GenomeNet

Database: RefSeq
Entry: NC_001474
LinkDB: NC_001474
Original site: NC_001474 
LOCUS       NC_001474              10723 bp    RNA     linear   VRL 11-JUL-2019
DEFINITION  Dengue virus 2, complete genome.
ACCESSION   NC_001474
VERSION     NC_001474.2
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Dengue virus 2
  ORGANISM  Dengue virus 2
            Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes;
            Amarillovirales; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10723)
  AUTHORS   Kinney,R.M., Butrapet,S., Chang,G.J., Tsuchiya,K.R., Roehrig,J.T.,
            Bhamarapravati,N. and Gubler,D.J.
  TITLE     Construction of infectious cDNA clones for dengue 2 virus: strain
            16681 and its attenuated vaccine derivative, strain PDK-53
  JOURNAL   Virology 230 (2), 300-308 (1997)
   PUBMED   9143286
REFERENCE   2  (bases 1 to 10723)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2007) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 10723)
  AUTHORS   Kinney,R.M., Butrapet,S., Chang,G.J., Tsuchiya,K.R., Roehrig,J.T.,
            Bhamarapravati,N. and Gubler,D.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-1997) Division of Vector-Borne Infectious
            Diseases, National Center for Infectious Diseases, Centers for
            Disease Control and Prevention, Public Health Service, U.S.
            Department of Health and Human Services, P.O. Box 2087, Fort
            Collins, CO 80522, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from U87411.
            On Nov 1, 2007 this sequence version replaced NC_001474.1.
            The mature peptides were added by the NCBI staff following other
            annotations for Dengue virus with the kind help of Dr. Vladimir
            Yamshchikov (Southern Research Institute, Birmingham, AL USA).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10723
                     /organism="Dengue virus 2"
                     /mol_type="genomic RNA"
                     /strain="16681"
                     /db_xref="taxon:11060"
                     /country="Thailand"
                     /collection_date="1964"
     5'UTR           1..96
     stem_loop       2..70
                     /note="stem-loop A (SLA)"
     regulatory      71..80
                     /regulatory_class="other"
                     /note="oligo U track spacer"
     regulatory      81..96
                     /regulatory_class="promoter"
                     /note="5' upstream AUG region (UAR)"
     stem_loop       81..95
                     /note="stem-loop B (SLB)"
     gene            97..10272
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /db_xref="GeneID:1494449"
     CDS             97..10272
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="contains structural proteins, C-prM/M-E and
                     non-structural proteins, NS1-NS2A/B-NS3-NS4A/B-NS5"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="NP_056776.2"
                     /db_xref="GeneID:1494449"
                     /translation="MNNQRKKAKNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPL
                     KLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRSA
                     GMIIMLIPTVMAFHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCE
                     DTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTCTTMGEHRREKRSVALVPHVGMGLE
                     TRTETWMSSEGAWKHVQRIETWILRHPGFTMMAAILAYTIGTTHFQRALIFILLTAVT
                     PSMTMRCIGMSNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPA
                     TLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGG
                     IVTCAMFRCKKNMEGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSI
                     TEAELTGYGTVTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLPGADTQG
                     SNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCR
                     LRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEK
                     RHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSIGQMF
                     ETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALHQVFGAIYGAAFSGVSWTMKILIG
                     VIITWIGMNSRSTSLSVTLVLVGIVTLYLGVMVQADSGCVVSWKNKELKCGSGIFITD
                     NVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIRSVTRLENLMWKQITPELNHILSE
                     NEVKLTIMTGDIKGIMQAGKRSLRPQPTELKYSWKTWGKAKMLSTESHNQTFLIDGPE
                     TAECPNTNRAWNSLEVEDYGFGVFTTNIWLKLKEKQDVFCDSKLMSAAIKDNRAVHAD
                     MGYWIESALNDTWKIEKASFIEVKNCHWPKSHTLWSNGVLESEMIIPKNLAGPVSQHN
                     YRPGYHTQITGPWHLGKLEMDFDFCDGTTVVVTEDCGNRGPSLRTTTASGKLITEWCC
                     RSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVNSLVTAGHGQVDNFSLGVLGMALFL
                     EEMLRTRVGTKHAILLVAVSFVTLITGNMSFRDLGRVMVMVGATMTDDIGMGVTYLAL
                     LAAFKVRPTFAAGLLLRKLTSKELMMTTIGIVLLSQSTIPETILELTDALALGMMVLK
                     MVRNMEKYQLAVTIMAILCVPNAVILQNAWKVSCTILAVVSVSPLLLTSSQQKTDWIP
                     LALTIKGLNPTAIFLTTLSRTSKKRSWPLNEAIMAVGMVSILASSLLKNDIPMTGPLV
                     AGGLLTVCYVLTGRSADLELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEE
                     EQTLTILIRTGLLVISGLFPVSIPITAAAWYLWEVKKQRAGVLWDVPSPPPMGKAELE
                     DGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLI
                     SYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNAGTIGAVSLDFSPGTS
                     GSPIIDKKGKVVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIEDDIFRKRRLTIMDL
                     HPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEH
                     TGREIVDLMCHATFTMRLLSPVRVPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEA
                     AGIFMTATPPGSRDPFPQSNAPIIDEEREIPERSWNSGHEWVTDFKGKTVWFVPSIKA
                     GNDIAACLRKNGKKVIQLSRKTFDSEYVKTRTNDWDFVVTTDISEMGANFKAERVIDP
                     RRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRIGRNPKNENDQYIYMGEPLENDE
                     DCAHWKEAKMLLDNINTPEGIIPSMFEPEREKVDAIDGEYRLRGEARKTFVDLMRRGD
                     LPVWLAYRVAAEGINYADRRWCFDGVKNNQILEENVEVEIWTKEGERKKLKPRWLDAR
                     IYSDPLALKEFKEFAAGRKSLTLNLITEMGRLPTFMTQKARDALDNLAVLHTAEAGGR
                     AYNHALSELPETLETLLLLTLLATVTGGIFLFLMSGRGIGKMTLGMCCIITASILLWY
                     AQIQPHWIAASIILEFFLIVLLIPEPEKQRTPQDNQLTYVVIAILTVVAATMANEMGF
                     LEKTKKDLGLGSIATQQPESNILDIDLRPASAWTLYAVATTFVTPMLRHSIENSSVNV
                     SLTAIANQATVLMGLGKGWPLSKMDIGVPLLAIGCYSQVNPITLTAALFLLVAHYAII
                     GPGLQAKATREAQKRAAAGIMKNPTVDGITVIDLDPIPYDPKFEKQLGQVMLLVLCVT
                     QVLMMRTTWALCEALTLATGPISTLWEGNPGRFWNTTIAVSMANIFRGSYLAGAGLLF
                     SIMKNTTNTRRGTGNIGETLGEKWKSRLNALGKSEFQIYKKSGIQEVDRTLAKEGIKR
                     GETDHHAVSRGSAKLRWFVERNMVTPEGKVVDLGCGRGGWSYYCGGLKNVREVKGLTK
                     GGPGHEEPIPMSTYGWNLVRLQSGVDVFFIPPEKCDTLLCDIGESSPNPTVEAGRTLR
                     VLNLVENWLNNNTQFCIKVLNPYMPSVIEKMEALQRKYGGALVRNPLSRNSTHEMYWV
                     SNASGNIVSSVNMISRMLINRFTMRYKKATYEPDVDLGSGTRNIGIESEIPNLDIIGK
                     RIEKIKQEHETSWHYDQDHPYKTWAYHGSYETKQTGSASSMVNGVVRLLTKPWDVVPM
                     VTQMAMTDTTPFGQQRVFKEKVDTRTQEPKEGTKKLMKITAEWLWKELGKKKTPRMCT
                     REEFTRKVRSNAALGAIFTDENKWKSAREAVEDSRFWELVDKERNLHLEGKCETCVYN
                     MMGKREKKLGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWFSRENSLSGVEGEG
                     LHKLGYILRDVSKKEGGAMYADDTAGWDTRITLEDLKNEEMVTNHMEGEHKKLAEAIF
                     KLTYQNKVVRVQRPTPRGTVMDIISRRDQRGSGQVGTYGLNTFTNMEAQLIRQMEGEG
                     VFKSIQHLTITEEIAVQNWLARVGRERLSRMAISGDDCVVKPLDDRFASALTALNDMG
                     KIRKDIQQWEPSRGWNDWTQVPFCSHHFHELIMKDGRVLVVPCRNQDELIGRARISQG
                     AGWSLRETACLGKSYAQMWSLMYFHRRDLRLAANAICSAVPSHWVPTSRTTWSIHAKH
                     EWMTTEDMLTVWNRVWIQENPWMEDKTPVESWEEIPYLGKREDQWCGSLIGLTSRATW
                     AKNIQAAINQVRSLIGNEEYTDYMPSMKRFRREEEEAGVLW"
     mat_peptide     97..438
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="anchored capsid protein ancC"
                     /protein_id="NP_739581.2"
                     /db_xref="VBRC:35917"
     mat_peptide     97..396
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="capsid protein C"
                     /protein_id="NP_739591.2"
                     /db_xref="VBRC:35918"
     misc_feature    109..438
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus capsid protein C; Region: Flavi_capsid;
                     pfam01003"
                     /db_xref="CDD:250285"
     mat_peptide     439..936
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein precursor prM"
                     /protein_id="NP_739582.2"
                     /db_xref="VBRC:35919"
     mat_peptide     439..711
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein pr"
                     /note="peptide pr"
                     /protein_id="YP_009164954.1"
     misc_feature    472..708
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus polyprotein propeptide; Region:
                     Flavi_propep; pfam01570"
                     /db_xref="CDD:279856"
     mat_peptide     712..936
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein M"
                     /protein_id="NP_739592.2"
                     /db_xref="VBRC:35920"
     misc_feature    715..936
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus envelope glycoprotein M; Region:
                     Flavi_M; pfam01004"
                     /db_xref="CDD:279358"
     mat_peptide     937..2421
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="envelope protein E"
                     /protein_id="NP_739583.2"
                     /db_xref="VBRC:35921"
     misc_feature    940..1824
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus glycoprotein, central and dimerization
                     domains; Region: Flavi_glycoprot; pfam00869"
                     /db_xref="CDD:279241"
     misc_feature    1849..2118
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Immunoglobulin-like domain III (C-terminal domain)
                     of Flavivirus envelope glycoprotein E; Region: Flavi_E_C;
                     cd12149"
                     /db_xref="CDD:213392"
     misc_feature    order(1864..1869,1873..1878,1897..1902,2032..2034)
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213392"
     misc_feature    order(1885..1887,1936..1938,1990..2001,2005..2007)
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="low pH domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213392"
     misc_feature    order(1888..1890,1936..1938,1984..1992,2044..2046)
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="low pH trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213392"
     misc_feature    2131..2421
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="flavivirus envelope glycoprotein E, stem/anchor
                     domain; Region: flavi_E_stem; TIGR04240"
                     /db_xref="CDD:213897"
     mat_peptide     2422..3477
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS1"
                     /protein_id="NP_739584.2"
                     /db_xref="VBRC:35922"
     misc_feature    2425..3486
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural Protein NS1; Region:
                     Flavi_NS1; pfam00948"
                     /db_xref="CDD:279316"
     mat_peptide     3478..4131
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2A"
                     /protein_id="NP_739585.2"
                     /db_xref="VBRC:35923"
     misc_feature    3508..4122
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2A; Region:
                     Flavi_NS2A; pfam01005"
                     /db_xref="CDD:279359"
     mat_peptide     4132..4521
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2B"
                     /protein_id="NP_739586.2"
                     /db_xref="VBRC:35924"
     misc_feature    4141..4521
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2B; Region:
                     Flavi_NS2B; pfam01002"
                     /db_xref="CDD:279357"
     mat_peptide     4522..6375
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS3"
                     /note="RNA-helicase; protease; ATPase; component of
                     capping enzyme (RNA thriphosphatase)"
                     /protein_id="NP_739587.2"
                     /db_xref="VBRC:35925"
     misc_feature    4576..5022
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Peptidase S7, Flavivirus NS3 serine protease;
                     Region: Peptidase_S7; pfam00949"
                     /db_xref="CDD:279317"
     misc_feature    5065..5496
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    5074..5511
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus DEAD domain; Region: Flavi_DEAD;
                     pfam07652"
                     /db_xref="CDD:284962"
     misc_feature    5107..5121
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    5371..5382
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    <5584..5913
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    order(5767..5769,5887..5889,5899..5901,5908..5910)
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     mat_peptide     6376..6756
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4A"
                     /protein_id="NP_739588.2"
                     /db_xref="VBRC:35926"
     misc_feature    6388..6816
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4A; Region:
                     Flavi_NS4A; pfam01350"
                     /db_xref="CDD:279666"
     mat_peptide     6757..6825
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein 2K"
                     /protein_id="NP_739593.2"
                     /db_xref="VBRC:35927"
     mat_peptide     6826..7569
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4B"
                     /protein_id="NP_739589.2"
                     /db_xref="VBRC:35928"
     misc_feature    6826..7548
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4B; Region:
                     Flavi_NS4B; pfam01349"
                     /db_xref="CDD:279665"
     mat_peptide     7570..10269
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="RNA-dependent RNA polymerase NS5"
                     /note="methyltransferase component of capping enzyme;
                     nonstructural protein NS5"
                     /protein_id="NP_739590.2"
                     /db_xref="VBRC:35929"
     misc_feature    7732..8235
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="FtsJ-like methyltransferase; Region: FtsJ;
                     pfam01728"
                     /db_xref="CDD:279986"
     misc_feature    8320..10236
                     /gene="POLY"
                     /locus_tag="DENV_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus RNA-directed RNA polymerase; Region:
                     Flavi_NS5; pfam00972"
                     /db_xref="CDD:279336"
     stem_loop       116..132
                     /note="capsid region hairpin (cHP)"
     regulatory      134..144
                     /regulatory_class="other"
                     /note="5' conserved sequence (CS); also called cyclization
                     sequence"
     3'UTR           10273..10723
     ncRNA           10299..10723
                     /ncRNA_class="lncRNA"
                     /product="sfRNA1"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10303..10368
                     /note="flaviviral nuclease-resistant RNA 1 (fNR1); also
                     called stem-loop 1 or xrRNA1"
     ncRNA           10372..10723
                     /ncRNA_class="lncRNA"
                     /product="sfRNA2"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10376..10441
                     /note="flaviviral nuclease-resistant RNA 2 (fNR2); also
                     called stem-loop 2 or xrRNA2"
     ncRNA           10449..10723
                     /ncRNA_class="lncRNA"
                     /product="sfRNA3"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10453..10534
                     /note="dumbbell 1 (DBI); also called xrRNA3"
     ncRNA           10536..10723
                     /ncRNA_class="lncRNA"
                     /product="sfRNA4"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10540..10621
                     /note="dumbbell 2 (DBII); also called xrRNA4"
     regulatory      10618..10628
                     /regulatory_class="other"
                     /note="3' conserved sequence (CS); also called cyclization
                     sequence"
     stem_loop       10631..10644
                     /note="short hairpin (sHP)"
     regulatory      10642..10658
                     /regulatory_class="promoter"
                     /note="3' upstream AUG region (UAR)"
     stem_loop       10645..10723
                     /note="3' stem-loop (3'SL)"
ORIGIN      
        1 agttgttagt ctacgtggac cgacaaagac agattctttg agggagctaa gctcaacgta
       61 gttctaacag ttttttaatt agagagcaga tctctgatga ataaccaacg gaaaaaggcg
      121 aaaaacacgc ctttcaatat gctgaaacgc gagagaaacc gcgtgtcgac tgtgcaacag
      181 ctgacaaaga gattctcact tggaatgctg cagggacgag gaccattaaa actgttcatg
      241 gccctggtgg cgttccttcg tttcctaaca atcccaccaa cagcagggat attgaagaga
      301 tggggaacaa ttaaaaaatc aaaagctatt aatgttttga gagggttcag gaaagagatt
      361 ggaaggatgc tgaacatctt gaataggaga cgcagatctg caggcatgat cattatgctg
      421 attccaacag tgatggcgtt ccatttaacc acacgtaacg gagaaccaca catgatcgtc
      481 agcagacaag agaaagggaa aagtcttctg tttaaaacag aggatggcgt gaacatgtgt
      541 accctcatgg ccatggacct tggtgaattg tgtgaagaca caatcacgta caagtgtccc
      601 cttctcaggc agaatgagcc agaagacata gactgttggt gcaactctac gtccacgtgg
      661 gtaacttatg ggacgtgtac caccatggga gaacatagaa gagaaaaaag atcagtggca
      721 ctcgttccac atgtgggaat gggactggag acacgaactg aaacatggat gtcatcagaa
      781 ggggcctgga aacatgtcca gagaattgaa acttggatct tgagacatcc aggcttcacc
      841 atgatggcag caatcctggc atacaccata ggaacgacac atttccaaag agccctgatt
      901 ttcatcttac tgacagctgt cactccttca atgacaatgc gttgcatagg aatgtcaaat
      961 agagactttg tggaaggggt ttcaggagga agctgggttg acatagtctt agaacatgga
     1021 agctgtgtga cgacgatggc aaaaaacaaa ccaacattgg attttgaact gataaaaaca
     1081 gaagccaaac agcctgccac cctaaggaag tactgtatag aggcaaagct aaccaacaca
     1141 acaacagaat ctcgctgccc aacacaaggg gaacccagcc taaatgaaga gcaggacaaa
     1201 aggttcgtct gcaaacactc catggtagac agaggatggg gaaatggatg tggactattt
     1261 ggaaagggag gcattgtgac ctgtgctatg ttcagatgca aaaagaacat ggaaggaaaa
     1321 gttgtgcaac cagaaaactt ggaatacacc attgtgataa cacctcactc aggggaagag
     1381 catgcagtcg gaaatgacac aggaaaacat ggcaaggaaa tcaaaataac accacagagt
     1441 tccatcacag aagcagaatt gacaggttat ggcactgtca caatggagtg ctctccaaga
     1501 acgggcctcg acttcaatga gatggtgttg ctgcagatgg aaaataaagc ttggctggtg
     1561 cacaggcaat ggttcctaga cctgccgtta ccatggttgc ccggagcgga cacacaaggg
     1621 tcaaattgga tacagaaaga gacattggtc actttcaaaa atccccatgc gaagaaacag
     1681 gatgttgttg ttttaggatc ccaagaaggg gccatgcaca cagcacttac aggggccaca
     1741 gaaatccaaa tgtcatcagg aaacttactc ttcacaggac atctcaagtg caggctgaga
     1801 atggacaagc tacagctcaa aggaatgtca tactctatgt gcacaggaaa gtttaaagtt
     1861 gtgaaggaaa tagcagaaac acaacatgga acaatagtta tcagagtgca atatgaaggg
     1921 gacggctctc catgcaagat cccttttgag ataatggatt tggaaaaaag acatgtctta
     1981 ggtcgcctga ttacagtcaa cccaattgtg acagaaaaag atagcccagt caacatagaa
     2041 gcagaacctc cattcggaga cagctacatc atcataggag tagagccggg acaactgaag
     2101 ctcaactggt ttaagaaagg aagttctatc ggccaaatgt ttgagacaac aatgaggggg
     2161 gcgaagagaa tggccatttt aggtgacaca gcctgggatt ttggatcctt gggaggagtg
     2221 tttacatcta taggaaaggc tctccaccaa gtctttggag caatctatgg agctgccttc
     2281 agtggggttt catggactat gaaaatcctc ataggagtca ttatcacatg gataggaatg
     2341 aattcacgca gcacctcact gtctgtgaca ctagtattgg tgggaattgt gacactgtat
     2401 ttgggagtca tggtgcaggc cgatagtggt tgcgttgtga gctggaaaaa caaagaactg
     2461 aaatgtggca gtgggatttt catcacagac aacgtgcaca catggacaga acaatacaag
     2521 ttccaaccag aatccccttc aaaactagct tcagctatcc agaaagccca tgaagagggc
     2581 atttgtggaa tccgctcagt aacaagactg gagaatctga tgtggaaaca aataacacca
     2641 gaattgaatc acattctatc agaaaatgag gtgaagttaa ctattatgac aggagacatc
     2701 aaaggaatca tgcaggcagg aaaacgatct ctgcggcctc agcccactga gctgaagtat
     2761 tcatggaaaa catggggcaa agcaaaaatg ctctctacag agtctcataa ccagaccttt
     2821 ctcattgatg gccccgaaac agcagaatgc cccaacacaa atagagcttg gaattcgttg
     2881 gaagttgaag actatggctt tggagtattc accaccaata tatggctaaa attgaaagaa
     2941 aaacaggatg tattctgcga ctcaaaactc atgtcagcgg ccataaaaga caacagagcc
     3001 gtccatgccg atatgggtta ttggatagaa agtgcactca atgacacatg gaagatagag
     3061 aaagcctctt tcattgaagt taaaaactgc cactggccaa aatcacacac cctctggagc
     3121 aatggagtgc tagaaagtga gatgataatt ccaaagaatc tcgctggacc agtgtctcaa
     3181 cacaactata gaccaggcta ccatacacaa ataacaggac catggcatct aggtaagctt
     3241 gagatggact ttgatttctg tgatggaaca acagtggtag tgactgagga ctgcggaaat
     3301 agaggaccct ctttgagaac aaccactgcc tctggaaaac tcataacaga atggtgctgc
     3361 cgatcttgca cattaccacc gctaagatac agaggtgagg atgggtgctg gtacgggatg
     3421 gaaatcagac cattgaagga gaaagaagag aatttggtca actccttggt cacagctgga
     3481 catgggcagg tcgacaactt ttcactagga gtcttgggaa tggcattgtt cctggaggaa
     3541 atgcttagga cccgagtagg aacgaaacat gcaatactac tagttgcagt ttcttttgtg
     3601 acattgatca cagggaacat gtcctttaga gacctgggaa gagtgatggt tatggtaggc
     3661 gccactatga cggatgacat aggtatgggc gtgacttatc ttgccctact agcagccttc
     3721 aaagtcagac caacttttgc agctggacta ctcttgagaa agctgacctc caaggaattg
     3781 atgatgacta ctataggaat tgtactcctc tcccagagca ccataccaga gaccattctt
     3841 gagttgactg atgcgttagc cttaggcatg atggtcctca aaatggtgag aaatatggaa
     3901 aagtatcaat tggcagtgac tatcatggct atcttgtgcg tcccaaacgc agtgatatta
     3961 caaaacgcat ggaaagtgag ttgcacaata ttggcagtgg tgtccgtttc cccactgctc
     4021 ttaacatcct cacagcaaaa aacagattgg ataccattag cattgacgat caaaggtctc
     4081 aatccaacag ctatttttct aacaaccctc tcaagaacca gcaagaaaag gagctggcca
     4141 ttaaatgagg ctatcatggc agtcgggatg gtgagcattt tagccagttc tctcctaaaa
     4201 aatgatattc ccatgacagg accattagtg gctggagggc tcctcactgt gtgctacgtg
     4261 ctcactggac gatcggccga tttggaactg gagagagcag ccgatgtcaa atgggaagac
     4321 caggcagaga tatcaggaag cagtccaatc ctgtcaataa caatatcaga agatggtagc
     4381 atgtcgataa aaaatgaaga ggaagaacaa acactgacca tactcattag aacaggattg
     4441 ctggtgatct caggactttt tcctgtatca ataccaatca cggcagcagc atggtacctg
     4501 tgggaagtga agaaacaacg ggccggagta ttgtgggatg ttccttcacc cccacccatg
     4561 ggaaaggctg aactggaaga tggagcctat agaattaagc aaaaagggat tcttggatat
     4621 tcccagatcg gagccggagt ttacaaagaa ggaacattcc atacaatgtg gcatgtcaca
     4681 cgtggcgctg ttctaatgca taaaggaaag aggattgaac catcatgggc ggacgtcaag
     4741 aaagacctaa tatcatatgg aggaggctgg aagttagaag gagaatggaa ggaaggagaa
     4801 gaagtccagg tattggcact ggagcctgga aaaaatccaa gagccgtcca aacgaaacct
     4861 ggtcttttca aaaccaacgc cggaacaata ggtgctgtat ctctggactt ttctcctgga
     4921 acgtcaggat ctccaattat cgacaaaaaa ggaaaagttg tgggtcttta tggtaatggt
     4981 gttgttacaa ggagtggagc atatgtgagt gctatagccc agactgaaaa aagcattgaa
     5041 gacaacccag agatcgaaga tgacattttc cgaaagagaa gactgaccat catggacctc
     5101 cacccaggag cgggaaagac gaagagatac cttccggcca tagtcagaga agctataaaa
     5161 cggggtttga gaacattaat cttggccccc actagagttg tggcagctga aatggaggaa
     5221 gcccttagag gacttccaat aagataccag accccagcca tcagagctga gcacaccggg
     5281 cgggagattg tggacctaat gtgtcatgcc acatttacca tgaggctgct atcaccagtt
     5341 agagtgccaa actacaacct gattatcatg gacgaagccc atttcacaga cccagcaagt
     5401 atagcagcta gaggatacat ctcaactcga gtggagatgg gtgaggcagc tgggattttt
     5461 atgacagcca ctcccccggg aagcagagac ccatttcctc agagcaatgc accaatcata
     5521 gatgaagaaa gagaaatccc tgaacgttcg tggaattccg gacatgaatg ggtcacggat
     5581 tttaaaggga agactgtttg gttcgttcca agtataaaag caggaaatga tatagcagct
     5641 tgcctgagga aaaatggaaa gaaagtgata caactcagta ggaagacctt tgattctgag
     5701 tatgtcaaga ctagaaccaa tgattgggac ttcgtggtta caactgacat ttcagaaatg
     5761 ggtgccaatt tcaaggctga gagggttata gaccccagac gctgcatgaa accagtcata
     5821 ctaacagatg gtgaagagcg ggtgattctg gcaggaccta tgccagtgac ccactctagt
     5881 gcagcacaaa gaagagggag aataggaaga aatccaaaaa atgagaatga ccagtacata
     5941 tacatggggg aacctctgga aaatgatgaa gactgtgcac actggaaaga agctaaaatg
     6001 ctcctagata acatcaacac gccagaagga atcattccta gcatgttcga accagagcgt
     6061 gaaaaggtgg atgccattga tggcgaatac cgcttgagag gagaagcaag gaaaaccttt
     6121 gtagacttaa tgagaagagg agacctacca gtctggttgg cctacagagt ggcagctgaa
     6181 ggcatcaact acgcagacag aaggtggtgt tttgatggag tcaagaacaa ccaaatccta
     6241 gaagaaaacg tggaagttga aatctggaca aaagaagggg aaaggaagaa attgaaaccc
     6301 agatggttgg atgctaggat ctattctgac ccactggcgc taaaagaatt taaggaattt
     6361 gcagccggaa gaaagtctct gaccctgaac ctaatcacag aaatgggtag gctcccaacc
     6421 ttcatgactc agaaggcaag agacgcactg gacaacttag cagtgctgca cacggctgag
     6481 gcaggtggaa gggcgtacaa ccatgctctc agtgaactgc cggagaccct ggagacattg
     6541 cttttactga cacttctggc tacagtcacg ggagggatct ttttattctt gatgagcgga
     6601 aggggcatag ggaagatgac cctgggaatg tgctgcataa tcacggctag catcctccta
     6661 tggtacgcac aaatacagcc acactggata gcagcttcaa taatactgga gttttttctc
     6721 atagttttgc ttattccaga acctgaaaaa cagagaacac cccaagacaa ccaactgacc
     6781 tacgttgtca tagccatcct cacagtggtg gccgcaacca tggcaaacga gatgggtttc
     6841 ctagaaaaaa cgaagaaaga tctcggattg ggaagcattg caacccagca acccgagagc
     6901 aacatcctgg acatagatct acgtcctgca tcagcatgga cgctgtatgc cgtggccaca
     6961 acatttgtta caccaatgtt gagacatagc attgaaaatt cctcagtgaa tgtgtcccta
     7021 acagctatag ccaaccaagc cacagtgtta atgggtctcg ggaaaggatg gccattgtca
     7081 aagatggaca tcggagttcc ccttctcgcc attggatgct actcacaagt caaccccata
     7141 actctcacag cagctctttt cttattggta gcacattatg ccatcatagg gccaggactc
     7201 caagcaaaag caaccagaga agctcagaaa agagcagcgg cgggcatcat gaaaaaccca
     7261 actgtcgatg gaataacagt gattgaccta gatccaatac cttatgatcc aaagtttgaa
     7321 aagcagttgg gacaagtaat gctcctagtc ctctgcgtga ctcaagtatt gatgatgagg
     7381 actacatggg ctctgtgtga ggctttaacc ttagctaccg ggcccatctc cacattgtgg
     7441 gaaggaaatc cagggaggtt ttggaacact accattgcgg tgtcaatggc taacattttt
     7501 agagggagtt acttggccgg agctggactt ctcttttcta ttatgaagaa cacaaccaac
     7561 acaagaaggg gaactggcaa cataggagag acgcttggag agaaatggaa aagccgattg
     7621 aacgcattgg gaaaaagtga attccagatc tacaagaaaa gtggaatcca ggaagtggat
     7681 agaaccttag caaaagaagg cattaaaaga ggagaaacgg accatcacgc tgtgtcgcga
     7741 ggctcagcaa aactgagatg gttcgttgag agaaacatgg tcacaccaga agggaaagta
     7801 gtggacctcg gttgtggcag aggaggctgg tcatactatt gtggaggact aaagaatgta
     7861 agagaagtca aaggcctaac aaaaggagga ccaggacacg aagaacccat ccccatgtca
     7921 acatatgggt ggaatctagt gcgtcttcaa agtggagttg acgttttctt catcccgcca
     7981 gaaaagtgtg acacattatt gtgtgacata ggggagtcat caccaaatcc cacagtggaa
     8041 gcaggacgaa cactcagagt ccttaactta gtagaaaatt ggttgaacaa caacactcaa
     8101 ttttgcataa aggttctcaa cccatatatg ccctcagtca tagaaaaaat ggaagcacta
     8161 caaaggaaat atggaggagc cttagtgagg aatccactct cacgaaactc cacacatgag
     8221 atgtactggg tatccaatgc ttccgggaac atagtgtcat cagtgaacat gatttcaagg
     8281 atgttgatca acagatttac aatgagatac aagaaagcca cttacgagcc ggatgttgac
     8341 ctcggaagcg gaacccgtaa catcgggatt gaaagtgaga taccaaacct agatataatt
     8401 gggaaaagaa tagaaaaaat aaagcaagag catgaaacat catggcacta tgaccaagac
     8461 cacccataca aaacgtgggc ataccatggt agctatgaaa caaaacagac tggatcagca
     8521 tcatccatgg tcaacggagt ggtcaggctg ctgacaaaac cttgggacgt cgtccccatg
     8581 gtgacacaga tggcaatgac agacacgact ccatttggac aacagcgcgt ttttaaagag
     8641 aaagtggaca cgagaaccca agaaccgaaa gaaggcacga agaaactaat gaaaataaca
     8701 gcagagtggc tttggaaaga attagggaag aaaaagacac ccaggatgtg caccagagaa
     8761 gaattcacaa gaaaggtgag aagcaatgca gccttggggg ccatattcac tgatgagaac
     8821 aagtggaagt cggcacgtga ggctgttgaa gatagtaggt tttgggagct ggttgacaag
     8881 gaaaggaatc tccatcttga aggaaagtgt gaaacatgtg tgtacaacat gatgggaaaa
     8941 agagagaaga agctagggga attcggcaag gcaaaaggca gcagagccat atggtacatg
     9001 tggcttggag cacgcttctt agagtttgaa gccctaggat tcttaaatga agatcactgg
     9061 ttctccagag agaactccct gagtggagtg gaaggagaag ggctgcacaa gctaggttac
     9121 attctaagag acgtgagcaa gaaagaggga ggagcaatgt atgccgatga caccgcagga
     9181 tgggatacaa gaatcacact agaagaccta aaaaatgaag aaatggtaac aaaccacatg
     9241 gaaggagaac acaagaaact agccgaggcc attttcaaac taacgtacca aaacaaggtg
     9301 gtgcgtgtgc aaagaccaac accaagaggc acagtaatgg acatcatatc gagaagagac
     9361 caaagaggta gtggacaagt tggcacctat ggactcaata ctttcaccaa tatggaagcc
     9421 caactaatca gacagatgga gggagaagga gtctttaaaa gcattcagca cctaacaatc
     9481 acagaagaaa tcgctgtgca aaactggtta gcaagagtgg ggcgcgaaag gttatcaaga
     9541 atggccatca gtggagatga ttgtgttgtg aaacctttag atgacaggtt cgcaagcgct
     9601 ttaacagctc taaatgacat gggaaagatt aggaaagaca tacaacaatg ggaaccttca
     9661 agaggatgga atgattggac acaagtgccc ttctgttcac accatttcca tgagttaatc
     9721 atgaaagacg gtcgcgtact cgttgttcca tgtagaaacc aagatgaact gattggcaga
     9781 gcccgaatct cccaaggagc agggtggtct ttgcgggaga cggcctgttt ggggaagtct
     9841 tacgcccaaa tgtggagctt gatgtacttc cacagacgcg acctcaggct ggcggcaaat
     9901 gctatttgct cggcagtacc atcacattgg gttccaacaa gtcgaacaac ctggtccata
     9961 catgctaaac atgaatggat gacaacggaa gacatgctga cagtctggaa cagggtgtgg
    10021 attcaagaaa acccatggat ggaagacaaa actccagtgg aatcatggga ggaaatccca
    10081 tacttgggga aaagagaaga ccaatggtgc ggctcattga ttgggttaac aagcagggcc
    10141 acctgggcaa agaacatcca agcagcaata aatcaagtta gatcccttat aggcaatgaa
    10201 gaatacacag attacatgcc atccatgaaa agattcagaa gagaagagga agaagcagga
    10261 gttctgtggt agaaagcaaa actaacatga aacaaggcta gaagtcaggt cggattaagc
    10321 catagtacgg aaaaaactat gctacctgtg agccccgtcc aaggacgtta aaagaagtca
    10381 ggccatcata aatgccatag cttgagtaaa ctatgcagcc tgtagctcca cctgagaagg
    10441 tgtaaaaaat ccgggaggcc acaaaccatg gaagctgtac gcatggcgta gtggactagc
    10501 ggttagagga gacccctccc ttacaaatcg cagcaacaat gggggcccaa ggcgagatga
    10561 agctgtagtc tcgctggaag gactagaggt tagaggagac ccccccgaaa caaaaaacag
    10621 catattgacg ctgggaaaga ccagagatcc tgctgtctcc tcagcatcat tccaggcaca
    10681 gaacgccaga aaatggaatg gtgctgttga atcaacaggt tct
//
DBGET integrated database retrieval system