GenomeNet

Database: RefSeq
Entry: NC_000882
LinkDB: NC_000882
Original site: NC_000882 
LOCUS       NC_000882               2744 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Pepper leaf curl virus, complete genome.
ACCESSION   NC_000882
VERSION     NC_000882.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Pepper leaf curl virus
  ORGANISM  Pepper leaf curl virus
            Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
REFERENCE   1  (bases 1 to 2744)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 2744)
  AUTHORS   Chiemsombat,P., Warin,N., Attathom,S. and Chatchawankarnpanich,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-OCT-1999) Plant Pathology, Kasetsart University,
            Malai-man, Kamphaengsaen, Nakorn Pathom 73140, Thailand
  REMARK    Sequence update by submitter
REFERENCE   3  (bases 1 to 2744)
  AUTHORS   Chiemsombat,P., Warin,N., Attathom,S. and Chatchawankarnpanich,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-1999) Plant Pathology, Kasetsart University,
            Malai-man, Kamphaengsaen, Nakorn Pathom 73140, Thailand
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF134484.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2744
                     /organism="Pepper leaf curl virus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:83839"
     gene            174..485
                     /gene="av2"
                     /locus_tag="PepLCVsAgp1"
                     /db_xref="GeneID:1450353"
     CDS             174..485
                     /gene="av2"
                     /locus_tag="PepLCVsAgp1"
                     /codon_start=1
                     /product="AV2 precoat protein"
                     /protein_id="NP_050013.1"
                     /db_xref="GeneID:1450353"
                     /translation="MVLRCMLAIKYLQLVENTYSPDTLGYDLIRDLILVIRARDYVEA
                     SRRYSHFHSRLQGASPFELRQPICQPCCCPYCPRHKQKEVMGQPDHVQKAQDIQDVQK
                     P"
     misc_feature    180..365
                     /gene="av2"
                     /locus_tag="PepLCVsAgp1"
                     /note="Geminivirus V1 protein; Region: Gemini_V1;
                     pfam01524"
                     /db_xref="CDD:279819"
     gene            295..1065
                     /gene="av1"
                     /locus_tag="PepLCVsAgp2"
                     /db_xref="GeneID:1450354"
     CDS             295..1065
                     /gene="av1"
                     /locus_tag="PepLCVsAgp2"
                     /codon_start=1
                     /product="AV1 coat protein"
                     /protein_id="NP_050014.1"
                     /db_xref="GeneID:1450354"
                     /translation="MSKRPADIVISTPASKVRRRLNFDSPYVSRAAAPTVLVTNKRRS
                     WANRTMYRKPRIYRMYKSPDVPRGCEGPCKVQSYEQRHDVAHVGKVICVSDVTRGNGL
                     THRVGKGPVIKSVYVWGRIWMDEISSQESHQSVMFFLVRDRRPFGTPQDFGQVFNMYD
                     NEPSTATVKNDNRDRFQVLRRFQATVTGGQYASKEQAIVRKFMKVNNHVTYNHQEAAK
                     YDNHTENALLLYMACTHASNPVYATLKIRIYFYDSVQN"
     misc_feature    346..1062
                     /gene="av1"
                     /locus_tag="PepLCVsAgp2"
                     /note="Geminivirus coat protein/nuclear export factor BR1
                     family; Region: Gemini_coat; pfam00844"
                     /db_xref="CDD:279217"
     gene            complement(1062..1475)
                     /gene="ac3"
                     /locus_tag="PepLCVsAgp3"
                     /db_xref="GeneID:1450355"
     CDS             complement(1062..1475)
                     /gene="ac3"
                     /locus_tag="PepLCVsAgp3"
                     /codon_start=1
                     /product="AC3 protein"
                     /protein_id="NP_050015.1"
                     /db_xref="GeneID:1450355"
                     /translation="MDSRTGAHHTAAQAAQAENGVYIWTVNNPLYFRITQHHERPFLR
                     NHDIITVQIQFNYNLRKAGGLHQCFLICQIWTRLHPQTSRFLRVFKYQCIKYLDHLGV
                     ISINNVIRAIRHVLYNVLEGTIDARLSEMIKFNIY"
     misc_feature    complement(1125..1472)
                     /gene="ac3"
                     /locus_tag="PepLCVsAgp3"
                     /note="Geminivirus AL3 protein; Region: Gemini_AL3;
                     pfam01407"
                     /db_xref="CDD:279715"
     gene            complement(1207..1620)
                     /gene="ac2"
                     /locus_tag="PepLCVsAgp4"
                     /db_xref="GeneID:1450356"
     CDS             complement(1207..1620)
                     /gene="ac2"
                     /locus_tag="PepLCVsAgp4"
                     /codon_start=1
                     /product="AC2 trap protein"
                     /protein_id="NP_050016.1"
                     /db_xref="GeneID:1450356"
                     /translation="MQSSSPSKAHSSQVPIKVRHRIAKKTTRRRRVDLPCGCSYFVAL
                     GCHPHGFTHRGTSHCSSSSSSREWRIYLDGQQSPIFQNNTTPREAVPEEPRHNHGANP
                     VQLQPEESGGTTPMLSNLPNLDSFTSSDLAFLKSI"
     misc_feature    complement(1231..1575)
                     /gene="ac2"
                     /locus_tag="PepLCVsAgp4"
                     /note="Geminivirus AL2 protein; Region: Gemini_AL2;
                     pfam01440"
                     /db_xref="CDD:279747"
     gene            complement(1538..2602)
                     /gene="ac1"
                     /locus_tag="PepLCVsAgp5"
                     /db_xref="GeneID:1450357"
     CDS             complement(1538..2602)
                     /gene="ac1"
                     /locus_tag="PepLCVsAgp5"
                     /codon_start=1
                     /product="AC1 replicase-associated protein"
                     /protein_id="NP_050017.1"
                     /db_xref="GeneID:1450357"
                     /translation="MAPPKNLRINAKNYFLTYPHCSLTKEEALSQIQAIETPTIKLFI
                     RICRELHEDGTPHLHILIQFEGKFQCKNPRFFDLTSPTRSAHFHPNIQGAKSSTDVKE
                     YIAKNGDVLDHGVFQIDGRSARGGCQSANDAYAEALNSGTKASALAILKEEAPKDYIL
                     QFHNLNSNLDKIFSLRIEMYISPFLVSFDQVQRNLNEWVAANVVKPARPLRPISIVVE
                     GDSRTGKTMWARSLGPHNYLCGHLDLSPKVYNNDPWYNVIDDVDPHYLKHFKEFMGAQ
                     RDWQSNTKYGKPVQIKGGIPTIFLCNPGPHSSYKEFLEEEKNTALKNWALKNAIFVTI
                     EGPLFSGSHQGATQNRQEDN"
     misc_feature    complement(2246..2581)
                     /gene="ac1"
                     /locus_tag="PepLCVsAgp5"
                     /note="Geminivirus Rep catalytic domain; Region:
                     Gemini_AL1; pfam00799"
                     /db_xref="CDD:279178"
     misc_feature    complement(1919..2227)
                     /gene="ac1"
                     /locus_tag="PepLCVsAgp5"
                     /note="Geminivirus rep protein central domain; Region:
                     Gemini_AL1_M; pfam08283"
                     /db_xref="CDD:285483"
     gene            complement(2152..2445)
                     /gene="ac4"
                     /locus_tag="PepLCVsAgp6"
                     /db_xref="GeneID:1450358"
     CDS             complement(2152..2445)
                     /gene="ac4"
                     /locus_tag="PepLCVsAgp6"
                     /codon_start=1
                     /product="AC4 protein"
                     /protein_id="NP_050018.1"
                     /db_xref="GeneID:1450358"
                     /translation="MGLLTCISSSNSKVNSNAKIHDSSTSHPQPGQHISIRTFRELKA
                     QQMSKNISQKTETFLIMGFSRSMEDRLEGVANLPTTHMPRHSIQEPKLRHSQF"
     misc_feature    complement(2194..2445)
                     /gene="ac4"
                     /locus_tag="PepLCVsAgp6"
                     /note="Geminivirus C4 protein; Region: Gemini_C4;
                     pfam01492"
                     /db_xref="CDD:279790"
ORIGIN      
        1 accggatggc cgcgattttt tttcaagtgg tccccccgcg tgcgctggac caatcataac
       61 catccctcaa agcttgcatg cctgcaggtt atcccatcaa aacgtggtcc ccaagtactt
      121 acatcaaaac atgtgggatc ctttactaaa cgaagtttcc tgaaaaccgt aacatggttt
      181 taaggtgtat gttagcaatt aagtatttgc aactagtaga gaatacatac tctcctgata
      241 cattaggcta cgacctaata cgtgatctca tcttggttat tcgtgctagg gattatgtcg
      301 aagcgtcccg cagatatagt catttccact cccgcctcca aggtgcgtcg ccgtttgaac
      361 ttcgacagcc catatgtcag ccgtgctgct gcccctactg tcctcgtcac aaacaaaagg
      421 aggtcatggg ccaaccggac catgtacaga aagcccagga tatacaggat gtacaaaagc
      481 cctgatgttc ctcggggctg tgaaggccca tgtaaggtcc agtcctatga acaacgtcat
      541 gatgtagccc atgtagggaa ggtaatttgt gtgtcagatg tcactcgagg taatgggctg
      601 acacaccgtg ttggtaaagg tcctgtaatc aagtctgttt acgtatgggg aagaatttgg
      661 atggatgaga tatcaagcca agaatcacac caatctgtca tgtttttttt agttcgggat
      721 aggagaccat ttggtactcc acaggacttc ggtcaggtgt tcaacatgta tgataatgag
      781 cccagtactg cgacggtgaa aaacgataac agagatcgat ttcaagtcct tcgtcgtttc
      841 caggcaactg tgacaggtgg gcaatatgca agcaaggagc aagccatagt taggaaattc
      901 atgaaggtga acaatcatgt gacttacaac catcaagaag ctgcgaagta tgacaatcac
      961 acagagaatg cgcttttatt gtatatggca tgtacgcatg ccagtaatcc agtgtatgca
     1021 actttgaaga tcagaatcta cttctacgac tctgtacaaa attaataaat attgaatttt
     1081 atcatttctg aaagacgagc atcaatggtg ccctccaata cattgtacaa tacatgtcta
     1141 atcgccctaa ttacattgtt tatactaatc actcctaaat ggtctaaata cttgatacat
     1201 tgatatttaa atactcttaa gaaacgcgag gtctgaggat gtaaacgagt ccaaatttgg
     1261 cagattagaa agcattggtg tagtcccccc gctttcctca ggttgtagtt gaactggatt
     1321 tgcaccgtga ttatgtcgtg gttcctcagg aacggcctct cgtggtgttg tgttattctg
     1381 aaatataggg gattgttgac cgtccagata tatacgccat tctctgcttg agctgcttga
     1441 gctgcagtgt gatgtgcccc tgtgcgtgaa tccatgagga tggcaaccta gagcgacgaa
     1501 atatgaacac ccacaaggga gatcaactcg tcttcgtcta gttgtcttct tggcgattct
     1561 gtgtcgcacc ttgatgggaa cctgagaaga gtgggccttc gatggtgacg aagattgcat
     1621 tctttagagc ccaattttta agtgcggtgt tcttttcctc ttccaagaac tctttatagc
     1681 ttgaatgtgg tcctggattg cagaggaaga tagtgggaat tccgccttta atttgaactg
     1741 gctttccgta ctttgtgttg ctttgccagt ctctttgggc ccccatgaat tctttaaaat
     1801 gctttaagta atgcggatcg acgtcatcaa tgacgttata ccaagggtcg ttgttgtaca
     1861 cttttgggct taagtctaaa tgaccacata aatagttatg tggtcctaac gacctggccc
     1921 acattgtttt ccccgtcctg ctatcaccct ctaccactat acttatcggt cttaatggcc
     1981 gcgcaggctt gacaacgttt gcagcaaccc attcatttaa gttcctctgg acttggtcaa
     2041 atgagaccaa aaagggggaa atgtacattt ctattcggag gctaaaaatc ttatctaaat
     2101 tactatttaa attatggaat tgtaaaatat aatcttttgg ggcctcttct ttcaaaattg
     2161 cgagtgccga agctttggtt cctgaattga gtgcctcggc atatgcgtcg ttggcagatt
     2221 ggcaaccccc tcgagccgat cttccatcga tctggaaaac cccatgatca agaacgtctc
     2281 cgttttttgc gatatattct ttgacatctg ttgagctttt agctccctga atgttcggat
     2341 ggaaatgtgc tgacctggtt ggggatgtga ggtcgaagaa tcgtggattt ttgcattgga
     2401 atttaccttc gaattggatg aggatatgca agtgaggagt cccatcttcg tgcaattccc
     2461 tgcaaatcct gataaatagt ttaattgtag gggtttctat ggcttggatt tgggaaagtg
     2521 cttcttcttt agtgagagag caatgtgggt atgtgaggaa atagtttttc gcatttattc
     2581 ttaaattttt aggaggagcc attgaccggt caatcggtgt ctctcaactc tctcctatgt
     2641 aattggtgtc tggggtctta tttatatgga gacccaatgg cattattgta attatggaaa
     2701 agtactttaa ttcaaatacc caaagcggcc atccgtataa tatt
//
DBGET integrated database retrieval system