GenomeNet

Database: RefSeq
Entry: NC_001475
LinkDB: NC_001475
Original site: NC_001475 
LOCUS       NC_001475              10707 bp    RNA     linear   VRL 11-JUL-2019
DEFINITION  Dengue virus 3, complete genome.
ACCESSION   NC_001475
VERSION     NC_001475.2
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Dengue virus 3
  ORGANISM  Dengue virus 3
            Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes;
            Amarillovirales; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10707)
  AUTHORS   Peyrefitte,C.N., Couissinier-Paris,P., Mercier-Perennec,V.,
            Bessaud,M., Martial,J., Kenane,N., Durand,J.P. and Tolou,H.J.
  TITLE     Genetic Characterization of Newly Reintroduced Dengue Virus Type 3
            in Martinique (French West Indies)
  JOURNAL   J. Clin. Microbiol. 41 (11), 5195-5198 (2003)
   PUBMED   14605161
REFERENCE   2  (bases 1 to 10707)
  AUTHORS   Peyrefitte,C., Mercier,V., Couissinier-Paris,P., Tock,F.,
            Kenane,N., Durand,J.-P. and Tolou,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-APR-2002) Unite de Virologie Tropicale, IMTSSA, Parc
            du Pharo, Marseille Armees, BDR 13998, France
REFERENCE   3  (bases 1 to 10707)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY099336.
            On Dec 20, 2007 this sequence version replaced NC_001475.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10707
                     /organism="Dengue virus 3"
                     /mol_type="genomic RNA"
                     /isolate="D3/H/IMTSSA-SRI/2000/1266"
                     /db_xref="taxon:11069"
                     /country="Sri Lanka"
     5'UTR           1..94
     stem_loop       2..69
                     /note="stem-loop A (SLA)"
     regulatory      70..78
                     /regulatory_class="other"
                     /note="oligo U track spacer"
     regulatory      79..94
                     /regulatory_class="ribosome_binding_site"
                     /note="5' upstream AUG region (UAR)"
     stem_loop       79..93
                     /note="stem-loop B (SLB)"
     gene            95..10267
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /db_xref="GeneID:5075727"
     CDS             95..10267
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="YP_001621843.1"
                     /db_xref="GeneID:5075727"
                     /translation="MNNQRKKTGKPSINMLKRVRNRVSTGSQLAKRFSKGLLNGQGPM
                     KLVMAFIAFLRFLAIPPTAGVLARWGTFKKSGAIKVLKGFKKEISNMLSIINQRKKTS
                     LCLMMILPAALAFHLTSRDGEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCD
                     DTVTYKCPHITEVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLD
                     TRTQTWMSAEGAWRQVEKVETWALRHPGFTILALFLAHYIGTSLTQKVVIFILLMLVT
                     PSMTMRCVGVGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIELQKTEATQLA
                     TLRKLCIEGKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGS
                     LVTCAKFQCLEPIEGKVVQYENLKYTVIITVHTGDQHQVGNETQGVTAEITPQASTTE
                     AILPEYGTLGLECSPRTGLDFNEMILLTMKNKAWMVHRQWFFDLPLPWASGATTETPT
                     WNRKELLVTFKNAHAKKQEVVVLGSQEGAMHTALTGATEIQNSGGTSIFAGHLKCRLK
                     MDKLELKGMSYAMCTNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKA
                     HNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDNALKINWYKKGSSIGKMFEA
                     TERGARRMAILGDTAWDFGSVGGVLNSLGKMVHQIFGSAYTALFSGVSWVMKIGIGVL
                     LTWIGLNSKNTSMSFSCIAIGIITLYLGAVVQADMGCVINWKGKELKCGSGIFVTNEV
                     HTWTEQYKFQADSPKRLATAIAGAWENGVCGIRSTTRMENLLWKQIANELNYILWENN
                     IKLTVVVGDTLGVLEQGKRTLTPQPMELKYSWKTWGKAKIVTAETQNSSFIIDGPNTP
                     ECPSASRAWNVWEVEDYGFGVFTTNIWLKLREVYTQLCDHRLMSAAVKDERAVHADMG
                     YWIESQKNGSWKLEKASLIEVKTCTWPKSHTLWTNGVLESDMIIPKSLAGPISQHNYR
                     PGYHTQTAGPWHLGKLELDFNYCEGTTVVITESCGTRGPSLRTTTVSGKLIHEWCCRS
                     CTLPPLRYMGEDGCWYGMEIRPISEKEENMVKSLVSAGSGKVDNFTMGVLCLAILFEE
                     VLRGKFGKKHMIAGVFFTFVLLLSGQITWRDMAHTLIMIGSNASDRMGMGVTYLALIA
                     TFKIQPFLALGFFLRKLTSRENLLLGVGLAMATTLQLPEDIEQMANGVALGLMALKLI
                     TQFETYQLWTALVSLTCSNTIFTLTVAWRTATLILAGVSLLPVCQSSSMRKTDWLPMT
                     VAAMGVPPLPLFIFSLKDTLKRRSWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAG
                     GLLIACYVITGTSADLTVEKAPDVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETEN
                     ILTVLLKTALLIVSGIFPYSIPATLLVWHTWQKQTQRSGVLWDVPSPPETQKAELEEG
                     VYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISY
                     GGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTTPGTFQTTTGEIGAIALDFKPGTSGS
                     PIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAEPDGPTPELEEEMFKKRNLTIMDLH
                     PGSGKTRKYLPAIVREAIKRRLRTLILAPTRVVAAEMEEALKGLPIRYQTTATKSEHT
                     GREIVDLMCHATFTMRLLSPVRVPNYNLIIMDEAHFTDPASIAARGYISTRVGMGEAA
                     AIFMTATPPGTADAFPQSNAPIQDEERDIPERSWNSGNEWITDFAGKTVWFVPSIKAG
                     NDIANCLRKNGKKVIQLSRKTFDTEYQKTKLNDWDFVVTTDISEMGANFKADRVIDPR
                     RCLKPVILTDGPERVILAGPMPVTAASAAQRRGRVGRNPQKENDQYIFTGQPLNNDED
                     HAHWTEAKMLLDNINTPEGIIPALFEPEREKSAAIDGEYRLKGESRKTFVELMRRGDL
                     PVWLAHKVASEGIKYTDRKWCFDGQRNNQILEENMDVEIWTKEGEKKKLRPRWLDART
                     YSDPLALKEFKDFAAGRKSIALDLVTEIGRVPSHLAHRTRNALDNLVMLHTSEDGGRA
                     YRHAVEELPETMETLLLLGLMILLTGGAMLFLISGKGIGKTSIGLICVIASSGMLWMA
                     EVPLQWIASAIVLEFFMMVLLIPEPEKQRTPQDNQLAYVVIGILTLAATIAANEMGLL
                     ETTKRDLGMSKEPGVVSPTSYLDVDLHPASAWTLYAVATTVITPMLRHTIENSTANVS
                     LAAIANQAVVLMGLDKGWPISKMDLGVPLLALGCYSQVNPLTLTAAVLLLITHYAIIG
                     PGLQAKATREAQKRTAAGIMKNPTVDGIMTIDLDSVIFDSKFEKQLGQVMLLVLCAVQ
                     LLLMRTSWALCEALTLATGPITTLWEGSPGKFWNTTIAVSMANIFRGSYLAGAGLAFS
                     IMKSVGTGKRGTGSQGETLGEKWKKKLNQLSRKEFDLYKKSGITEVDRTEAKEGLKRG
                     ETTHHAVSRGSAKLQWFVERNMVVPEGRVIDLGCGRGGWSYYCAGLKKVTEVRGYTKG
                     GPGHEEPVPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDIGESSPSPTVEESRTIRV
                     LKMVEPWLKNNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLSRNSTHEMYWISN
                     GTGNIVSSVNMVSRLLLNRFTMTHRRPTIEKDVDLGAGTRHVNAEPETPNMDVIGERI
                     KRIKEEHNSTWHYDDENPYKTWAYHGSYEVKATGSASSMINGVVKLLTKPWDVVPMVT
                     QMAMTDTTPFGQQRVFKEKVDTRTPRPMPGTRKAMEITAEWLWRTLGRNKRPRLCTRE
                     EFTKKVRTNAAMGAVFTEENQWDSAKAAVEDEEFWKLVDRERELHKLGKCGSCVYNMM
                     GKREKKLGEFGKAKGSRAIWYMWLGARYLEFEALGFLNEDHWFSRENSYSGVEGEGLH
                     KLGYILRDISKIPGGAMYADDTAGWDTRITEDDLHNEEKIIQQMDPEHRQLANAIFKL
                     TYQNKVVKVQRPTPTGTVMDIISRKDQRGSGQLGTYGLNTFTNMEAQLVRQMEGEGVL
                     TKADLENPHLLEKKITQWLETKGVERLKRMAISGDDCVVKPIDDRFANALLALNDMGK
                     VRKDIPQWQPSKGWHDWQQVPFCSHHFHELIMKDGRKLVVPCRPQDELIGRARISQGA
                     GWSLRETACLGKAYAQMWSLMYFHRRDLRLASNAICSAVPVHWVPTSRTTWSIHAHHQ
                     WMTTEDMLTVWNRVWIEENPWMEDKTPVTTWENVPYLGKREDQWCGSLIGLTSRATWA
                     QNIPTAIQQVRSLIGNEEFLDYMPSMKRFRKEEESEGAIW"
     mat_peptide     95..436
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="anchored capsid protein ancC"
                     /protein_id="YP_001531165.2"
     mat_peptide     95..394
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="capsid protein C"
                     /protein_id="YP_001531164.2"
     misc_feature    107..436
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus capsid protein C; Region: Flavi_capsid;
                     pfam01003"
                     /db_xref="CDD:250285"
     mat_peptide     437..934
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein precursor prM"
                     /note="premembrane/membrane protein"
                     /protein_id="YP_001531166.1"
     mat_peptide     437..709
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein pr"
                     /note="peptide pr"
                     /protein_id="YP_009164955.1"
     misc_feature    470..706
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus polyprotein propeptide; Region:
                     Flavi_propep; pfam01570"
                     /db_xref="CDD:279856"
     mat_peptide     710..934
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein M"
                     /note="protein M"
                     /protein_id="YP_001531167.1"
     misc_feature    713..934
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus envelope glycoprotein M; Region:
                     Flavi_M; pfam01004"
                     /db_xref="CDD:279358"
     mat_peptide     935..2413
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="envelope protein E"
                     /note="protein E"
                     /protein_id="YP_001531168.2"
     misc_feature    938..1816
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus glycoprotein, central and dimerization
                     domains; Region: Flavi_glycoprot; pfam00869"
                     /db_xref="CDD:279241"
     misc_feature    1820..2107
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus glycoprotein, immunoglobulin-like
                     domain; Region: Flavi_glycop_C; pfam02832"
                     /db_xref="CDD:280922"
     misc_feature    2123..2413
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="flavivirus envelope glycoprotein E, stem/anchor
                     domain; Region: flavi_E_stem; TIGR04240"
                     /db_xref="CDD:213897"
     mat_peptide     2414..3469
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS1"
                     /protein_id="YP_001531169.2"
     misc_feature    2420..3478
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural Protein NS1; Region:
                     Flavi_NS1; pfam00948"
                     /db_xref="CDD:279316"
     mat_peptide     3470..4123
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2A"
                     /protein_id="YP_001531170.2"
     misc_feature    3500..4048
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2A; Region:
                     Flavi_NS2A; pfam01005"
                     /db_xref="CDD:279359"
     mat_peptide     4124..4513
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2B"
                     /protein_id="YP_001531171.3"
     misc_feature    4133..4513
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2B; Region:
                     Flavi_NS2B; pfam01002"
                     /db_xref="CDD:279357"
     mat_peptide     4514..6370
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS3"
                     /protein_id="YP_001531172.2"
     misc_feature    4574..5014
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Peptidase S7, Flavivirus NS3 serine protease;
                     Region: Peptidase_S7; pfam00949"
                     /db_xref="CDD:279317"
     misc_feature    5054..5491
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    5069..5506
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus DEAD domain; Region: Flavi_DEAD;
                     pfam07652"
                     /db_xref="CDD:284962"
     misc_feature    5102..5116
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    5366..5377
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    5627..5905
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    order(5762..5764,5882..5884,5894..5896,5903..5905)
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     mat_peptide     6371..6751
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4A"
                     /protein_id="YP_001531173.2"
     misc_feature    6383..6814
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4A; Region:
                     Flavi_NS4A; pfam01350"
                     /db_xref="CDD:279666"
     mat_peptide     6752..6820
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein 2K"
                     /note="presumably plays a role in membrane rearrangement"
                     /protein_id="YP_001531174.2"
     mat_peptide     6821..7564
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4B"
                     /protein_id="YP_001531175.2"
     misc_feature    6821..7543
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4B; Region:
                     Flavi_NS4B; pfam01349"
                     /db_xref="CDD:279665"
     mat_peptide     7565..10264
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="RNA-dependent RNA polymerase NS5"
                     /protein_id="YP_001531176.2"
     misc_feature    7727..8233
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="FtsJ-like methyltransferase; Region: FtsJ;
                     pfam01728"
                     /db_xref="CDD:279986"
     misc_feature    8312..10231
                     /gene="POLY"
                     /locus_tag="DV3_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus RNA-directed RNA polymerase; Region:
                     Flavi_NS5; pfam00972"
                     /db_xref="CDD:279336"
     stem_loop       114..130
                     /note="capsid region hairpin (cHP)"
     regulatory      132..142
                     /regulatory_class="other"
                     /note="5' conserved sequence (CS); also called cyclization
                     sequence"
     3'UTR           10268..10707
     ncRNA           10290..10707
                     /ncRNA_class="lncRNA"
                     /product="sfRNA1"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10294..10359
                     /note="flaviviral nuclease-resistant RNA 1 (fNR1); also
                     called stem-loop 1 or xrRNA1"
     ncRNA           10366..10707
                     /ncRNA_class="lncRNA"
                     /product="sfRNA2"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10370..10432
                     /note="flaviviral nuclease-resistant RNA 2 (fNR2); also
                     called stem-loop 2 or xrRNA2"
     ncRNA           10436..10707
                     /ncRNA_class="lncRNA"
                     /product="sfRNA3"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10440..10552
                     /note="dumbbell 1 (DBI); also called xrRNA3"
     ncRNA           10524..10707
                     /ncRNA_class="lncRNA"
                     /product="sfRNA4"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10524..10605
                     /note="dumbbell 2 (DBII); also called xrRNA4"
     regulatory      10602..10612
                     /regulatory_class="other"
                     /note="3' conserved sequence (CS); also called cyclization
                     sequence"
     stem_loop       10615..10628
                     /note="short hairpin (sHP)"
     regulatory      10626..10642
                     /regulatory_class="promoter"
                     /note="3' upstream AUG region (UAR)"
     stem_loop       10629..10707
                     /note="3' stem-loop (3'SL)"
ORIGIN      
        1 agttgttagt ctacgtggac cgacaagaac agtttcgact cggaagcttg cttaacgtag
       61 tgctgacagt tttttattag agagcagatc tctgatgaac aaccaacgga agaagacggg
      121 aaaaccgtct atcaatatgc tgaaacgcgt gagaaaccgt gtgtcaactg gatcacagtt
      181 ggcgaagaga ttctcaaaag gactgctgaa cggccaggga ccaatgaaat tggttatggc
      241 gttcatagct ttcctcagat ttctagccat tccaccaaca gcaggagtct tggctagatg
      301 gggaaccttc aagaagtcgg gggccattaa ggtcctgaaa ggcttcaaga aggagatctc
      361 aaacatgctg agcataatca accaacggaa aaagacatcg ctctgtctca tgatgatatt
      421 gccagcagca cttgctttcc acttgacttc acgagatgga gagccgcgca tgattgtggg
      481 gaagaatgaa agaggtaaat ccctactttt taagacagcc tctggaatca acatgtgcac
      541 actcatagcc atggatttgg gagagatgtg tgatgacacg gtcacttaca aatgccccca
      601 cattaccgaa gtggaacctg aagacattga ctgctggtgc aaccttacat caacatgggt
      661 gacttatgga acgtgcaatc aagctggaga gcatagacgc gacaagagat cagtggcgtt
      721 agctccccat gtcggcatgg gactggacac acgcacccaa acctggatgt cggctgaagg
      781 agcttggaga caagtcgaga aggtagagac atgggccctt aggcacccag ggttcaccat
      841 actagcccta tttctcgccc attacatagg cacttccctg acccagaagg tggttatttt
      901 catattatta atgctggtca ccccatccat gacaatgaga tgtgtgggag taggaaacag
      961 agattttgtg gaagggctat caggagctac gtgggttgac gtggtgctcg agcacggggg
     1021 gtgtgtgact accatggcta agaacaagcc cacgctggat atagagcttc agaagaccga
     1081 ggccacccaa ctggcgaccc taaggaagct atgcattgag gggaaaatta ccaacataac
     1141 aactgactca agatgtccta cccaagggga agcggttttg cctgaggagc aggaccagaa
     1201 ctacgtgtgt aagcatacat acgtagacag aggttggggg aacggttgtg gtttgtttgg
     1261 caaaggaagc ttggtaacat gtgcgaaatt tcaatgcctg gaaccaatag agggaaaagt
     1321 ggtgcaatat gagaacctca aatacaccgt catcattaca gtgcacacag gagaccaaca
     1381 ccaggtggga aatgaaacgc aaggagtcac ggctgagata acacctcagg catcaaccac
     1441 tgaagccatc ttgcctgaat atggaaccct tgggctagaa tgctcaccac ggacaggttt
     1501 ggatttcaat gaaatgatct tactaacaat gaagaacaaa gcatggatgg tacatagaca
     1561 atggttcttt gacctacctc taccatgggc atcaggagct acaacagaaa caccaacctg
     1621 gaacaggaag gagcttcttg tgacattcaa aaacgcacat gcgaaaaaac aagaagtagt
     1681 tgtccttgga tcgcaagagg gagcaatgca taccgcactg acaggagcta cagaaatcca
     1741 aaactcagga ggcacaagca ttttcgcggg gcacttaaaa tgtagactta agatggacaa
     1801 attggaactc aaggggatga gctatgcaat gtgcacgaat acctttgtgt tgaagaaaga
     1861 agtctcagaa acgcagcacg ggacaatact cattaaggtt gagtacaaag gggaagatgc
     1921 accttgcaag attccctttt ccacagagga tggacaaggg aaagctcata atggcagact
     1981 gatcacagcc aaccctgtgg tgactaagaa ggaggagcct gtcaatattg aggctgaacc
     2041 tccttttggg gaaagcaata tagtaattgg aattggagac aacgccttga aaatcaactg
     2101 gtacaagaag gggagctcga ttgggaagat gttcgaggcc actgaaaggg gtgcaaggcg
     2161 catggccatc ttgggagaca cagcttggga ctttggatca gtgggtggtg ttctgaactc
     2221 attaggcaaa atggtgcacc aaatatttgg aagtgcttat acagccctgt tcagtggagt
     2281 ctcttgggtg atgaaaattg gaataggtgt cctcttgact tggatagggt tgaattcaaa
     2341 aaacacatcc atgtcatttt catgcattgc gataggaatc attacactct atctgggagc
     2401 tgtggtacaa gctgacatgg ggtgtgtcat aaactggaag ggcaaagaac tcaaatgtgg
     2461 aagcggaatt ttcgtcacca atgaggtcca tacctggaca gagcaataca aattccaagc
     2521 agactcccca aaaagattgg caacagccat tgcaggcgcc tgggagaatg gagtgtgtgg
     2581 aattaggtca acaaccagaa tggagaatct cttgtggaag caaatagcca atgaactgaa
     2641 ctacatatta tgggaaaaca atatcaaatt aacggtagtt gtgggcgata cacttggggt
     2701 cttagagcaa gggaaaagaa cactaacacc acaacccatg gagctaaaat actcatggaa
     2761 aacgtgggga aaggcaaaaa tagtgacagc tgaaacacaa aattcctctt tcataataga
     2821 cgggccaaac acaccggagt gtccaagtgc ctcaagagca tggaatgtgt gggaggtgga
     2881 agattacggg ttcggagtct tcacaaccaa catatggctg aaactccgag aggtctacac
     2941 ccaactatgt gaccataggc taatgtcggc agctgtcaag gatgagaggg ccgtgcatgc
     3001 cgacatgggc tactggatag aaagccaaaa gaatggaagt tggaagctag aaaaagcatc
     3061 cctcatagag gtaaaaacct gcacatggcc aaaatcacac actctctgga ctaatggtgt
     3121 gctagagagt gacatgatca tcccaaagag tctagctggt cctatctcac aacacaacta
     3181 caggcccggg taccacaccc aaacggcagg accctggcac ttaggaaaat tggagctgga
     3241 cttcaactac tgtgaaggaa caacagttgt catcacagaa agctgtggga caagaggccc
     3301 atcattgaga acaacaacag tgtcagggaa gttgatacac gaatggtgtt gccgctcgtg
     3361 cacacttccc cccctgcgat acatgggaga agacggctgc tggtatggca tggaaatcag
     3421 acccatcagt gagaaagaag agaacatggt aaagtcttta gtctcagcgg gaagtggaaa
     3481 ggtggacaac ttcacaatgg gtgtcttgtg tttggcaatc ctctttgaag aggtgttgag
     3541 aggaaaattt gggaagaaac acatgattgc aggggttttc tttacgtttg tgctccttct
     3601 ctcagggcaa ataacatgga gagacatggc gcacacacta ataatgatcg ggtccaacgc
     3661 ctctgacagg atgggaatgg gcgtcaccta cctagctcta attgcaacat ttaaaatcca
     3721 gccattcttg gctttgggat ttttcctaag aaagctgaca tctagagaaa atttattgtt
     3781 aggagttggg ttggccatgg caacaacgtt acaactgcca gaggacattg aacaaatggc
     3841 aaatggagtc gctctggggc tcatggctct taaactgata acacaatttg aaacatacca
     3901 attgtggacg gcattagtct ccttaacgtg ttcaaacaca atttttacgt tgactgttgc
     3961 ctggagaaca gccactctga ttttggccgg agtttcgctt ttaccagtgt gccagtcttc
     4021 aagcatgagg aaaacagatt ggctcccaat gacagtggca gctatgggag ttccacccct
     4081 tccacttttt atttttagct tgaaagacac actcaaaagg agaagctggc cactgaatga
     4141 aggggtgatg gctgttgggc ttgtgagcat tctggccagt tctctcctta gaaatgatgt
     4201 gcccatggct ggaccattag tggccggggg cttgctgata gcgtgctacg tcataactgg
     4261 cacgtcagcg gacctcactg tagaaaaagc cccagatgta acatgggagg aagaggctga
     4321 gcagacagga gtgtcccaca acttaatgat cacagttgat gatgatggaa caatgagaat
     4381 aaaagatgat gagactgaga acatcctaac agtgctttta aaaacagcat tactaatagt
     4441 atcaggcatt tttccatact ccatacccgc aacattgttg gtctggcaca cttggcaaaa
     4501 acaaacccaa agatccggcg ttttatggga cgtacccagc cccccagaga cacagaaagc
     4561 agaactggaa gaaggggttt ataggatcaa acagcaagga atttttggga aaacccaagt
     4621 aggggttgga gtacagaaag aaggagtctt ccacaccatg tggcacgtca caagaggggc
     4681 agtgttgaca cataatggga aaagactgga accaaactgg gctagtgtga aaaaagatct
     4741 gatttcatat ggaggaggat ggagactgag cgcacaatgg caaaaggggg aggaggtgca
     4801 ggttattgcc gtagagccag ggaagaaccc aaagaacttt caaaccacgc caggcacttt
     4861 ccagactact acaggggaaa taggagcaat tgcactggat ttcaagcctg gaacttcagg
     4921 atctcctatc ataaatagag agggaaaggt agtgggactg tatggcaatg gagtggttac
     4981 aaagaatggt ggctatgtca gcggaatagc gcaaacaaat gcagaaccag atggaccgac
     5041 accagagttg gaagaagaga tgttcaaaaa gcgaaacctg accataatgg atcttcatcc
     5101 tgggtcagga aagacacgga aataccttcc agctattgtc agagaggcaa tcaagagacg
     5161 tttaagaacc ttaattttgg caccgacaag ggtggttgca gctgagatgg aagaagcatt
     5221 gaaagggctc ccaataaggt accaaacaac agcaacaaaa tctgaacaca caggaagaga
     5281 gattgttgat ctaatgtgcc acgcaacgtt cacaatgcgt ttgctgtcac cagttagggt
     5341 tccaaattac aacttgataa taatggatga ggcccatttc acagacccag ccagtatagc
     5401 ggctagaggg tacatatcaa ctcgtgttgg aatgggagag gcagccgcaa tcttcatgac
     5461 agcaacaccc cctggaacag ctgatgcctt tcctcagagc aacgctccaa ttcaagatga
     5521 agaaagggac ataccagaac gctcatggaa ttcaggcaat gaatggatta ccgacttcgc
     5581 tgggaaaacg gtgtggtttg tccctagcat taaagccgga aatgacatag caaactgctt
     5641 gcgaaaaaac gggaaaaaag tcattcaact tagtaggaag acttttgaca cagaatatca
     5701 gaagactaaa ctgaatgatt gggactttgt ggtgacaact gacatttcag aaatgggggc
     5761 caatttcaaa gcagatagag tgatcgaccc aagaagatgt ctcaaaccag tgatcttgac
     5821 agatggacca gagcgggtga tcctggccgg accaatgcca gtcaccgcgg cgagtgctgc
     5881 gcaaaggaga gggagagttg gcaggaaccc acaaaaagag aatgaccagt acatattcac
     5941 gggccagcct ctcaacaatg atgaagacca tgctcactgg acagaagcaa aaatgctgct
     6001 ggacaacatc aacacaccag aagggattat accagctctc tttgaaccag aaagggagaa
     6061 gtcagccgcc atagacggtg agtatcgcct gaagggtgag tccaggaaga ctttcgtgga
     6121 actcatgagg aggggtgacc ttccagtttg gttagcccat aaagtagcat cagaaggaat
     6181 caaatacaca gatagaaaat ggtgctttga tgggcaacgc aataatcaaa ttttagagga
     6241 gaacatggat gtggaaattt ggacaaagga aggagaaaag aaaaaattga gacctaggtg
     6301 gcttgatgcc cgcacttatt cagatccatt ggcactcaag gaattcaagg actttgcggc
     6361 tggcagaaag tcaatcgccc ttgatcttgt gacagaaata ggaagagtgc cttcacatct
     6421 agcccacaga acaagaaacg ctctggacaa tctggtgatg ctgcatacgt cagaagatgg
     6481 cggtagggct tacaggcatg cggtggagga actaccagaa acaatggaaa cactcctact
     6541 cttgggacta atgatcttgt tgacaggtgg agcaatgctt ttcttgatat caggtaaagg
     6601 gattggaaag acttcaatag gactcatttg tgtaatcgct tccagcggca tgttgtggat
     6661 ggccgaagtt ccactccaat ggatcgcgtc ggctatagtc ctggagtttt ttatgatggt
     6721 gttgctcata ccagaaccag aaaagcagag aaccccccaa gacaaccaac tcgcatatgt
     6781 cgtgataggc atacttacat tggctgcaac aatagcagcc aatgaaatgg gactgctgga
     6841 aaccacaaag agagacttag gaatgtctaa ggagccaggt gttgtttctc caaccagcta
     6901 tttggatgtg gacttgcacc cagcatcagc ctggacattg tacgccgtgg ccactacagt
     6961 aataacacca atgttaagac ataccataga gaattctaca gcaaatgtgt ccctggcagc
     7021 tatagccaac caggcagtgg tcctgatggg tttggacaaa ggatggccaa tatcaaaaat
     7081 ggacttaggc gtgccactac tggcactggg ttgctattca caagtgaacc cactgactct
     7141 aactgcggca gtacttttgc taatcacaca ttatgctatc ataggtccag gattgcaagc
     7201 aaaagccacc cgtgaagctc agaaaaggac agctgctgga ataatgaaga atccaacagt
     7261 ggatgggata atgacaatag acctagattc tgtaatattt gattcaaaat ttgaaaaaca
     7321 actgggacag gttatgctcc tggttttgtg cgcagtccaa ctcttgctaa tgagaacatc
     7381 atgggccttg tgtgaagctt taactctagc tacaggacca ataacaacac tctgggaagg
     7441 atcacctggt aagttctgga acaccacgat agctgtttcc atggcgaaca tttttagagg
     7501 gagctattta gcaggagctg ggcttgcttt ttctattatg aaatcagttg gaacaggaaa
     7561 aagaggaaca ggctcacaag gtgaaacttt aggagaaaaa tggaaaaaga aattaaatca
     7621 attatcccgg aaagagtttg acctttacaa gaaatctgga atcactgaag tggatagaac
     7681 agaagccaaa gaagggttga aaagaggaga gacaacacat catgccgtgt cccgaggtag
     7741 cgcaaaactt caatggtttg tggaaagaaa catggtcgtt cccgaaggaa gagtcataga
     7801 cttgggctgt ggaagaggag gctggtcata ttactgtgca ggactgaaaa aagtcacaga
     7861 agtgcgagga tacacaaaag gcggtccagg acacgaagaa ccagtaccta tgtctacata
     7921 tggatggaac atagttaagt taatgagcgg aaaggatgtg ttctatctcc cacctgaaaa
     7981 gtgtgatacc ctgttgtgtg acattggaga atcttcacca agcccaacag tggaagagag
     8041 cagaactata agagttttga agatggttga accatggcta aaaaacaacc agttttgcat
     8101 taaagttttg aacccttaca tgccaactgt gattgagcac ctagaaagac tacaaaggaa
     8161 acatggagga atgcttgtga gaaatccact ttcacgaaac tccacgcacg aaatgtactg
     8221 gatatctaat ggcacaggta acattgtctc ttcagtcaac atggtgtcta gattgctact
     8281 gaacaggttc acgatgacac acaggagacc caccatagag aaagatgtgg atttaggagc
     8341 aggaactcga catgttaatg cggaaccaga aacacccaac atggatgtca ttggggaaag
     8401 aataaaaagg atcaaggagg agcataattc aacatggcac tatgatgacg aaaaccccta
     8461 caaaacgtgg gcttaccatg gatcctatga agtcaaagcc acaggctcag cctcctccat
     8521 gataaatgga gtcgtgaaac tcctcaccaa accatgggat gtggtgccca tggtgacaca
     8581 gatggcaatg acagacacaa ctccatttgg ccagcagaga gtctttaaag agaaagtgga
     8641 caccaggacg cccaggccca tgccagggac aagaaaggct atggagatca cagcggagtg
     8701 gctctggaga accctgggaa ggaacaaaag acccagatta tgcacaaggg aagagtttac
     8761 aaaaaaggtc agaactaacg cagccatggg cgccgttttc acagaggaga accaatggga
     8821 cagtgcgaaa gctgctgttg aggatgaaga attttggaaa cttgtggaca gagaacgtga
     8881 actccacaaa ttgggcaaat gtggaagctg cgtttataac atgatgggca agagagagaa
     8941 aaaacttgga gagtttggca aagcaaaagg cagtagagct atatggtaca tgtggttggg
     9001 agccaggtac cttgagttcg aagcccttgg attcttaaat gaagaccact ggttctcgcg
     9061 tgaaaactct tacagtggag tagaaggaga aggactgcac aagctaggct acatattaag
     9121 ggacatttcc aagatacccg gaggagccat gtatgctgat gacacagctg gttgggacac
     9181 aagaataaca gaagatgacc tgcacaatga ggaaaagatc atacagcaaa tggaccctga
     9241 acacaggcag ttagcgaacg ctatattcaa gctcacatac caaaacaaag tggtcaaagt
     9301 tcaacgaccg actccaacgg gcacggtaat ggatattata tctaggaaag accaaagggg
     9361 cagtggacaa ctgggaactt atggcctgaa tacattcacc aacatggaag cccagttagt
     9421 cagacaaatg gaaggagaag gtgtgctgac aaaggcagac ctcgagaacc ctcatctgct
     9481 agagaagaaa atcacacaat ggttggaaac caaaggagtg gagaggttaa aaagaatggc
     9541 cattagcggg gatgattgcg tggtgaaacc aatcgatgac aggttcgcta atgccctgct
     9601 tgctttgaac gatatgggaa aggttcggaa agacatacct caatggcagc catcaaaggg
     9661 atggcatgat tggcaacagg ttcctttctg ctcccaccac tttcatgaat tgatcatgaa
     9721 agatggaaga aagttggtgg ttccctgcag accccaggac gaactaatag gaagagcaag
     9781 aatctctcaa ggagcgggat ggagccttag agaaactgca tgtctgggga aagcctacgc
     9841 ccaaatgtgg agtctcatgt attttcacag aagagatctc agattagcat ccaacgccat
     9901 atgttcagca gtaccagtcc actgggttcc cacaagtaga acgacatggt ctattcatgc
     9961 tcaccatcag tggatgacta cagaagacat gcttactgtt tggaacaggg tgtggataga
    10021 ggaaaatcca tggatggaag acaaaactcc agttacaact tgggaaaatg ttccatatct
    10081 aggaaagaga gaagaccaat ggtgtggatc acttattggt ctcacttcca gagcaacctg
    10141 ggcccagaac atacccacag caattcaaca ggtgagaagc cttataggca atgaagagtt
    10201 cctggactac atgccttcaa tgaagagatt caggaaggaa gaggagtcgg agggagccat
    10261 ttggtaaacg taggaagtgg aaaagaggct aactgtcagg ccaccttaag ccacagtacg
    10321 gaagaagctg tgctgcctgt gagccccgtc caaggacgtt aaaagaagaa gtcaggcccc
    10381 aaagccacgg tttgagcaaa ccgtgctgcc tgtagctccg tcgtggggac gtaaaacctg
    10441 ggaggctgca aactgtggaa gctgtacgca cggtgtagca gactagcggt tagaggagac
    10501 ccctcccatg acacaacgca gcagcggggc ccgagcactg agggaagctg tacctccttg
    10561 caaaggacta gaggttagag gagacccccc gcaaataaaa acagcatatt gacgctggga
    10621 gagaccagag atcctgctgt ctcctcagca tcattccagg cacagaacgc cagaaaatgg
    10681 aatggtgctg ttgaatcaac aggttct
//
DBGET integrated database retrieval system