTCFGVVDCYPKSGAGCLTTTATFVGN
                     LVFGCCKC"
     gene            1095744..1095852
                     /locus_tag="PVL30_004270"
                     /old_locus_tag="LELG_06090"
                     /db_xref="GeneID:5231456"
     tRNA            1095744..1095852
                     /locus_tag="PVL30_004270"
                     /old_locus_tag="LELG_06090"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:5231456"
     gene            <1096086..>1096586
                     /locus_tag="PVL30_004271"
                     /old_locus_tag="LELG_04550"
                     /db_xref="GeneID:5231465"
     mRNA            <1096086..>1096586
                     /locus_tag="PVL30_004271"
                     /old_locus_tag="LELG_04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524528.2"
                     /db_xref="GeneID:5231465"
     CDS             1096086..1096586
                     /locus_tag="PVL30_004271"
                     /old_locus_tag="LELG_04550"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524578.2"
                     /db_xref="GeneID:5231465"
                     /db_xref="PFAM:PF10262"
                     /translation="MESTSPFKEIVKTPRLIIQYCTKCKWTNRAIWYTQEVLQTFTNP
                     QDIAEISLQPEIEKPGTFAIYLQVGEYVEVVYRRKFKKVENRGDNVEDPDEYDGFPDA
                     KFLKSLIKEKLSKLKAKAENGEKVLSSVQLGDHLSSGKGNLLNDGGREETQVECRDCI
                     AEEGGL"
     gene            complement(<1096990..>1100307)
                     /locus_tag="PVL30_004272"
                     /old_locus_tag="LELG_04551"
                     /db_xref="GeneID:5231334"
     mRNA            complement(<1096990..>1100307)
                     /locus_tag="PVL30_004272"
                     /old_locus_tag="LELG_04551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524529.2"
                     /db_xref="GeneID:5231334"
     CDS             complement(1096990..1100307)
                     /locus_tag="PVL30_004272"
                     /old_locus_tag="LELG_04551"
                     /note="MEROPS:MER0002882"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524579.2"
                     /db_xref="GeneID:5231334"
                     /db_xref="PFAM:PF00443"
                     /db_xref="PFAM:PF13423"
                     /translation="MGVSTESEYHHSRPVGRVPPLPDAPEHRQQIANWSPYTHPRSSR
                     SSSSLSSQSASTPGKATHRTDHGLLRKSPDVGDLNAQLVTATGHASHGQHSSHSNHTI
                     ATPSLHSNSKLNPNYHRNALSTSPVRQSVGDGHLQNGQLRQRAYSSSPPRTNPSHVSS
                     QGSSQGTSHASTSMQQTTSVNSQLSSDDVKIYYTRLINYEFRNLQLDTDLQTKSLFDL
                     IDYCELLYERSDTQLRNSTHTEQLSGIKTYIKGYLIFNYFINSFIMLHYQGFDEFIKN
                     SEQDFIIYLNIYAFYNTDIYFQNGQYSVDAIDLRRYIKLYLVDKNLLSFNIEELYEWL
                     NEYIRYLQEMEQRSQMEQDGDSGSEYSEEEQASIQDQESMDGYDELSFDNSAYPPSSI
                     TDHPNHHTHNHNNHHHQQQQQQQHRHQQNSHSRGSSIASLDGFKLRYPSVKLNQVPAT
                     EHQSAIESKAAKKLPPPPPPLPSSQPPIPIHSMPPISLVPPIPNPLPELPSSRNVSAS
                     PQNTHITPYPKQPILNLDVDNYTLPTNDIPKKNDKSHKNIPHLTNQKAASVAVPNASN
                     HYIKEKKHTTQPDGYHRAKHSQSVPLDNNYVNGYSSQVYGAIPPQGHQPTYQGPSYVN
                     YGQAPYYPQQVPQQYGMVHHSTQQLNYPPPQSYPASQPFAYSPHNNLIPTHVLLQQEQ
                     IKSQKVSILRDYSICGLKNFGSSCYINSTIQLLFGIYPFKIIFNRGFQRFVKDPKYID
                     IMKKINSHSKDSALLSEAVAGLLRTFQQNGGASVAPTKFIRVTSLLKPGLNIPHEQQD
                     AQEFLLFVLERLHDELSDKAVEDFDPDKLFAKWGITVNPENKSSYTKWYKSLHAHEGS
                     SPISDLFQGHLQNKLKCNKCSYESITYSPFSILSLPIPNTRHNNEVVDLSSCLKYYIQ
                     DETLSGDNAWRCPKCHGEVPTVENHPVFVKKKGLFKLGKSKQKQQPAGENAAATTTVS
                     TKSLNFVKLPTILFIHLSRFSMYNLTDKLDTPIRYPLQLRFNNHGHEIVYKISGVINH
                     FGNLKSGHYTALINKSTVNETNYDLENLVHPYWCYFDDENVKSNVSNGNIRGGPGYDD
                     VVSKDVYVLCYERVKTV"
     gene            complement(<1101180..>1102769)
                     /locus_tag="PVL30_004273"
                     /old_locus_tag="LELG_04552"
                     /db_xref="GeneID:5231365"
     mRNA            complement(<1101180..>1102769)
                     /locus_tag="PVL30_004273"
                     /old_locus_tag="LELG_04552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524530.2"
                     /db_xref="GeneID:5231365"
     CDS             complement(1101180..1102769)
                     /locus_tag="PVL30_004273"
                     /old_locus_tag="LELG_04552"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524580.2"
                     /db_xref="GeneID:5231365"
                     /translation="MHSPLKARRRRFILIISLAITLGFLFLLNLLQLSRSHDASSSIQ
                     KLSERLKELGLDSTPWSMPDSIENNQEEEEEEEDQGKDGLIGNRVKQDYSKGPKNQHQ
                     QKLTQKELEVLNSNLNSNSNLDLEAKKNPHKYLGGTRKMDTEEKLKYQSGKQSTLLGV
                     PQKDQDFEPVTIPKPVYKTDVSTNFNLNPIKPLRFRIYSHNIKNGGNRPLTPGESSWN
                     DRVHDLAMSMKFHITANTIITLQESYKYQVLDIMNYLNLDGDAGVAGGSNSDGDVPTW
                     DFYGVGRIDGAEYGEFAPIIYNTKEWELVYSDTIWLNEIDTRISYEGWDALYPRICSY
                     ITLRHRESQNVINVFNTHFDHIGKLARKGSAKLIMDTVQDLQKQQCKNIQGNHWPAFI
                     MGDLNAEPKEESIKILKDGFVDSVTLATSNNKYGHTKSTVTGFEGEVLLNGGQNIDYI
                     FAPKYAQSIGDVKDKVENKAKSNKEKKDKCDELKKSNAFAERADLTLLSYGMLHSRFN
                     GRYMSDHRPLVADYYISNKCL"
     gene            complement(<1103541..>1103801)
                     /locus_tag="PVL30_004274"
                     /db_xref="GeneID:85890401"
     mRNA            complement(<1103541..>1103801)
                     /locus_tag="PVL30_004274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119535.1"
                     /db_xref="GeneID:85890401"
     CDS             complement(1103541..1103801)
                     /locus_tag="PVL30_004274"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975518.1"
                     /db_xref="GeneID:85890401"
                     /translation="MVCRCTICAEWLHSIQQAEQHVSIEHGIEEGSQKKFYYVINSGE
                     LLPDDSRLHKGQLPIYLVEQYLLLHQLTQKLETQTEKTKTQS"
     gene            <1107570..>1109942
                     /gene="RLM1"
                     /locus_tag="PVL30_004275"
                     /old_locus_tag="LELG_04554"
                     /db_xref="GeneID:5231445"
     mRNA            <1107570..>1109942
                     /gene="RLM1"
                     /locus_tag="PVL30_004275"
                     /old_locus_tag="LELG_04554"
                     /product="resistance to lethality of MKK1P386
                     overexpression"
                     /transcript_id="XM_001524532.2"
                     /db_xref="GeneID:5231445"
     CDS             1107570..1109942
                     /gene="RLM1"
                     /locus_tag="PVL30_004275"
                     /old_locus_tag="LELG_04554"
                     /codon_start=1
                     /transl_table=12
                     /product="resistance to lethality of MKK1P386
                     overexpression"
                     /protein_id="XP_001524582.2"
                     /db_xref="GeneID:5231445"
                     /db_xref="PFAM:PF00319"
                     /translation="MGRRKIEIEPLTDDRNRTVTFVKRKAGLFKKAYELAILCQVDLS
                     VVIVGNNNKIYEFSTVDTNEVIKTYQSVSKSRKKIHESKSPEAYSDYKKKIKITDPLT
                     YKNGEVVSTAIAAAAAGTKKSSSSSSLANFTSTATNAKEFRSGDEMIDDDYEDDDEYD
                     DDDDDDDDDNNNNGKDNSFDQSIKTDNLSKRNLKRKHSPNDIGIQDQNQNRNRNPKVF
                     NSKRPAPSPPPKHISLSNVPTFNKLSKPKTEPSTQSQTYSQLHQRSQSTPSPIPPKRE
                     GGITRPVLRVQIPTDAKGTNTHTHNPAMSFDGEIKSSSGRDTARTITAIENTNSSIQQ
                     SSSNQSGSQGIGSSGSHNHNHNHNHNHNQSQQQSVDSGPYPSTHLMPGVPSTKFSGYS
                     SFRSPDTRKPMLPLPIQSNSQTSSPASATAPGLPNTSSSSGGNSGGGIIQVGITAPAA
                     SAAFPPGNGSLHHNVPFANNTFQNNNANNATIFYTMQQQQQQQHHQQQPHQQQQQSQA
                     SQSPQYMMYSSVQGFNTPSQFQQFPGALNSAQQAATHQKQQTTPQRIRQTNLIQGQQS
                     QQGQSQTPSQTPSQTQAQTQTQPQNPLADTAARFRNGAQTASTFASQQSQNTGEQTPL
                     SGLPSRYVNDMFPFPSPSNFLAPQDWPTGITPTTTTSNMQQFFSNMMPLQSAGGINPL
                     QPQPPQTTASTQTTQASTTLNSTGQENVQRGGSLDASGTPSYRTHISPIIYSGSGASG
                     NSRQTSLVGKISEEEDEEGDEIRDEVGTNPSTAVQSDTKETGNGDQNDGK"
     gene            <1111381..>1111998
                     /gene="RPS6"
                     /locus_tag="PVL30_004276"
                     /old_locus_tag="LELG_04555"
                     /db_xref="GeneID:5231312"
     mRNA            <1111381..>1111998
                     /gene="RPS6"
                     /locus_tag="PVL30_004276"
                     /old_locus_tag="LELG_04555"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_001524533.2"
                     /db_xref="GeneID:5231312"
     CDS             1111381..1111998
                     /gene="RPS6"
                     /locus_tag="PVL30_004276"
                     /old_locus_tag="LELG_04555"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_001524583.1"
                     /db_xref="GeneID:5231312"
                     /db_xref="PFAM:PF01092"
                     /translation="MGQEVEGDSVGDEFKGYIFKITGGNDKQGFPMKQGVMHPTRVRL
                     LLSKGHSCYRPRRTGERKRKSVRGCIVAQDLSVLSLAIVKQGDEDIDGLTNTTVPKRL
                     GPKRANHIRKFFGLTKEDDVRDYVVRREVTKGDKTYTKAPKIQRLVTPQTLQRKRALK
                     AKKVKNAQHQRDAAAEYAQLLAKRLHERKDEKATLKKKRAESVKA"
     gene            complement(<1112627..>1114003)
                     /gene="PRP21"
                     /locus_tag="PVL30_004277"
                     /old_locus_tag="LELG_04556"
                     /db_xref="GeneID:5231464"
     mRNA            complement(<1112627..>1114003)
                     /gene="PRP21"
                     /locus_tag="PVL30_004277"
                     /old_locus_tag="LELG_04556"
                     /product="SF3a splicing factor complex subunit"
                     /transcript_id="XM_001524534.2"
                     /db_xref="GeneID:5231464"
     CDS             complement(1112627..1114003)
                     /gene="PRP21"
                     /locus_tag="PVL30_004277"
                     /old_locus_tag="LELG_04556"
                     /note="BUSCO:EOG09264RIE"
                     /codon_start=1
                     /transl_table=12
                     /product="SF3a splicing factor complex subunit"
                     /protein_id="XP_001524584.2"
                     /db_xref="GeneID:5231464"
                     /db_xref="PFAM:PF01805"
                     /db_xref="PFAM:PF12230"
                     /translation="MSTSAPIPLQQSSLPENAKIPPTDIKETIDKSVIYILKNGKSFE
                     ERLLKNNRNKHFNFLQPDNEYHQYYQWKLQNTETPLGTETGADNSLNKDTAIKNHIDA
                     KDIVIPKPRDLPFLIDNFPQINQYDHDVIKTTALYISINGQDRILDLFKHETKQGNSA
                     QFEFLKPQHSLHGLFQTYVKQYDIVREMISDPNHPLNKQVANDLDEIEHDKNNGQFNI
                     LTRGYDRAQYLKQNRIRKKQQDAKLREQQVKFASIDWQDFAIVEYIHFTESEKNQELQ
                     TDGDQESKNLRLPLNRTDLIKRSLTNKRREIKLEKINQSNGTDHEQDLVESVRKQTST
                     SPSNKETSPSPTPPPFKGMKIKAAGTTRLKRATTKTASTTTLNNDDKIATNLGVKLIK
                     CPITGKMIPEGEFDTHLRNLLRDPSYKQQQENYIKKNFSFESNITTDQVYENIKRLMK
                     KRTSTSHD"
     gene            <1116499..>1117755
                     /gene="IPK1"
                     /locus_tag="PVL30_004278"
                     /old_locus_tag="LELG_04557"
                     /db_xref="GeneID:5231716"
     mRNA            <1116499..>1117755
                     /gene="IPK1"
                     /locus_tag="PVL30_004278"
                     /old_locus_tag="LELG_04557"
                     /product="Inositol-pentakisphosphate 2-kinase"
                     /transcript_id="XM_001524535.2"
                     /db_xref="GeneID:5231716"
     CDS             1116499..1117755
                     /gene="IPK1"
                     /locus_tag="PVL30_004278"
                     /old_locus_tag="LELG_04557"
                     /codon_start=1
                     /transl_table=12
                     /product="Inositol-pentakisphosphate 2-kinase"
                     /protein_id="XP_001524585.2"
                     /db_xref="GeneID:5231716"
                     /db_xref="PFAM:PF06090"
                     /translation="MEIYKITSPKEWTYFAKGSANILFKYTGTNDYLRHKLLRLRLIK
                     EDEEYISTCELYDFIELKCKHLFYAPQQIIIDIQLVVLTTDFVAELDSHGNQLQLKER
                     YGLLLPNILDGECTKISLSKLCQLYVNCDDPTTTCSHANSNKAKELSNGNGNNNTLLP
                     PRIISPSSKINSIIFEIKPKWLYDNTSQNYCRTCSHNQLRHFKRHFCPLDLLYPETLE
                     QGLDDIFSYIPSEVNKLIETNEFPLRQLFLTYLQNPNNVFLKLKQYQKINNKNDLIEN
                     LTSQKDVSQNLSLVMTLRDVGLFLKFEKYDPLNDVHNSHNNVNNLITLPPKRRRTTTT
                     TTTTSTTQNGSGNTEESLSEEKYLITCNIYDLDLKSTMKYKHWLKVENDLQEIYNSTN
                     PNWRHCNRVGQSMGFSEAKKTRQRDK"
     gene            complement(<1118180..>1120234)
                     /gene="NCP1"
                     /locus_tag="PVL30_004279"
                     /old_locus_tag="LELG_04559"
                     /db_xref="GeneID:5231299"
     mRNA            complement(<1118180..>1120234)
                     /gene="NCP1"
                     /locus_tag="PVL30_004279"
                     /old_locus_tag="LELG_04559"
                     /product="NADPH-cytochrome P450 reductase"
                     /transcript_id="XM_001524537.2"
                     /db_xref="GeneID:5231299"
     CDS             complement(1118180..1120234)
                     /gene="NCP1"
                     /locus_tag="PVL30_004279"
                     /old_locus_tag="LELG_04559"
                     /codon_start=1
                     /transl_table=12
                     /product="NADPH-cytochrome P450 reductase"
                     /protein_id="XP_001524587.2"
                     /db_xref="GeneID:5231299"
                     /db_xref="PFAM:PF00175"
                     /db_xref="PFAM:PF00258"
                     /db_xref="PFAM:PF00667"
                     /translation="MALDSLDLYVVIILTLSVAAYFAKGYFFDKPESTGFLNADGGAG
                     GVGGINSRNILEVLAKNNKNALLLFGSQTGTAEDYCNKMSKELSSRFGLHTMVADFAD
                     YDWEKFEEIKEETLVFFLMATYGEGEPTDNAIEFMEYLENEADTLSSLRFTVFGLGNS
                     TYEFYNAIGRKLNTTLEEKGAERFAEYGEGDDGLGTLDEDFLSWKDNVFDSLRNNLSL
                     EEKELKYEPSVKVIERDDLTKDDNSVSLGEPNKKHIAGDVDLTKGPFDHTHPYIAQIT
                     ATKELFNTKERSCVHVEFDLSDSNLKYTTGDHLAVWPQNSNENIEKFLKAFGLEDKRD
                     DVYALKAIDSTYQIPFPTPITYEATIRHHLEISGPISRQFFLSVAGFAPDEETKTKLT
                     SLATDKSKFAEAVTQKKYNIADALLAVSGGKPWKNVPFEFLIENVQHLQPRYYSISSS
                     SLSEKSKIDITAVVEVEQESDGRVVSGVVTNLLKNIELKQHKSQQQPIVTYDLDGPRG
                     KFSNFKLPVHVRRSTFKLPSSTKTPIILVGPGTGVAPLRGFVRERVQQVKNGMNVGPS
                     LLFYGCRNENEDYLYKDEWKEYAKTLGSNFEIITAFSRQDPAKKVYVQHKLLEQAKRI
                     NELLVEGAIIYVCGDASHMARDVQASFAKVIAQERGIDVEKAAELIRSLKVQNRYQED
                     VW"
     gene            complement(<1122003..>1123352)
                     /locus_tag="PVL30_004280"
                     /old_locus_tag="LELG_04560"
                     /db_xref="GeneID:5231317"
     mRNA            complement(<1122003..>1123352)
                     /locus_tag="PVL30_004280"
                     /old_locus_tag="LELG_04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524538.2"
                     /db_xref="GeneID:5231317"
     CDS             complement(1122003..1123352)
                     /locus_tag="PVL30_004280"
                     /old_locus_tag="LELG_04560"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524588.2"
                     /db_xref="GeneID:5231317"
                     /db_xref="PFAM:PF01454"
                     /translation="MARRKITLAELEADEDSTYHQTDQPSQKRKRRNVIEDDNDEGDG
                     DYQADDGQQHGSNNNNSSSSSNNNNNRQLQSHLSDTLHESMHNEHDMQHDVNQVVKLI
                     LSRELKGGFFKREYINQNLSHKKFKSDLILKEAIQVLENVYGLTLQEAPAMKVKQDRV
                     KGRRAATATATGSGSASRTGTGTGPGLGPGIATGSSQGSVKKPLVVVSTLSREAKEVL
                     GELWSRDTTSSLDMSKLGSDKFFMPRYSRTKTLPSSNFDLVKAGIMMVVITLVILNEN
                     HISEQQLLRSLKTFGLPDGLRQANSNINMNSPDLIKELVAREYLVKEEISIGDNNSGN
                     GASGGNGGNGGNGANSRYNSRTSSRNKDNDTDKDKILEYSLGRRSLVEFTAQSVFDFI
                     KIVYGDDFSDTIAESTIVTIERAYGVAWAQEESSVNSPAPGDGEEQERETQQDVEAV"
     gene            <1124233..>1125414
                     /locus_tag="PVL30_004281"
                     /old_locus_tag="LELG_04561"
                     /db_xref="GeneID:5231687"
     mRNA            <1124233..>1125414
                     /locus_tag="PVL30_004281"
                     /old_locus_tag="LELG_04561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524539.2"
                     /db_xref="GeneID:5231687"
     CDS             1124233..1125414
                     /locus_tag="PVL30_004281"
                     /old_locus_tag="LELG_04561"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524589.2"
                     /db_xref="GeneID:5231687"
                     /translation="MSKHPLLFPHEESQFLNATPNTPLNNNYNNNKAAMELQPNQFTS
                     PIRKAPPVPNNTPNTVNYNHKLEQMHQELYLSLKQTVFKIASSPNYRHASLMPDYVVA
                     EARAIIETAWAGISANNKEQGDDDDDDDVNNNTNNNKNDTKSDVLKRVDMADGGVTAA
                     ENNKNNVASSNPPHGNIDPSAPRKLPNEDCIPWLDQQLNFCILPNNNLNNVNNNANHN
                     NNNKKHVSHQTSQQLQQKLPKPHELDVYSMLNPKKTLNMGYREKIVSWLSHIPHLLDT
                     ETNEITMDCYPGVVADNSSSNISSLYSTSAKEEFTGPREIDLADIEDLLEFQAQKITR
                     YVTRLYGEEFDSNGGSVEKDCANGKAEGGVARCSEENGAIAMEEDMTATFPIAESTNI
                     P"
     gene            complement(<1125618..>1126301)
                     /gene="NAT4"
                     /locus_tag="PVL30_004282"
                     /old_locus_tag="LELG_04562"
                     /db_xref="GeneID:5231305"
     mRNA            complement(<1125618..>1126301)
                     /gene="NAT4"
                     /locus_tag="PVL30_004282"
                     /old_locus_tag="LELG_04562"
                     /product="N alpha-acetyl-transferase"
                     /transcript_id="XM_001524540.1"
                     /db_xref="GeneID:5231305"
     CDS             complement(1125618..1126301)
                     /gene="NAT4"
                     /locus_tag="PVL30_004282"
                     /old_locus_tag="LELG_04562"
                     /codon_start=1
                     /transl_table=12
                     /product="N alpha-acetyl-transferase"
                     /protein_id="XP_001524590.2"
                     /db_xref="GeneID:5231305"
                     /db_xref="PFAM:PF00583"
                     /translation="MDVEFEINGQAYSEFHEDDSELSRKIAQNVSYDILLSQLPNAFH
                     LPGLNTHISPAADLAQEQIEELISIIDDNLGDLYIKNNGINWKIDKDRDEMKEPGLVV
                     VWFTEKDKTRVAGYISFKLCFDADERFVVYLYEIHFRKDFQGKSLGRIVMDQFHFFAK
                     GLQRSDHSLYQRVKGTSLTVFSDNERALNWYKRLGYQLAENSPQDKVLRSGKIRKPGY
                     YLLRRGIIS"
     gene            <1126748..>1127497
                     /locus_tag="PVL30_004283"
                     /old_locus_tag="LELG_04563"
                     /db_xref="GeneID:5231559"
     mRNA            <1126748..>1127497
                     /locus_tag="PVL30_004283"
                     /old_locus_tag="LELG_04563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524541.1"
                     /db_xref="GeneID:5231559"
     CDS             1126748..1127497
                     /locus_tag="PVL30_004283"
                     /old_locus_tag="LELG_04563"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524591.2"
                     /db_xref="GeneID:5231559"
                     /translation="MVSTVETARQSGFSEKDELTIERHISARFKSTLVKMEKSPNFNI
                     IDARSTIVWREVLQSMETRSKGLIKQLINAENDEPIEKLKTFPYRDWNDDWYEYFIRT
                     LLLQVIDILVTKNAGKNSYTIFTDLWEASKNVSDPTVGKKLMNRMLAYHSFLLDKSII
                     PHVWLQKLREFSRSHTDEIEEFINTLEQKYEHACFVSMCFKTDSFKDICTKLYVDAYN
                     SWLTDKTIKPPHVDSMCVEFQKYSSYLTITT"
     gene            <1128823..>1129584
                     /locus_tag="PVL30_004284"
                     /old_locus_tag="LELG_04564"
                     /db_xref="GeneID:5231528"
     mRNA            <1128823..>1129584
                     /locus_tag="PVL30_004284"
                     /old_locus_tag="LELG_04564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524542.2"
                     /db_xref="GeneID:5231528"
     CDS             1128823..1129584
                     /locus_tag="PVL30_004284"
                     /old_locus_tag="LELG_04564"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524592.2"
                     /db_xref="GeneID:5231528"
                     /translation="MLEDIAMEVEGKLSPTNSTASSSSNQSFSHTATTLPSSPTAAAT
                     TTTISSSPSILESTLQIQQERSRYRLHPLSSSPLRSPTTSRTTSTRITPKRNYTHDHQ
                     IAYQRYQTETDGIYGSPRGMGDGAGAGASAGTSAGANGRVINNRNKHSKIKQLRDQHR
                     QDILSLRREKIDHHQSQQDYMTHQERELGIVITEEEIERLLNEEKALQEELARKRDCG
                     EETEADKVEMMDEAERRLWEEEMELIEMIEEMGID"
     gene            <1130744..>1132354
                     /gene="DAL5_2"
                     /locus_tag="PVL30_004285"
                     /old_locus_tag="LELG_04565"
                     /db_xref="GeneID:5231421"
     mRNA            <1130744..>1132354
                     /gene="DAL5_2"
                     /locus_tag="PVL30_004285"
                     /old_locus_tag="LELG_04565"
                     /product="Allantoate permease"
                     /transcript_id="XM_001524543.1"
                     /db_xref="GeneID:5231421"
     CDS             1130744..1132354
                     /gene="DAL5_2"
                     /locus_tag="PVL30_004285"
                     /old_locus_tag="LELG_04565"
                     /codon_start=1
                     /transl_table=12
                     /product="Allantoate permease"
                     /protein_id="XP_001524593.2"
                     /db_xref="GeneID:5231421"
                     /db_xref="PFAM:PF07690"
                     /translation="MKEKNEATDSIRPVSSISGDELEKNKEGAIATSVHSKTSVDAFT
                     IAYDDSDINNINDINNVDRAMKFAIEHKGEQISISKDELKRVLLKIDLFILPMVCLVY
                     AIQYMDKTSTSYGSILGLRTSLHMEGNMYSWTSTCFYLGYLAFAFVSAYLLQRLPLVK
                     TVSVFIVLWGVILALCAVPQYPGFIALRTILGALESSVTPAFALITSQWYRQEEQYLR
                     TACWFSSNGIGQIIGSAIGYGLYKNQHLYSLPAWKLVFVITGVMTIVLGFLVALHIPD
                     TPTEAWFLNAREKAVVVERIRSNQQGFGNPRFKKSQFIEALKDYHSWLYVLFALSFNI
                     PNGGITSFTSILLNEDFGYSTEKSLLMNMPQGTIIIVCCPLLAYLSQFIKSRLLMTTG
                     VTAVALMSACLLAFAPTKEGRLAGLYLFTLSPIGSICILSQIASSVAGHTKKVTVSAM
                     YLIAYCVGNLIGPQTFIASQAPGYQGAKVAIVVCIVVCLFTLIVIYFSFRRENKRRDS
                     LPKVDLHIDNHEFADLTDRQNPHFRYAL"
     gene            <1133405..>1139008
                     /gene="DNF3"
                     /locus_tag="PVL30_004286"
                     /old_locus_tag="LELG_04566"
                     /db_xref="GeneID:5231387"
     mRNA            <1133405..>1139008
                     /gene="DNF3"
                     /locus_tag="PVL30_004286"
                     /old_locus_tag="LELG_04566"
                     /product="drs2 neo1 protein"
                     /transcript_id="XM_001524544.2"
                     /db_xref="GeneID:5231387"
     CDS             1133405..1139008
                     /gene="DNF3"
                     /locus_tag="PVL30_004286"
                     /old_locus_tag="LELG_04566"
                     /codon_start=1
                     /transl_table=12
                     /product="drs2 neo1 protein"
                     /protein_id="XP_001524594.2"
                     /db_xref="GeneID:5231387"
                     /db_xref="PFAM:PF00122"
                     /db_xref="PFAM:PF00702"
                     /db_xref="PFAM:PF13246"
                     /db_xref="PFAM:PF16209"
                     /db_xref="PFAM:PF16212"
                     /translation="MSNLNPSDNTLPNITLHSNETSQANGAKEDIENRHNERDHEPTP
                     FRPGNSNGNNNNNSLQVPSNPQPRRKRGLSLRSQLFNKAFNIQEDTPPPSSSSSVPQQ
                     SKTSSSNTQGPASAPVPVPLSSSSSSSFQNPQLSHQQNYQIPLSGSTTTTFEPQKGIE
                     LQDIPKNQIHSPQPPPSINIDEAPELFSPINPTAVKGAHYDPYNSLSDAHLTKSSSHL
                     TMDSMRTSNSTNSFIAKRQRLHGVPKNKFLTQLKELKNKLLGIKSLPNTETGRIIPLS
                     VNPESVNSYYQDEYYSTKFKGYIDERTNHTYINNLITSSKYTVYSFLPKQLKAQFSKV
                     ANCYFMVVAIMQMIPGWSTTGHYTTIIPLCIFMSISIAREGFDDWKRHGHDKEENNKL
                     TTVIKEDLEMSSFDTHSINTILTETIPVNNSRMNLNGKTQSLSVQNIASNNSSLSDME
                     DSLTNENLAFTNKHALKRYNLKEIPTKWKNVKVGDIVKVNEDEWFPADMILIATSNND
                     TQEAFVETMALDGETNLKSKVPHKDLSDRASTVPGLKNLHALVTTEDPNIDLYNFDAS
                     FSMHDMTFPLGSENMVYRGSILRNTKAVLGLVVFTGEETKVRMNNLKNPRTKAPKLQK
                     NINYIVIFMVFVVIMLAAFSTMAQRLEYFSNRDGAWYLYNQDAGVAATLMGFIIMYNT
                     LIPLSLYVTMEIIKVMQLCFLQFDIDMYHKESNTPADAKTATILEELGQVSYIFSDKT
                     GTLTDNKMVFRKMSVCGVSFLHDLDLLLTERSNPEENNGIDKLVPRTSMHIPQSSTKK
                     QANPESMEIGYNPRISTTSLARESMDVRQSGVSTKTWVSTAQPRKLQDATNSLHLLRY
                     VQSHPQTLFAKKAKFFLLCLALCNTCLPRKKDKNKCKDGSSTSSLDDEEVEKDMGSVG
                     DNDNNNNNGNNNENDDDNNNGHDDSSITYQAASPDELALVQAARDLGYVMFDKRSEKL
                     TVKTYPHGFDNDPVFEEYKVLDVIEFSSARKRMSIVIKFPDGRICVICKGADNIILEK
                     LKNAKMAKQKAMEISVQTTERKMEEQDVILQSRFSQDIESRESGLSFRKSLNIGGGAG
                     GAGASANFGAGAGVGGDFVHGNPSGTNRVNTIDSALMGAEEEEREVAMIAEKARKSLH
                     IQQARKYTFEMNEDEGGARNSTNGYDKQQTHSGSALRLIPNDKLLVNEEFLIEKTLEH
                     IEEFSTEGLRTLLYSFRWLDKNEYESWHSEYANAKAALSERTKLVEEVGSKIECNLEL
                     VGATAIEDKLQEGVSEAIVKLRRAGIKLWMLTGDKRETAINIGYSCRLIKDYSTLVVL
                     TNDEGMRKICENIKSTLRDLEGGRIAHCVLVIDGATLGDVEADQDLFAYFLELCVQVD
                     STICCRASPSQKANMVSAVRKLKKSAVTLAIGDGANDIAMIQSADIGVGITGKEGLQA
                     ARSADYAIAQFRYLLKLLLVNGRYNYVRTSKFVLCTFYKELLFYLTQCVYQRSTLFSG
                     SSMYESWSLSMFNTLFTSLPVICIGMFDKDLKPATLLAVPELYAKGRLYQAFNLRIFI
                     SWMVLATLQSVGVTFMAFYCWGFTALRDNTTFAFGSLMFAVMIILINAKCTLLEMQNR
                     QWLAFASFIISVGGFGLWNVLIMALYKSKQSTIYFVADGLYEWGRDQSWWASLLIFSF
                     VPLLFDIFIKIFKFMFKPSDDEIFKVYEQDMELRRIFETAAYKELCQSWTWPRDPSTT
                     KAFLRKILVKIGILRDKQSTEKENPSADIELSNYSNYEPHLDISSSINRKRAGTNQLD
                     HELPPSSDGSKIYGDDFARTSDDKYETLPSGKRIKIKQRNRKWSLSRALRKRGSANGD
                     DDDDDDVDAIIDARLKNLREEEEGH"
     gene            complement(<1139194..>1142181)
                     /gene="BUB1"
                     /locus_tag="PVL30_004287"
                     /old_locus_tag="LELG_04567"
                     /db_xref="GeneID:5231520"
     mRNA            complement(<1139194..>1142181)
                     /gene="BUB1"
                     /locus_tag="PVL30_004287"
                     /old_locus_tag="LELG_04567"
                     /product="protein kinase"
                     /transcript_id="XM_001524545.2"
                     /db_xref="GeneID:5231520"
     CDS             complement(1139194..1142181)
                     /gene="BUB1"
                     /locus_tag="PVL30_004287"
                     /old_locus_tag="LELG_04567"
                     /codon_start=1
                     /transl_table=12
                     /product="protein kinase"
                     /protein_id="XP_001524595.2"
                     /db_xref="GeneID:5231520"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF08171"
                     /db_xref="PFAM:PF08311"
                     /translation="MKEIDYIEQHKENIEPSKGGRSVSKLASFYSTSDTYKYQKQKAQ
                     LLLEKDKFEYSIEKSQELDDPLQAFVDYIDWTHTHFPQGANVESGLVLLLERCTSCFR
                     DVPQYKNDPRYLKVWIEYIKYSDSPRDIFIYLAKKQIGVQLAIYYEEFAHFLESEGKI
                     TDAREIYELGIQLSAFPLERLRKSFKFFNERINANTIPGVEESSRIAPSEKHGPASVA
                     ASAAEDRANSPNEGGEYLEPKMKKSKIDIYQDIDQSSRSVLLSIFDDVGDVHLQSKLQ
                     RTKENVIPAVQWQGQILKQKEKRQIRSSDKIEIFRDEDNSEASSSESKKQSDPGFKQR
                     VCTDRLGGNENLYYTLVEVTGKRPERVMINMDLLYPVHSEELGFSELLAITRYRQRMS
                     KSLNCNSPKPIDKTKVAEITETFTIPLNDDHTMKIRDPTLTAVTKLAQNDVLDMFNGS
                     PPAELTEDEDNNVVEPTVTNLEGFVTETLHPKEHVEEFYRENNGHQSVGYHNQKDGSN
                     SQEVQVPQLHQHHQHYQHHQHYQHHQHHYDNYHHDNSIPTQVDSLSPQVNREIHTGAS
                     KIEGQQIIDPFSHALQDHIIEESNIPISLFPGFCDRSNKSMEFVAKQRRNSTGFSKSI
                     SRASKSSMIDCGGDELFCLIRKLGDGGYGYVYLVESASSGASKALKVENPASKWEFYI
                     LHQINKRLLKSPEHSRLFIKCEALYLFRDESFLILDYYPHGSLLDLVNLFRSQNRAVD
                     EDLCIFLTIELIKSTNVLHEIGIIHGDLKADNCMLRLNHVDDHVWSEVYDGKGQNGWD
                     GKGITIIDFGRAIDMTAFRNNDKNRSSNNAIENENKTSVQFVSHLITDDQDCPQMNEG
                     RPWTFEADYYGLACIVHTLLFGSYLKVNASTSTAMRTSVTSSTIAPTSIRVGKVRPQQ
                     NFKRYWQTNLWEPLFDILLNPKIENSGNNSENKDNFQIAVAEKLRDIQVEMEIWLERN
                     SKSHNLKSKLKSLESDLAAIHKV"
     gene            <1142635..>1144509
                     /gene="GPI16"
                     /locus_tag="PVL30_004288"
                     /old_locus_tag="LELG_04568"
                     /db_xref="GeneID:5231345"
     mRNA            <1142635..>1144509
                     /gene="GPI16"
                     /locus_tag="PVL30_004288"
                     /old_locus_tag="LELG_04568"
                     /product="Subunit of the glycosylphosphatidylinositol
                     transamidase complex-like protein"
                     /transcript_id="XM_001524546.2"
                     /db_xref="GeneID:5231345"
     CDS             1142635..1144509
                     /gene="GPI16"
                     /locus_tag="PVL30_004288"
                     /old_locus_tag="LELG_04568"
                     /note="BUSCO:EOG09261LEU"
                     /codon_start=1
                     /transl_table=12
                     /product="Subunit of the glycosylphosphatidylinositol
                     transamidase complex-like protein"
                     /protein_id="XP_001524596.2"
                     /db_xref="GeneID:5231345"
                     /db_xref="PFAM:PF04113"
                     /translation="MWNLAVVVVTFGALFAHCALASELYSESLDLQPLPRNKLLSSFQ
                     FNSISQPIEISYINESTLEKQTSKHSHYSLFSSSLGPVLESTNTRDLSLRFTQGWWDS
                     QSWGKLPFNGSHSGGTGVEVVAIIEASNHISAKRNWQKLTKILSGFFCASLNSIDDST
                     TTYPNFITNFSSIDGKTSYRPVAGNKLFLFRAALPSEPVCTENLTPFLKLLPTRGKSG
                     ISSLLDGHKVFDSLWHGMSIDVHTKCDETNELCRLELHQTINQVVDVIRSIRKRQEGG
                     IPKPTPGDKLRCDSTKTNNIWQCFPLGEAAEQEWSLETLYGRKIKGPAFQDDKDVTRV
                     SIKVEPTVWNITMHRESADSRISNTLNGDGKGWILETIDSPFLYDFKFQTSNSSIVRP
                     IEQPSLQVARSLTGYSLDKGGLRVAFTNTSKQPVRFIYFESLPWFMRLYMSTMKLSLN
                     KMETKNTAEFIKDFYYRPSADRSRPSHLEMLIEVPALSTLAMTYDFDKSLLLYREYPP
                     DANHGFDVEPAIIIVIKEDWEERESENYRSNERAKKMYEFRTTSLLLTLPTPDFSMPY
                     NVIILTCTVMSLAFGIVFNLITKKTVTEEEFERAAKDTGLGKLKSFIQLKVLRKSKID
                     "
     gene            complement(<1144692..>1145576)
                     /locus_tag="PVL30_004289"
                     /old_locus_tag="LELG_04569"
                     /db_xref="GeneID:5231292"
     mRNA            complement(<1144692..>1145576)
                     /locus_tag="PVL30_004289"
                     /old_locus_tag="LELG_04569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524547.2"
                     /db_xref="GeneID:5231292"
     CDS             complement(1144692..1145576)
                     /locus_tag="PVL30_004289"
                     /old_locus_tag="LELG_04569"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524597.2"
                     /db_xref="GeneID:5231292"
                     /db_xref="PFAM:PF10483"
                     /translation="MSSQNATVLLTRLLSLRESSSFHLILDSVAQSSYYLVQEYFYHS
                     RNTNIIYLSYETASKPKNVNEFLDCTVTPLTDVIQFVKNHTKSGVKNLVLVDSLNYID
                     NESLPQFLASLVNPDVVVVATYHTSCIAPYITYTNYPSSLSLLTYIATTIFDIQPSLS
                     ANVDHETLEKQVSKLCFPVNANLNSTKFELVLTNRRKSGRSITYRFDLDCENHEYEVS
                     KKKSGSGAEAEDEEELLRDLTTFNLTTSEKQKLAREQVELPFMQAQEALGSAGGAIVY
                     EFEKDDDYDEEDPYEDPF"
     gene            <1145996..>1149325
                     /gene="prp10"
                     /locus_tag="PVL30_004290"
                     /old_locus_tag="LELG_04570"
                     /db_xref="GeneID:5231401"
     mRNA            <1145996..>1149325
                     /gene="prp10"
                     /locus_tag="PVL30_004290"
                     /old_locus_tag="LELG_04570"
                     /product="U2 snRNP component prp10"
                     /transcript_id="XM_001524548.2"
                     /db_xref="GeneID:5231401"
     CDS             1145996..1149325
                     /gene="prp10"
                     /locus_tag="PVL30_004290"
                     /old_locus_tag="LELG_04570"
                     /note="BUSCO:EOG092608T8"
                     /codon_start=1
                     /transl_table=12
                     /product="U2 snRNP component prp10"
                     /protein_id="XP_001524598.2"
                     /db_xref="GeneID:5231401"
                     /translation="MPADSKTLTGSYTIPDALKKRLEEEIETDAATARVNSQTESNAR
                     RFQNDYNKQKYHRDIDLNFDSSKPYKEVLKERQIEKGEHEVVATINDLKPREQRKRVG
                     LHLEDVPTQPSLKKQQSLVTDTSIESAELSLVKKLKENNVPVINGIPLTDEILTMVLP
                     EGYVKTTPPSEYQGLVSRPQLNFNQLTGPQYYEPPSNEDVPLSTLDTVAVFPGLRGLE
                     YFKEEDKKYFGELLQKRPEELSAEEQKEVQSMKLVLKAKNGTRIVRKRAMRSLTENAV
                     KFGPKTLLSQILPVLLEPSLDEQERHLLIKMMSRIMLRLNESIRPYTSKVIHVLSPFL
                     IDESITMRTESREIISNLTKAVGFANMVSTLRPDLDHVDEYVRNVASRVLAIVASTIG
                     LQQFLPFLKAVVRSKQAWTARHTGIKIVQQLCISLGKGNGSTILPFLSQIVEILTPAI
                     NDESQQVRAITALTLAQLAESVEPYGIDSFERTLEPLWYETKRQRGRVLAAYLRCIGS
                     LIPLMVFDPRYEEYTNHYVKEVMYLISKQYGSPDEDMRKTVLKVLLKLPLSKQIVPEY
                     QQRVFIPFFRAFWNRRTASESSQVLKLVIAATQHLASRFNTMLVLRNIIHFTKDDNEQ
                     LRRLAVEAVNVLISANPDALVEMNSDDVRITVDGVLFAFQEQSIEGGNNSSGNSGAIY
                     LYAFNSLAKALSSRLKPYLGSIISSLLYRMKNKSPEIRQQSCDLVTIIAPVIGSSGRD
                     EDNGVEADNILSKLILILYESLGEVYPDVLGSIINALHACVNSINKDTLLSMSNPSIN
                     QILPTLTPILKNRHEKVQESSIKLIGLIATRNAETINAKEWMRICFDLLEMLKSSKKR
                     IRIAANATFGHIANTIGPQDVIVMLLNNLKVQERQLRVCTAVAMGIVAEKCQPFTVLP
                     AIMNEYRTPEKNVQNGILKALSFLFEYLDGKTSRDYLFAITPLLEDALIDRDLVHRQT
                     AATVVSHVALNVYGLTDGENTEVFVHFLNLVLPNIFETSPHVISRILESLDSLRVTVG
                     NGVFMNYVWAALFHPARKVREPFWKLFNSAYVQCADSLVPSYPRIDCFANTVTDRDSH
                     NGYDDDHSNERFSLQELDLCL"
     gene            <1150187..>1151137
                     /gene="RNY1_1"
                     /locus_tag="PVL30_004291"
                     /old_locus_tag="LELG_04571"
                     /db_xref="GeneID:5231414"
     mRNA            <1150187..>1151137
                     /gene="RNY1_1"
                     /locus_tag="PVL30_004291"
                     /old_locus_tag="LELG_04571"
                     /product="T2 family ribonuclease"
                     /transcript_id="XM_001524549.1"
                     /db_xref="GeneID:5231414"
     CDS             1150187..1151137
                     /gene="RNY1_1"
                     /locus_tag="PVL30_004291"
                     /old_locus_tag="LELG_04571"
                     /codon_start=1
                     /transl_table=12
                     /product="T2 family ribonuclease"
                     /protein_id="XP_001524599.2"
                     /db_xref="GeneID:5231414"
                     /db_xref="PFAM:PF00445"
                     /translation="MISNFFAAALVAQLSMAEPYFGKYFHGQRTSSDSSSGPNLYSVE
                     DCSAFISETNNTWSCHNSTAISDSCCFEDYGILMSTQFWDYNTTLLSIAVNGTAQDIV
                     KSDIQAQIDSLYDDVRRTFTIHGLWNDLCDGSYRSNCQPDLELDDARDNLTHLIGEEF
                     HEPELLHIMKKYWINTEKSNVEDQASVALWEHEYNKHGTCMNTLNPPCFTGEFREHEQ
                     AVQFFKKVVEIWSQLDTFEFLAAAGIYPTVAKQYKLRDVQDALAKAHGGQVYVGCLNG
                     AIDEIWYYHNLQGNVLTGTYRAIDTLTNSTCKENVWYIPK"
     gene            <1153107..>1154807
                     /locus_tag="PVL30_004292"
                     /old_locus_tag="LELG_04572"
                     /db_xref="GeneID:5231434"
     mRNA            <1153107..>1154807
                     /locus_tag="PVL30_004292"
                     /old_locus_tag="LELG_04572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524550.1"
                     /db_xref="GeneID:5231434"
     CDS             1153107..1154807
                     /locus_tag="PVL30_004292"
                     /old_locus_tag="LELG_04572"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524600.2"
                     /db_xref="GeneID:5231434"
                     /db_xref="PFAM:PF01425"
                     /translation="MRTEDWKILAAEAQETFNDSLTKAIKLAEFDDSLKSKYDALPSA
                     KGETTDDYGSPTKHPVDVYLKTVPQSVLDITEKDPIDLLKDLKDKKITCVDVLKAYTT
                     AAIIANKLTNCVQEFLPIEALKFAQELDEKYEEKKNLPLYGLPFSIKEMIPFVGRSVT
                     HGSLCYLDRVVDYNADIVNILMDNGAYPFVRTTNPQSLMMLECVSYMHGRTVNTFNSD
                     LTSGGSSGGEGVLNGLYASPFGLGSDIGGSIRSPAAFNGIYGLRTTLGRIPTADYFSC
                     NIGSESILSVTGPLSRSLGTVELVMKSIIDSKPWLVDPTLAAIEWKTFDSQQEKPKFR
                     IGVLMSDGIVTPSPPILRALNIVKEKLASLGNIELVPFEPFEHERTAEILGKLYFEDG
                     ARDFKATVADTKEPILEQTTWAIDGAKDLEMHDQWFWNLEKQKYRKQYLKHWMSYTDK
                     QGHVLDAVIAPVFPNVAPKHNTSKYWGYTCQWNLLDYPVLVFPVTIVDENLDVPFKDY
                     KPKNESDEFFYKQYDSPKSFAKAPVNLGLVGLRNTDEKLIEIAKILRQEIGDIFAGQQ
                     "
     gene            <1155572..>1158331
                     /gene="OPT6"
                     /locus_tag="PVL30_004293"
                     /old_locus_tag="LELG_04573"
                     /db_xref="GeneID:5231433"
     mRNA            <1155572..>1158331
                     /gene="OPT6"
                     /locus_tag="PVL30_004293"
                     /old_locus_tag="LELG_04573"
                     /product="oligopeptide transporter 6"
                     /transcript_id="XM_001524551.1"
                     /db_xref="GeneID:5231433"
     CDS             1155572..1158331
                     /gene="OPT6"
                     /locus_tag="PVL30_004293"
                     /old_locus_tag="LELG_04573"
                     /codon_start=1
                     /transl_table=12
                     /product="oligopeptide transporter 6"
                     /protein_id="XP_001524601.2"
                     /db_xref="GeneID:5231433"
                     /db_xref="PFAM:PF03169"
                     /translation="MAGHEYIELESFSDNSSDFNSKQSHDNKTSSSFSLTALNKAQLL
                     LILLRLGVISDDVYETGVLPSPSKFSQGTKYMIEKITSLSVFDAIEILRNALADHKED
                     VNFLREDYRLLERLVSQIPEGFGERKDDCNDKIKRNSEKVIEERYIDTFKNKTYLHII
                     DWDLQVRLEAALIEFHSPYPEIRAITDPYDDPNVPVETFRCYFIGFTWTFIGSIINSF
                     FVHRMPSIGLNSHTIQILLLPCGKLWERFVPNKKIALGSLSFELNSGPWTYKEMMLST
                     IIYSCSASIPYSIYNIFVMKIDKFYGLKWVGIVFQILLTISTQFLGFSFAMIMKKVCV
                     YPSKAIWPTLLPTIALNKALMNEGENNKVHGWSISRYKFFMIVGVCSFIYNWVPMHLF
                     QALSNFNWPTWFNPSSIHLTNIAGSTMGLGLNPLPTFDWNQLNAGGCLTVPFYTYMNK
                     YLGSLLGFIVILIVYYTNNYYTAFLPINSNRLFNNKAEVYKVHDILNEKNQFDHGKYQ
                     DIGPPYFSAANLVLYGAYFCLYPFAILYHFVTEWSSTRASFHSVWLSITDAFGKGKGN
                     ETQTGAEHRFGRYASDAHCKMMAKYDDVPDSWFIAILVVSTLFAVATVLFYPVETPVW
                     GIFFTILINFIFLIPLTAIASVTGFSFGLNVLVELIVGYAIPNSGLALITLKAFGYNI
                     DSQASNYITDQKLAHYSKVPPRAIFKGQLISTLINIVVSLTVANWQLAHIPDICDSHQ
                     KDKLSCPGANTYFYSSIQYGEIGPAKVFSGIYPILKWCFLLGALLVLPCVWFKKNGPQ
                     RLTMYFQPSIIIGGFLDFAPYNLSYFTGGLYLSYIFMYQIKKNYLLWWEKYNYILTSA
                     LSAGVAFSSLLIFFTVQYHPRELKWWGNLVSQQGIEGGYLPDIWKDVSTAPDGYIGLR
                     KGNYP"
     gene            complement(<1158536..>1159642)
                     /gene="OMA1"
                     /locus_tag="PVL30_004294"
                     /old_locus_tag="LELG_04574"
                     /db_xref="GeneID:5231319"
     mRNA            complement(<1158536..>1159642)
                     /gene="OMA1"
                     /locus_tag="PVL30_004294"
                     /old_locus_tag="LELG_04574"
                     /product="metalloendopeptidase"
                     /transcript_id="XM_001524552.2"
                     /db_xref="GeneID:5231319"
     CDS             complement(1158536..1159642)
                     /gene="OMA1"
                     /locus_tag="PVL30_004294"
                     /old_locus_tag="LELG_04574"
                     /note="MEROPS:MER0026545"
                     /codon_start=1
                     /transl_table=12
                     /product="metalloendopeptidase"
                     /protein_id="XP_001524602.2"
                     /db_xref="GeneID:5231319"
                     /db_xref="PFAM:PF01435"
                     /translation="MFRRIFQTHSNATKTFSIFKWSKSPHITSPRFTNFFQNTSHRRG
                     YASYRRFGDQNSNGFNTSSPLTQYYIQLLTSRKALYIGGGLIAFYIYNLHETPYTHRR
                     RFIWIPFWIEQKIGDYSYRQIMAQYGSMILPHSNPLYARIGGIMNKLLATAIENDENL
                     KQRQHLQQLHWEINIIQNDQLPPNAFILPNGKIFIFSSILPICQNDDGIATVLSHELS
                     HQLAQHSSEQLSSQPFYMALSTILYSLTGISWFNDMLINGLLTMPASREMETEADHIG
                     CEILAKSCFNPRQAVKFWERMGNMEQKLMQSSRGIGSGGLVGEWFSSHPATSKRIHDI
                     ETWMPQLVEIRESSECYEYGKFHNFNSNFFGKQL"
     gene            complement(<1160371..>1161606)
                     /gene="SKG1"
                     /locus_tag="PVL30_004295"
                     /old_locus_tag="LELG_04575"
                     /db_xref="GeneID:5231294"
     mRNA            complement(<1160371..>1161606)
                     /gene="SKG1"
                     /locus_tag="PVL30_004295"
                     /old_locus_tag="LELG_04575"
                     /product="suppressor of lethality of KEX2 GAS1 double null
                     mutant protein 1"
                     /transcript_id="XM_001524553.2"
                     /db_xref="GeneID:5231294"
     CDS             complement(1160371..1161606)
                     /gene="SKG1"
                     /locus_tag="PVL30_004295"
                     /old_locus_tag="LELG_04575"
                     /codon_start=1
                     /transl_table=12
                     /product="suppressor of lethality of KEX2 GAS1 double null
                     mutant protein 1"
                     /protein_id="XP_001524603.2"
                     /db_xref="GeneID:5231294"
                     /translation="MANSNALAVGLAVGIPSALIIGVVLIFWYKNQRKLRKEDLDDNF
                     IERELQDDHSFKMFQDELHTTYDQKKGPESVDIQLKEQAVSDTSNGSSESGLENELQH
                     QQQPEGSAHPYAQHLKLHQAARQSPFEQQQQQQPSRQPTQYYQQQQHQQQQQQQQQLP
                     PHQRQISSYDFYNTFIPTFTSDNNNSYASSTLPPPTAPTAPTQVANDGTYSSSSRAHS
                     SSDLAKGVANIFSSKNRSNSVNNTNNNNSTNNVHNLSDSTASSILLSSNNNNSNNNNN
                     NNNNSNNSNSNNVSQPIHSRSTSNDLDTLAKQLNNSAFFEKLPSKAAAAAGNVNIKPR
                     YPSVSNTMKNNSSSDLINNHLVGEDSAINDHFTYEAAMVEVSPKKASKLNNEIKQEDN
                     AKEVATYAKDQSLQIPKDE"
     gene            complement(<1164356..>1165015)
                     /locus_tag="PVL30_004296"
                     /old_locus_tag="LELG_04576"
                     /db_xref="GeneID:5231323"
     mRNA            complement(<1164356..>1165015)
                     /locus_tag="PVL30_004296"
                     /old_locus_tag="LELG_04576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524554.1"
                     /db_xref="GeneID:5231323"
     CDS             complement(1164356..1165015)
                     /locus_tag="PVL30_004296"
                     /old_locus_tag="LELG_04576"
                     /note="BUSCO:EOG09265LIB"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524604.1"
                     /db_xref="GeneID:5231323"
                     /db_xref="PFAM:PF08695"
                     /translation="MFSLIRGRSISQVQRWTSTRSVLNLRTFLLSTRCNQELNQTKRK
                     PPLISFDQNSQHPSSRVPEEKAVDANGDPLITVERDLPYPYAKRDENRKYFVVFAIGM
                     TLACLVIFNYEKSSSPIINSVLYYLRRSTIGQDALGKDIDFASSWPWIWGTLNTVQGK
                     IDIKFKVKGFERSGYLVLKAERESKRHPFEVEKFVLEVDTKDSKVEYDLMTDPEYEFD
                     L"
     gene            <1165480..>1167879
                     /gene="TFB1"
                     /locus_tag="PVL30_004297"
                     /old_locus_tag="LELG_04577"
                     /db_xref="GeneID:5231424"
     mRNA            <1165480..>1167879
                     /gene="TFB1"
                     /locus_tag="PVL30_004297"
                     /old_locus_tag="LELG_04577"
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /transcript_id="XM_001524555.1"
                     /db_xref="GeneID:5231424"
     CDS             1165480..1167879
                     /gene="TFB1"
                     /locus_tag="PVL30_004297"
                     /old_locus_tag="LELG_04577"
                     /note="BUSCO:EOG0926315C"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /protein_id="XP_001524605.2"
                     /db_xref="GeneID:5231424"
                     /db_xref="PFAM:PF03909"
                     /db_xref="PFAM:PF08567"
                     /translation="METVRGACSKDKVGGMVFIREDITPSMLEWKAVDDDKNNIAIPL
                     NKLVALQATKETVPKMILQISYKSDVENEPDKKMKLHFNNRPTMNNIKDALQTIVARS
                     RTRVEGSPSTPMSDAGIGSPSTLSSTFPGAAAVGKTGGTGLSQSPSGGGSLQPGVSPS
                     TPTPVPSSSSSSSSSSSSATGNFSLAQNALSDANLLKNFELQQKLLLEDRNLRNIFTK
                     SVMSFKLSPTIFWSSRINQLRTFALTISQHRGPYNVLSTIKPVATSDNQVNVNVTRDT
                     INEIFEIYPIIKRAFTDLVPKRFSEGEFWSRFFNSKLFRRLRGDKIGINSGRGDVVLD
                     KYLYMDEKATPLSDVNKESQKEAGKEQGKEGKGKEGKGKEGKGKEGKGKEQSKESNKE
                     ETSADATTATASQADGNSPKRRKVEAENPLLNDNITDDNITVNKTIDLFANEQDNSQK
                     LGNRPDMTMRFDGDLSTIMGNSSGGGPNRFQGNGRENEMVILMRNMNKLSSKMMSMSS
                     ADTSSSSSSSSLPRTKGETTVDGLSAQEVNEYEEELNLHDLNVVEESHYIKLNINTSA
                     SRSPSVGPGEKDAGAEEQLDDKEAQNFIYQQFQQVTKGGDEKTEKDDIKTSNYFDLTD
                     TFKGKTEDIEKTSFEVSALLRQNFKTYKLLNKDETYLKSSYEKVPVNLVPDSLYQEII
                     TYNITIVEFLSHFWKLFLQGKNPQQLKKLFTSLKNCANSLREFKTRATAQLEAIEIVA
                     KNEKLRDKILKDFNSCLEPVELSLQTALTKYTAAAAAATSATSATSVSSVAPVPATEG
                     A"
     gene            complement(<1168024..>1168642)
                     /locus_tag="PVL30_004298"
                     /db_xref="GeneID:85890402"
     mRNA            complement(join(<1168024..1168367,1168477..>1168642))
                     /locus_tag="PVL30_004298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119536.1"
                     /db_xref="GeneID:85890402"
     CDS             complement(join(1168024..1168367,1168477..1168642))
                     /locus_tag="PVL30_004298"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975519.1"
                     /db_xref="GeneID:85890402"
                     /translation="MNLNQSMIPSNSHQFDTTSATAQVAGAIQNSAIQVDSNYANIES
                     SPRLSNTGTKWSNQTSKTAWVLLDDAKLCYSVVKQNHTPIVDLLDLLEEEGYENIIFV
                     LKRNEFGGGSRFGIDLKGIVSFINGIVGCSLIPNLAKTFASCEMSSLNSKEEEFDDYD
                     WLGLLCQMN"
     gene            <1169201..>1169877
                     /gene="ECM1"
                     /locus_tag="PVL30_004299"
                     /old_locus_tag="LELG_04578"
                     /db_xref="GeneID:5231429"
     mRNA            join(<1169201..1169213,1169285..>1169877)
                     /gene="ECM1"
                     /locus_tag="PVL30_004299"
                     /old_locus_tag="LELG_04578"
                     /product="60S ribosomal protein subunit export"
                     /transcript_id="XM_001524556.2"
                     /db_xref="GeneID:5231429"
     CDS             join(1169201..1169213,1169285..1169877)
                     /gene="ECM1"
                     /locus_tag="PVL30_004299"
                     /old_locus_tag="LELG_04578"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein subunit export"
                     /protein_id="XP_001524606.2"
                     /db_xref="GeneID:5231429"
                     /db_xref="PFAM:PF09135"
                     /translation="MAKKISKHSRAARRGEVIEPSGLESTKLAASTSTENDGVRKSII
                     RTQIKNENLLNKKLESSKVRKSKLKKKSSAIKHKLERSDKLQGILSSKIDASIQRAKY
                     VQSARKANWDKINSSIEIRNHILDELKQDSSPEKELTQEEIEKMEEDEYVRKFYEDDE
                     NADNIDKEDKQDGGENKDGKGNEVEKVLSNNRFALLGEVEE"
     gene            complement(<1170443..>1175860)
                     /gene="SEC3"
                     /locus_tag="PVL30_004300"
                     /old_locus_tag="LELG_04579"
                     /db_xref="GeneID:5231396"
     mRNA            complement(<1170443..>1175860)
                     /gene="SEC3"
                     /locus_tag="PVL30_004300"
                     /old_locus_tag="LELG_04579"
                     /product="GTP-Rho binding exocyst subunit"
                     /transcript_id="XM_001524557.2"
                     /db_xref="GeneID:5231396"
     CDS             complement(1170443..1175860)
                     /gene="SEC3"
                     /locus_tag="PVL30_004300"
                     /old_locus_tag="LELG_04579"
                     /codon_start=1
                     /transl_table=12
                     /product="GTP-Rho binding exocyst subunit"
                     /protein_id="XP_001524607.2"
                     /db_xref="GeneID:5231396"
                     /db_xref="PFAM:PF09763"
                     /db_xref="PFAM:PF15277"
                     /translation="MEQDSQYPGPQQQQQNIQPRQQVPYPTNNTTPYRGNGDGDGYSY
                     GTGSMIGTGNRGGSLSGGTHQTSLPPYRDTTPSSPIRSSFNSYGNNSNIRRYSGSPSQ
                     MSSASNAEQERKRITDKIIEDCYSKSTVVNGQKVHEIAYIAHIGVVEYTKSSAAPPHS
                     DAERASYKKRILVLCKKQSGRVMLQKGRFSDERSLFQIGRDWDISELKSIRKVGSDGM
                     TLQLNKDYYWKSDEEDSRIWKFCRYVCQEFGHSMGRYPALHGFSLDDFMLPNPPSTSS
                     TSSPAQSNAPRFAPISPSANKAIGGGNAGGQPLRQTQTQTSSQQQEPKSKSLKQKILH
                     KPSLFSSDKTSKHSSSSPKSPSNATFTPSSPKHKKTLSGGLYKNIDWTSQGQLPQKPM
                     KVLERDRSANASTNTLEPTPVLNEPINTITSNASLKQAVSSSQNSLPNSRSEPTSTSN
                     HQPQSQPRSTIDENSRFQDPYSRTTNQQPMQKQQQEQQFNQHNNKKPQHPYFQKTVDD
                     AQSVMSNDSQNFHFGNPTSGENVRQSQERLSDYAKTNTMKPMETVSEQRQISEPLETK
                     AAYNNQLYDQLSKGSQSKRFEKHGSTVSEKSVEEVLQEFGDSIPSPRKPKKIAASAMT
                     PDFGIEEITDESDTDSRPGQTISIKKRQGLSNQHQQAEKLNSQETLSSQKGGHRKSNS
                     QISIDRGVKNNLNSNINSNSNSNSNSNMSNINLNKRESDPMRSNQKLSSQVSLNSAQT
                     GNRDYRDNNGYKRDGEFSKGHQKSNSQLSVDKLKADIERGNSSKNAFRRDTNHNDTII
                     SSRYDETTINNNNNDDHQEKGLGISAPSFIGESTQIEAQGSSAMGNLTDLLDDHIVEF
                     GRNEQDEPDLNEIEPTRSRQQHQHQQQQQKQKPQLERDDPNSYDNDPNALEEDPRIFE
                     GYSKEPALNVSKKANSSLPVAASASTTTKNSENDFSNSNKRSVLIDTAFEKDPEVEEL
                     LKELGWNTKMNTEVLLKGLTKELNKAKRETVKRLVSVDLTKTLAQDVETASGEIDNML
                     RVFQRMDYNLKTLTNDVNAIDEKSKGLQLKFVNEKLLYNDLHEILSKVSINTSHLQEI
                     GSFKEFSNLNRIEDLENKLSSLYNAIVTINADDPQNHKNENNDLSSLRALKEHQARFK
                     TVNDRFLRHAFDFMSKRIDSIGARLVNEIDKLNLESFITALSSLLFYSGITYYMREVG
                     ATHFNMIKQQFNEIFAKVLDKMLVYKVNSLRASQKSQNKRRSNSNIFHSNFDNDQKSS
                     HNTNNDKDYGNGNGNDNVNDHSVFKQNENHSGQSTPRGSRSRLSQSPAFHHTFDDLDD
                     DDDEDDDDIMLLRKSRSTRFGRSGGRSGLGGAGGSGGNSGGRFGGLLSDGDFESKKQE
                     RLEMMKQQAMASYPKSSNDLDDSKAVVTFIDETRSVIMFLQFFIIEFFHYDVTTFDFN
                     EFVQTNAFSQRQKMIRTASTKNFVELINGENGNMSISTDVMNNLNAMLAKYIDRFCRL
                     VSPTDINKPVIIWQIEQMINSVQETYINQEFLIYNFMKKLSDQYSSSWKRYVDGLVES
                     INGSVIAAKAGVLPSIKNIGYLLLITESSLDREVRGSATRAMIDQAYDKICEGLSHLF
                     SREDPLMKGNMLDSKERETRGVAKLENNFFILQQVNDLSTSNNAATKRLLDSLTKSFK
                     ETESRYFDEQTYQGFGPLFEFINSHRENSRSSKSMKHAKSLLSKYTERDIQNLLGHIL
                     RNFEMQFRESSEHAPQSQKAIDRVLAKDLVDRLWLDLETVFIDYFTRLGKVLRQDYDR
                     ELEYNVGRQDIHHIFMSIREK"
     gene            <1177133..>1178170
                     /gene="PXR1"
                     /locus_tag="PVL30_004301"
                     /old_locus_tag="LELG_04580"
                     /db_xref="GeneID:5231354"
     mRNA            <1177133..>1178170
                     /gene="PXR1"
                     /locus_tag="PVL30_004301"
                     /old_locus_tag="LELG_04580"
                     /product="telomerase inhibitor"
                     /transcript_id="XM_001524558.2"
                     /db_xref="GeneID:5231354"
     CDS             1177133..1178170
                     /gene="PXR1"
                     /locus_tag="PVL30_004301"
                     /old_locus_tag="LELG_04580"
                     /codon_start=1
                     /transl_table=12
                     /product="telomerase inhibitor"
                     /protein_id="XP_001524608.2"
                     /db_xref="GeneID:5231354"
                     /db_xref="PFAM:PF01585"
                     /translation="MGLAGTKVKQRFGLDPRNTNWSNNNNQFGHQYLTKMGWTPGKGI
                     GLVPDSITTHLKINIKTDNAGLGAKLQKRNKDANELDECSGVDAFQRILGRLNGKEDA
                     VNKVMDMKRDDMIINGKMGIRFVKGEVLSSTWDKEKKALISYANGKNEDKKDKDEVSS
                     SRKRKVEDEEKREVKKSRKDIKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKK
                     EKKEKKEKKEKKEKSDKKEKKEKKDKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKE
                     KKEKKDKLDKESSNAANVESTKSLVSDSSRESTPTPIASRLSVRSKWIKQKRASVMDA
                     KALNEIFMISN"
     gene            complement(<1178490..>1180118)
                     /gene="EPD2"
                     /locus_tag="PVL30_004302"
                     /old_locus_tag="LELG_04582"
                     /db_xref="GeneID:5231373"
     mRNA            complement(<1178490..>1180118)
                     /gene="EPD2"
                     /locus_tag="PVL30_004302"
                     /old_locus_tag="LELG_04582"
                     /product="Protein epd2"
                     /transcript_id="XM_001524560.1"
                     /db_xref="GeneID:5231373"
     CDS             complement(1178490..1180118)
                     /gene="EPD2"
                     /locus_tag="PVL30_004302"
                     /old_locus_tag="LELG_04582"
                     /note="CAZy:CBM43; CAZy:GH72"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein epd2"
                     /protein_id="XP_001524610.1"
                     /db_xref="GeneID:5231373"
                     /db_xref="PFAM:PF03198"
                     /db_xref="PFAM:PF07983"
                     /translation="MKFTSFIPFVTLFATALAKFEDTTPPIEIVGNKFFYTNNGSQFL
                     MRGIAYQEDTSLQGGERSSSSNNTAYKDPLADAAACRRDVEHFIKLNTNTLRIYAIDP
                     ELDHDECMQMFSEAGIYIVADLSQPQNSINRNEPSWDVAHYERYTQVIDALADYANVL
                     GFFAGNEVTNNRSNTDASPFVKAAVRDMKQYIDNSSNMRKIPVGYSSNDDEDTRIAIA
                     DYFACGSLDERADFFGINMYEWCGDSTFEESGYKDRTEEFSNLPIPIFFSEYGCNVER
                     PRLFTEVQELYGRNMTDIWSGGIVYMYYEEANNYGLVSLRGSSVSTMGDYKYYSSEIN
                     NISPSYAHSSDETDQATSTLSCPDSSKSTWRASPDLPPTPDDNYCSCIAQSFGCVVKE
                     DVDEEDYGEIFGDVCGRIDCSDISADGTKGEYGEYSFCSAKEKLSYVLNLYYMEQNEN
                     SNACDFDGQASVNRDAQVASSCTLGSGASRVLQGSGSGSGASRTGTNSGSTNTASGSR
                     QSLALPNAEKVSSFKLMCIVGIVSVFVGGLTIAL"
     gene            complement(<1182867..>1183925)
                     /gene="ERG26"
                     /locus_tag="PVL30_004303"
                     /old_locus_tag="LELG_04583"
                     /db_xref="GeneID:5231344"
     mRNA            complement(<1182867..>1183925)
                     /gene="ERG26"
                     /locus_tag="PVL30_004303"
                     /old_locus_tag="LELG_04583"
                     /product="erg26, C-3 sterol dehydrogenase"
                     /transcript_id="XM_001524561.1"
                     /db_xref="GeneID:5231344"
     CDS             complement(1182867..1183925)
                     /gene="ERG26"
                     /locus_tag="PVL30_004303"
                     /old_locus_tag="LELG_04583"
                     /codon_start=1
                     /transl_table=12
                     /product="erg26, C-3 sterol dehydrogenase"
                     /protein_id="XP_001524611.1"
                     /db_xref="GeneID:5231344"
                     /db_xref="PFAM:PF01073"
                     /db_xref="PFAM:PF01370"
                     /db_xref="PFAM:PF04321"
                     /db_xref="PFAM:PF07993"
                     /db_xref="PFAM:PF13460"
                     /db_xref="PFAM:PF16363"
                     /translation="MSARLNPKSVLLVGGAGFLGLHLIQQFHVNSPETKITVFDIRPI
                     PSKLSKFFTFDPKQIGFIKGDLTSAGDVALAIKESGCDVIVHSASPIHGMAQAIYEKV
                     NVEGTKNLLAVSKECGVGVFVYTSSAGVIFNGQDVINADESWPYPEVHMDGYNETKAI
                     AETAVMEANDPAQNFRTVCLRPAGIFGPGDRQLVPGLKASAELGQSKYQLGDNNNLFD
                     WTYVGNVADAHVLAAQKLLDEERRDQVSGQTFFITNDAPTYFWTLARAVWKNDGYIDK
                     YYIKLSRPVALCLGYVSEFVSKMLGKQPGITPFRVKVVCAVRYHNIEKAKKLLDYKPE
                     VDIETGIINTLEWINEKL"
     gene            complement(<1184706..>1186973)
                     /locus_tag="PVL30_004304"
                     /old_locus_tag="LELG_04584"
                     /db_xref="GeneID:5231328"
     mRNA            complement(<1184706..>1186973)
                     /locus_tag="PVL30_004304"
                     /old_locus_tag="LELG_04584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524562.2"
                     /db_xref="GeneID:5231328"
     CDS             complement(1184706..1186973)
                     /locus_tag="PVL30_004304"
                     /old_locus_tag="LELG_04584"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524612.2"
                     /db_xref="GeneID:5231328"
                     /translation="MNNRKAYDSLKEGSKMDGKGRPTFLETKRSTSISSKLKGLFAKP
                     FANSGVHHHSSTSNSDSNGTDSLASSHYTTQRSLPSTYPTRPQPSTTQQSHQNSFKTI
                     KVPGSFSPNRPTATTQKEFSSTVHTPNINRNQMLQTTDVDVGSNNKFNINANADVDAD
                     VDVDVDVNETENGDVTLNANDVLSNFFKKKGNSQLTDVEYEGVMSLMSKSRAGTPYKR
                     SNIELSMNEESEQASKRRHLTRGDESTIGLINGINDETFSIVGSTPHRQHYTRVNPNT
                     STNSIGYRSTYRPVYDDTFDRSYQLLHNNTISHLPRGRVTSMSRRPAPYRSRMKGFAS
                     RQSSLNRTSAETSTATANEMTKPDNSSFSESLLKKKPALVTASSSSSSSSSFDKGRPM
                     SQTARALLTILDGSKEKSTEAESKDGAKDQKNVKPTFSNPYAVNGRKSRQTRLPNAKE
                     TDANILEKSQAYASSSDVPIPKPDIFDESAKLKAKEEKEKETETETETKMKLNELSNS
                     NAGAKTFSFGIDPSSVNKTSKGDEKSENTGNNKMTGDKKMPESILFSTNKAGSINDNS
                     KPLFSFQPAPKEKSDIKGELSNTEKKSNESNTGGKPSLFGNPTSQQGLFNFNSTTASS
                     NSNSNNNNSNNINSNNSIKDGDDTKENRTNNNGFNFSSKPAGGFSFGNASAQSPVPNG
                     TSNLPTQTSFVSSFGSSNGSKTTPGFGNLSVPEQNTVNRRAEHVDEFIFPQPKVVEVQ
                     LNRAEVERLKPLFPF"
     gene            <1187672..>1188334
                     /locus_tag="PVL30_004305"
                     /old_locus_tag="LELG_04585"
                     /db_xref="GeneID:5231395"
     mRNA            <1187672..>1188334
                     /locus_tag="PVL30_004305"
                     /old_locus_tag="LELG_04585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524563.1"
                     /db_xref="GeneID:5231395"
     CDS             1187672..1188334
                     /locus_tag="PVL30_004305"
                     /old_locus_tag="LELG_04585"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524613.1"
                     /db_xref="GeneID:5231395"
                     /translation="MTTAIELLYEFDKYVTTRLESNSFTSNLLITPTSKFITELLVIV
                     FVLLLTYEVIYWSGIYLGLWEYHAKDIFTEVPIHCAHINVRINVVRENKKFALLEYYA
                     LKEKYCHNLIYWKRLNELSNEVFELNKFIKYYFEFSPEDFEMNKEPEFGSTIGHLRSK
                     VLGIVNSSDIFSDFNRSKLEANDVKIYNNRNEEVPLTKNEEYLSKCHIETGNVIDAVI
                     VI"
     gene            complement(<1188485..>1190071)
                     /locus_tag="PVL30_004306"
                     /old_locus_tag="LELG_04586"
                     /db_xref="GeneID:5231422"
     mRNA            complement(<1188485..>1190071)
                     /locus_tag="PVL30_004306"
                     /old_locus_tag="LELG_04586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524564.2"
                     /db_xref="GeneID:5231422"
     CDS             complement(1188485..1190071)
                     /locus_tag="PVL30_004306"
                     /old_locus_tag="LELG_04586"
                     /note="BUSCO:EOG09264JK1"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524614.2"
                     /db_xref="GeneID:5231422"
                     /db_xref="PFAM:PF08513"
                     /db_xref="PFAM:PF10607"
                     /translation="MSSQHRPRRLASKIDKLVLDFFVHEGYSEAAAKFAKEIDVDLNE
                     SNLSSKEDQCQLLNTTVSTASTDALEDYAQLGEKDYYSTLLAHFSNKNAQVSSQPSQS
                     SSSLLSSSLPSIAWSSTRAPSLTAATTHPSTESAMNPTNDVQQQRSLFFHLKGYTTIN
                     ERKRIKSLLLNGKVTEAIQEINTHFPLLLDRNNLLHFKLLRLNLIEMIRSHKSTLQME
                     ADEKTFLNDVLVFVRKHLINKVANLYKLLKELEITMSLLCFRFDPTAKTLSDQKDLPQ
                     ELKNFFDLNLRSQVFKLVNKAIVDYYEDGGLRTIKHQANNTVVDEVMQNLRQQGSVEE
                     RRGYQISSSISTSNSNINNRIYTGPRYDEFDLSNIRTYEETNPITEESENEEEAEVEA
                     EEEEEQQQQQQLQVVANEGERRAEDDQEREGAGRREFFTQRQIGENGNQTVDIKYDMG
                     SSIANGLGNSSSFGKNNLVKDIDSKNEEEVENLIKLSLDSNLERVIKLYILTEQRKVD
                     IKHSKHKDYSPFKDFFPQNS"
     gene            <1190653..>1191528
                     /locus_tag="PVL30_004307"
                     /db_xref="GeneID:85890403"
     mRNA            join(<1190653..1190977,1191045..1191235,1191294..1191347,
                     1191478..>1191528)
                     /locus_tag="PVL30_004307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119537.1"
                     /db_xref="GeneID:85890403"
     CDS             join(1190653..1190977,1191045..1191235,1191294..1191347,
                     1191478..1191528)
                     /locus_tag="PVL30_004307"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975520.1"
                     /db_xref="GeneID:85890403"
                     /db_xref="PFAM:PF07106"
                     /translation="MPSSKSTLCSGDAKAFIRDYMKSQYRPYSTSDIQSNLHNQVTRS
                     KLGPILDDLVAEKELIVKTIGKTNYYCFKELHIEENVGIDAGGEEEAFKEQLKVLEAR
                     IEILLTDIAKVSKLPSNEKLVASIASIESEINKLQQKFESIAEQSSNLELKEIQKYSN
                     NLVAVHKSRKQLFKDLYGKLTEVIDGKEILEACDICPQELQSNLCL"
     gene            <1191786..>1193606
                     /locus_tag="PVL30_004308"
                     /old_locus_tag="LELG_04587"
                     /db_xref="GeneID:5231320"
     mRNA            join(<1191786..1191793,1191980..>1193606)
                     /locus_tag="PVL30_004308"
                     /old_locus_tag="LELG_04587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524565.2"
                     /db_xref="GeneID:5231320"
     CDS             join(1191786..1191793,1191980..1193606)
                     /locus_tag="PVL30_004308"
                     /old_locus_tag="LELG_04587"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524615.2"
                     /db_xref="GeneID:5231320"
                     /db_xref="PFAM:PF06813"
                     /db_xref="PFAM:PF07690"
                     /translation="MVLIIIVTYIIKTTTTTVTATATATATATATATATAIATVAIPA
                     TPIICFTAAIFTITIQSMVSRNIQRVFVLLSCTFLGLICGTLYLYSSYSPQLAKQLQY
                     TASDSSLIALCGTIGVAIAGPLSGAVVDKKGYTYSLLVGGMLIVSGYIGMKFQYDLKW
                     NNLSLSCYWIFSIGLGSTFITSACLKCCAVSFPSIRGVATSLPLALYGLSALFYSVIA
                     SAFYSERTSDFLEFLARSIVIIFVACFPSVYMADKDHKKKASLQSKRGPRSLDNANHT
                     SSRRRLFFSLKFWLIFIITGILAALGQMYIYSVGYIVKALVVSETDPSPTLALNVDIL
                     IQQQQQVQVGLLSIANCLGRITSGIMGDIITQSFNKPRSWLLIIPASGTLVAQLLSSA
                     VHHYSSLSLNSFLIGYVYGFMFCLMPIIVGDVFGMDNFSFNWGMVTLAPIIPSYYFTS
                     LFGKIYDANSSLGSAVENLSNVDPDAGTTVTAKIQGCFLGNQCYNEIFGLTTTIAAVA
                     IFLVVILNASDLLFKRKKLLSLSEIRADNFASEKPK"
     gene            complement(<1194063..>1205321)
                     /locus_tag="PVL30_004309"
                     /old_locus_tag="LELG_04590"
                     /db_xref="GeneID:5231425"
     mRNA            complement(<1194063..>1205321)
                     /locus_tag="PVL30_004309"
                     /old_locus_tag="LELG_04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524568.2"
                     /db_xref="GeneID:5231425"
     CDS             complement(1194063..1205321)
                     /locus_tag="PVL30_004309"
                     /old_locus_tag="LELG_04590"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524618.2"
                     /db_xref="GeneID:5231425"
                     /db_xref="PFAM:PF12814"
                     /translation="MSPTNDAQSSSPSPSSKEDIRGQLSDIQKRLFKRPSRVPREPNH
                     AISTGAASHDNTHASFISDEPKRHALANFLPPIPPSAAGRTKGESATGTATGTSTAHP
                     SALSNPGPLLSSSSPSPSSSSTQSSSKSRSKLPHKSSGKLISSLSTPSLGPPGPDSKG
                     NDMNFVVGLSENLLSECRRLNAENSKIKQKLKSAVDEIQLFKDEIFQLRNYNQIYSSK
                     EEALKDKNWALETDAIQLREELSMVKQENDKLKALEADLNKKIEVLTADNDSWALKNE
                     VLTKNLEDDKKEWEKERMELNKRITYLNDENDLMHLKLSGGDVSSVIDLSKSEIKTGA
                     DKDGEEQENEEAANITFDSILEELRHHEENPELSVLSNTQSEVDMLRSRLQEANETIA
                     KLKNSVIKLKDIQENASPRHHQNHHHPNYPPPNHQTFVQSQRTPMKINQPVTPLMHVP
                     NKRFSMSSPSKRNSKISIKSEDNDRKSIDWEKDLVENISTPSKPLATDNMDAQGDNSS
                     INSRNFDVAGNEDDLEIPYLVDSSDSDSDSDSETVDAGASPSKRSKSTLNTKSVSKLS
                     EEQIQRYVKQNKLVMLPVGEYEQLQKNCVKNDDKLIDIASSRGYKILKRDVYEDLLDE
                     EKMKSKLESNGIVTLPETEFVEMQGKLLKFEDPNIEYITEKANTMGYIVTTTDNYDNL
                     TQQAKNPTLDQLHILARSHDSSVVSNNELKRLQEPSREALQSFAKKLNLAVIPEKEYE
                     TFTKPSITHIKDRAQELNHTILPIEEHNKLVENIENPTLDYLKAHLPKHKHTIISNET
                     YNNLITRATNPSEEEVKVNANRHGIITLTQSEYVKLYKDANDPSLEHLRKHANNMEYT
                     VVSLTGYESLRASAESPSLDIVAKKYPNHKILSRAEFNKLTKKSTEPLSLDQLRAKCE
                     ESGLVALPKEEYSKLQDVAKVTPTDDQLKEFAAKAGLAVVSSTELNTLKEISASTVEK
                     EEAASVAAPVAAPVLAAQGKDTAIEKGFDKRNKDSVASLSLEQLQTQAKLLNYCIITE
                     DERRKLEKNWNDESRIQEWAEKENMVLMGKSEYEKLCSPDLASLSINAEKLGFTIIAE
                     DELLKLKNPEISDLKTHAKKYENVLLSQLEFEQLQKLAHEPSLDHIEEVAKKLDYVPV
                     SKSDHEASQELKTNPSRDFVENAASKLDLKVIEINRLRDLHEKIEKPKLDYLKEKLLV
                     HHYVAVDKEEFDKLNDALSSPSVEYLKEKSKDASLIVVPQQEYEHLEKLATSPEIDHL
                     TKLASASNLSLVPTQEYDNLKNKVANPSLEFLTDNANSIGHKVVKQDEWKSLKQSAEN
                     PDLERIKELASAKNLKVMLVDEHAELIHKADSPDVEHIKRVAANHSHEVIPADEVAVL
                     KKTANEPDVEHIKRVAAKHSHEVIPADEHADLIRKADSPDVEHIKHVAAKHSHEVIPA
                     DEVAVLKKTANEPDVEHIKRVAAKHSHEVIPADEHADLIRKADSPDVEHIKRVAAKHS
                     HEVIPADEHSDLIRKANEPDVEHIKRVAAKHSHEVIPTDEHAELIRKADSPDVEHIKH
                     VAAKHSHEVIPADEHADLIRKANEPDVEHIIKVASARDYEVITKSSYNTLVKNAENPE
                     FEHIKAVASKVDSIVLPLLEYNELQKQANEPSIEHLRKLSENIEHVVVPKSEYNVLQN
                     PSREDLANHAANHGLVIASEDEMESLRKQVEQPDMDYLKSKAKNIYSSLIISSKEFDR
                     LTKIANSPGLDYLKEKALDQNHVLYQKDEANKLESLANNPKEDHIKAVAKAQGLVAIT
                     ENLHRSLLSPSKEAIEKHASSMGHTLVPSKELSRLQEVEKLPSKEFLRSKALQHDCVV
                     LSTKEHVELTNLANEPSRDHVKKTAEAVGLAAIPAAKYETLLSSLAKPSVEYLKDKAQ
                     ENGFALVSEDELKSLKDSLEEPDFEYLANKAKTSHRSVLVDENEYSNLQQTSNNPSTE
                     FLNDKAHVYGLELIDRSELKELKRLSVHPTKEELTATSKKLDLVVLDAIEYDKLCHKL
                     QEPSIDYLQEHAFKLDHSIISTEDYNKLTTLANSPSKEHLEEHAKSAGLIVLPKTDHE
                     KLLKDLKDLNDPKESKLEQWAAGKGLALVKVTELAKLKEQIDSPSLEYLAAHVLKNGK
                     IIVSETEWKDHQHQVENPSLEYLRSKSADQKLTLIEAEKLAALERSVESPSLEVITEK
                     AKALNFEVISESEYLSLKDKAANPTLESLKQHAASKQMILIPENKYEELLEPSEQALV
                     SNASKLGLAIIAKSELDILRKQHDSPSLEFLESKATAYGYCVVSKESFDKLSQTVDTP
                     SEQFLEDHSSRLGLRLVKEQDYVQLLKESSNPSHAYLASKATQLNMTLIPIDQFEELT
                     AKLNSPSLDHLIEKAIKLDHKVVPLSEFESLKMKEDPIDYLAKHKKMVALSDDEHRTL
                     VNQANRSLEDFAEEQNKIVLHVDAHSSLVQAASRTAHDLARENNLIVLDKNEHTTLTT
                     RAAMSLDDLANEKDKVVLDKDEHNTLTTRAAMSLDDLAKEKDKVVLDKDEHNTLTTRA
                     AMSLDDLAKEKDKVVLDKDEHTTLTTRAAMSLEDLAKEKDKVVLDKDEHTALTTRAAM
                     SLEDLAREAEKILLPVSEHKLLEEKAQRSARERAAEEGLIALPTEEVSKMKETIANPS
                     LEYLQKSCERHSTVLVPKGDYESLKMQASESLEEKAKKSGLALIESTRLQELNETVTN
                     PTREHLHTKAKALGLVVVETAEFMDISQRAQRSLEDIAQEHHVKFVPFNEYEEMIQMV
                     KNPSQEFLTKSASAQGYKVLLEKEYEELVAKSRESLEAKAGAAGMVVISQAEFSHLSN
                     THKELSENVEKLEATNKEFLAERDSLNSQISTMLAKLDNPDLAYVKSKVENFNMTVLP
                     LAEFNQFEQLKKSLSDVDRQLKKCSLNKPLVLVFEDEYRHIQTLAETSLEDRAKEQEL
                     VLLPAEEYSRFQETENSITNDNENLRKQIDSPDINYLKTKGESLGLAVIEKPQLEELE
                     ALANLSLEDRAAKDQRVLLTKEEYDFLNSPQLETLKTHSSRYDHAVIPIAEMDRLYQL
                     ESSPPISFINEHAEMNNLKLLTQDDHSRLVSLANIPLQDRINDAEMKLIKNEEYDDLI
                     VKAHKPSLEHLTGLATSIGLSLVPIHELNEMRDILKQTLNERAEREGYVVLTTKEYEL
                     MKSNLQSLSEKANTPISARAEEEGYVLVSKPEYDQLNTIASTSLEDRAAESGLVMVNK
                     SILENLQKQAEESNNVIEGENKGVALNDDSKDSLASSPKMEKASAGDQNYNPSESELR
                     EVAASLNLILLSQQEYDVLTTMDQDKLSEVAKNFSLAVVPESELVRLKQTSAEKDAVD
                     LKAKSLESELNQLKSEVDALSSKESIINIARKNGLLPVAESKYIATTTHPTPDLENVR
                     VVPTSYFHQLLKMKSLTVDKISEEAFDKLALQRGYVQKTNEQQSSPVTKEVDTFKDLG
                     STQLASPATAVSGAQTRAIEEGNAVTRYTSPSQTAINRGNEYSARRSNIGRGGNIPPS
                     ASIRSNLSAESIRSAAVFSMATDVSFTDRSMIPAITQVVIGEYLFKYYRKFGASALSG
                     IADTRHERYFWVHPYSLTLYWSESNPVLSNPSSVKTRAAAIVSVESVDDNNPIPTGLY
                     YKSIVVHSNGRSIKFTCATRQRHNIWYNALRYLISRNIDELKIEEDTEVEGINADEHH
                     AEGLTPSYDSQKNLEALMDTGDRRAYPRPKRNSSHPGTPKESSGRLSRFQSFRK"
     gene            complement(<1206484..>1207854)
                     /gene="GDH3"
                     /locus_tag="PVL30_004310"
                     /old_locus_tag="LELG_04591"
                     /db_xref="GeneID:5231423"
     mRNA            complement(<1206484..>1207854)
                     /gene="GDH3"
                     /locus_tag="PVL30_004310"
                     /old_locus_tag="LELG_04591"
                     /product="NADP-dependent glutamate dehydrogenase"
                     /transcript_id="XM_001524569.2"
                     /db_xref="GeneID:5231423"
     CDS             complement(1206484..1207854)
                     /gene="GDH3"
                     /locus_tag="PVL30_004310"
                     /old_locus_tag="LELG_04591"
                     /codon_start=1
                     /transl_table=12
                     /product="NADP-dependent glutamate dehydrogenase"
                     /protein_id="XP_001524619.1"
                     /db_xref="GeneID:5231423"
                     /db_xref="PFAM:PF00208"
                     /db_xref="PFAM:PF02812"
                     /translation="MVLPHEPEFQQAYDELVTAVSDSTLFTEQPKYKKVIPVVSVPER
                     IIQFRVTWENDKGEIQVNNGYRVQFNSALGPYKGGLRFHPSVNLSILKFLGFEQIFKN
                     ALTGLSMGGGKGGSDFNPKDKSDAEIRRFCVSFMRQLARYIGPDTDVPAGDIGVGGRE
                     VGFLFGAYKQMQNNWAGVLTGKGLSWGGSLIRPEATGFGCVYYTAKMIEKATNGKESF
                     KDKRVAISGSGNVAQYAALKVIELGGVVVSLSDSKGSIISKNGITVDQVNAIAAAKLK
                     FKSLEEIVQTEAKVFGGDNAVEYIAGVRPWTKVGQVDVALPSATQNEVSGDEAKALVE
                     AGCKYIAEGSNMGSTKEAIEVFEANRGNGVWYAPGKAANCGGVAVSGLEMAQNSQRVK
                     WTLEEVDEKLKDIMETCFENCYQTAKKYSTEKGNDTALPSLLKGANIAGFIKVADAMF
                     DQGEVF"
     gene            1210829..1210900
                     /locus_tag="PVL30_004311"
                     /old_locus_tag="LELG_06091"
                     /db_xref="GeneID:5231357"
     tRNA            1210829..1210900
                     /locus_tag="PVL30_004311"
                     /old_locus_tag="LELG_06091"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:5231357"
     gene            complement(<1211264..>1212944)
                     /gene="TUB4"
                     /locus_tag="PVL30_004312"
                     /old_locus_tag="LELG_04592"
                     /db_xref="GeneID:5231446"
     mRNA            complement(join(<1211264..1212785,1212937..>1212944))
                     /gene="TUB4"
                     /locus_tag="PVL30_004312"
                     /old_locus_tag="LELG_04592"
                     /product="gamma-tubulin"
                     /transcript_id="XM_001524570.2"
                     /db_xref="GeneID:5231446"
     CDS             complement(join(1211264..1212785,1212937..1212944))
                     /gene="TUB4"
                     /locus_tag="PVL30_004312"
                     /old_locus_tag="LELG_04592"
                     /codon_start=1
                     /transl_table=12
                     /product="gamma-tubulin"
                     /protein_id="XP_001524620.2"
                     /db_xref="GeneID:5231446"
                     /db_xref="PFAM:PF00091"
                     /db_xref="PFAM:PF03953"
                     /translation="MPGETVTIQAGQCGNQVGLSYWQQLASEHGITADGSSTPYPPES
                     SNEFIDYSQQGSRNTTLTESESPQNVRQLQYRNDNPELYFTVSDSYKYTPRSIMIDLE
                     PSVISKALNAMPMFNPRNAHLSENGGGAANNWSNGYRYGHEHEEDILNLIDREVDKCD
                     NLAHFQLMHSVAGGTGSGVGSKILEILQDRYSKKIITTVSVFPSNDKTSDVVVQPYNS
                     VLTLKKLIECSHGTFVFHNDALNNIDNLLLNQSNMRHNPYYNHHLNDKEMSGHASFQG
                     ANKLIASVIASISNPIRFPGYMYSSIQSIMSSVIPTSDLKFLTTSIAPFSGGHSNHKY
                     INEHDMFLELSDDRYKSVISPHGTDVVFVALMNYLISGSSLDRKEIRKGILKIQSRTN
                     FPGWATRSVPVVYGKKSPFVQDQSLEGIQISNNTSVIALFEKILRQFDMLAKRKAYFN
                     MYCEDNSAEEMNRVGGVFGECREAIVSVIDEYKACKSGSYLDDEEEDQEFRDDGDVEM
                     N"
     gene            complement(<1213642..>1214718)
                     /locus_tag="PVL30_004313"
                     /old_locus_tag="LELG_04593"
                     /db_xref="GeneID:5231451"
     mRNA            complement(<1213642..>1214718)
                     /locus_tag="PVL30_004313"
                     /old_locus_tag="LELG_04593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524571.1"
                     /db_xref="GeneID:5231451"
     CDS             complement(1213642..1214718)
                     /locus_tag="PVL30_004313"
                     /old_locus_tag="LELG_04593"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524621.1"
                     /db_xref="GeneID:5231451"
                     /translation="MKFDIATATLILAAVSQIAASPAVGTPITSEITKRDVDSLNLAL
                     THLNSYNAKRDLMTNQELSKRESQIVTDILALIKDTNLAPTVIKWFIDDPTLSGIAKD
                     VIVTAIKNGWINVGTLLKSLNDSGLAVDVIHDLINYCPFYAEIFKLIGQELSNLPELI
                     GNALGLSSTTVQQEVEKSKREAREYLLAARDDQPVVLLARDSSDTLTSLMESLKDSGL
                     ANQVVEALVTDDDFYSFGASLIEQLFNENAISLSDLLQDLIASGLIPTLLKNFLNLDT
                     LKSVIVNALAAAFGNCKDTTTSSTFVTSPPGGPTPTVTTGSANLSSLTASLTDVTVSS
                     GGGGNTLATSTTTGKTCKKKRRSY"
     gene            <1218579..>1227452
                     /locus_tag="PVL30_004314"
                     /old_locus_tag="LELG_04594"
                     /db_xref="GeneID:5231349"
     mRNA            <1218579..>1227452
                     /locus_tag="PVL30_004314"
                     /old_locus_tag="LELG_04594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524572.2"
                     /db_xref="GeneID:5231349"
     CDS             1218579..1227452
                     /locus_tag="PVL30_004314"
                     /old_locus_tag="LELG_04594"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524622.2"
                     /db_xref="GeneID:5231349"
                     /db_xref="PFAM:PF10293"
                     /db_xref="PFAM:PF10305"
                     /db_xref="PFAM:PF10344"
                     /db_xref="PFAM:PF10347"
                     /db_xref="PFAM:PF10351"
                     /db_xref="PFAM:PF10359"
                     /translation="MLYYCFLVAAITYAVLLLLINTLPHISVKYFGLLSLRCITIKTK
                     TSTIRIGRLSLRLSFRKSMGQTSLRPFNIEVADVSIRSDTQKPSGTSNSEEHHESKRK
                     SPNVPPKSLFNINLKEKLHFTLPKSIHNYLVRTQLINMINFQVFRISIYHEDAHEDIC
                     VETEFCRIQTEIEKNCDLRITLTLLNGVIYDIANVEEKVHLFRNVEFYVDCQAIATCE
                     ALTPNKISIQLQDFEQSLSVGRLNIPLEFFDIENRQKQRQKQKEKEDQERERDRERDQ
                     KSEPNQSSNMNVDSSQTNPEISDELSKDTKESIQIATEGVKHHKERFLKYKELTKEIL
                     MLYSNTNVRFEDTTISYKDVSANLSNFVLLLKKSEKPDQSIAVKLEMYLTSFKIYHKE
                     TQCLELPSCTINYELCPLKLLMAAQAYLDLKSMTETHNQVQTETQTPTQTPTQTPTQT
                     PTHSQPQAQTQTKTPSKPLSQFLDFELNITLSNPTIDIYYDQEDFIFGLFKNKLAAKE
                     KKHSNAATNSIDANKSLRMTNFASQIINFVSSKLTIVDFQLNLHLPEIGSFKDSEFNR
                     HSTSNMVISFRLSAFFLRLFTRRQRSRSRSRISRSSTKRTLNCLLKLKNFKGEAQENL
                     VQLTKINTLVSYDLEKQQLSGQVSSKVIRFKSVNDHFFYMVRQFRNRQRMYFNQKYDI
                     WRAKHKKEDATNSINPNSENKPTTPTPSETATPQEPNGSTKFIHLFEVLPSFVSSLKF
                     TSKEIIFDILCKEGLPSRIIYDWQLEKEVDLADFRRGISLRINDTTGHYKLSKQSLGL
                     SVAQIQLFTISEYSSEYMEDFDKVCPQQASDSELDDLSSINSFASEHDNQERMTGGSN
                     IGDGNVSSGSGGGRNNVEDCDNDNDNDDDDDDDSPEQGIKRIKNVLNIQDINLTNSVS
                     TADDADRDRLLLSIPEIDSRLDMFFFWCIFYARSMLQRFAPTVESNCSKEQLQKISKP
                     KPKLKLDVSLKSMATIVRLPNVVDVLIEIDNLKMDNVFVVKNALVRNVRLYVVHPATR
                     LWARMVIIQDPTFSADLSKSLHEASFAIKATSIRINVPHQFQFYTIIDNTITLAKAIK
                     QLKHNFLYFNYGATEYERIYPEAKEALHFPHVNIKTGALGLTLESDPFENELAMIYEL
                     GLIEQKERLRKLQAFEIKCKNVMDSAIPDIDDQINLSDTPAPTNSHSSHTYFANHKFK
                     MHSPLRHEYLGKNKNMNDGSGESVNASHARTGILKDAFSKIRCNNPSERAQTQTQTQT
                     QDNSNNNSSQIPVDSQTEMTRSQASKKIEEARNQLLENFSLAWTRKYRLFRNNRLRLW
                     KERSQEAWGKDEVQDSFKNKYDIVDYAEGPPLAGPLFRDLDLTLSAFQGGDVDEFLYK
                     FAKKQPKLTYSILIPMNIDLKARKFYMILRDYPLPLASFPTASNPQQPTIHIRSNVII
                     NEMLYTRKEQLRYIYVPYSLAVTNNGTADNFYSVYIPRTLTPVKVASDFHCDLNTDRA
                     CTLSWCKAYQPALSAMGQAFQMFSKPAIDDSPIGWWDKVPLIMHGRYEFEVRNELCLL
                     MKSGTSPDKLVGKNSGFVYSWKNNVSVVIDGTIDPRNLITVSSDDFMFAIPNYAMEER
                     NIWSLFYDGADQISPDFDLDAKKYHKKVIRLSSNDRVKWVGGMKFERNKHFSNKLSDE
                     ELRTSEFKPHYDVEITNPANEYHPDSYEGYRSDYVHMSLSVISKSHNGEAFNAAFFTP
                     LSFHHFFYWWDTIAHYSPPPVRSGRLFTQGQKSYKVKFSPHLFTMKYQMIFNPVTISH
                     LYLHSSDELKGKKNRISFTGLKGKFAICEIDLHQRKELLTYVNKKLNRKTQVKHLKMS
                     QAEINVERADVRILNALFGDQSVSGKLMSFLTGDNSSSRGSSNRSHKSSGGSGGGGGG
                     GFGGGTHASEFTRWLDSVEVPDGDFSWIDPEDFVELELRETLSPYPKIRIIPFFYTPK
                     CSYFREFTLKHTGPFPFGNEDIHDCIMNLEKPAAVQTRILEERIDTLRQDLKKAQHAL
                     ERLKLYDAPEFQQDIENTESEIAVLVEKINIIQTAKDNFNQGDVEALQDLADTNSTES
                     ISRQLSGLSAYSSHVNNDELLQASNFVAIAEFHNRFIVHNLKMKWDDVLKEYFVSYLE
                     RIGDRKSHVYYMTKTAVDLVQSVIKESEEAEKSSESISDKHIEKKFSLGENVIESFDE
                     TLEKVGNPDEEEPEYKYLVKLIHPQIQMISKKLPDTCVLLTSKDLDIRIVDINEKDMV
                     DVMTDNKEMTAKIESRIGVVFREEQLFVISKNDILNMKPWSKFEKDGYMSVNNWPPWF
                     ECEVCYEGSWAQEHLVSEKNTIALIYKNPNQLFLNSKKLEQANEIKVYLSKLVFSATS
                     AQYLAIYCIVTELLMTNNQHDTVNGRLSKVLAFADPSDFRGWDSKVRDLQTHIREFKD
                     ILMNFDQKGASLSEKERKYLKLLELEMEKLKLELLMIMKALRMKNKKSKQTSKYWSIL
                     AEQIIWHFLDDDRKPFIDFACANTALSRMESVEGSNSNEFTIGMLQGFNLEENATYPI
                     LLSPMMSEIPNVADPDSESAVPVVKITWTMLAAVGGIPIIKDAKLEVLPLRFELVYKT
                     AKKLQAYLFPKDESFEADIGGSDSEYGDDDDDNDMMSFTSSEYEGYPAENSSIDSSIM
                     GYEKGYNQSDHRSPWKKLMTKSKNSLGGANNKSSTSSRNKSGNGYSSSSGSLMKHRDS
                     SILSRSSSQSSVSQQQQQQQQHGKGKTNTWKLTNRSKQGISRQAWQGLSEEDDLSILI
                     SRSMQFKSIIDLEIVAFKLMVSFSGPTSLSLLNVNQLVISMPDLSYEHRIWSGEDFMN
                     RLKKDIIKVIVQHTGKILGNKFKPNKKIKVDKPLKQISDYRRFMTLEDLQRDGRERDS
                     SSVDHKLNLGQSKSRSSHQSQSSDHLHPPSHTHHNGKHIRPITRREDAGDGTFEAYLD
                     PADDKVEIDIDSA"
     gene            <1228712..>1231612
                     /gene="GYP2"
                     /locus_tag="PVL30_004315"
                     /old_locus_tag="LELG_04595"
                     /db_xref="GeneID:5231430"
     mRNA            <1228712..>1231612
                     /gene="GYP2"
                     /locus_tag="PVL30_004315"
                     /old_locus_tag="LELG_04595"
                     /product="GTPase activating protein (GAP)"
                     /transcript_id="XM_001524573.2"
                     /db_xref="GeneID:5231430"
     CDS             1228712..1231612
                     /gene="GYP2"
                     /locus_tag="PVL30_004315"
                     /old_locus_tag="LELG_04595"
                     /note="BUSCO:EOG09260K4B"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase activating protein (GAP)"
                     /protein_id="XP_001524623.2"
                     /db_xref="GeneID:5231430"
                     /db_xref="PFAM:PF00566"
                     /db_xref="PFAM:PF02893"
                     /translation="MAFFGVLKDRAFNVLNQVISENKHGSENLSKEQKFCQKFNIPDD
                     ERVIIEADVILEVSSFQPDDEAIAAARAKGGNLGSASKSSRRKITSHTRSQGTLYLTQ
                     HFLLYADSRDSRHCSFSLQLSIVKKLERETSAYDNRLLISLSTTSRLLLRISFDGLRS
                     DNERFASDLSMALKNNHPNIKKLAKFVQASYSEYLLSKNHMSSTKIEHVPPGGLGLVF
                     KFPGNPKESRDKTKLKFWFDLFIENGRNLSLIKTEMFYKLIRVGLPNRMRGEIWELCC
                     GSMYLRLENENFYEKILESNSGKSSFAIEEIEKDLNRSLPEYAAYQSEEGIGRLRRVL
                     TAYSWKNPEIGYCQAMNIVVAALLIYMSEEQAFWCLNVLCDRLVPGYYSKTMYGTLLD
                     QKVFESLVQKTMPMLWDHIVKNDIQVSVVTLPWFLSLYLSSMPLVYAFRILDIFFMQG
                     PRTLFQVALAVFKINGEALLKSEDDASFISIIKSYFGSLDTSAHPSSPQLKYRNITKF
                     QELLAVAFREFSVVDEEMINTHRNRHRGTIYQNISTFVKRTEIRNLPKTPNISSENLD
                     SLYDRFYSSVEQSRITEGSGSSTIDFKAFQDLMSDLCDWVGFQDEKYEQIEQSFLHRL
                     FQKWDLENNEVLTFKNLVMGINSLVEPDLMTSMSNFFALYQDQHGKLGNDGILKLSED
                     LLYITNPWKSGAYVDGITQQIIQREVAAAVIREQEERKKNEDSENSSVDADNQPQVHI
                     DEERFLGQQTERYLQSASMFIKRAFEYAQPNEEELLIEDLKLSSDISHNAALDPSHPV
                     FLNLPTFRMVILADETYELLFTNTLRESIHLDKPLSNTSNPIRNLRDMFDGLLNDGVR
                     VANRVRQRMDSKASQASGSGASSSNSSARSTKASNATGPSAQDAEDEEDEEDFRKVVI
                     DEKDKDFLLSSESATGPESPSSSQAMQSSTSNTSDGEAKPKKSTNELNLIEF"
     gene            complement(<1231751..>1234819)
                     /locus_tag="PVL30_004316"
                     /old_locus_tag="LELG_04596"
                     /db_xref="GeneID:5231290"
     mRNA            complement(<1231751..>1234819)
                     /locus_tag="PVL30_004316"
                     /old_locus_tag="LELG_04596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524574.2"
                     /db_xref="GeneID:5231290"
     CDS             complement(1231751..1234819)
                     /locus_tag="PVL30_004316"
                     /old_locus_tag="LELG_04596"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524624.2"
                     /db_xref="GeneID:5231290"
                     /translation="MFKKRERTQHRTAYTGVGQNSGNSQQPNPGARAAALSIGNAFKQ
                     QSSQPQPSTSRQSFGSSNTVNSSNYRNGSLSTSRNGSLLQRGSRSSYAPPVTQQPQAR
                     VPNSGSRRYSLGSSITSQPRSNRPLNSAGATGRSVSRGSNYSHNIDDSFPESYAEQGY
                     DDDHEDSSHAYNMANMRDLKLPVTAEDNFQKPVRMVKKYVPSPTGIKVIEVPESSFDM
                     EIKRSNSMRMNPYNSRSNSLRAPAKKSASRSGSLTSVDSKNLGRRTISSATNHTQAMG
                     SLNEQVTLEDSLGKSAERVARENKLKALEEQIAKEKELEKEVELKRIEYERLRKARLD
                     KEKELEKYAAIQSEEPNVANNRDNTNAAVAETTDVSAHANPNDSDAYIIPPAVAVRSA
                     EPEVKKTNFAETHTEIDNDTQTGDITTASDILLEVQEPHDSASRRSSTGPVEDTLSLL
                     SEDGKNMAPTEQANDEGYSKDELSKVSSESDLNNGMVVKISLGEKGLEEEGNDPRSSI
                     LSANQDGIESVETLSSNSSGANEVSKNKDAVSQDANPDLSQNAANYFPLDQSTTPRVE
                     TTAADEERNGDLLTSNSKQQQQRQWESNADTRVSQANSSMNSLQPPTIAVNTSSKSSL
                     YSDDTSPKRPLKSAMKSTSFSSLPNNQKSAVKNVNKNSAAHQAYLSLTTAENTRLNSS
                     ISTSPNPPTSRRRSTSRGEVYNLGGVDGGAYPQYSNPNVLHKEAQRKLSHNSLRNSSV
                     NPNAQRHQNPSRGGNATGPANGAGMSNRTMRNSTYVQPIKPHPALQPNYVSPSKLKVQ
                     ELYAKAQARPYSNFAPLEKTSSFEKEVPENQRQSQQPGNTAQVPQKKTGPKRTTLRSP
                     NPPSATQNHASRPLYSQPQNNGRTGNANISANPSGYKSRFNDSDDDLPGASFGGKFKS
                     RFADSDDDLPRGGGGGSGGMQSLAPMPEARYNNSKNNYNNNKSNSNYNTGASSAAAAT
                     NYANNNQWQAQSQAQAQAQAQFSPSYEDQDSGSKQKKKFGKLRKLFGSKS"
     gene            complement(<1235646..>1236071)
                     /locus_tag="PVL30_004317"
                     /old_locus_tag="LELG_04597"
                     /db_xref="GeneID:5231326"
     mRNA            complement(<1235646..>1236071)
                     /locus_tag="PVL30_004317"
                     /old_locus_tag="LELG_04597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524575.1"
                     /db_xref="GeneID:5231326"
     CDS             complement(1235646..1236071)
                     /locus_tag="PVL30_004317"
                     /old_locus_tag="LELG_04597"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524625.1"
                     /db_xref="GeneID:5231326"
                     /translation="MSSFTIPDLRFEQSFWRQLNAYAGNTMPTRKISTNKLGYGSAKG
                     LTDEELELLNADIDKEEERYLNKPQPLAPVTPGIVVYAIVKDQIIMPFLQGLFLTGFL
                     ISIRPILAHVVRNGQHVGRWMYNLLGLDQLSKNRRIVSR"
     gene            <1236574..>1237584
                     /gene="rpb3"
                     /locus_tag="PVL30_004318"
                     /old_locus_tag="LELG_04598"
                     /db_xref="GeneID:5231699"
     mRNA            <1236574..>1237584
                     /gene="rpb3"
                     /locus_tag="PVL30_004318"
                     /old_locus_tag="LELG_04598"
                     /product="RNA polymerase II subunit 3"
                     /transcript_id="XM_001524576.1"
                     /db_xref="GeneID:5231699"
     CDS             1236574..1237584
                     /gene="rpb3"
                     /locus_tag="PVL30_004318"
                     /old_locus_tag="LELG_04598"
                     /note="BUSCO:EOG09263PXH"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II subunit 3"
                     /protein_id="XP_001524626.2"
                     /db_xref="GeneID:5231699"
                     /db_xref="PFAM:PF01000"
                     /db_xref="PFAM:PF01193"
                     /translation="MDKRNGPSVIMRDAEKDRVSFVLQGVDLSMANSLRRTMLAEVPT
                     LAIDLVEIDVNTSVLADEFLAHRLGLIPLDSQGIENLLYSRDCACDNYCSKCSVTLEL
                     TAKCDSDSTMNVCASDLLKLNTESLGKPIIRDPQNRGPLICKLRRHQEIRLTCIAKKG
                     IAKEHAKWSPCAAVGFEYDPWNKLKHTDYWYEVDAAEEWPKSENCRLEEAPDPDAKFD
                     YNAVPSKFYFDVETVGNLPPNEVVLQGVQTLQAKLAAIALELTKSNVEGNNAQTGGFT
                     TYGRTDYGGQTPGADASYGDAGYGGADTYGGVGAGGAGGYGGAGYGGSGNYDNNGYGG
                     AS"
     gene            complement(<1237807..>1238637)
                     /gene="HIS6"
                     /locus_tag="PVL30_004319"
                     /old_locus_tag="LELG_04599"
                     /db_xref="GeneID:5231321"
     mRNA            complement(<1237807..>1238637)
                     /gene="HIS6"
                     /locus_tag="PVL30_004319"
                     /old_locus_tag="LELG_04599"
                     /product="Enzyme that catalyzes the fourth step in the
                     histidine pathway"
                     /transcript_id="XM_001524577.1"
                     /db_xref="GeneID:5231321"
     CDS             complement(1237807..1238637)
                     /gene="HIS6"
                     /locus_tag="PVL30_004319"
                     /old_locus_tag="LELG_04599"
                     /note="BUSCO:EOG092640IZ"
                     /codon_start=1
                     /transl_table=12
                     /product="Enzyme that catalyzes the fourth step in the
                     histidine pathway"
                     /protein_id="XP_001524627.2"
                     /db_xref="GeneID:5231321"
                     /db_xref="PFAM:PF00977"
                     /translation="MTKFRGCIDIHSGQVKQIVGGTLAQDDNVADTTTRENFVSTKPS
                     SYYAELYKTNNVQGSHVIKLGSNPANDEAAKLACKTWPGGLQVGGGINLDNALEWLKY
                     GASHVILTSWLFTKDEKSSLMQLDFQKLQSLKEKVGKDRLIVDLSCRTVIENGETAWY
                     VAMNKWQTLTAEKLSKEFLEKVCAYCDEILIHAADVEGLCQGIDQQLVENLGKWCPHG
                     FQGKIVYAGGAKSISDLELVDRLSQGSVDLTFGSALDIFGGSLVKFQDLVEWNNRDST
                     "
     gene            <1239041..>1240165
                     /gene="FAF1"
                     /locus_tag="PVL30_004320"
                     /old_locus_tag="LELG_04600"
                     /db_xref="GeneID:5231417"
     mRNA            <1239041..>1240165
                     /gene="FAF1"
                     /locus_tag="PVL30_004320"
                     /old_locus_tag="LELG_04600"
                     /product="pre-rRNA processing and 40S ribosomal subunit
                     assembly"
                     /transcript_id="XM_001524578.2"
                     /db_xref="GeneID:5231417"
     CDS             1239041..1240165
                     /gene="FAF1"
                     /locus_tag="PVL30_004320"
                     /old_locus_tag="LELG_04600"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-rRNA processing and 40S ribosomal subunit
                     assembly"
                     /protein_id="XP_001524628.2"
                     /db_xref="GeneID:5231417"
                     /translation="MSDDADYLKALEVQRRNFELQFGSVEEMGYDDKLTRTKRNGRKK
                     SQGSEEEYDLSGDDDEEENEENEENEENEENEENEEEEEYSHSSDDSSLESDFSNSDS
                     EIEMVSHQASSNLASRGNKTDNDIFTPAPPAPKVVKLNSSTPPPSFSQTNKIERKLLK
                     SGRAATLREIESKERQALEAQKRQNRGTSTKEDSENLENDLKLQRLLQESHILASGDA
                     AQKYSGAELTLQTIDYEDPTGSSRKRLLASRINELTQTNRTKQRKLESMPMNMRKNMI
                     AKRDLKVKQYEKEAKDAGIVLSKLKKGQVRDLKAGRGVTSQADRLGTGLKKNKNNNTK
                     RERGLKIHGVGKATRNGLIISQGDIERINNKGKKQFRKSR"
     gene            complement(<1240278..>1242941)
                     /gene="BRN1"
                     /locus_tag="PVL30_004321"
                     /old_locus_tag="LELG_04601"
                     /db_xref="GeneID:5231413"
     mRNA            complement(<1240278..>1242941)
                     /gene="BRN1"
                     /locus_tag="PVL30_004321"
                     /old_locus_tag="LELG_04601"
                     /product="condensin subunit"
                     /transcript_id="XM_001524579.2"
                     /db_xref="GeneID:5231413"
     CDS             complement(1240278..1242941)
                     /gene="BRN1"
                     /locus_tag="PVL30_004321"
                     /old_locus_tag="LELG_04601"
                     /note="BUSCO:EOG09260WU6"
                     /codon_start=1
                     /transl_table=12
                     /product="condensin subunit"
                     /protein_id="XP_001524629.2"
                     /db_xref="GeneID:5231413"
                     /translation="MESLNGSHMYHDDASPYRHQQQRTNLRSERSASSLISSPSNRTN
                     SNHQKHQHHSGSNHNNNNNIIINNTNTNKRVISSRIISHSRHVSRTLEQDESLHNDSF
                     DDPGIDFDVNKHQILSNFEEWIKMSTDNKINSKNSWQFALIDYFHDLNVIKDGDQINF
                     QKASATLDGCMKIYSNRVDSAATETGKLLSGLATKQANATQRRNNNLNNNIDEGDEAN
                     GENILNGYANGNGEGGKHSGVGGGEGDDEEDDEDDGTGNKKKRKTNRVVESTLVDFET
                     IRLKKFDEELSIDPLFKKALAEFDEGGAKSLLLNTLSIDSSGRVVFDATTNQPASPKD
                     NKEITKKLEATEQDIEQGADPEADPEADPEADPEADPEAGSLNFNLDSLKDLLYTEAE
                     GVEFKDKVVCPSLHEFKSALEDINKAKGIFSDFNTKMNEQDVDGDAYLMNEQYMAGDD
                     NDYGVDFDASVDDNDDGANIDLGGASFPQVEADVIQDILKDDIDQDDDITKSSWLKHS
                     AALLDEDLMNYFDEKMKRNWTGPEHWKVSAYKKANKMDGKGNNTSTVSSSTDPGAATN
                     TVPKKKKVNAEIEFFDVENEDEDVLFKSHRDPNFINLKQTTAFDTTDAAELKEMRDKN
                     CLPNDIQFTSTRLISFFQKPQMRIFSYRLSSMAHQKRSKTLTDSEFFAEQYKQREEYQ
                     LKEKQRLEQEEHEARLATSFNQADFDDFDDDYNGLDFNDALEDVNNNMNGISMNGEGS
                     QSQFSGESSAAAGAVGGASGLMTKRKSEYVNFSRVAKRVDIKLLKDNLWKAINEGKYN
                     DASDKESKHEEMQEENVNQNIVLTPEPESALRSIKFGEIIKRIKAMYRPEQFKELSTS
                     FCFICVLHLANEHGLQIKGNNENNNLEIIGF"
     gene            <1244886..>1247060
                     /locus_tag="PVL30_004322"
                     /old_locus_tag="LELG_04602"
                     /db_xref="GeneID:5231426"
     mRNA            <1244886..>1247060
                     /locus_tag="PVL30_004322"
                     /old_locus_tag="LELG_04602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524580.2"
                     /db_xref="GeneID:5231426"
     CDS             1244886..1247060
                     /locus_tag="PVL30_004322"
                     /old_locus_tag="LELG_04602"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524630.2"
                     /db_xref="GeneID:5231426"
                     /translation="MKDIIPHNKERNKRNNETKLENTGGISSSKLHWRGVPKRTKSPL
                     FFHPPPPPPPPLPPPIFSSPSSSSSPPSSSPGKSGISNTERILDPKTNANAPRISIQH
                     VDFVAKGEACLSKRSNGSSPSSPEEEFWNSRSGLRKFDKNFPTIDGKQSSLSPEEGLG
                     SSFAQILKLNTPPSEPKNLLESALCVSDKSKHIRKNSYSHSHSPITIVPEDSKSTCFI
                     CKELLSAVLKSERIITLCCGDAVHLECFIAYFKKELVSNVDSRTGILQKSMIMSKDCN
                     GDKCRGQHKAEIDRRQYHEALRTGQPQLTPLRPAPAQPKLRSISSDPYDSSKTADKTS
                     HLKLPERNARRKSLPESDNFKALRSTLNEQTTQLVQKTSTNARENKVDHERVSPPLSS
                     NKEYIVTAKNSEAKSGYSQIGVQTVLKESTKRRENDEAMRLPKQNSLVKSEGKGKVER
                     ECEHDGEVVGDGDGDDDDDGEVEDEREREGSGDVIKINGKYGDESIVKEDEDDINDSL
                     VQFMVSNCSHIKVSKLIQFGNLRVADRLQVLFNDEVKYELKYSFLFEKYLAIWDVSSE
                     PVLIDMSHAEVTILAQSLKIVCSTQSLNKKLFTVSLRSSAASVFEKWIIMLMDKTLEL
                     PKKKITSTIELKNLIKSNEMVFKFGNQEGNKQIGLRKALIANSKHKRNSYTNETMLSK
                     QLEESCIENRRSSKPVSFERSETYDSDVDSDEELINSALRQN"
     gene            complement(<1247471..>1248280)
                     /gene="RCE1"
                     /locus_tag="PVL30_004323"
                     /old_locus_tag="LELG_04603"
                     /db_xref="GeneID:5231370"
     mRNA            complement(<1247471..>1248280)
                     /gene="RCE1"
                     /locus_tag="PVL30_004323"
                     /old_locus_tag="LELG_04603"
                     /product="CAAX prenyl protease"
                     /transcript_id="XM_001524581.1"
                     /db_xref="GeneID:5231370"
     CDS             complement(1247471..1248280)
                     /gene="RCE1"
                     /locus_tag="PVL30_004323"
                     /old_locus_tag="LELG_04603"
                     /note="BUSCO:EOG09263IMF; MEROPS:MER0004244"
                     /codon_start=1
                     /transl_table=12
                     /product="CAAX prenyl protease"
                     /protein_id="XP_001524631.2"
                     /db_xref="GeneID:5231370"
                     /db_xref="PFAM:PF02517"
                     /translation="MFYEALALAIASSYIFAIYAFQPVRLKYKSRDDLEVMQFRFYRV
                     GMLSFILLALVPYLVQGEFVENIKFMGLIPGFTSNMNLQEDIKGIGYSAMFIVILFSS
                     SIFQMLETDGIDEDDENVNERDGNQNERSFWYRDLVFAPITEELIYRGLVLLVVRKEI
                     PNFLKFTPFLFGIAHVHHGWQLYCKRVALSQILISISFQFAYTSLFGYLSNWIYLKTQ
                     NLWAPIIVHSGCNYFGFPSFSISSDLLASRVVYFFLIFLGAGFALREYCAS"
     gene            <1249515..>1254089
                     /gene="GDB1"
                     /locus_tag="PVL30_004324"
                     /old_locus_tag="LELG_04604"
                     /db_xref="GeneID:5231418"
     mRNA            <1249515..>1254089
                     /gene="GDB1"
                     /locus_tag="PVL30_004324"
                     /old_locus_tag="LELG_04604"
                     /product="bifunctional
                     4-alpha-glucanotransferase/amylo-alpha-1,6-glucosidase"
                     /transcript_id="XM_001524582.2"
                     /db_xref="GeneID:5231418"
     CDS             1249515..1254089
                     /gene="GDB1"
                     /locus_tag="PVL30_004324"
                     /old_locus_tag="LELG_04604"
                     /note="CAZy:GH133"
                     /codon_start=1
                     /transl_table=12
                     /product="bifunctional
                     4-alpha-glucanotransferase/amylo-alpha-1,6-glucosidase"
                     /protein_id="XP_001524632.2"
                     /db_xref="GeneID:5231418"
                     /db_xref="PFAM:PF06202"
                     /db_xref="PFAM:PF14699"
                     /db_xref="PFAM:PF14701"
                     /db_xref="PFAM:PF14702"
                     /translation="MTNTRLILFRLSNLGEPVNNENIKNGVLTLPADDYPQGFKSGDA
                     LFELRFQLNAASQVSRKGVFHTNVPKSFDIDFDRNKHNAYPIESSFHQDITINIPIYK
                     PGAYNYYFTYEDENGNEKETAKFYFNVPPHLELDGKFVPFNSINVETVVSKWIGPYER
                     WNKFFGIVKAKGYNMVHFTPLQQRGESDSPYSIYDQLKWDPKIFSDQSKATKEIHKVL
                     NDNKLLSITDVVWNHTANNSEWLKSAPESGYTQDTAPHLNAAIELDAKLLEFSEKLED
                     LGLPTAIESEDDLQKIVTALKSQVHDELKLWQYYVFDRKKEVEKVLDTFKSGSDISKA
                     QIPSSVNTNDLNQIAQYTLENASDNKQAILGRRFENELNPRSFLSILYAILGDSVEEN
                     ALKAKVGEIVDEINAPFYAQYDDDVKTIDQQVADRIRFLRLADNGPRLGKITEKNPLT
                     EPYFTRFVDANGKKQALANNGWIWGGNPLVDFASNKSKAYLRREVIVWGDCVKLRYGA
                     KYEDSPKLWDRIIEYTKEMARVFNGFRIDNCHSTPLPVAERLLDEARKVNPDLYVIAE
                     LFSGSEEMDKIFVERLALNSLVREAMQAWSVAELSTLVHKHGGRPIGSLTWLPLSEFS
                     YPASKEPKLDSSHGGYTEMEIPKVLTSTAPHAIFMDCTHDNETPAQKRTVEDTLPNAA
                     LVAFCSSAIGSVYGFDECYPHLLNVVDEKRQYSLDDSDNVNNGIGKVKAKLNNIRQQL
                     AEESEDIARDHEMYIHHEGQYITIQRYNARSGKGWFLIARTKFTDHEGEQILSPSTLG
                     GTKVKHEFSYTLKKVGEYEKNDKVLSGIPVQVEEIEAPTVEDANGDSIIKVNDSFIPG
                     SIAVFSTEIPGVDKKLDDYVRKGAVEASVNLDLYDLNNLLYRCSPEELDASGGKEDVY
                     DIPGYGRLVYAGLEGWQSALKEVIWSNNLGSSICDHFRQGSWAADYVVNRLDKYASSS
                     KGLQRFQTWLRERFDAVKNVPYYLRPHYFALIIGIAYEAARFRVLRLLTPEIQVATNF
                     VQSLALTSVQMVGTMNNTSLLPDKSVPCLAAGLPHFSNDYMRCWGRDVFISFRGLLIV
                     PERFDDAKQHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFLQAIQEYVVNVPSG
                     EEILKEKVSRRFPLDDRYIKYDDPEAFSYESSIEDIIFEILERHAKGIKYREANAGPN
                     LDSQMKPEGFDVEVGVDWETGLVHGGQQLNCGTWMDKMGESERAHNKGIPGTPRDGAA
                     VEIQGLLKSALRWVNELSKKGQFKHKEVTKPNGSKITLKEWEQLVQENFERKFYVPED
                     ANEDGEYDIDSSLVNRRGIYKDLYKSGKPYEDYQLRANFPIAMCVAPELFDKHHGLVA
                     IRNADKIIRGPVGIRTLDPSHYNYRPYYNNSVDSDDFATSKGRNYHQGPEWVWCYGYF
                     LRAFLYFNFAEDDTYSDGHKPSNELFTLLNTRIQHHIEWIKQSPWAGLTELTNKDGEL
                     CHDSSPTQAWSSSCLLDLYYDLWNDSRYQG"
     gene            <1255239..>1255781
                     /gene="UPS2"
                     /locus_tag="PVL30_004325"
                     /old_locus_tag="LELG_04605"
                     /db_xref="GeneID:5231304"
     mRNA            <1255239..>1255781
                     /gene="UPS2"
                     /locus_tag="PVL30_004325"
                     /old_locus_tag="LELG_04605"
                     /product="Phospholipid metabolism protein"
                     /transcript_id="XM_001524583.1"
                     /db_xref="GeneID:5231304"
     CDS             1255239..1255781
                     /gene="UPS2"
                     /locus_tag="PVL30_004325"
                     /old_locus_tag="LELG_04605"
                     /note="BUSCO:EOG092641K1"
                     /codon_start=1
                     /transl_table=12
                     /product="Phospholipid metabolism protein"
                     /protein_id="XP_001524633.1"
                     /db_xref="GeneID:5231304"
                     /db_xref="PFAM:PF04707"
                     /translation="MKFFQSDYEFNYPWDQVTAANWQKYPNELSTHVISVDILNRSVV
                     DNHILRTERLIGCKQSIPKWLSFVVGGASISYVREVSEIDLNNKSLVMKSMNLTMNHL
                     LLVKETVIYKPDLQLPEHKTTFNQSAEITAFASITKLCDKLEDWSIERFGQNASKGKL
                     AFDGVLNNLTKKWEETGVFK"
     gene            complement(<1256482..>1256928)
                     /gene="RBT5"
                     /locus_tag="PVL30_004326"
                     /old_locus_tag="LELG_04606"
                     /db_xref="GeneID:5231375"
     mRNA            complement(<1256482..>1256928)
                     /gene="RBT5"
                     /locus_tag="PVL30_004326"
                     /old_locus_tag="LELG_04606"
                     /product="GPI-anchored hemophore rbt5"
                     /transcript_id="XM_001524584.1"
                     /db_xref="GeneID:5231375"
     CDS             complement(1256482..1256928)
                     /gene="RBT5"
                     /locus_tag="PVL30_004326"
                     /old_locus_tag="LELG_04606"
                     /codon_start=1
                     /transl_table=12
                     /product="GPI-anchored hemophore rbt5"
                     /protein_id="XP_001524634.1"
                     /db_xref="GeneID:5231375"
                     /db_xref="PFAM:PF05730"
                     /translation="MKISSILSIAALASVISAAPTVTAPPNADATDGTNWSTYPAVPK
                     TASINGFADRIYDQLPECAKPCMNQDTGSTPCPYWDTGCLCVMPQFAGPIGNCIANNC
                     KGTPVQTATSLASSICSSAGVWSPYWMIPPTVKTKLDSAAAVTTAA"
     gene            <1259478..>1261805
                     /gene="SEC10"
                     /locus_tag="PVL30_004327"
                     /old_locus_tag="LELG_04608"
                     /db_xref="GeneID:5231300"
     mRNA            <1259478..>1261805
                     /gene="SEC10"
                     /locus_tag="PVL30_004327"
                     /old_locus_tag="LELG_04608"
                     /product="Exocyst complex component 5"
                     /transcript_id="XM_001524586.2"
                     /db_xref="GeneID:5231300"
     CDS             1259478..1261805
                     /gene="SEC10"
                     /locus_tag="PVL30_004327"
                     /old_locus_tag="LELG_04608"
                     /note="BUSCO:EOG09260WUS"
                     /codon_start=1
                     /transl_table=12
                     /product="Exocyst complex component 5"
                     /protein_id="XP_001524636.2"
                     /db_xref="GeneID:5231300"
                     /db_xref="PFAM:PF07393"
                     /translation="MSTKFSLYESNPDVDKYVNEGSVSINQFVENISKDHHLKGAEIN
                     KQAYLDPKPYIRSFESNLRELNQLSADAKTQESKSEIEVDNFELRHSENVIGLSQQIA
                     ETTDKFNYLDKQISEVSSKINPLGVTMDKISSSRDKSQEIIFLIRAYHGFYTKGEYPH
                     LDTLKISAKVEDNVKCAKSVKELMKLASRISDEALPKTLKCLKDVEAYGKNMENELLH
                     NFETLLQGDESTDGNVDIKRMNTIATVLFVYNDGVNLIETFVSKNAINNSLDEGIFDN
                     VGVTSSDTQELESRLREFYLNVKFEIKSKARISKKIFNDPDMVLIMVVQRLYDGVIKD
                     QVSRVLARAREVGTLCYLKTIGVLKKVIFEFTHEIKDYLVTEDFNKDGNLLAAMDQAY
                     THLFSEFIRDDVLLTEEYRNIEETIDSTLRRFDPVAFSYQSKYETINTAPSSEDEHIA
                     FANERKKLAQFKQYVKTKIGEKRQDERGISKLELEEDELAAIEVIETLIKTVAESIGR
                     MLEVLPSRVPEHAVSALTILISNFDKLSVREEVQLQSSDFFLSLYSIQFKKELLFCLS
                     TSAKKIIFPCLGSSPVAKSKAKTLINDFVKRHEESINLLLKKTIEYSLTQIQGLLNKQ
                     KKKDFVCDKIEEDTEACELVSGFLEEMYANVSMALSGSNLETFLVAIGHGLLQQLLEH
                     YKKFAVNSIGGVVLTRDVIQYQSRVDEWNIPSLSEKFQILKEIGNLFTVQSDLVNSLV
                     TEGQLSQMKPYTVRQYISKRTDFNPSYADRFFKFR"
     gene            complement(<1262029..>1262463)
                     /locus_tag="PVL30_004328"
                     /old_locus_tag="LELG_04609"
                     /db_xref="GeneID:5231329"
     mRNA            complement(<1262029..>1262463)
                     /locus_tag="PVL30_004328"
                     /old_locus_tag="LELG_04609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524587.2"
                     /db_xref="GeneID:5231329"
     CDS             complement(1262029..1262463)
                     /locus_tag="PVL30_004328"
                     /old_locus_tag="LELG_04609"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524637.2"
                     /db_xref="GeneID:5231329"
                     /translation="MRDGSYSYIHFTHQNQVQFMESWQNEPLQYDDVDIPAQANGITS
                     ANGGVGDGSGSGADFLNNTEDGDAGLMGTDSHEISSNFKSRMTARQKKQWMDLALHES
                     FKSDLKKFKDSTILPNMINNGGKSELGIDSRNDHQSNSIIEN"
     gene            complement(<1262988..>1263897)
                     /gene="SOD1"
                     /locus_tag="PVL30_004329"
                     /db_xref="GeneID:85890404"
     mRNA            complement(join(<1262988..1263439,1263885..>1263897))
                     /gene="SOD1"
                     /locus_tag="PVL30_004329"
                     /product="Superoxide dismutase [Cu-Zn]"
                     /transcript_id="XM_061119538.1"
                     /db_xref="GeneID:85890404"
     CDS             complement(join(1262988..1263439,1263885..1263897))
                     /gene="SOD1"
                     /locus_tag="PVL30_004329"
                     /codon_start=1
                     /transl_table=12
                     /product="Superoxide dismutase [Cu-Zn]"
                     /protein_id="XP_060975521.1"
                     /db_xref="GeneID:85890404"
                     /db_xref="PFAM:PF00080"
                     /translation="MVKAVAVVRGDSSVSGVVKFEQASESEPTTISWEIEGNDPNALR
                     GFHVHAFGDNTNGCTSAGPHFNPFSKTHGAPEDDERHVGDLGNISTDSKGVAKGTKQD
                     LLIKLIGKDSVLGRSVVVHAGTDDYGKGGFEDSKTTGHAGARPACGVIGLAE"
     gene            complement(<1265778..>1266569)
                     /gene="RRP15"
                     /locus_tag="PVL30_004330"
                     /old_locus_tag="LELG_04610"
                     /db_xref="GeneID:5231410"
     mRNA            complement(<1265778..>1266569)
                     /gene="RRP15"
                     /locus_tag="PVL30_004330"
                     /old_locus_tag="LELG_04610"
                     /product="pre-60S ribosomal particles component"
                     /transcript_id="XM_001524588.2"
                     /db_xref="GeneID:5231410"
     CDS             complement(1265778..1266569)
                     /gene="RRP15"
                     /locus_tag="PVL30_004330"
                     /old_locus_tag="LELG_04610"
                     /note="BUSCO:EOG092653LT"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-60S ribosomal particles component"
                     /protein_id="XP_001524638.2"
                     /db_xref="GeneID:5231410"
                     /db_xref="PFAM:PF07890"
                     /translation="MPQGVKVKKSSLKPSKAAVQNKAKVAVSKDLSSPSSSEDESSQD
                     GEQIDSEEEEEKEEEEEEEEEEELSELDEDDEVDVADVSSGDEDEDEEEELEAEEDDD
                     EFPLKKKQKKNRDDGSESFANAFNSIINSKLKAYDRKEPILARNKTTLKKLESEKLEL
                     KAKKALLAEKKQFKDKHRVKQLLPVVGEGEDPSQVRSILDKEKQMKKIAQKGVVRLFN
                     AILATQVRTNVEVSKEKVGQAKREELMNDVSKEKFLDLIAAAGED"
     gene            <1266996..>1269206
                     /gene="KAR3"
                     /locus_tag="PVL30_004331"
                     /old_locus_tag="LELG_04611"
                     /db_xref="GeneID:5231374"
     mRNA            <1266996..>1269206
                     /gene="KAR3"
                     /locus_tag="PVL30_004331"
                     /old_locus_tag="LELG_04611"
                     /product="kinesin-like nuclear fusion protein"
                     /transcript_id="XM_001524589.2"
                     /db_xref="GeneID:5231374"
     CDS             1266996..1269206
                     /gene="KAR3"
                     /locus_tag="PVL30_004331"
                     /old_locus_tag="LELG_04611"
                     /codon_start=1
                     /transl_table=12
                     /product="kinesin-like nuclear fusion protein"
                     /protein_id="XP_001524639.2"
                     /db_xref="GeneID:5231374"
                     /db_xref="PFAM:PF00225"
                     /db_xref="PFAM:PF16796"
                     /translation="MTVFDIANKENENKAVNKRKSVQMEYARPQSHLRFSNHSHSPPP
                     SKAQPGLPQLSTRFVSTSAPTSNPLSKMRKTTSTNKNLSRPISESHRLRQLIYEKQLE
                     LDSLNTESVTLTTQTETQLLHNFTIENEYMTFERELSKLKSNIESLRDYEQISLSEVR
                     KKFDIKSQEMMIRHQKRLHARKESIASQIEKIMAEKQEKYDNEIDELNKKLVDLNEEK
                     DLLQQSYQQNVAFFKEQKLMETDKMETTLQKELQSNESSMEQIEQSILDLQKQTNVLT
                     EMDIPKLEKDLGRYQSLLAQLSTKNSDKEKELQDFQTQISANKARITSLKQTSVLRAE
                     ESERMQFEIKRMQEELIDQDFKRRILHSQLQELKGNIRVFCRIRAVSPGSSLIQFDLP
                     DDDDDDDDGGDDDGDNGGDGIKSNTNTNTNVNININDEGKQELTMTKNNIGISNTSST
                     FKFQFDKIFSMSQSNEAIFEEFSQLIQCCIDGQNVCVFAYGQTGSGKTYTMSTPQTGM
                     IPLSIAKIFNDIDEFQQHHQQWRYKVSGRFIEIYNENIVDLLNPRPGHKHEIKHDDDS
                     CKTSISDVTTIPITSPEQANSVLEQVNERRRTAATKSNDKSSRSHSIFILDVHGINVS
                     SNIKTYGTLNLIDLAGSERINVSQVEGERLKETQAINKSLSSLGDVISSINSSQALHI
                     PYRNSKLTYLLKHSLGGNSKTLMFVNVSPLQSDFNETLNSLRFATKVNNTKLKK"
     gene            <1271438..>1272979
                     /locus_tag="PVL30_004332"
                     /old_locus_tag="LELG_04612"
                     /db_xref="GeneID:5231427"
     mRNA            <1271438..>1272979
                     /locus_tag="PVL30_004332"
                     /old_locus_tag="LELG_04612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524590.2"
                     /db_xref="GeneID:5231427"
     CDS             1271438..1272979
                     /locus_tag="PVL30_004332"
                     /old_locus_tag="LELG_04612"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524640.2"
                     /db_xref="GeneID:5231427"
                     /db_xref="PFAM:PF01380"
                     /translation="MTSPFQSPTKEEIGDDVAGLLLTKEDSTVSLAVAGENPETTHKS
                     IGHSINRPHSSSSTASDNFTTAFVQSSLNSITNTLRLENEAVNNLYNQYQTDEFSITN
                     LLDSIALMFKTYQRKGKIIICGIGKSHKLATKLTATLNSLSISSCNLHPSEALHGDLG
                     MINESLDCLIMLTSSGNTPELLNLLPHLSTDLPIILLTCNKVSKLSKSGRIRSLIYAE
                     LSPMHNEEAIHGLPAPTVSTTLSLILADSVILALSELIENDLFKRRKLFGLKHPGGSI
                     GSSLNKGGGGGGSSSSSSSSSNNNNNSRANGNAAGEETNTKFDTNAASTSLSSFPQSE
                     ISSATSLLSLKVDRFAKVVEAFVGSNTESNQTSIFSENMHEEELEMYAPPKSPLSEGS
                     SAASASGTGTGTGAGAGTGAGTGTGAGAGAGTLGGVETCKLVTHDQILNVGEFDILQW
                     MALYDTLKIQGSPLQVKFTQIKEFYREYCANRSSELTKTSLIERAEHINHWNTFKWNL
                     LRSFK"
     gene            complement(<1273628..>1276627)
                     /gene="PUF3"
                     /locus_tag="PVL30_004333"
                     /old_locus_tag="LELG_04614"
                     /db_xref="GeneID:5231428"
     mRNA            complement(<1273628..>1276627)
                     /gene="PUF3"
                     /locus_tag="PVL30_004333"
                     /old_locus_tag="LELG_04614"
                     /product="mRNA binding protein puf3"
                     /transcript_id="XM_001524592.2"
                     /db_xref="GeneID:5231428"
     CDS             complement(1273628..1276627)
                     /gene="PUF3"
                     /locus_tag="PVL30_004333"
                     /old_locus_tag="LELG_04614"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA binding protein puf3"
                     /protein_id="XP_001524642.2"
                     /db_xref="GeneID:5231428"
                     /db_xref="PFAM:PF00806"
                     /translation="MPTETIWSSSHSSPIQANLSLSSNKNQSTSQFKSVLDQVDPDIA
                     KFLADSDPIDQLPTNLCDRRLSFNDGSDIDDSFINFKRGALSAITAPVGGNINFNSNP
                     SRFNFSSSSNNAAGNNSQRLNFGTASISGGIASRHPPQESFLQKFSSVADATREIELG
                     SLSLSSGNTGGEFNKPFLSMGVGGSRASGSLNENLNMPVPRSSRHQSISDKIDTYNSN
                     NSNNSSSVSSNNIGNSNNIGNSSSSSSSSSSGNNNNNNNNNNNNNNSSPIQNSAAVSV
                     NSDLNTNFNVHESNKTSTGQSTTSHIPQTFWNPATVTSFTPANNTANYFLDGTIKSTE
                     PSPQLQPPMVPPQSFYGHMQNQQPQQQQQQQQQQQQQQMPPINGSHSHAAPPPPPPFM
                     VPSPPPPQFMDPNMYHMMYGNFFPFPLAPIPPPPPPPIINDSEQGATSVSSEDKEREE
                     TEKKSTKTNEEETRQNENPNAKTSSTSKNGLPKPEEGKDEYQNGAGPIGVGLINRQYS
                     PAAFMFPPFHPFAMYQHSPGMMSPDNLKSVSPQEAAMGMPTIERHNGLPHHKSSHHSS
                     HKLSPPPKSSSAPPRDSKNASGNNGNGHPQKKKNAKGKNAGSGNGGNGGNGSGGGSHI
                     YRSPLLEEVRSNTKNKDYTLRDIFGHAVEFTKDQHGSRFIQQKLPTASEEEKEVIFNE
                     IRDITYDLMTDVFGNYVIQKYFEHGSKIQKSILLSHMVGHIYELSLQMYGCRVVQRAL
                     ESLEDVDDQMKIIKELRDYILICSKDQNGNHVIQKSIEKIHPFDKIRFILTSLENQIY
                     HLSTHSYGCRVVQRLLEYSNKEDQKMIMQELNKYIYYLIQDQYGNYVIQHILEQGTPA
                     EKEEVLTIVLGNVVTFSKHKFASNVIEKCIKHGDVQQRKRILHEVMLGNEAEDDIKNS
                     KDNGGENVEVSDDSPLALMMKDQYANYVIQKLVEVLDSNYPEKKQLVLKLRQYLKQLS
                     DMNNFGGKHLASVEKMIMMAETAFDQN"
     gene            <1278659..>1279729
                     /locus_tag="PVL30_004334"
                     /old_locus_tag="LELG_04615"
                     /db_xref="GeneID:5231389"
     mRNA            <1278659..>1279729
                     /locus_tag="PVL30_004334"
                     /old_locus_tag="LELG_04615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524593.1"
                     /db_xref="GeneID:5231389"
     CDS             1278659..1279729
                     /locus_tag="PVL30_004334"
                     /old_locus_tag="LELG_04615"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524643.2"
                     /db_xref="GeneID:5231389"
                     /translation="MAKSAAETSKRLMNLLYNQTASQISITSSSPRILKQLNTDTETN
                     KGKDRGIGKDEYSSTSLLDDPTAFALGINNYNNNYNNNNNNNNNKEHFPPTPSSFAHL
                     RKTPAKQALVNCWPKYQSNILSFRCPNSFVTKQDFQNILPRERYQSYDINPKSAFEVI
                     KRREGELLTFCNEYFLVFKNQISACVYIMETSNKLINGVPLKLNFEPLETITQQLVPE
                     KLRRSNYEELIKETTLSKTSFFQSTENDYEFPNYKPILNILDIERRERSVLVHNWPFG
                     LMPQTFHDYFRNYNLDPKEPKTVVHSDISKEINSVILTFSKKRDALRFTRNFHGKHWS
                     ILQDYSITNEKVFSQPILCEDI"
     gene            complement(<1279991..>1281793)
                     /gene="HSV2"
                     /locus_tag="PVL30_004335"
                     /old_locus_tag="LELG_04616"
                     /db_xref="GeneID:5231347"
     mRNA            complement(<1279991..>1281793)
                     /gene="HSV2"
                     /locus_tag="PVL30_004335"
                     /old_locus_tag="LELG_04616"
                     /product="Phosphatidylinositol 3,5-bisphosphate-binding
                     protein"
                     /transcript_id="XM_001524594.2"
                     /db_xref="GeneID:5231347"
     CDS             complement(1279991..1281793)
                     /gene="HSV2"
                     /locus_tag="PVL30_004335"
                     /old_locus_tag="LELG_04616"
                     /codon_start=1
                     /transl_table=12
                     /product="Phosphatidylinositol 3,5-bisphosphate-binding
                     protein"
                     /protein_id="XP_001524644.2"
                     /db_xref="GeneID:5231347"
                     /translation="MRNKNTLDKIHCMNFNQDCGCFAVGHEHGFLVYNTDPLELKVKR
                     DFTNSIRSANSSQHPLYPPRSSSSLASNSSKSTTVESRQNKSSRIGSTLGDTAKGINK
                     VNYGSGGEGGDVQTEDPGSDKNRIGSQIKREPIAEFGDYGSSIGHVTMLYRTNYLALI
                     GGGVHARFPPNMLIIWDDLKRKISLQEAFANPILNVLLSRTKIIVVLVDELYIYEFTT
                     PLKKLYTYKTHPQNEQGLASLVTTSAGGNRFNAQYTKSTASGVVVHNSTTVAFPGKAT
                     GQIQIVVLNNQTDDSNTSVKNNNLYVQQLSSSVPPTPPPPPQQQQQQQQQQQQQQQQQ
                     QQQQQQQAPLLSPSKASSNSSTSTSIPAVVAAAAVSTSVPPTVTIIRAHKSAIHNICL
                     NNLGTMVASASITGTIIRIHSTETTNLLYEFRRGLDKAEITSMEFSPDGNKLAVISDK
                     YTLHIYSLDDQFANGADQATYGTHKTSAVQHSHGNSDSPMQNNKEHVLSRYISRIPSR
                     IVPQYFKSTWSCCSVNTGKYHPNETVLDKGTLGWLDSDTVVILWPVKQLVEKYMIIKD
                     SSGTINSSDIDDTVVQQKHRWKLIRVSWKTLELS"
     gene            <1283180..>1286317
                     /gene="ATG1"
                     /locus_tag="PVL30_004336"
                     /old_locus_tag="LELG_04617"
                     /db_xref="GeneID:5231596"
     mRNA            <1283180..>1286317
                     /gene="ATG1"
                     /locus_tag="PVL30_004336"
                     /old_locus_tag="LELG_04617"
                     /product="Serine/threonine-protein kinase"
                     /transcript_id="XM_001524595.2"
                     /db_xref="GeneID:5231596"
     CDS             1283180..1286317
                     /gene="ATG1"
                     /locus_tag="PVL30_004336"
                     /old_locus_tag="LELG_04617"
                     /codon_start=1
                     /transl_table=12
                     /product="Serine/threonine-protein kinase"
                     /protein_id="XP_001524645.2"
                     /db_xref="GeneID:5231596"
                     /db_xref="PFAM:PF00069"
                     /db_xref="PFAM:PF07714"
                     /db_xref="PFAM:PF12063"
                     /translation="MSTESKANTTNAYESATATTSIPTKSPHDERKNSNHDQRMQSQQ
                     QQQQQQQQQRQRFIGKYLISSEIGKGSFATVYKAYKINDNSGGNLHTSSISTSTSTST
                     STSSSPSISTNNNIIDNNSSITNSKSSIPVAIKSVNRSKLKSKKLLENLEIEIQILKT
                     MKHPHIVKLLDYKQTGTHFHLVMDYCSMGDLSYFIRRRTQLVKTHPIICSLIERYPSP
                     EGSHGLNETLVLHFLRQLSSALKFLRDKSLVHRDIKPQNLLLCPPVHSRDEFVRNQFE
                     GMWELPILKIADFGFARFLPSTSMAETLCGSPLYMAPEILRYEKYNAKADLWSVGAVL
                     YEMTVGKPPFKANNHIELLKNIEKANDKIKFPSAAQVPDALKQLVRSLLKYNPTERIS
                     FQEFFNDNLITCDLEDTNKPLETSEIDENLFISEYISPIKKSERSRLIQPMTAINSSE
                     PREEMRMNRLSGQEQEQMQEQMQEQMQEQMQEQMQEQEQEQEQEQEQEQERKENNKYG
                     IEFSSEGFYQKGDNIVVEDESVEKTMSPSKAGNFNRPVSEVQNDEEIKRLIYKSSPVP
                     EQLSKSINTSSPNMKVRRDEVIVENDYVVVEKRAVEVNALADELAHTGSGAIAIHDPR
                     FTSSNTANTDSGNSNNSNKTNSLQQQHHHHHQQSQSQSQQQVKSTRRTSSSGSQRRPS
                     FGDRRISISISPTSALSKAIGIASHRLFGAGNDSQNVNNQKIDNETQTLHTSHTPHAL
                     QAPQDKISDPISNPEFANHALLQRLYLPTSATVINNNDSLGLQGSNYSSYASSSLEPS
                     NKEEVVLFKLETLATKAHAIYLFADVKFSQLIPSPPSWDEINRDADGESLPPRIIKSI
                     SEEGMALYMKSLSLLAKGMSVASDWWYEQFGGSGASAQSRTNADLVLSRKINQLVQWI
                     REKFNECLEKAEYVKLRFQEAQSILSATDNDYYRDHLDTPQVVAEKLIFDRALEMSRN
                     AAVNELVKEDLKGCELAYSTAIWMLEALLDEEEDPDTNSTIRRLDEDDRQMVERFIIS
                     IGNRLSVLKRKLDLL"
     gene            <1287110..>1287598
                     /locus_tag="PVL30_004337"
                     /old_locus_tag="LELG_04618"
                     /db_xref="GeneID:5231331"
     mRNA            <1287110..>1287598
                     /locus_tag="PVL30_004337"
                     /old_locus_tag="LELG_04618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001524596.1"
                     /db_xref="GeneID:5231331"
     CDS             1287110..1287598
                     /locus_tag="PVL30_004337"
                     /old_locus_tag="LELG_04618"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001524646.2"
                     /db_xref="GeneID:5231331"
                     /translation="MSSTSYEATTYYSLHAVYSSDLPFFITQTTLSYLLSGEIELSRM
                     RVDKIVPSEMNITLSTGSPYGNERIKEIVILFDEYANHTRPLTELSYKYNYNYASLSE
                     KEIQLELSNGVMETLSIESSSTNEVQRLLEEQLVLPNKPQNNLSLRVRAASRRQEMLR
                     LG"
     gene            complement(<1292565..>1294886)
                     /gene="PMT6"
                     /locus_tag="PVL30_004338"
                     /old_locus_tag="LELG_04619"
                     /db_xref="GeneID:5231372"
     mRNA            complement(<1292565..>1294886)
                     /gene="PMT6"
                     /locus_tag="PVL30_004338"
                     /old_locus_tag="LELG_04619"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /transcript_id="XM_001524597.2"
                     /db_xref="GeneID:5231372"
     CDS             complement(1292565..1294886)
                     /gene="PMT6"
                     /locus_tag="PVL30_004338"
                     /old_locus_tag="LELG_04619"
                     /note="CAZy:GT39"
                     /codon_start=1
                     /transl_table=12
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="XP_001524647.2"
                     /db_xref="GeneID:5231372"
                     /db_xref="PFAM:PF02366"
                     /db_xref="PFAM:PF02815"
                     /db_xref="PFAM:PF16192"
                     /translation="MSDSYTSSSLSHKQAGILKHRTEAVGNSRIDEYSSTDKIDTNST
                     LDMEELIHKTSQLKLAEQRSRSRSKMWEIASPLILTAISAFVRIYRIDMANKVIWDEA
                     HFGKFASQYLKQEHYFDVHPPMGKLLLGLAGYLAEYDGSFEFKSGQVYPDSVNFVVMR
                     LFSCIFGVLTTPLAYQTSLRMGYSQQACWLISLMVTFEQMSLTLSRFILLDSILLFFA
                     AFTFFGLLNLHKVVVANRDLTKEGLKWFTLTGLSIGCVCSVKWVGLFITSVVGLYTAI
                     DLLLKTLRQMSSSRQSHLKYLGHWIVRVATLIMLPMSIYMAAFKVHFTVLKYAGDATG
                     STSTLLQASFVNSDLLSGPRSVSFESMVTIRSLGLSPNLLHSHEHNYPMGSQEQQITA
                     YAFKDANNQFVIKHPSHESYHSITNTTLIENFDTFRIMHNKTGCYLRSQPINAALSDH
                     DFEVSCTYEDESENKEEQEWVLEIQGQEKSPIPQFQNESEMELHPISTSFRLRNKHLG
                     CYLASTGREYPPWGFRQGEVVCKYSLFSKDKTTWWNVEDHQNSALNLPAIPYVPPKPN
                     FWKEFVLLNYGMMISNSALLPDPDRFDRLSSEWWEWPILRTGLRMSGWGENDFKCFLI
                     GNPLITWSSSCALVISVLILAKMLFGYQRQQQQQQQQQQQQRNEEYLIPCLILPLAAW
                     IFNLLPFLFMGRVKYLHHYMPAQYFAIFVTGFVVDRMLSSNKIPSFIRNLVYVVIYIL
                     IAVTFWKLKDLAYGMVGSPKNFRHLRLLSTWMI"
     gene            complement(<1295448..>1296038)
                     /gene="sec66"
                     /locus_tag="PVL30_004339"
                     /db_xref="GeneID:85890405"
     mRNA            complement(<1295448..>1296038)
                     /gene="sec66"
                     /locus_tag="PVL30_004339"
                     /product="Translocation protein S66"
                     /transcript_id="XM_061119539.1"
                     /db_xref="GeneID:85890405"
     CDS             complement(1295448..1296038)
                     /gene="sec66"
                     /locus_tag="PVL30_004339"
                     /note="BUSCO:EOG09264TQ5"
                     /codon_start=1
                     /transl_table=12
                     /product="Translocation protein S66"
                     /protein_id="XP_060975522.1"
                     /db_xref="GeneID:85890405"
                     /db_xref="PFAM:PF09802"
                     /translation="MAEETEIPTPEPVKISVFTPLIYVGLLLTIFAVFSIYYRKRRVE
                     KFKEVKPIFKENYNALVYQQLKSQYNDKDTPKEKRPHEKLLKAALLRRAVEAIRRSMK
                     LKENEPVFNKLYQNGLIGDDLFKQLEFEMKFQEIELKEIVVECESYKKGWAQTFFPLA
                     QEICFNEALRRRLNAMEARSDDLAALWDYKADISGK"
     gene            complement(<1296620..>1297231)
                     /gene="MRP8"
                     /locus_tag="PVL30_004340"
                     /db_xref="GeneID:85890406"
     mRNA            complement(<1296620..>1297231)
                     /gene="MRP8"
                     /locus_tag="PVL30_004340"
                     /product="mitochondrial ribosomal protein"
                     /transcript_id="XM_061119540.1"
                     /db_xref="GeneID:85890406"
     CDS             complement(1296620..1297231)
                     /gene="MRP8"
                     /locus_tag="PVL30_004340"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial ribosomal protein"
                     /protein_id="XP_060975523.1"
                     /db_xref="GeneID:85890406"
                     /db_xref="PFAM:PF07957"
                     /translation="MSNAEDRIARLEALVEKQSKLIATTGQRLLELQVHDVKSKMSQI
                     SSSEGQSSKLDSDEFITNEDVVQLVTELQTQLDFLEDRSMRRTHNSTLKEDTEKLAPL
                     SNRDGDFPEFSIPITFGDFKALSKEGVLRMGLFFEIILPSEGEISETLSKSTDTKNDL
                     INLAKNKDISELMNNFDDEQVDDVYDELARYFGIKHRRRADGW"
     gene            <1298226..>1298675
                     /locus_tag="PVL30_004341"
                     /db_xref="GeneID:85890407"
     mRNA            join(<1298226..1298233,1298414..>1298675)
                     /locus_tag="PVL30_004341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119541.1"
                     /db_xref="GeneID:85890407"
     CDS             join(1298226..1298233,1298414..1298675)
                     /locus_tag="PVL30_004341"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975524.1"
                     /db_xref="GeneID:85890407"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1298733..>1300611)
                     /locus_tag="PVL30_004342"
                     /db_xref="GeneID:85890408"
     mRNA            complement(join(<1298733..1298772,1299353..>1300611))
                     /locus_tag="PVL30_004342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119542.1"
                     /db_xref="GeneID:85890408"
     CDS             complement(join(1298733..1298772,1299353..1300611))
                     /locus_tag="PVL30_004342"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975525.1"
                     /db_xref="GeneID:85890408"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1301765..>1302433
                     /locus_tag="PVL30_004343"
                     /db_xref="GeneID:85890409"
     mRNA            join(<1301765..1301772,1301953..>1302433)
                     /locus_tag="PVL30_004343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119543.1"
                     /db_xref="GeneID:85890409"
     CDS             join(1301765..1301772,1301953..1302433)
                     /locus_tag="PVL30_004343"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975526.1"
                     /db_xref="GeneID:85890409"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGNSGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGG
                     GGGGGDGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNP
                     EN"
     gene            complement(<1302491..>1304369)
                     /locus_tag="PVL30_004344"
                     /db_xref="GeneID:85890410"
     mRNA            complement(join(<1302491..1302530,1303111..>1304369))
                     /locus_tag="PVL30_004344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119544.1"
                     /db_xref="GeneID:85890410"
     CDS             complement(join(1302491..1302530,1303111..1304369))
                     /locus_tag="PVL30_004344"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975527.1"
                     /db_xref="GeneID:85890410"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1305526..>1306179
                     /locus_tag="PVL30_004345"
                     /db_xref="GeneID:85890411"
     mRNA            join(<1305526..1305533,1305714..>1306179)
                     /locus_tag="PVL30_004345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119545.1"
                     /db_xref="GeneID:85890411"
     CDS             join(1305526..1305533,1305714..1306179)
                     /locus_tag="PVL30_004345"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975528.1"
                     /db_xref="GeneID:85890411"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGG
                     DGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1306237..>1308115)
                     /locus_tag="PVL30_004346"
                     /db_xref="GeneID:85890412"
     mRNA            complement(join(<1306237..1306276,1306857..>1308115))
                     /locus_tag="PVL30_004346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119546.1"
                     /db_xref="GeneID:85890412"
     CDS             complement(join(1306237..1306276,1306857..1308115))
                     /locus_tag="PVL30_004346"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975529.1"
                     /db_xref="GeneID:85890412"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1309272..>1309940
                     /locus_tag="PVL30_004347"
                     /db_xref="GeneID:85890413"
     mRNA            join(<1309272..1309279,1309460..>1309940)
                     /locus_tag="PVL30_004347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119547.1"
                     /db_xref="GeneID:85890413"
     CDS             join(1309272..1309279,1309460..1309940)
                     /locus_tag="PVL30_004347"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975530.1"
                     /db_xref="GeneID:85890413"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGNSGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGG
                     GGGGGDGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNP
                     EN"
     gene            complement(<1309998..>1311876)
                     /locus_tag="PVL30_004348"
                     /db_xref="GeneID:85890414"
     mRNA            complement(join(<1309998..1310037,1310618..>1311876))
                     /locus_tag="PVL30_004348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119548.1"
                     /db_xref="GeneID:85890414"
     CDS             complement(join(1309998..1310037,1310618..1311876))
                     /locus_tag="PVL30_004348"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975531.1"
                     /db_xref="GeneID:85890414"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1313033..>1313701
                     /locus_tag="PVL30_004349"
                     /db_xref="GeneID:85890415"
     mRNA            join(<1313033..1313040,1313221..>1313701)
                     /locus_tag="PVL30_004349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119549.1"
                     /db_xref="GeneID:85890415"
     CDS             join(1313033..1313040,1313221..1313701)
                     /locus_tag="PVL30_004349"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975532.1"
                     /db_xref="GeneID:85890415"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGNSGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGG
                     GGGGGDGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNP
                     EN"
     gene            complement(<1313759..>1315637)
                     /locus_tag="PVL30_004350"
                     /db_xref="GeneID:85890416"
     mRNA            complement(join(<1313759..1313798,1314379..>1315637))
                     /locus_tag="PVL30_004350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119550.1"
                     /db_xref="GeneID:85890416"
     CDS             complement(join(1313759..1313798,1314379..1315637))
                     /locus_tag="PVL30_004350"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975533.1"
                     /db_xref="GeneID:85890416"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1316794..>1317411
                     /locus_tag="PVL30_004351"
                     /db_xref="GeneID:85890417"
     mRNA            join(<1316794..1316801,1316982..>1317411)
                     /locus_tag="PVL30_004351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119551.1"
                     /db_xref="GeneID:85890417"
     CDS             join(1316794..1316801,1316982..1317411)
                     /locus_tag="PVL30_004351"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975534.1"
                     /db_xref="GeneID:85890417"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGG
                     DGNSGGGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1317469..>1319347)
                     /locus_tag="PVL30_004352"
                     /db_xref="GeneID:85890418"
     mRNA            complement(join(<1317469..1317508,1318089..>1319347))
                     /locus_tag="PVL30_004352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119552.1"
                     /db_xref="GeneID:85890418"
     CDS             complement(join(1317469..1317508,1318089..1319347))
                     /locus_tag="PVL30_004352"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975535.1"
                     /db_xref="GeneID:85890418"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1320519..>1321166
                     /locus_tag="PVL30_004353"
                     /db_xref="GeneID:85890419"
     mRNA            join(<1320519..1320526,1320707..>1321166)
                     /locus_tag="PVL30_004353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119553.1"
                     /db_xref="GeneID:85890419"
     CDS             join(1320519..1320526,1320707..1321166)
                     /locus_tag="PVL30_004353"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975536.1"
                     /db_xref="GeneID:85890419"
                     /translation="MAGSGGSGGGHSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGGDG
                     NSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1321224..>1323102)
                     /locus_tag="PVL30_004354"
                     /db_xref="GeneID:85890420"
     mRNA            complement(join(<1321224..1321263,1321844..>1323102))
                     /locus_tag="PVL30_004354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119554.1"
                     /db_xref="GeneID:85890420"
     CDS             complement(join(1321224..1321263,1321844..1323102))
                     /locus_tag="PVL30_004354"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975537.1"
                     /db_xref="GeneID:85890420"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1324274..>1324927
                     /locus_tag="PVL30_004355"
                     /db_xref="GeneID:85890421"
     mRNA            join(<1324274..1324281,1324462..>1324927)
                     /locus_tag="PVL30_004355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119555.1"
                     /db_xref="GeneID:85890421"
     CDS             join(1324274..1324281,1324462..1324927)
                     /locus_tag="PVL30_004355"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975538.1"
                     /db_xref="GeneID:85890421"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGG
                     DGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1324985..>1326863)
                     /locus_tag="PVL30_004356"
                     /db_xref="GeneID:85890422"
     mRNA            complement(join(<1324985..1325024,1325605..>1326863))
                     /locus_tag="PVL30_004356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119556.1"
                     /db_xref="GeneID:85890422"
     CDS             complement(join(1324985..1325024,1325605..1326863))
                     /locus_tag="PVL30_004356"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975539.1"
                     /db_xref="GeneID:85890422"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1328020..>1328688
                     /locus_tag="PVL30_004357"
                     /db_xref="GeneID:85890423"
     mRNA            join(<1328020..1328027,1328208..>1328688)
                     /locus_tag="PVL30_004357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119557.1"
                     /db_xref="GeneID:85890423"
     CDS             join(1328020..1328027,1328208..1328688)
                     /locus_tag="PVL30_004357"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975540.1"
                     /db_xref="GeneID:85890423"
                     /translation="MAGSGGSGGGHSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGGDG
                     NSGGGDGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNP
                     EN"
     gene            complement(<1328746..>1330624)
                     /locus_tag="PVL30_004358"
                     /db_xref="GeneID:85890424"
     mRNA            complement(join(<1328746..1328785,1329366..>1330624))
                     /locus_tag="PVL30_004358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119558.1"
                     /db_xref="GeneID:85890424"
     CDS             complement(join(1328746..1328785,1329366..1330624))
                     /locus_tag="PVL30_004358"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975541.1"
                     /db_xref="GeneID:85890424"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1331796..>1332464
                     /locus_tag="PVL30_004359"
                     /db_xref="GeneID:85890425"
     mRNA            join(<1331796..1331803,1331984..>1332464)
                     /locus_tag="PVL30_004359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119559.1"
                     /db_xref="GeneID:85890425"
     CDS             join(1331796..1331803,1331984..1332464)
                     /locus_tag="PVL30_004359"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975542.1"
                     /db_xref="GeneID:85890425"
                     /translation="MAGSGGSGGGHSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSG
                     GGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGGDG
                     NSGGGDGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNP
                     EN"
     gene            complement(<1332522..>1334400)
                     /locus_tag="PVL30_004360"
                     /db_xref="GeneID:85890426"
     mRNA            complement(join(<1332522..1332561,1333142..>1334400))
                     /locus_tag="PVL30_004360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119560.1"
                     /db_xref="GeneID:85890426"
     CDS             complement(join(1332522..1332561,1333142..1334400))
                     /locus_tag="PVL30_004360"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975543.1"
                     /db_xref="GeneID:85890426"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1335572..>1336225
                     /locus_tag="PVL30_004361"
                     /db_xref="GeneID:85890427"
     mRNA            join(<1335572..1335579,1335760..>1336225)
                     /locus_tag="PVL30_004361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119561.1"
                     /db_xref="GeneID:85890427"
     CDS             join(1335572..1335579,1335760..1336225)
                     /locus_tag="PVL30_004361"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975544.1"
                     /db_xref="GeneID:85890427"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGG
                     DGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1336283..>1338161)
                     /locus_tag="PVL30_004362"
                     /db_xref="GeneID:85890428"
     mRNA            complement(join(<1336283..1336322,1336903..>1338161))
                     /locus_tag="PVL30_004362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119562.1"
                     /db_xref="GeneID:85890428"
     CDS             complement(join(1336283..1336322,1336903..1338161))
                     /locus_tag="PVL30_004362"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975545.1"
                     /db_xref="GeneID:85890428"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTGNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            <1339318..>1339971
                     /locus_tag="PVL30_004363"
                     /db_xref="GeneID:85890429"
     mRNA            join(<1339318..1339325,1339506..>1339971)
                     /locus_tag="PVL30_004363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119563.1"
                     /db_xref="GeneID:85890429"
     CDS             join(1339318..1339325,1339506..1339971)
                     /locus_tag="PVL30_004363"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975546.1"
                     /db_xref="GeneID:85890429"
                     /translation="MAGSGGSGGGHSGGGSGGGHSGGGSSSGGSSIGGDGSSGGGDGN
                     SGGGDGSSGGGSSGSSGDGSSGGGGDGSSGGGSSGSSGDGSSGSSGDGSSGGGGGGGG
                     DGNSGGGDGNSGGGDGSSGGGSSGGGSGSSGGGGSKAIPPRANNDYYVAKLNPEN"
     gene            complement(<1340029..>1341907)
                     /locus_tag="PVL30_004364"
                     /old_locus_tag="LELG_05605"
                     /db_xref="GeneID:5230167"
     mRNA            complement(join(<1340029..1340068,1340649..>1341907))
                     /locus_tag="PVL30_004364"
                     /old_locus_tag="LELG_05605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523009.2"
                     /db_xref="GeneID:5230167"
     CDS             complement(join(1340029..1340068,1340649..1341907))
                     /locus_tag="PVL30_004364"
                     /old_locus_tag="LELG_05605"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523059.2"
                     /db_xref="GeneID:5230167"
                     /db_xref="PFAM:PF01504"
                     /translation="MPFFNKCFQNVFAKDSKPAEPKVRFKLSQKPALKSPKVAFEKLK
                     TAFVKKAKSSPTSQLSEKVESKSPSSLTNNLSIAKNAERFFLTEGIKISIIDSERRLW
                     NKYDSVDIVMSSEGSNAKFKSISPKIFHWVRRMLGLSDALILQSFGIDEDSVIKIGES
                     LFSSADGKYLIYSVTKEHFEDIRDKAAKMNTHYEKPSFLLPYLHLFSFEFEGEERYYT
                     MTPAFDKETNIVYGLQNDLKGVNMFTESSSNAINTTDTTASNHQTNSNSKKNTKHTKH
                     TKQTKHTENTENTENTKNTSFAAYFSSSSKRQSYYIDESSPTSNVRFPMLAKERKDIL
                     SKLARDIAYLTKQNKIGYKLLVGVGPKVARRPRIQVWIVDYHKSYIKEGGSKKFFRFG
                     KTKVKTPEEYARWLLETFNQHIEVVEGGINKAQRDHRITG"
     gene            complement(<1342699..>1344225)
                     /locus_tag="PVL30_004365"
                     /old_locus_tag="LELG_05606"
                     /db_xref="GeneID:5230221"
     mRNA            complement(<1342699..>1344225)
                     /locus_tag="PVL30_004365"
                     /old_locus_tag="LELG_05606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523010.1"
                     /db_xref="GeneID:5230221"
     CDS             complement(1342699..1344225)
                     /locus_tag="PVL30_004365"
                     /old_locus_tag="LELG_05606"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523060.2"
                     /db_xref="GeneID:5230221"
                     /translation="MSRTKAKKRPTLQTERVSVLSELHPRRKVKKITVTIKLPINVLT
                     AINQKNYNAVVKTPLRQGDGTVGQLEGIFTDDTERQIPSKKSSPTARHSEDFNDITEL
                     EREILSQLDPSLGNCSSHSHQGKPNIMNDEVLLKSRTGDGEPDVDTKLHDTTELSEER
                     EKPRHLENDRFRKDTSTKPKAEYKSVPPNIIPLLKSELCNSESGDDEALIDSVAFSLN
                     DPLGGGRIKFPVKSRFCTHLECFDYFNFCIFNKITSTTQSVTQRNLIRQNYDRLSKSD
                     KRAHNGMYVQRSAANGKQRQLPNGGRLQFSQTHGSSGFNGFNGFNGPEGSNNLKDIRL
                     PSYVTILENPNPVYTSRFLTPGYQNCPFYKCPICEVSFPLSALMVSDVFNYFLKMTSQ
                     DVHKVELLGSEKYRPIGHGGFSSTKTFRVEGERAENDAAGGEETILDTISISSDDGSD
                     DDHKERIKEEEVNKAFPSRNNKTTIPVPPTSTMETFWNSYNWSNEGNGDSWDDPVVID
                     "
     gene            complement(<1344890..>1345924)
                     /locus_tag="PVL30_004366"
                     /old_locus_tag="LELG_05607"
                     /db_xref="GeneID:5230240"
     mRNA            complement(<1344890..>1345924)
                     /locus_tag="PVL30_004366"
                     /old_locus_tag="LELG_05607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523011.1"
                     /db_xref="GeneID:5230240"
     CDS             complement(1344890..1345924)
                     /locus_tag="PVL30_004366"
                     /old_locus_tag="LELG_05607"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523061.2"
                     /db_xref="GeneID:5230240"
                     /db_xref="PFAM:PF00397"
                     /translation="MSDNLGNLDKLPNGWVAQWDEEYKRYYYVNKATGKSQWEFPTEE
                     ETNYSDNERHDAEQKSYQRPEAGPSEGTRGFGIGQGEQSEQGEQGEQSERGIGSFVMN
                     QAMSSMSGSKHNNYQGSSNSGLNSAGLGAAVSMVGSYLASHSSGQNKPAGNNSSGGLG
                     GMISSFLGNGNSQNNSGNYQGNSGYNSNNYGGNYNNSNSYNGGNSNSGNPYGGQSQQG
                     GGLTGMIGNLIGGGSSSNQGSYSRPEQSYNNSNQNQRPQEGFGYSGSNSGSGRYDESN
                     RFGGEFGMPGGEQGHHGHHGRHSEGRFGEDQPGYGPNRNEGRNRYDPSSSNDNYGGGA
                     FGYNTGNNRY"
     gene            complement(<1346835..>1347347)
                     /gene="YFH1"
                     /locus_tag="PVL30_004367"
                     /old_locus_tag="LELG_05608"
                     /db_xref="GeneID:5230148"
     mRNA            complement(<1346835..>1347347)
                     /gene="YFH1"
                     /locus_tag="PVL30_004367"
                     /old_locus_tag="LELG_05608"
                     /product="Mitochondrial matrix iron chaperone"
                     /transcript_id="XM_001523012.2"
                     /db_xref="GeneID:5230148"
     CDS             complement(1346835..1347347)
                     /gene="YFH1"
                     /locus_tag="PVL30_004367"
                     /old_locus_tag="LELG_05608"
                     /note="BUSCO:EOG092659DX"
                     /codon_start=1
                     /transl_table=12
                     /product="Mitochondrial matrix iron chaperone"
                     /protein_id="XP_001523062.2"
                     /db_xref="GeneID:5230148"
                     /db_xref="PFAM:PF01491"
                     /translation="MLKRSIAQILKFRKPAGSFRLLASRRISRISVSRNGATLLSRPY
                     SVSTQGENLEGKIDQLDDNTYNTISNEYLDSLSDALENLNEEFEQVDSELSHGVLTLT
                     LPPNGTYVINKQPPNKQIWLSSPISGPKRYDSIGGKWVTLRDGSSLTALLEEEISHAV
                     GTNVKFDMTM"
     gene            <1347717..>1348217
                     /locus_tag="PVL30_004368"
                     /old_locus_tag="LELG_05609"
                     /db_xref="GeneID:5230152"
     mRNA            <1347717..>1348217
                     /locus_tag="PVL30_004368"
                     /old_locus_tag="LELG_05609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523013.1"
                     /db_xref="GeneID:5230152"
     CDS             1347717..1348217
                     /locus_tag="PVL30_004368"
                     /old_locus_tag="LELG_05609"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523063.2"
                     /db_xref="GeneID:5230152"
                     /translation="MFLLIIFIAIILVLLVLALPYISGLTTVEINKPSKSVGRNKGTE
                     RARDKSGPNNDGNVSYGYIPPDEVVSEDSTGTGFKSKVSAVGQKLQVHSEDLPIQIKL
                     ANAKNEQHELRRRKHQKLDIDTDPNTYDYDIDDLIAEENATARQEQQAEFYRNQKIGG
                     EKEEMV"
     gene            complement(<1349255..>1352086)
                     /gene="VAC7"
                     /locus_tag="PVL30_004369"
                     /old_locus_tag="LELG_05610"
                     /db_xref="GeneID:5230177"
     mRNA            complement(<1349255..>1352086)
                     /gene="VAC7"
                     /locus_tag="PVL30_004369"
                     /old_locus_tag="LELG_05610"
                     /product="Vacuolar inheritance and morphology protein"
                     /transcript_id="XM_001523014.2"
                     /db_xref="GeneID:5230177"
     CDS             complement(1349255..1352086)
                     /gene="VAC7"
                     /locus_tag="PVL30_004369"
                     /old_locus_tag="LELG_05610"
                     /codon_start=1
                     /transl_table=12
                     /product="Vacuolar inheritance and morphology protein"
                     /protein_id="XP_001523064.2"
                     /db_xref="GeneID:5230177"
                     /translation="MNTSSAHSQSQMESKKNKPEKQKMSEKQSELEKQQREPERAKDM
                     VEQSSHVSQNTVTHTIDNKPKQSTSTSNGVSDLPSADSSDKIDNSRKDLSSLTSSKSE
                     KTKQKVIDNEGASNYSSNGRAPTHVNVPQRSAGTPTAATGTTPTTTTTTTTTTKPELE
                     NVNSSSSKGNSGLGLSVAPAKAGGLQILNDENTQSRQEPSARKANVQSVLQASQSGSP
                     APEIHQTKQSSLVAQPSSLMMNSNGSSLHTPSISNMTDSDARNKNTKHKRIAKQNSTK
                     TDFFAAKLASAVDDVESSDSDETFVYENANDDYDETSSVNRDFLLDTASINGLGVGAV
                     VGSGTSAGIGLSSCSNPYQRSLPLDGENEKRPEKTLNKKTHSVANSLNNPTSSEKDLH
                     KRPLALRTFSSFSANEPEAKTIVYRNLEKIPGEASSSADHKLRASQASVGVAHSITED
                     ENEDAFSYKGSEDGYSIDCDGDREARHPDKKNSAESSEHIRSVDGRNEIHRSSFEASV
                     TNGTGTGTGTGAVSGAVTGVDASSSGAGALQSTASKSNSRKKYQSSTASSKLRSTTSK
                     LFDKKGSQPKRYSIIPDDFDIEDFDDELIYYDNKADTHENDKTPLLNLKQGIPHYRSL
                     NLHAPGIKHQNKRYISGNGQPLISSPDSRAGIVQNNGKRAFPFPHQEIYPRYYYDVDP
                     FDQESQVYESDFDLADSNNTRKKGLRHLDKTDGYTENNGHPFLLTQRPLSSKHGFCKS
                     FLYTFICIFAILTVGFILGFFMATTKELSNVGIVSIENPIVSKDELVFNILVEAFNPG
                     WFSVDIEEVELDLFARSGYLPDSPPALSKNLQARKDSSKLETVKLGSISNLESAMNFK
                     AGFFSREPSTQRGEVKLLNPGKNITSADSTQQFRDDTDNSLKWSIISENPFDLIITGV
                     LKYTLPMGRSTKSVVVRKTGYIDPTLFIM"
     gene            complement(<1353209..>1355491)
                     /gene="BAS1"
                     /locus_tag="PVL30_004370"
                     /old_locus_tag="LELG_05611"
                     /db_xref="GeneID:5230290"
     mRNA            complement(<1353209..>1355491)
                     /gene="BAS1"
                     /locus_tag="PVL30_004370"
                     /old_locus_tag="LELG_05611"
                     /product="myb-like DNA-binding protein bas1"
                     /transcript_id="XM_001523015.2"
                     /db_xref="GeneID:5230290"
     CDS             complement(1353209..1355491)
                     /gene="BAS1"
                     /locus_tag="PVL30_004370"
                     /old_locus_tag="LELG_05611"
                     /codon_start=1
                     /transl_table=12
                     /product="myb-like DNA-binding protein bas1"
                     /protein_id="XP_001523065.2"
                     /db_xref="GeneID:5230290"
                     /db_xref="PFAM:PF00249"
                     /db_xref="PFAM:PF13921"
                     /translation="MSQTPVNEDIKTEKQLNSRKRLLPIDALAITESLGLQTFRKESR
                     KSWTKEEDTFLSKVITEKLDNDSKLENIDWEEVAKLVSADGSKKGKDCRKRWNNCLDP
                     GLRKGKWTNEEDEQLINAFEKFGASWLKVAQEIKGRTEDQCAKRYKEILDPKTKGRLK
                     PWSKEEDLALVAQVKTHGTKWRTICTAFESRPSLTCRNRWRKLVTDVVRDKASPEIKQ
                     AVEGITSESAVLLDSLSRQQEELTKRNSSIQDPKRDNKRQKMFNFEHQGVSHTSYSNN
                     NHNGYNNNHHINSRGYKRETSAEPSATETRTEWRYELGSKNPRQSSSFTGVIKDRESA
                     ELLLNYAQTRNYNVTIHQHIHHHYGQRRRESNTSFNSDDPLQNSNLIEPEQSASRFQH
                     FNYLPPRTEVPKLGSSSPDGNEVHRQHHHHHYYHHVYPHEDGKSQITTQANIDQSPDE
                     TILSRVEDDKNSNIDNGNKNNHNHNNTNNNKQMEQDTRPCNVETFRKHDLSKQASSNP
                     LTPLTQAVELLTSAENNQNQNHNHNHNQIHHPHKAHQDHNQNHNQKYNQNRNQNQEPA
                     FMGDEMEGLEMAGGNEPEPHGSDFWETMKDLHKPLSANDALPPSPPPPPLSQQNGNIH
                     KPKDDFKAKVRYNTDVSVSGSNFINSNGAISQQFSSETFGQPKVIDATEFHSDQANGG
                     FASQHMDEEDEVLAREVGEVGIDQEILDSYGLFYNVYTKEGSTFPDSQPNQQTSQQQA
                     SVGSTYDQWGSGFIIPFNPS"
     gene            complement(<1356215..>1357171)
                     /gene="MTD1"
                     /locus_tag="PVL30_004371"
                     /old_locus_tag="LELG_05614"
                     /db_xref="GeneID:5230149"
     mRNA            complement(<1356215..>1357171)
                     /gene="MTD1"
                     /locus_tag="PVL30_004371"
                     /old_locus_tag="LELG_05614"
                     /product="NAD-dependent 5,10-methylenetetrahydrafolate
                     dehydrogenase"
                     /transcript_id="XM_001523018.1"
                     /db_xref="GeneID:5230149"
     CDS             complement(1356215..1357171)
                     /gene="MTD1"
                     /locus_tag="PVL30_004371"
                     /old_locus_tag="LELG_05614"
                     /note="BUSCO:EOG09263RW3"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD-dependent 5,10-methylenetetrahydrafolate
                     dehydrogenase"
                     /protein_id="XP_001523068.2"
                     /db_xref="GeneID:5230149"
                     /db_xref="PFAM:PF00763"
                     /translation="MSRPAGRTILASTIAKPYQEEVIAAVSKLSFRPTLVGFLANDDP
                     AARMYANWTGKTCESLGFTYKLVETSKNDLETSLIKANKDNDVNGIMVYFPVFGDKQD
                     QYLQQLISPEKDVEGLNFLYYHNLYHNVRFLDPPHNQQKSIIPCTPLAMVKILEYLGV
                     YNNILHYGNRLYGKKVLIVNRSEVVGRPLAALLANDGATVYSVDINNIQQFTRGDDLS
                     ERRHLVKDLNDDESSLEKLAPQCDVIITGVPSESYKFPTELVSHGTVVINFSSFKNFN
                     DDVKERAGLYVPSIGKVTIAILLRNLLRLIDNKQIRSQTESA"
     gene            complement(<1358263..>1360125)
                     /gene="GYP1"
                     /locus_tag="PVL30_004372"
                     /old_locus_tag="LELG_05615"
                     /db_xref="GeneID:5230294"
     mRNA            complement(<1358263..>1360125)
                     /gene="GYP1"
                     /locus_tag="PVL30_004372"
                     /old_locus_tag="LELG_05615"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_001523019.1"
                     /db_xref="GeneID:5230294"
     CDS             complement(1358263..1360125)
                     /gene="GYP1"
                     /locus_tag="PVL30_004372"
                     /old_locus_tag="LELG_05615"
                     /note="BUSCO:EOG09261YLQ"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase-activating protein"
                     /protein_id="XP_001523069.2"
                     /db_xref="GeneID:5230294"
                     /db_xref="PFAM:PF00566"
                     /translation="MGKKKQEMAQVYSGSKDEFIFGEEGGRGKNLSSFLKNLSLTGSA
                     TSPSRTSTSRDSIEEANKNIYGSLSYKGGNDNRITSSLWSSPSHYQYHHQQHQQQEQQ
                     NTSPRPSNIRSLSSGVLNHPHSHFQSTSSIDKKLKGSNNGRINYKDLDDDWNSEISED
                     VSIGATRPTNASYPSLSIGSKKPFPEGEKQHDKYAMGGGEALQKATEGGLGPAAFDAK
                     QSKFRKFRSVLANDGVIDINELRKLSWNGIPDELRALAWLLLSGYLPTNRTRQASTLK
                     RKRQEYFDGVVSMNINFEDSTGIGGAKHQSQQHQQNQKVANSRENNIYHQIKIDVKRT
                     NPTSALYAHSSTQVSLQKILYLWAIRHPASGYVQGINDLATPFYQTFLAHYIWQLKRK
                     KGKKMKEDEILFIPGYISCGGDDDDEVESEKEEKEEEEEEETLLLNSDDILQLDVQTF
                     DPGRLSARVISLIEADTYWCLSRLLETITDNYIHEQPGILRQVSELKTLISKIDSDLI
                     RHFDSEGIEFVQFAFRWINCLLMRELPMPLIVRMWDTYLSEQPLGFNTFHTYVCAAFL
                     IRFSKELKSKDFQEILLFLQNPPTSSWKEKDVELMLSEAYIWQSLYKNAAAHLK"
     gene            complement(<1360690..>1362315)
                     /gene="SSZ1"
                     /locus_tag="PVL30_004373"
                     /old_locus_tag="LELG_05616"
                     /db_xref="GeneID:5230159"
     mRNA            complement(<1360690..>1362315)
                     /gene="SSZ1"
                     /locus_tag="PVL30_004373"
                     /old_locus_tag="LELG_05616"
                     /product="Hsp70 protein that interacts with Zuo1p"
                     /transcript_id="XM_001523020.1"
                     /db_xref="GeneID:5230159"
     CDS             complement(1360690..1362315)
                     /gene="SSZ1"
                     /locus_tag="PVL30_004373"
                     /old_locus_tag="LELG_05616"
                     /codon_start=1
                     /transl_table=12
                     /product="Hsp70 protein that interacts with Zuo1p"
                     /protein_id="XP_001523070.2"
                     /db_xref="GeneID:5230159"
                     /db_xref="PFAM:PF00012"
                     /db_xref="PFAM:PF06723"
                     /translation="MSVIGITFGNTSSSIAVATQDGKVDVIANPDGDRSIPSALSYVG
                     TDEYHGSQAESRLIRNPENTIVNFRDFVGKKFADIKHDFSYGAKPQDANGEIAYKIVN
                     DGKTEVLSLNTVVERHFKQLKSAAEDYIGKPVKNVVLAVPTDFTEHQREELSKIVGNA
                     GLNVLQLINEPSAALLDHLSSEEGKLAEDKIYAVADFGGVRSDGAIISVRGGVLTILA
                     TAHEYGLGGDNLDAALSEFFAKEFEKKYKVDPRKTARSLAKLKAESITVRKTLSNVQT
                     STCSIESLAEGFDFHTSINRLRYELTAREPLSKMTAFVEKLIAKAELDPLDIDEVLLV
                     GGCAHTPKLASSISYLFPASTKVIAPSLVTKASNPSELVARGAALQAALIEGFDQEEI
                     NESLQPIVVNTQHLSKPIGIKDADGKFVPILVAETAYPIKRSLEVTNGENSTVSIQLY
                     EGKRTVKETVVENAHDDEEDSEDEDSEEEPEIEREVVYEAGDLLAELSLSDLKPNAKV
                     EVTVNITQNGVLHLTGRELKQGATPVKGEISSQ"
     gene            <1363261..>1363866
                     /gene="MGT1"
                     /locus_tag="PVL30_004374"
                     /old_locus_tag="LELG_05617"
                     /db_xref="GeneID:5230165"
     mRNA            <1363261..>1363866
                     /gene="MGT1"
                     /locus_tag="PVL30_004374"
                     /old_locus_tag="LELG_05617"
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /transcript_id="XM_001523021.1"
                     /db_xref="GeneID:5230165"
     CDS             1363261..1363866
                     /gene="MGT1"
                     /locus_tag="PVL30_004374"
                     /old_locus_tag="LELG_05617"
                     /codon_start=1
                     /transl_table=12
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="XP_001523071.1"
                     /db_xref="GeneID:5230165"
                     /db_xref="PFAM:PF01035"
                     /translation="MLVKTLYYRLVEGTFAKAMLVLDEKGTLYYASLGEDSNALRETL
                     VTDFASKQRQFQLKPMVTLSNHERADYTALCFLKLMEEEEDWKNEGEESLQQKGAKRI
                     PIEFIFGTELQRKVWQQLLEIPVGEVRYYGNIVEALGLPKSASRAVGNACGANKIALV
                     VPCHRVIAQTGKLTGYRWGLATKKQILKMELGDAYTTLVSE"
     gene            1364408..1364481
                     /locus_tag="PVL30_004375"
                     /old_locus_tag="LELG_06101"
                     /db_xref="GeneID:5230153"
     tRNA            1364408..1364481
                     /locus_tag="PVL30_004375"
                     /old_locus_tag="LELG_06101"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:5230153"
     gene            <1366020..>1367660
                     /gene="ALD6"
                     /locus_tag="PVL30_004376"
                     /old_locus_tag="LELG_05618"
                     /db_xref="GeneID:5230164"
     mRNA            <1366020..>1367660
                     /gene="ALD6"
                     /locus_tag="PVL30_004376"
                     /old_locus_tag="LELG_05618"
                     /product="aldehyde dehydrogenase (NADP(+)) ald6"
                     /transcript_id="XM_001523022.1"
                     /db_xref="GeneID:5230164"
     CDS             1366020..1367660
                     /gene="ALD6"
                     /locus_tag="PVL30_004376"
                     /old_locus_tag="LELG_05618"
                     /codon_start=1
                     /transl_table=12
                     /product="aldehyde dehydrogenase (NADP(+)) ald6"
                     /protein_id="XP_001523072.1"
                     /db_xref="GeneID:5230164"
                     /db_xref="PFAM:PF00171"
                     /translation="MLSKVLKSRSIRSSTQKLMRYKTTLSLSSTTTSYPTQHTTAQDE
                     PYFTPSFIDNKFVKSDSTEWFDIHDPATNNVVSKVPQSTDAELEEAIASAHKAFPSWR
                     DTSIIKRQGVAFKFAALLRENMDRIASVIVLEQGKTFVDAQGDVTRGLQVAEAACNIT
                     NDLKAESLEVSTDMETKMVREPLGVVASICPFNFPAMVPLWSLPLILVTGNTAVIKPS
                     ERVPGAAMIICELAAQAGVPPGVINIVHGKHATVNKLIEDPRIKALTFVGGDKAGKYI
                     YEKGSALGKRVQANLGAKNHLVVLPDAPKQQFINALNGAAFGAAGQRCMAISVLVTVG
                     KTREWIEDVAKDASKLITGSGFDKSSDLGPLINPESLTKAESIIEDSVKAGANLVLDG
                     RGFRPDDAKFAKGNFLAPTILTGIKPGMRAYDEEIFAPVLSVVNVDTIDEAIELINNN
                     PYGNGVSLFTQSGAYAQYFTKRIDVGQVGINVPIPVPLPMFSFTGSRGSFLGDLNFYG
                     KAGITFLTKPKTITAAWKVQSIADDEILKPSTSMPIQQ"
     gene            complement(<1371545..>1373440)
                     /locus_tag="PVL30_004377"
                     /old_locus_tag="LELG_05619"
                     /db_xref="GeneID:5230155"
     mRNA            complement(<1371545..>1373440)
                     /locus_tag="PVL30_004377"
                     /old_locus_tag="LELG_05619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523025.1"
                     /db_xref="GeneID:5230155"
     CDS             complement(1371545..1373440)
                     /locus_tag="PVL30_004377"
                     /old_locus_tag="LELG_05619"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523075.2"
                     /db_xref="GeneID:5230155"
                     /db_xref="PFAM:PF10297"
                     /translation="MTEVASISPSSQGPATVSKPTTAKPIAPTTRLQPPQTTTSNNHL
                     AIKPAPQVIKTSKDWVLPPRPKPGRKLKEKESGAVSLKKSKKSPAKSKKTPSISTSTS
                     TSTSTNTNTVNTGAVAVANNNNNINAVTGTPRTPKSHSNTSTSNTAKTPALSSDISTI
                     SALLKNISIIDAENNQLKSSLLCLIHEYKHLKQSIFDPSYTTPGASASTTTTAASTTT
                     TSTGAAATAVAAPAVAAPASLPITIANPEGDDTNRAKIDSQVHKRSYDEYLMLSEGDK
                     IVANNHQQASIGNTEVVEKDIGIDDTNELSRLLSPAAPHNMESDNSCFSTKFSTSDNT
                     AAGTPQPFGNEDGVISEFDEFIKMDDEVEREHSLKRCKTNDDAQNRTTTARSRSNSNK
                     FNYKSYKRGGIDDKDEEEDDDDVDEEESDLDINFDEEDEHSSLSRTTSPYSSDYENNS
                     IMSTLTRSTTVSSVGTVVHDKSQLHSQLQMTSQSHQQLHQQSHQQLPHHNVLNYSNPL
                     MNSVNVIHPPPMTLKKMGTFFDLPKYEENSMNKPYKFQFDSLMGDCGVEKKRVGADGG
                     GGGGVRGQYVDDAYYQITDYLAETSLNNHLSYYDLDMDSNEYLAGDANLNANTSVGGN
                     ADGTLSL"
     gene            <1377077..>1378993
                     /locus_tag="PVL30_004378"
                     /old_locus_tag="LELG_05622"
                     /db_xref="GeneID:5230158"
     mRNA            <1377077..>1378993
                     /locus_tag="PVL30_004378"
                     /old_locus_tag="LELG_05622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523026.1"
                     /db_xref="GeneID:5230158"
     CDS             1377077..1378993
                     /locus_tag="PVL30_004378"
                     /old_locus_tag="LELG_05622"
                     /note="BUSCO:EOG09261HZD"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523076.1"
                     /db_xref="GeneID:5230158"
                     /db_xref="PFAM:PF00370"
                     /db_xref="PFAM:PF02782"
                     /translation="MPDYSTSNNLYLGFDLSTQQLKIIVTNEHLHALNTYNVEFDSVY
                     KDKYGIHKGVISGKDGEIVSPVLMWLDAIDHLFAEMKNEKFPFEKVVGISGSGQQHGS
                     IYWSHDADKLLGELNPELDLSQQLPEALSWEMSPNWQDHSTIPEANVFHDVVGKENLA
                     RITGSRAHLRFTGLQIRKFVTRSHGKEYQHTARISLVSSFVTSVLLGHIAELEQSDAC
                     GMNLYDINKQDYDDELLAIAAGVSTKADGVAKSDPKYQESIDALKQKLGPIKPITYKA
                     AGNISPYFVSKYGFSQDCKVYSFTGDNLATIISLPLQPNDCLVSLGTSTTVLLITENY
                     QPSSQYHLFKHPTMPNHYMGMICYSNGALAREKARDEINKAHKVANPKSWDQFNAILD
                     KSHSFNGKLGIYFPIGEIVPQAPAQTIRAVLDKGGDNNNNNNNNNNNNKNNNNNTNHN
                     GEYKVTSCELDTHDFVIDDDALAIVESQTLSCRLRAGPMLSKSGNSQTTSSENKEIYQ
                     SVVDKFGELYTDGKKQTVESLTSRPNKCYYVGGASNNMSIIKKMSQILGAVNGNFKVE
                     IPNACALGGAYKASWSHECEVEDKMIPYDQYIAKLFKVSEELESFSDKDLWHEYFEGV
                     GMLARMENDLLKAD"
     gene            <1379417..>1380853
                     /locus_tag="PVL30_004379"
                     /old_locus_tag="LELG_05623"
                     /db_xref="GeneID:5230161"
     mRNA            <1379417..>1380853
                     /locus_tag="PVL30_004379"
                     /old_locus_tag="LELG_05623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523027.1"
                     /db_xref="GeneID:5230161"
     CDS             1379417..1380853
                     /locus_tag="PVL30_004379"
                     /old_locus_tag="LELG_05623"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523077.2"
                     /db_xref="GeneID:5230161"
                     /translation="MSRVRYLNLQTRRLSTLLKKDIHSLQPKDLTHESINHDDYDGLR
                     KLIVELSNSSNPAKSKLYEHLIPTFGRYFQIQDSSFDNEMLKHLIDLNPGRVFTTAEL
                     FEKHANEKSNDLVNHVFDKLVKEYIEDTESEIDSVFAFFEQYGREMRLGQGDISAMLL
                     TEMIKREDAKSIRRFFGTIDVNKEVCLEVAKHKLDSSWGRFAFIELVKQWFRIGAADI
                     RPWVYEVTLRILNFNNNDLQNLVGANESESDEFATLSNDIINFINESKMDMEASNVYL
                     RSLILEVCGIARDDLDATLRKYAHYEGFAPFGLESLKQSMVKIFAYQAIKHNKSIYVS
                     TAEAIQPPETTISSLQLLIVLKSYFNADDGLELFNSYVSQVSDTVKEGKSQKGALTEA
                     IILGFLVHNDREFATLIFDKAVEGQIISDELEITRIKKWFKAYSDSFIEKEDWEAHAK
                     HMMKEQALQFIQNVGTAKLSALIPKESM"
     gene            <1381619..>1382731
                     /gene="LYS1_2"
                     /locus_tag="PVL30_004380"
                     /old_locus_tag="LELG_05624"
                     /db_xref="GeneID:5230292"
     mRNA            <1381619..>1382731
                     /gene="LYS1_2"
                     /locus_tag="PVL30_004380"
                     /old_locus_tag="LELG_05624"
                     /product="Saccharopine dehydrogenase"
                     /transcript_id="XM_001523028.1"
                     /db_xref="GeneID:5230292"
     CDS             1381619..1382731
                     /gene="LYS1_2"
                     /locus_tag="PVL30_004380"
                     /old_locus_tag="LELG_05624"
                     /note="BUSCO:EOG09262XGK"
                     /codon_start=1
                     /transl_table=12
                     /product="Saccharopine dehydrogenase"
                     /protein_id="XP_001523078.1"
                     /db_xref="GeneID:5230292"
                     /db_xref="PFAM:PF05222"
                     /translation="MSSNPVILHLRAETKPLEARAALTPTTTKQLLDAGFKVYVEESS
                     QSTFNAKEYEAVGAEIVPEGSWKDAPKDRIIFGLKELPENDTFPLVHTHIQFAHCYKN
                     QAGWEKVLGRFPAGNGTLYDLEFLENDQGRRVAAFGFYAGFAGAAIGVLDWAFKQLHG
                     DDENLPGVSPYPNEDALIKDVKTELDKALAKNGGKYPTALVIGALGRCGSGAIDLFKK
                     VGIPDDNVAKWDMAETAKGGPFKEIVDTNIFVNCIYLSQPIAPFINYETLNVPERKLT
                     TIVDVSADTTNPHNPIPVYEIATVFNDPTVPVKTTAGPKLSVCSIDHLPSLLPREASE
                     FFSKDLMPSLLQLPERDTAPVWVRAKQLFDKNVARL"
     gene            complement(<1382855..>1384288)
                     /gene="MAK11"
                     /locus_tag="PVL30_004381"
                     /old_locus_tag="LELG_05625"
                     /db_xref="GeneID:5230150"
     mRNA            complement(<1382855..>1384288)
                     /gene="MAK11"
                     /locus_tag="PVL30_004381"
                     /old_locus_tag="LELG_05625"
                     /product="Protein mak11"
                     /transcript_id="XM_001523029.1"
                     /db_xref="GeneID:5230150"
     CDS             complement(1382855..1384288)
                     /gene="MAK11"
                     /locus_tag="PVL30_004381"
                     /old_locus_tag="LELG_05625"
                     /codon_start=1
                     /transl_table=12
                     /product="Protein mak11"
                     /protein_id="XP_001523079.2"
                     /db_xref="GeneID:5230150"
                     /db_xref="PFAM:PF00400"
                     /translation="MGKSAKFKSTNASEAPKAVEKEIKSALKGSTATITTQPSVTSNV
                     SSTKSSLNPIQFRIFVGSYEHNLLCLSVILDPKNVKEPVFQPIFHFQAHSLSIKSIDL
                     AKRYLVTGSNDEHIRIYDLQKRKELGTLLSHQGTITALRFSREGTNTTSEDADATAES
                     LHAGKWLLSGSEDGKIIIWRTKDWEVFATLKGHSDKINDLSIHPSGRVAISVSQDKTI
                     RLWNLMTAKKAAVLKIKGRDHLGHSGQFVRWSSNGQFFVVGLNNSILLYKTSTAKIAK
                     KLKFKSTLMCIEIVKFDNKEWMIIGFGDGSIGFYDFEEIIESLEEGDGKDKDNEDAVA
                     DSNENTSIDAVFLLRGHTNRIKDVQFYQSVDTQDIPFLISVSSDGKVVIWNLSIKDQV
                     AIYDTGERLNCVVCAPEHIEKVETMKKRFADEEEGEAELDGSEYETDGEEIKTIMSGK
                     QNKRGKSRNGKNNHNNKKKRKVKVTLE"
     gene            <1384912..>1386729
                     /gene="cut9"
                     /locus_tag="PVL30_004382"
                     /old_locus_tag="LELG_05626"
                     /db_xref="GeneID:5230172"
     mRNA            <1384912..>1386729
                     /gene="cut9"
                     /locus_tag="PVL30_004382"
                     /old_locus_tag="LELG_05626"
                     /product="anaphase-promoting complex subunit Cut9"
                     /transcript_id="XM_001523030.1"
                     /db_xref="GeneID:5230172"
     CDS             1384912..1386729
                     /gene="cut9"
                     /locus_tag="PVL30_004382"
                     /old_locus_tag="LELG_05626"
                     /note="BUSCO:EOG09260S5R"
                     /codon_start=1
                     /transl_table=12
                     /product="anaphase-promoting complex subunit Cut9"
                     /protein_id="XP_001523080.2"
                     /db_xref="GeneID:5230172"
                     /db_xref="PFAM:PF12895"
                     /db_xref="PFAM:PF13181"
                     /db_xref="PFAM:PF13424"
                     /translation="MVHNQKTPQQHNSTLFISPMLSRRKEIFRTPPNQTLTTKQNSKL
                     FETPGSSSKSSFFNLDRTSNNNLSHNRSDESLSQDSLTPIDKLRLWRHDVIGQHQYKT
                     AEFLGDKILDITNDANDAFWLAQVYFNRGNYLRCKELILSNEEFSQSILCRYLAGYSL
                     IKLEQWEDALDVIGEENPYEKDDRLKNEDGGVKLEASMCYLRGLVYAAQNNFARATEC
                     YKEALLVDVKCYEAFDELISNNLLTPSEEWEFVTTRLNYNEVDSNDDLIKLLYATKLS
                     KYLNADKIKEAEQVLREEYGLNDNGDLLLSQADYLYTQCNFDACLNVCEKILFKDQYN
                     FDVLPNYLSCLYELGGRNKLFYKSHQMAEFHPTNPMTWLAIGTYYLSINKVVEARKSF
                     SKATTINPNFGQAWIGFAHTFAIEGEHEQAISAYAYAARLFPGTHLPNLFLGMQHMAM
                     SNLQMAQEYLLASHYICNADPLLLNELGVLYFHKAQFDKAHSYLCTALERAKNHLNLN
                     SKTYVSIRSNLGHTFRRMNMPEEALECFGEVLQCRQDANIMTAVALIYMKVGDFVKAA
                     DYLHNALAISPLDPIANDLLQRALESCSLGAFEAELGDL"
     gene            <1390617..>1392317
                     /locus_tag="PVL30_004383"
                     /db_xref="GeneID:85890430"
     mRNA            <1390617..>1392317
                     /locus_tag="PVL30_004383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119564.1"
                     /db_xref="GeneID:85890430"
     CDS             1390617..1392317
                     /locus_tag="PVL30_004383"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975547.1"
                     /db_xref="GeneID:85890430"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1393026..>1393484)
                     /locus_tag="PVL30_004384"
                     /old_locus_tag="LELG_05628"
                     /db_xref="GeneID:5230173"
     mRNA            complement(<1393026..>1393484)
                     /locus_tag="PVL30_004384"
                     /old_locus_tag="LELG_05628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523032.1"
                     /db_xref="GeneID:5230173"
     CDS             complement(1393026..1393484)
                     /locus_tag="PVL30_004384"
                     /old_locus_tag="LELG_05628"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523082.1"
                     /db_xref="GeneID:5230173"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            <1397600..>1399300
                     /locus_tag="PVL30_004385"
                     /db_xref="GeneID:85890431"
     mRNA            <1397600..>1399300
                     /locus_tag="PVL30_004385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119565.1"
                     /db_xref="GeneID:85890431"
     CDS             1397600..1399300
                     /locus_tag="PVL30_004385"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975548.1"
                     /db_xref="GeneID:85890431"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1400009..>1400467)
                     /locus_tag="PVL30_004386"
                     /old_locus_tag="LELG_05630"
                     /db_xref="GeneID:5230166"
     mRNA            complement(<1400009..>1400467)
                     /locus_tag="PVL30_004386"
                     /old_locus_tag="LELG_05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523034.1"
                     /db_xref="GeneID:5230166"
     CDS             complement(1400009..1400467)
                     /locus_tag="PVL30_004386"
                     /old_locus_tag="LELG_05630"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523084.1"
                     /db_xref="GeneID:5230166"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            <1404583..>1406283
                     /locus_tag="PVL30_004387"
                     /old_locus_tag="LELG_05627"
                     /db_xref="GeneID:5230178"
     mRNA            <1404583..>1406283
                     /locus_tag="PVL30_004387"
                     /old_locus_tag="LELG_05627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523031.2"
                     /db_xref="GeneID:5230178"
     CDS             1404583..1406283
                     /locus_tag="PVL30_004387"
                     /old_locus_tag="LELG_05627"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523081.2"
                     /db_xref="GeneID:5230178"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1406992..>1407450)
                     /locus_tag="PVL30_004388"
                     /db_xref="GeneID:85890432"
     mRNA            complement(<1406992..>1407450)
                     /locus_tag="PVL30_004388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119566.1"
                     /db_xref="GeneID:85890432"
     CDS             complement(1406992..1407450)
                     /locus_tag="PVL30_004388"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975549.1"
                     /db_xref="GeneID:85890432"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            <1411566..>1413266
                     /locus_tag="PVL30_004389"
                     /old_locus_tag="LELG_05629"
                     /db_xref="GeneID:5230171"
     mRNA            <1411566..>1413266
                     /locus_tag="PVL30_004389"
                     /old_locus_tag="LELG_05629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523033.2"
                     /db_xref="GeneID:5230171"
     CDS             1411566..1413266
                     /locus_tag="PVL30_004389"
                     /old_locus_tag="LELG_05629"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523083.2"
                     /db_xref="GeneID:5230171"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1413975..>1414433)
                     /locus_tag="PVL30_004390"
                     /db_xref="GeneID:85890433"
     mRNA            complement(<1413975..>1414433)
                     /locus_tag="PVL30_004390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_061119567.1"
                     /db_xref="GeneID:85890433"
     CDS             complement(1413975..1414433)
                     /locus_tag="PVL30_004390"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_060975550.1"
                     /db_xref="GeneID:85890433"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            <1418587..>1420287
                     /locus_tag="PVL30_004391"
                     /old_locus_tag="LELG_05631"
                     /db_xref="GeneID:5230157"
     mRNA            <1418587..>1420287
                     /locus_tag="PVL30_004391"
                     /old_locus_tag="LELG_05631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523035.2"
                     /db_xref="GeneID:5230157"
     CDS             1418587..1420287
                     /locus_tag="PVL30_004391"
                     /old_locus_tag="LELG_05631"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523085.2"
                     /db_xref="GeneID:5230157"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1420996..>1421454)
                     /locus_tag="PVL30_004392"
                     /old_locus_tag="LELG_05632"
                     /db_xref="GeneID:5230296"
     mRNA            complement(<1420996..>1421454)
                     /locus_tag="PVL30_004392"
                     /old_locus_tag="LELG_05632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523036.1"
                     /db_xref="GeneID:5230296"
     CDS             complement(1420996..1421454)
                     /locus_tag="PVL30_004392"
                     /old_locus_tag="LELG_05632"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523086.1"
                     /db_xref="GeneID:5230296"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            <1425570..>1427270
                     /locus_tag="PVL30_004393"
                     /old_locus_tag="LELG_05634"
                     /db_xref="GeneID:5230151"
     mRNA            <1425570..>1427270
                     /locus_tag="PVL30_004393"
                     /old_locus_tag="LELG_05634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523038.2"
                     /db_xref="GeneID:5230151"
     CDS             1425570..1427270
                     /locus_tag="PVL30_004393"
                     /old_locus_tag="LELG_05634"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523088.2"
                     /db_xref="GeneID:5230151"
                     /translation="MKRLSFKHFNYFGYGIYHDIKTRLPYYKSDFTDAWNYRVIPSST
                     FIFFANLLPAIAFAQDMFDKTNNAYGVNEVLMSSAFGGVVFGLFSGQPLCIVGVTGPI
                     SIFSYTVYELMTPRGTPYFPFMCWIYLWSMVFHIIIAVGNYISWMRIISLYSCDIFGF
                     FINLVYIQKGIQILSNQFDDVNLASGYCSVMIALCMIICGVGSTTFGNYLHYFRPWVR
                     KVFVDYGVVASVIFFTGFIHFGGKLNDTELARLPITKSFQPTEHGDIRPHGWFIHFWP
                     GENIEVGDVFLAIPFAILLTFLFYFDHNVSSLMCQSKEYPLKKPASFHWDFLLLGLTT
                     GFAGIMGIPPPNGLIPQAPLHTDSLVVYDHSGKKLSVVEQRVTNTVQGIMTFVMMSRP
                     FLVILGLVPQAVLSGLFFIMAISGLHGNIVTNRIRYIFLDKHYIENDPNCPQLFRDIH
                     ALPTKKWFYIYVVLEVIGGVAEFVITLTIAAVGFPGVLLFLAFCAKWIWPLFIPREEL
                     DRLDGDVADEFILKNFTVASDEKKRRKQNGVDEEKASESEIDDDAEEYTRDAAISSSE
                     "
     gene            complement(<1427979..>1428437)
                     /locus_tag="PVL30_004394"
                     /old_locus_tag="LELG_05635"
                     /db_xref="GeneID:5230291"
     mRNA            complement(<1427979..>1428437)
                     /locus_tag="PVL30_004394"
                     /old_locus_tag="LELG_05635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523039.1"
                     /db_xref="GeneID:5230291"
     CDS             complement(1427979..1428437)
                     /locus_tag="PVL30_004394"
                     /old_locus_tag="LELG_05635"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523089.1"
                     /db_xref="GeneID:5230291"
                     /translation="MKFVQLFFAIATLFATLNAIFFGYPNKTDGSIIFGLHDKREEAK
                     PVPLPKREIKTGTASYRYGTGKRDTYPLPAWIPLEYLDGVVNSYLNHTIPRGKAGFDK
                     VLEILHINATLASELYLFPNQTAIAWAGEVAIIRAIEREYAETHPAPKPF"
     gene            complement(<1430385..>1431485)
                     /locus_tag="PVL30_004395"
                     /old_locus_tag="LELG_05636"
                     /db_xref="GeneID:5230293"
     mRNA            complement(<1430385..>1431485)
                     /locus_tag="PVL30_004395"
                     /old_locus_tag="LELG_05636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523040.1"
                     /db_xref="GeneID:5230293"
     CDS             complement(1430385..1431485)
                     /locus_tag="PVL30_004395"
                     /old_locus_tag="LELG_05636"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523090.2"
                     /db_xref="GeneID:5230293"
                     /translation="MKFSNVLIAAAAYIVASNAAAIPAAPETSKTLVAARNLDLNTEV
                     DAKLVARQDAADDSVNTIVKRGTEDLLSKVPLGTIIKAVDLVLAGTISDVDSLLSFLG
                     ITVADAGALGLSTVDGLGALVSQLVGLIGQTVDGLLSKRDVESILKKIPLGALSEAVG
                     LVVTGTIGTVNDLLTFLDLTLDDVAELGLSTADGAGSLVSSLVGLIGQTVDGLLSKRG
                     LEDLLSKVPLGTIIKAVDLVLAGTISDVDSLLSFLGITVADAGALGLSTVDGLGALVS
                     QLVGLIGKTADGLLSKRGLEDLLSKVPLGTIIKAVDLVLAGTISDVDSLLSFLGITVA
                     DAGALGLSTVDGLGALVSQLVGLIGNAVDGLL"
     gene            complement(<1435271..>1436551)
                     /locus_tag="PVL30_004396"
                     /old_locus_tag="LELG_05638"
                     /db_xref="GeneID:5230169"
     mRNA            complement(<1435271..>1436551)
                     /locus_tag="PVL30_004396"
                     /old_locus_tag="LELG_05638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523042.1"
                     /db_xref="GeneID:5230169"
     CDS             complement(1435271..1436551)
                     /locus_tag="PVL30_004396"
                     /old_locus_tag="LELG_05638"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523092.2"
                     /db_xref="GeneID:5230169"
                     /translation="MRLTKVFAVVAATFTVSANAAAINPASFAPGAQDVVISGAAYSN
                     LLQVLGVTEATAAKLGLVEGQTAGQLANEVSNLLDQKKRREFIGEESANAGADAIVQR
                     DLISTLSQIPLSLLSDALNLLVTGGITAYDELLSVLGINATVANELGLLATETTSELI
                     NSIAKLIEQAIENGFSSAKRDLAPDTKVDSKRDLIGTLSQIPLDVLSGALNLLVTGGI
                     STFDELISYLGVNTTEANELGLLATQTISGLVNQVVKLVEDAIEDGFSSAKRDTLTDD
                     LSQIPLELLTQALHFLVTGAISGFDDLLGFLGINATEANELGLLATQTISGLVNQVAK
                     LVEDAIENGFSSAKRDTLTDDLSQIPLALLTAAVNAIVTGGILTFDQLISWLGISPTV
                     ANKLGLFATQTISELLNQLIQLVETSIENGFKNA"
     gene            <1440630..>1441922
                     /locus_tag="PVL30_004397"
                     /old_locus_tag="LELG_05640"
                     /db_xref="GeneID:5230160"
     mRNA            <1440630..>1441922
                     /locus_tag="PVL30_004397"
                     /old_locus_tag="LELG_05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_001523044.2"
                     /db_xref="GeneID:5230160"
     CDS             1440630..1441922
                     /locus_tag="PVL30_004397"
                     /old_locus_tag="LELG_05640"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_001523094.2"
                     /db_xref="GeneID:5230160"
                     /translation="MTTKSELRQTLKALDYEFATNLPLHLYSTFLLHRINPRFPKRAW
                     STWPKRFEEVPIPDTKFEDDVIDPYDSEIYEHDISFDEDMNKYLLAEHDRLTNKGSKI
                     SKNKSFLSKSNNIRKRSEQNDSQDDDDNNNETTGIKPVENESIYVEESDDDEEEYRTE
                     EKQPGNNASGEPVAHGQHLTEEEMKRRVVDIVYHETAPNAKSVLVNAIHGLIESKIQQ
                     KIQKMKEKGKIDKSLYMTDELPRQTLIPICNQIAGRFDQVLNTLFRTYTPRVQKQMRL
                     TLIEWQHVVSAAVANAISRPNLETMSLVPLENVFQQCKFLFDGEGVSANVYQFEDSVD
                     QKAVSKVFDENGGFNVVEYLKYLGSQNIPLQGPLTYTDLAEQHMDYTNAEIERKSKLE
                     TNILNALKLVKESNRVAHNDDDDDEDEEIEDLEDVYTI"
     gene            complement(<1442268..>1443398)
                     /gene="SCS7"
                     /locus_tag="PVL30_004398"
                     /old_locus_tag="LELG_05641"
                     /db_xref="GeneID:5230176"
     mRNA            complement(<1442268..>1443398)
                     /gene="SCS7"
                     /locus_tag="PVL30_004398"
                     /old_locus_tag="LELG_05641"
                     /product="fatty acid alpha-hydroxylase"
                     /transcript_id="XM_001523045.1"
                     /db_xref="GeneID:5230176"
     CDS             complement(1442268..1443398)
                     /gene="SCS7"
                     /locus_tag="PVL30_004398"
                     /old_locus_tag="LELG_05641"
                     /note="BUSCO:EOG09263KDI"
                     /codon_start=1
                     /transl_table=12
                     /product="fatty acid alpha-hydroxylase"
                     /protein_id="XP_001523095.1"
                     /db_xref="GeneID:5230176"
                     /db_xref="PFAM:PF00173"
                     /db_xref="PFAM:PF04116"
                     /translation="MPRSLPLLASSEVAKHNTKNDCWVTLYQRKIYNVTGFLDEHPAG
                     ADIILPFAGKDITEIMADTTSHEHSESAYEMLDDEMLIGYMATEIEERELIENRNRTP
                     VEMKLNESDDFDMYEFHDHLPPAEKLSIQTDFEEDAKKHKFLDLNKPLLMQLLRSNYS
                     KEFYLDQVHRPRHYGKGSAPLFGNFLEPLSLTPWWVVPLVWLPPNMYLFYIGLTNQHP
                     LIALSLWAMGLFVWTIVEYGLHRFVFHLDGYLPDHPVFLTLHFLLHGVHHYLPMDGYR
                     LVLPPTLFIILAYPFYRLVFSIFPFYMACSGFAGGTLGYIMYDVTHYVLHHTHLPKYL
                     QDLKTYHLEHHYKNYEMGFGVTSRFWDVIFNTEIESTYEKRN"
     gene            complement(<1445366..>1450750)
                     /gene="ZDS1"
                     /locus_tag="PVL30_004399"
                     /old_locus_tag="LELG_05642"
                     /db_xref="GeneID:5230147"
     mRNA            complement(<1445366..>1450750)
                     /gene="ZDS1"
                     /locus_tag="PVL30_004399"
                     /old_locus_tag="LELG_05642"
                     /product="zillion different screens protein"
                     /transcript_id="XM_001523046.1"
                     /db_xref="GeneID:5230147"
     CDS             complement(1445366..1450750)
                     /gene="ZDS1"
                     /locus_tag="PVL30_004399"
                     /old_locus_tag="LELG_05642"
                     /codon_start=1
                     /transl_table=12
                     /product="zillion different screens protein"
                     /protein_id="XP_001523096.2"
                     /db_xref="GeneID:5230147"
                     /db_xref="PFAM:PF08632"
                     /translation="MSQSYMSSQNDQSQNSHYESAVQDLEKEKQMVTALKRMSIGHLM
                     HYDPDLPPGTIDEFNPFSGNSHSSPSAQNHLYDEDLIPQNTQSPYQSTPLSSQGGASK
                     SHARSSPDNKNETSTSNRLQTSSPPKRNSIYDNTSILTSESRDEYFDAEEDHVYEASG
                     NSVWVPANMHPQINPDSYNTLVKNQVEEILDKKLSRQKSQLSRKSTLSRSSSVSDATE
                     VVVHRNSIKGRSESPETENLGLTSGTSSSPSRSTSRSASPQKDTSSKRESWYMNHKRF
                     SNPSLKELTSELEQLSKKAGLDKSDAVTVARTLSSNSLGYTDVEKMAFDELSEADEES
                     ATSSTLYLQQRLQQQFQITPELGLGSEDENENLEEYEHERKQEHDHDNYDENKHEHEL
                     GYLQEKENDSRNGGFALKRSRRPNYRKKNFENEASPIPGSKETLPGTPTPTQRKYNTR
                     NSQYLFSYKKPTDQSPDYASPIGTRNQGSQQQQSHNIRSQASPKTPSLSPSPTPGSIP
                     GTGLSSNQSAFEQGLNDLSNLYYGGQQRHHSPRDSKSRKENPNSNRFYSQNHAHGDNN
                     VYRQGDRRHDPRRSPHIGTPQTGPQYSNSPYGPVQGSGTRLQATPRGSSQLTPTPTST
                     PLPTPPSQQEHQQQYNQHQQQKSHYAHNIDHNSHIRSSKNSNTVASDSRNRYHHHQNQ
                     SHPSIHASPSQRRAGHNGSAPIRSASNTNINDFMISTPTQTRHHSPALPKKEREYYKI
                     QTGPRVKDVPSKSYTERQHGSVKPTTTPASTTTTSAVNVAAAPRSQQLRQNLDLLRSE
                     INEFKESLNKSEAHQQDPRQHEREREREASNKKEHANYDQYYRVQRNQQQQQYANNKL
                     RHAVQPLYYPQAQIQKQQQQQQQQQHQKERFFDQSQGLHRDDVNYNIQDNHNQKAPNP
                     PDISFDVSYQDLSTDDPLGMEKEILADLGELDNDQEFLNNGVQETAVEPLKESTPENE
                     KDDFFASIPTVDNDHLDLVEQDQPPYQNQLQDQNRADGSLPINFDSLDKDIPDSEPDS
                     RKNNEAIDVDESYDISPMLSEFELNQSTPKQAQKAPSTSNVKTSSKATKVNTKLFNKV
                     SIEIIDSDNYENKMGKKKKSFEKDVGDVGDVGGVGDNKSLKKKKSFGLLTHHAPNGAG
                     DSDLSKLKKKKSWNWLRERSASMTSLDMSTLPPVPTDKVPIRSFSNPEGGKSSDTNVK
                     QGDSQLRRSSSSQIERAADRAEHVSNHSEKENVISKLFKKKSKATLSSAHSIQSRESG
                     QSGTVLDSESDRDRDLDLVHGPEKSVKKKSSGLFKKRSKMKMVDHNRDPNKATSPSSH
                     IGVLETAGHLDVSNSGQQGKENREPIEERNSFDHGRTVIHHFNGKQLLPSNENPSSIR
                     MVDESDDRVEKPMSDVVVDTPTGLIPEAETDSANVENFANEETKNSDSKKKRRQNRYK
                     KKKDEDATSVSSFRKTESQPHPHPQSQSQSQSQTETETETEIGHEEGEVLDGVEGVNG
                     VDDAAVSSPTPAKEQLQKQDIQEKLQKAIRRTSKANQPIQFTDSAFGFPLPPPSQSTI
                     VMLDYRFPVHVERAIYRLSHLKLANPKRSLREQVLLSNFMYAYLNLVDHTLHVEHMSE
                     EGSRIGDDNHSNDGNGDEDDNGEGNGNEDDNGDGFGDGKGNDFSNDDKDVVIVNDGED
                     SSEAGKQFRRMGVVNGDVNIVEVGDIDDIDELAGAEETMEYNDDEFAENEVILEEEDI
                     LFADNYRYRDDAMNGKSYGRVAVYDVGDHDTEIERGGKETVTAAAAAAAAQQQNETEK
                     GNVSGDIVTV"
     gene            <1453426..>1455138
                     /gene="HOM3"
                     /locus_tag="PVL30_004400"
                     /old_locus_tag="LELG_05643"
                     /db_xref="GeneID:5230163"
     mRNA            <1453426..>1455138
                     /gene="HOM3"
                     /locus_tag="PVL30_004400"
                     /old_locus_tag="LELG_05643"
                     /product="Aspartokinase"
                     /transcript_id="XM_001523047.1"
                     /db_xref="GeneID:5230163"
     CDS             1453426..1455138
                     /gene="HOM3"
                     /locus_tag="PVL30_004400"
                     /old_locus_tag="LELG_05643"
                     /codon_start=1
                     /transl_table=12
                     /product="Aspartokinase"
                     /protein_id="XP_001523097.2"
                     /db_xref="GeneID:5230163"
                     /db_xref="PFAM:PF00696"
                     /translation="MSESPSLSARSYNSVLDFKSGHTPSSPLSSPLSSSAAGRNNQGW
                     VVQKFGGTSVGKFAEEIVENIVRVFNKSNKVAVVCSARSSNTKSEGTTSRLIRSAELA
                     SNNQDYESLLSVIEQDHIDNCTNLIKLSAIKNHLMNDIKAEIQHGRELLHACQIIGEI
                     SPRSLDSIMSMGEKLSCLFMTALMQDHDLKAVYINLSDLIPSNYNFVNGFDDKFYQFI
                     SEEIASRINEAVSGSEEVGEKGENNDVDNDVIPVLTGYFGVVPGGLLNGVGRGYTDLC
                     AALAAVGLQAEELQIWKEVDGIFTADPRKVPNARLLESVTPEEAAELTYYGSEVIHPF
                     TMEQVIKARIPIRIKNVENPKGKGTIIYPDNIARRGEQTPPHPPAAYETLSQSYISSH
                     KKRSATAITAKQDIVVINIHSNKKTLSHGFLAHIFTTLDKYKLVVDLISTSEVHVSMA
                     LSIQNDQEQQLKNAIQELKKMGEVDVTKNMTIISLVGKQMVNFIGIAGNMFKILADEQ
                     INIEMISQGANEINISAVINEKDTLRALRSVHAQLLEGKHHLYENPESASAVDIRLEA
                     LKMS"
     gene            <1455535..>1456572
                     /gene="GVP36"
                     /locus_tag="PVL30_004401"
                     /old_locus_tag="LELG_05644"
                     /db_xref="GeneID:5230295"
     mRNA            <1455535..>1456572
                     /gene="GVP36"
                     /locus_tag="PVL30_004401"
                     /old_locus_tag="LELG_05644"
                     /product="BAR domain-containing protein"
                     /transcript_id="XM_001523048.1"
                     /db_xref="GeneID:5230295"
     CDS             1455535..1456572
                     /gene="GVP36"
                     /locus_tag="PVL30_004401"
                     /old_locus_tag="LELG_05644"
                     /codon_start=1
                     /transl_table=12
                     /product="BAR domain-containing protein"
                     /protein_id="XP_001523098.2"
                     /db_xref="GeneID:5230295"
                     /db_xref="PFAM:PF03114"
                     /db_xref="PFAM:PF10455"
                     /translation="MSFNFANFTKDLKSFGDRLTTDFNNEVLPLAQRTQRMVQEKIGK
                     VNADDISQLPTEYIALAEKCNSIEKLYKNVLKITTNYENESYDYPSNLQESFTDFSQN
                     ITRRFSNLSKATTTAEAQAALIKPDETFKPPKTLYHALSRATDASVLTDGSGTGADED
                     YSQLASVAAGTTKSESSDPLIKGLDLYSSSLKKIADARIGQDQLIKQKFNLPLQTTLR
                     SLISQSNNIQRKVEQKRIDYDMTRYNLTNCNNPAKESKLRVDMENAEDEFANTVEDAI
                     NIMQNVVENAKPLQEFLNLIQAQLAYHKLASELLGSMVGDFENLIEEQNKLSAGSGHN
                     QTGKESGEFEL"
     gene            complement(<1456809..>1458401)
                     /gene="ARO9"
                     /locus_tag="PVL30_004402"
                     /old_locus_tag="LELG_05645"
                     /db_xref="GeneID:5230170"
     mRNA            complement(<1456809..>1458401)
                     /gene="ARO9"
                     /locus_tag="PVL30_004402"
                     /old_locus_tag="LELG_05645"
                     /product="Aromatic amino acid aminotransferase II"
                     /transcript_id="XM_001523049.1"
                     /db_xref="GeneID:5230170"
     CDS             complement(1456809..1458401)
                     /gene="ARO9"
                     /locus_tag="PVL30_004402"
                     /old_locus_tag="LELG_05645"
                     /codon_start=1
                     /transl_table=12
                     /product="Aromatic amino acid aminotransferase II"
                     /protein_id="XP_001523099.2"
                     /db_xref="GeneID:5230170"
                     /db_xref="PFAM:PF00155"
                     /translation="MAKSIEQLISKRAKGRTSSHFTNGPSEAPPAGFKPHPKPLLLSY
                     GTPNNGFFPIDSLDINLVNFPFEHLDKYNSPQDSLQKLSISIKNGNDTNGQSSKNIDK
                     EKEEFPTFQVTRHFDDPNLTDLSTGLQYAAVEGHAPLLEFTKNFITRAHKPANDEWGS
                     IITTGASDGLNKAVDAVLDNGDVILIEEFTFTPFLRFVDNAGAIPIPVKIALSSDSNG
                     LDLDHLQSLLENWQVHHKDLPKPKALYTIATGQNPTGFTQSVEFRKKVYSLAQKHDLI
                     IIEDDPYGYLTLPKYEAPSKDGFETPFRRESAKLAKQLTIDEYLKDHLTPSYLELDLD
                     GRVIRVETFSKLFAPGLRLGFIIAHQKIINVIKNYAEVINRGASGVAQLIVNDVIQGK
                     LGGVDGWLNWILKMRATYSLRKDLLVHTILQSEAYKQGLVDIIDPKAGMFVTFKIKFL
                     DGRPEDEIVDKVQQLFWKIISYGVSVVPGNKMTVDAKFSASRSNFFRLCYAPANNDED
                     LVESGKRLTEAVLEFYKNGEKF"
     gene            <1460349..>1461578
                     /gene="PDA1"
                     /locus_tag="PVL30_004403"
                     /old_locus_tag="LELG_05646"
                     /db_xref="GeneID:5230179"
     mRNA            <1460349..>1461578
                     /gene="PDA1"
                     /locus_tag="PVL30_004403"
                     /old_locus_tag="LELG_05646"
                     /product="alpha subunit of pyruvate dehydrogenase"
                     /transcript_id="XM_001523050.1"
                     /db_xref="GeneID:5230179"
     CDS             1460349..1461578
                     /gene="PDA1"
                     /locus_tag="PVL30_004403"
                     /old_locus_tag="LELG_05646"
                     /note="BUSCO:EOG09262Q8D"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha subunit of pyruvate dehydrogenase"
                     /protein_id="XP_001523100.1"
                     /db_xref="GeneID:5230179"
                     /db_xref="PFAM:PF00676"
                     /translation="MSRLINASRVIGGVSTRSHQVTSQLTRTLATSATPDSSDLVTVD
                     LPKSSFEGYNLEVPELEFETEKETLLQMYKDMIVIRRMEMASDALYKAKKIRGFCHLS
                     IGQEAVAVGIENAIGPKDTVITSYRCHGFAHMRGASVKSILAELMGRRSGVSYGKGGS
                     MHMFAPGFYGGNGIVGAQVPLGAGLAFSHKYKGEKAVNFCLYGDGASNQGQVFESYNM
                     AKLWNLPCIFVCENNKYGMGTSAARSSAMTEYYKRGQYIPGLKINGMDVLACYQGSKF
                     AKDWATQGNGPLVVEFETYRYGGHSMSDPGTTYRTREEVQHMRSKSDPIAGLKAVLLE
                     KNIATEEEIKKYDKAARKYVDEQVAEAEADAPPEARMDILFEDVYVPGSEVPVLRGRI
                     SDDSWDFTKKDFLNKVY"
     gene            <1462138..>1468188
                     /gene="brr2"
                     /locus_tag="PVL30_004404"
                     /old_locus_tag="LELG_05647"
                     /db_xref="GeneID:5230156"
     mRNA            <1462138..>1468188
                     /gene="brr2"
                     /locus_tag="PVL30_004404"
                     /old_locus_tag="LELG_05647"
                     /product="Pre-mRNA-splicing helicase BRR2"
                     /transcript_id="XM_001523051.1"
                     /db_xref="GeneID:5230156"
     CDS             1462138..1468188
                     /gene="brr2"
                     /locus_tag="PVL30_004404"
                     /old_locus_tag="LELG_05647"
                     /codon_start=1
                     /transl_table=12
                     /product="Pre-mRNA-splicing helicase BRR2"
                     /protein_id="XP_001523101.2"
                     /db_xref="GeneID:5230156"
                     /db_xref="PFAM:PF00270"
                     /db_xref="PFAM:PF00271"
                     /db_xref="PFAM:PF02889"
                     /db_xref="PFAM:PF04851"
                     /translation="MSEVHGESPKGDSLVNTNINTTTAATAATATAASAYKFEEAYDT
                     FLTKIRSYLLDASPEIITSAVEILLEILGSDTINVTTKRKEINALLKIQVKDEELSQL
                     IQLANLHNSFLHKHEIDQAGEKHHHQQQQQQQQQQIVTVDIEMDEEEDGNQLEGGEVY
                     SKEVVELEDEEDEQVNDQKEDYDDSIERGVASQVAFNWQIFKSRMARIGIEIETVSKI
                     LSDKTIDASKVLKEKLKHLIEDSALVDKIVEDRWRIVFTKRLEENETTLSLKKIMKEM
                     FSLRLYNLAMELIFTEKDQRHITQELTRRRFYEEKATELKVTLPEGTFQEKLPSYDII
                     TVPPPLAKQKNVEKDELLPTSSLPAWAREVFPTNETTTFNRIQSKIYPKAFGSDENLL
                     ICAPTGAGKTNVAMLTMLRAISNHRFNDAINKDQFKIVYIAPLKALVSEQVREFQRRL
                     TPVFGLVVNELTGDASLSQQQIKETNVLITTPEKWDIITRENHEYLSLIKLVIIDEIH
                     LLHDQRGPVLESIIARINRDQENEVRIVGLSATLPNYNDVAKFIGANEEGIFYFDSSY
                     RPCPLEQKFVVIKDQKALKKRLAIDEACYDLVHKTLKQNHQLIVFVHSRNETVSTAEY
                     LINRLSDQESDLNLVAEDSTREILSQESAQVTNAKLQRILGSGIGAHHAGLSKEERTL
                     VEDLFAQGHLKVLVSTATLAWGVNLPAHTVIIKGTEVYSPESGSWMQLSPQDVFQMLG
                     RAGRPRYDKNGEGVIITTQDEIQYYLAILNQQYPIESQMLNKLIDSMNAEVVRGSIKT
                     LESAVDWLGHTYLYVRMLQLPSLYMLGGNGNGIGKGKRDDPSLYVKRAEMAHVALTVL
                     QRCRLIEYDNGLVKATELGKIASYHYISYQTINRYNSLLKPWHKESDIIRVFAQSDEF
                     QLLPVRREERLEISKLMEKCPFPIREPPIEPVAKISILFQTYISRLHLEGYALIADMI
                     YIKQSADRLLHALYELAILKKWSSLAKYTLELAKMAKQRMWLCDSPLRQFGSLVPRDI
                     IRASESSHLPWSQYFNLTTEELAEVLYLKGGNARLAMQYISSFPKIEIVDYAVQPISD
                     EFMRIKVEVRPEWDWIWEVHGRQEVFEVILEDCNGLRLLLHRQVFVRQSQIGENRILE
                     FHVPLSKPLSPNLILSFVSAKWVNCTWKTAIVTDLTIPKDKSYYTARTNQLDDAHVHE
                     FENIPPVFSQEVYDIICDEDQQNCFIGINQGQEKLHVPDLAISRHLQQSNGRAVYITS
                     KQTSIDQYVQRFAKSNEANIFKLTGDLKIDVQGYNKSQIIVGKPEYFYSLVRRWKTLK
                     SVRSIGLLILDDLHLMEANPVYEFLLTRVRLLRSQYSHETSLRLVAISYPLMDVRDVC
                     TWLDIKKANIVNFPASVREHDISQIDLTIDDNSNVNGSDDGEHEYLNDVPSYIEMGKK
                     VLIYANSNEMALKIAKQSAFNFKAGIDAQKFVDKVKSVQLKAFLKDAGVALYLNTFSD
                     LDKKIAKHLFANGTVSVLIATRESEDFSILADVVMIDKTQYSDNYEHREIDYNVTTIF
                     DMIGSCSSLQNDGHIYMQTSSEMVNYYSSFINTGIMVESQLRSHVHEFFIAGIVDKLL
                     RQRAECLDLLTHSFFYRRLLSNPSYYNCKDISSDGLSEYLSMIIESVVDDLVQNGFIE
                     EKGDESSSDDDDDDNEEEEDNLQFATLNKALIASHYGLSYDTLNFFGGLSEASKLKDI
                     LLALANAVEFENIPIRNGEDKLLTSLAKKMPIKLNGGTQVNITPFTKVFILIQAFISR
                     VKFPDTLRFDVEKILEVLMSKLLNACIDMLSGEGHLNAMLLMDLSQMITQRTWSFENH
                     LRQIPHFDNEALLKRCKEHNVTSVYDIMSLEDDERDEVLQIPEDDERLNDVAAFVNKY
                     PNVKLTYDLQKTSVEVDESVLLSVSLERDEEMESLEVVSNGLPISKTENWWIVVGVPS
                     SGQSQLYAIKKCQISQLEQTFNIEFNVPTVGEHKLTCWVICDSYLDADKEANFTISIV
                     "
     gene            <1468909..>1470018
                     /gene="TRP4"
                     /locus_tag="PVL30_004405"
                     /old_locus_tag="LELG_05648"
                     /db_xref="GeneID:5230284"
     mRNA            <1468909..>