GenomeNet

Database: RefSeq
Entry: NC_001344
LinkDB: NC_001344
Original site: NC_001344 
LOCUS       NC_001344               3027 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Duck hepatitis B virus, complete genome.
ACCESSION   NC_001344
VERSION     NC_001344.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; complete genome.
SOURCE      Duck hepatitis B virus
  ORGANISM  Duck hepatitis B virus
            Viruses; Retro-transcribing viruses; Hepadnaviridae;
            Avihepadnavirus.
REFERENCE   1  (bases 1 to 3027)
  AUTHORS   Tong,S., Mattes,F., Blum,H.E., Fernholz,D., Schneider,R. and
            Will,H.
  TITLE     Complete nucleotide sequence of a chinese Hepatitis B virus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3027)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3027)
  AUTHORS   Schneider,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-1991) R. Schneider, Max-Planck Inst fuer
            Biochemie, Am Klopferspitz 18a, 8033 Martinsried, FRG
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to X60213.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3027
                     /organism="Duck hepatitis B virus"
                     /mol_type="genomic DNA"
                     /isolate="DHBVQCA34"
                     /db_xref="taxon:12639"
     gene            join(2524..3027,1..414)
                     /locus_tag="DHBVgp1"
                     /db_xref="GeneID:2546410"
     CDS             join(2524..3027,1..414)
                     /locus_tag="DHBVgp1"
                     /note="pre-C/C (core) orf"
                     /codon_start=1
                     /product="secretory protein"
                     /protein_id="NP_039827.1"
                     /db_xref="GOA:Q89860"
                     /db_xref="InterPro:IPR002006"
                     /db_xref="UniProtKB/Swiss-Prot:Q89860"
                     /db_xref="GeneID:2546410"
                     /translation="MWNLRITPLSFGAACQGIFTSTLLLSALTVPLVCTIVYDSCLYM
                     DINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIKKHVLIATHFVDLIED
                     FWQTTQGMHEIAESLRAVIPPTTAPVPTGYLIQHEEAEEIPLGDLFKHQEERIVSFQP
                     DYPITARIHAHLKAYAKINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTP
                     EKYRGRDAPTIEAITRPIQAAQGGRKTSSGTRKPRGLEPRRRKVKTTVVYGRRRSKSR
                     ERRAPSPQRAGSPLPRSSSSHHRSPSPRK"
     misc_feature    join(2656..3027,1..366)
                     /locus_tag="DHBVgp1"
                     /note="Hepatitis core antigen; Region: Hepatitis_core;
                     pfam00906"
                     /db_xref="CDD:279277"
     gene            join(2653..3027,1..414)
                     /locus_tag="DHBVgp2"
                     /db_xref="GeneID:2546413"
     CDS             join(2653..3027,1..414)
                     /locus_tag="DHBVgp2"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="NP_039829.1"
                     /db_xref="GOA:Q66406"
                     /db_xref="InterPro:IPR002006"
                     /db_xref="UniProtKB/Swiss-Prot:Q66406"
                     /db_xref="GeneID:2546413"
                     /translation="MDINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIK
                     KHVLIATHFVDLIEDFWQTTQGMHEIAESLRAVIPPTTAPVPTGYLIQHEEAEEIPLG
                     DLFKHQEERIVSFQPDYPITARIHAHLKAYAKINEESLDRARRLLWWHYNCLLWGEAN
                     VTNYISRLRTWLSTPEKYRGRDAPTIEAITRPIQAAQGGRKTSSGTRKPRGLEPRRRK
                     VKTTVVYGRRRSKSRERRAPSPQRAGSPLPRSSSSHHRSPSPRK"
     misc_feature    join(2656..3027,1..366)
                     /locus_tag="DHBVgp2"
                     /note="Hepatitis core antigen; Region: Hepatitis_core;
                     pfam00906"
                     /db_xref="CDD:279277"
     gene            20..2536
                     /locus_tag="DHBVgp3"
                     /db_xref="GeneID:2546416"
     CDS             20..2536
                     /locus_tag="DHBVgp3"
                     /note="P (polymerase)orf"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_039821.1"
                     /db_xref="GOA:Q66403"
                     /db_xref="InterPro:IPR000201"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001462"
                     /db_xref="UniProtKB/Swiss-Prot:Q66403"
                     /db_xref="GeneID:2546416"
                     /translation="MQKLMRNLWIGLGDCFGGITTVYCGEKLTLLITFLGSVLGCQLR
                     KSTEAVMPQPLKQSLDQSKRLREAEKHLRELENLVDSNLEEEKLKPQLSMGEDVQSPG
                     KGEPLHPNVRAPLSHVVRAATIDLPRLGNKLPAKHHLGKLSGLYQMKGCTFNPEWKVP
                     DISDTHFDLQVVNECPSRNWKYLTPAKFWPKSISYFPVQAGVKAKYPDNVMQHEAIVG
                     KYLNRLYEAGILYKRISKHLVTFKGKPYNWELQYLVKQHQVPDGTTTSKINGRAENRR
                     RRAPAKSISRPHDSERDCNMVGQISNNRSSIRPCANNGGGKHSSTTGRLACWGGKTIG
                     TDQSYSSRDASASVDSRGRSKSSRGFSSISRRKATGNHHHCSYVTNSVEATTRGRSTP
                     GKQVFTRDSSSLPESRASRACDKDSSPQEEENAWYLRGNTSWPNRITGKLFLVDKNSR
                     NTTEARLVVDFSQFSKGKNAMRFPRYWSPNLSTLRRILPVGMPRISLDLSQAFYHLPL
                     NPASSSRLAVSDGQHVYYFRKAPMGVGLSPFLLHLFTTALGSEIARRFNVWTFTYMDD
                     FLLCHPNARHLNSISHAVCSFLQELGIRINFDKTTPSPVNDIRFLGYQIDQKFMKIEE
                     SRWIELRTVIKKIKIGAWYDWKCIQRFVGHLNFVLPFTKGNIEMLKPMYAAITNKVNF
                     SFSSAYRTLLYKLTMGVCKLAIRPKSSVPLPRVATDATPTHGAISHITGGSAVFAFSK
                     VRDIHIQELLMVCLAKIMIKPRCILSDSTFVCHKRYQTLPWHFAMLAKQLLSPIQLYF
                     VPSKYNPADGPSRHRPPDWTALTYTPLSKAIYIPHRLCGT"
     misc_feature    380..1189
                     /locus_tag="DHBVgp3"
                     /note="DNA polymerase (viral) N-terminal domain; Region:
                     DNA_pol_viral_N; pfam00242"
                     /db_xref="CDD:278663"
     misc_feature    <1370..1864
                     /locus_tag="DHBVgp3"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    order(1511..1528,1613..1618,1706..1708,1712..1717,
                     1850..1855)
                     /locus_tag="DHBVgp3"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(1511..1528,1613..1615,1712..1714)
                     /locus_tag="DHBVgp3"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    1616..1618
                     /locus_tag="DHBVgp3"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    1904..2494
                     /locus_tag="DHBVgp3"
                     /note="DNA polymerase (viral) C-terminal domain; Region:
                     DNA_pol_viral_C; pfam00336"
                     /db_xref="CDD:278751"
     gene            170..2536
                     /locus_tag="DHBVgp4"
                     /db_xref="GeneID:2546414"
     CDS             170..2536
                     /locus_tag="DHBVgp4"
                     /codon_start=1
                     /product="P-protein"
                     /protein_id="NP_039822.1"
                     /db_xref="GOA:Q66403"
                     /db_xref="InterPro:IPR000201"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001462"
                     /db_xref="UniProtKB/Swiss-Prot:Q66403"
                     /db_xref="GeneID:2546414"
                     /translation="MPQPLKQSLDQSKRLREAEKHLRELENLVDSNLEEEKLKPQLSM
                     GEDVQSPGKGEPLHPNVRAPLSHVVRAATIDLPRLGNKLPAKHHLGKLSGLYQMKGCT
                     FNPEWKVPDISDTHFDLQVVNECPSRNWKYLTPAKFWPKSISYFPVQAGVKAKYPDNV
                     MQHEAIVGKYLNRLYEAGILYKRISKHLVTFKGKPYNWELQYLVKQHQVPDGTTTSKI
                     NGRAENRRRRAPAKSISRPHDSERDCNMVGQISNNRSSIRPCANNGGGKHSSTTGRLA
                     CWGGKTIGTDQSYSSRDASASVDSRGRSKSSRGFSSISRRKATGNHHHCSYVTNSVEA
                     TTRGRSTPGKQVFTRDSSSLPESRASRACDKDSSPQEEENAWYLRGNTSWPNRITGKL
                     FLVDKNSRNTTEARLVVDFSQFSKGKNAMRFPRYWSPNLSTLRRILPVGMPRISLDLS
                     QAFYHLPLNPASSSRLAVSDGQHVYYFRKAPMGVGLSPFLLHLFTTALGSEIARRFNV
                     WTFTYMDDFLLCHPNARHLNSISHAVCSFLQELGIRINFDKTTPSPVNDIRFLGYQID
                     QKFMKIEESRWIELRTVIKKIKIGAWYDWKCIQRFVGHLNFVLPFTKGNIEMLKPMYA
                     AITNKVNFSFSSAYRTLLYKLTMGVCKLAIRPKSSVPLPRVATDATPTHGAISHITGG
                     SAVFAFSKVRDIHIQELLMVCLAKIMIKPRCILSDSTFVCHKRYQTLPWHFAMLAKQL
                     LSPIQLYFVPSKYNPADGPSRHRPPDWTALTYTPLSKAIYIPHRLCGT"
     misc_feature    380..1189
                     /locus_tag="DHBVgp4"
                     /note="DNA polymerase (viral) N-terminal domain; Region:
                     DNA_pol_viral_N; pfam00242"
                     /db_xref="CDD:278663"
     misc_feature    <1370..1864
                     /locus_tag="DHBVgp4"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    order(1511..1528,1613..1618,1706..1708,1712..1717,
                     1850..1855)
                     /locus_tag="DHBVgp4"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(1511..1528,1613..1615,1712..1714)
                     /locus_tag="DHBVgp4"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    1616..1618
                     /locus_tag="DHBVgp4"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    1904..2494
                     /locus_tag="DHBVgp4"
                     /note="DNA polymerase (viral) C-terminal domain; Region:
                     DNA_pol_viral_C; pfam00336"
                     /db_xref="CDD:278751"
     gene            693..1793
                     /locus_tag="DHBVgp5"
                     /db_xref="GeneID:2546415"
     CDS             693..1793
                     /locus_tag="DHBVgp5"
                     /note="pre-S/S (surface)orf"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_039823.1"
                     /db_xref="GOA:Q66405"
                     /db_xref="InterPro:IPR000349"
                     /db_xref="UniProtKB/Swiss-Prot:Q66405"
                     /db_xref="GeneID:2546415"
                     /translation="MKQESFISGYLNIWLHSKASLIIGNFNTLSSNIKFLMGQQPAKS
                     MDVRRIEGGELLLNQLAGRMIPKGTVTWSGKFPTIDHLLDHVQTMEEVNTLQQQGAWP
                     AGAGRRLGLTNPTPHETPQPQWTPEEDQKAREAFRRYQEERPPETTTIAPTSPTPWKL
                     QPGDDPLLENKSLLETHPLYQNPEPAVPVIKTPPLKKKKMPGTFGGILAGLIGLLVSF
                     FLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISQHYVGSCPWGCPGFLWTYL
                     RLFIIFLLILLVAAGLLYLTDNMSIILEKLQWESVSVLFSSISSLLPSDQKSLVALMF
                     GLLLIWMTSSSATQTLVTLTQLATLSVLFYKN"
     misc_feature    <1290..>1511
                     /locus_tag="DHBVgp5"
                     /note="Major surface antigen from hepadnavirus; Region:
                     vMSA; pfam00695"
                     /db_xref="CDD:279085"
     gene            801..1793
                     /locus_tag="DHBVgp6"
                     /db_xref="GeneID:2546412"
     CDS             801..1793
                     /locus_tag="DHBVgp6"
                     /codon_start=1
                     /product="pre-S protein"
                     /protein_id="NP_039824.1"
                     /db_xref="GOA:Q66405"
                     /db_xref="InterPro:IPR000349"
                     /db_xref="UniProtKB/Swiss-Prot:Q66405"
                     /db_xref="GeneID:2546412"
                     /translation="MGQQPAKSMDVRRIEGGELLLNQLAGRMIPKGTVTWSGKFPTID
                     HLLDHVQTMEEVNTLQQQGAWPAGAGRRLGLTNPTPHETPQPQWTPEEDQKAREAFRR
                     YQEERPPETTTIAPTSPTPWKLQPGDDPLLENKSLLETHPLYQNPEPAVPVIKTPPLK
                     KKKMPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGA
                     QISQHYVGSCPWGCPGFLWTYLRLFIIFLLILLVAAGLLYLTDNMSIILEKLQWESVS
                     VLFSSISSLLPSDQKSLVALMFGLLLIWMTSSSATQTLVTLTQLATLSVLFYKN"
     misc_feature    <1290..>1511
                     /locus_tag="DHBVgp6"
                     /note="Major surface antigen from hepadnavirus; Region:
                     vMSA; pfam00695"
                     /db_xref="CDD:279085"
     gene            1290..1793
                     /locus_tag="DHBVgp7"
                     /db_xref="GeneID:2546411"
     CDS             1290..1793
                     /locus_tag="DHBVgp7"
                     /codon_start=1
                     /product="surface protein"
                     /protein_id="NP_039826.1"
                     /db_xref="GOA:Q66405"
                     /db_xref="InterPro:IPR000349"
                     /db_xref="UniProtKB/Swiss-Prot:Q66405"
                     /db_xref="GeneID:2546411"
                     /translation="MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKG
                     KMQCAFQDTGAQISQHYVGSCPWGCPGFLWTYLRLFIIFLLILLVAAGLLYLTDNMSI
                     ILEKLQWESVSVLFSSISSLLPSDQKSLVALMFGLLLIWMTSSSATQTLVTLTQLATL
                     SVLFYKN"
     misc_feature    <1290..>1511
                     /locus_tag="DHBVgp7"
                     /note="Major surface antigen from hepadnavirus; Region:
                     vMSA; pfam00695"
                     /db_xref="CDD:279085"
ORIGIN      
        1 catgcacacc taaaagctta tgcaaaaatt aatgaggaat ctttggatag ggctaggaga
       61 ttgctttggt ggcattacaa ctgtttactg tggggagaag ctaacgttac taattacatt
      121 tctcggctcc gtacttggtt gtcaactccg gaaaagtacc gaggccgtga tgccccaacc
      181 attgaagcaa tcactagacc aatccaagcg gctcagggag gcagaaaaac atcttcggga
      241 actagaaaac ctcgtggact cgaacctaga agaagaaaag ttaaaaccac agttgtctat
      301 gggagaagac gttcaaagtc cagggaaagg agagcccctt caccccaacg tgcgggctcc
      361 cctctcccac gtagttcgag cagccaccat agatctccct cgcctaggaa ataaattacc
      421 tgctaagcat cacttgggga agttgtcagg tttatatcaa atgaagggtt gtacctttaa
      481 ccctgaatgg aaagtacctg atatttcgga tactcatttt gatttacaag tagtaaatga
      541 gtgcccttcc cgaaattgga aatatttgac tccagccaaa ttttggccca agagcatttc
      601 ctactttcct gtccaggcag gggttaaagc gaaatatcct gacaacgtga tgcagcatga
      661 ggcaatagta ggtaaatatt tgaacaggct ctatgaagca ggaatccttt ataagcggat
      721 atctaaacat ttggttacat tcaaaggcaa gccttataat tgggaacttc aataccttgt
      781 caagcaacat caagttcctg atgggacaac aaccagcaaa atcaatggac gtgcggagaa
      841 tcgaaggagg agagctcctg ctaaatcaat tagcaggccg catgattccg aaagggactg
      901 taacatggtc gggcaaattt ccaacaatag atcatctatt agaccatgtg caaacaatgg
      961 aggaggtaaa cactcttcaa caacagggcg cttggcctgc tggggcggga agacgattgg
     1021 gactgaccaa tcctactcct cacgagacgc ctcagcctca gtggactccc gaggaagatc
     1081 aaaaagctcg cgaggctttt cgtcgatatc aagaagaaag gccaccggaa accaccacca
     1141 ttgctcctac gtcaccaact ccgtggaagc tacaaccagg ggacgatcca ctcctggaaa
     1201 acaagtcttt actcgagact catcctcttt accagaatcc cgagccagcc gtgcctgtga
     1261 taaagactcc tcccctcaag aagaagaaaa tgcctggtac cttcggggga atactagctg
     1321 gcctaatcgg attactggta agctttttct tgttgataaa aattctcgaa atactacgga
     1381 ggctagattg gtggtggatt tctctcagtt ctccaaaggg aaaaatgcaa tgcgctttcc
     1441 aagatactgg agcccaaatc tctcaacatt acgtcggatc ctgcccgtgg ggatgcccag
     1501 gatttctctg gacttatctc aggcttttta tcatcttcct cttaatcctg ctagtagcag
     1561 caggcttgct gtatctgacg gacaacatgt ctattatttt agaaaagctc caatgggagt
     1621 cggtctcagt ccttttctcc tccatctctt cactactgcc ctcggatcag aaatcgctcg
     1681 tcgctttaat gtttggactt ttacttatat ggatgacttc ctcctctgcc acccaaacgc
     1741 tcgtcacctt aactcaatta gccacgctgt ctgttctttt ctacaagaat taggaatacg
     1801 cataaacttt gataagacta ctccgtctcc tgtaaatgac ataagattcc tcggttacca
     1861 gattgatcag aaattcatga agatcgaaga aagcagatgg atagaactaa ggactgttat
     1921 caagaaaata aaaataggtg catggtatga ctggaaatgt attcaaagat ttgttgggca
     1981 tttgaacttt gtgttaccat ttactaaagg taacattgaa atgttaaaac caatgtatgc
     2041 tgctattact aacaaagtta actttagctt ctcttcagct tataggactt tattgtacaa
     2101 attaactatg ggtgtttgta aattagccat tcgaccaaag tcctctgtac ctttgccacg
     2161 tgtagccaca gatgctactc caacacatgg cgcaatatcc catatcaccg gcgggagcgc
     2221 agtgtttgct ttttcaaagg tcagggatat acatatacag gaattgctga tggtatgttt
     2281 agctaagata atgattaaac ccagatgtat actctccgat tctacttttg tttgccacaa
     2341 acgttatcag acgttaccat ggcattttgc tatgttggcc aaacaactgc tatctcctat
     2401 acagttgtac tttgttccaa gtaaatacaa tcctgctgac ggcccatcca ggcacagacc
     2461 gcctgattgg acggctctta catacacccc tctctcgaaa gcaatatata ttccacatag
     2521 gctatgtgga acttaagaat tacacccctc tccttcggag ctgcctgcca aggtatcttt
     2581 acgtctacat tgctgttgtc agccttgact gtacctttgg tatgtaccat tgtttatgat
     2641 tcttgcttat atatggatat caatgcttct agagccttag ccaatgtata tgatctgcca
     2701 gatgatttct ttccaaaaat tgatgatctt gtaagggatg ctaaagacgc tttagaacct
     2761 tactggaaat ctgattcaat aaagaaacat gttttgattg caactcactt tgtggatctt
     2821 attgaagact tctggcagac tactcagggt atgcatgaaa ttgctgaatc cttaagagca
     2881 gtaataccac ctaccactgc tcctgtacct actggatatc tcattcaaca cgaggaggct
     2941 gaagagatac ccttaggtga tttatttaaa catcaggaag aaagaatagt cagttttcaa
     3001 ccagactatc ctattacagc aagaatt
//
DBGET integrated database retrieval system