GenomeNet

Database: RefSeq
Entry: NC_001477
LinkDB: NC_001477
Original site: NC_001477 
LOCUS       NC_001477              10735 bp ss-RNA     linear   VRL 03-MAY-2019
DEFINITION  Dengue virus 1, complete genome.
ACCESSION   NC_001477
VERSION     NC_001477.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Dengue virus 1
  ORGANISM  Dengue virus 1
            Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes;
            Amarillovirales; Flaviviridae; Flavivirus.
REFERENCE   1  (bases 1 to 10735)
  AUTHORS   Puri,B., Nelson,W.M., Henchal,E.A., Hoke,C.H., Eckels,K.H.,
            Dubois,D.R., Porter,K.R. and Hayes,C.G.
  TITLE     Molecular analysis of dengue virus attenuation after serial passage
            in primary dog kidney cells
  JOURNAL   J. Gen. Virol. 78 (PT 9), 2287-2291 (1997)
   PUBMED   9292016
REFERENCE   2  (bases 1 to 10735)
  AUTHORS   McKee,K.T. Jr., Bancroft,W.H., Eckels,K.H., Redfield,R.R.,
            Summers,P.L. and Russell,P.K.
  TITLE     Lack of attenuation of a candidate dengue 1 vaccine (45AZ5) in
            human volunteers
  JOURNAL   Am. J. Trop. Med. Hyg. 36 (2), 435-442 (1987)
   PUBMED   3826504
REFERENCE   3  (bases 1 to 10735)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 10735)
  AUTHORS   Puri,B. and Nelson,W.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-1997) Inf. Dis. Dept, Naval Medical Research
            Institute, 8901 Wisconsin Ave., Bethesda, MD 20889-5607, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from U88536.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10735
                     /organism="Dengue virus 1"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11053"
                     /clone="45AZ5"
                     /type="1"
     5'UTR           1..94
     stem_loop       2..69
                     /note="stem-loop A (SLA)"
     regulatory      70..78
                     /regulatory_class="other"
                     /note="oligo U track spacer"
     regulatory      79..94
                     /regulatory_class="promoter"
                     /note="5' upstream AUG region (UAR)"
     stem_loop       79..93
                     /note="stem-loop B (SLB)"
     gene            95..10273
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /db_xref="GeneID:5075725"
     CDS             95..10273
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="NP_059433.1"
                     /db_xref="GeneID:5075725"
                     /translation="MNNQRKKTGRPSFNMLKRARNRVSTVSQLAKRFSKGLLSGQGPM
                     KLVMAFIAFLRFLAIPPTAGILARWGSFKKNGAIKVLRGFKKEISNMLNIMNRRKRSV
                     TMLLMLLPTALAFHLTTRGGEPHMIVSKQERGKSLLFKTSAGVNMCTLIAMDLGELCE
                     DTMTYKCPRITETEPDDVDCWCNATETWVTYGTCSQTGEHRRDKRSVALAPHVGLGLE
                     TRTETWMSSEGAWKQIQKVETWALRHPGFTVIALFLAHAIGTSITQKGIIFILLMLVT
                     PSMAMRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPA
                     VLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGWGNGCGLFGKGS
                     LITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGDQHQVGNETTEHGTTATITPQAPT
                     SEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKKKSWLVHKQWFLDLPLPWTSGASTSQ
                     ETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCR
                     LKMDKLILKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKG
                     VTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMF
                     EATARGARRMAILGDTAWDFGSIGGVFTSVGKLIHQIFGTAYGVLFSGVSWTMKIGIG
                     ILLTWLGLNSRSTSLSMTCIAVGMVTLYLGVMVQADSGCVINWKGRELKCGSGIFVTN
                     EVHTWTEQYKFQADSPKRLSAAIGKAWEEGVCGIRSATRLENIMWKQISNELNHILLE
                     NDMKFTVVVGDVSGILAQGKKMIRPQPMEHKYSWKSWGKAKIIGADVQNTTFIIDGPN
                     TPECPDNQRAWNIWEVEDYGFGIFTTNIWLKLRDSYTQVCDHRLMSAAIKDSKAVHAD
                     MGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHN
                     YRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKTIHEWCC
                     RSCTLPPLRFKGEDGCWYGMEIRPVKEKEENLVKSMVSAGSGEVDSFSLGLLCISIMI
                     EEVMRSRWSRKMLMTGTLAVFLLLTMGQLTWNDLIRLCIMVGANASDKMGMGTTYLAL
                     MATFRMRPMFAVGLLFRRLTSREVLLLTVGLSLVASVELPNSLEELGDGLAMGIMMLK
                     LLTDFQSHQLWATLLSLTFVKTTFSLHYAWKTMAMILSIVSLFPLCLSTTSQKTTWLP
                     VLLGSLGCKPLTMFLITENKIWGRKSWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLI
                     AGGMLIACYVISGSSADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEER
                     DDTLTILLKATLLAISGVYPMSIPATLFVWYFWQKKKQRSGVLWDTPSPPEVERAVLD
                     DGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLI
                     SYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTS
                     GSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDEVFRKRNLTIMD
                     LHPGSGKTRRYLPAIVREAIKRKLRTLVLAPTRVVASEMAEALKGMPIRYQTTAVKSE
                     HTGKEIVDLMCHATFTMRLLSPVRVPNYNMIIMDEAHFTDPASIAARGYISTRVGMGE
                     AAAIFMTATPPGSVEAFPQSNAVIQDEERDIPERSWNSGYDWITDFPGKTVWFVPSIK
                     SGNDIANCLRKNGKRVVQLSRKTFDTEYQKTKNNDWDYVVTTDISEMGANFRADRVID
                     PRRCLKPVILKDGPERVILAGPMPVTVASAAQRRGRIGRNQNKEGDQYIYMGQPLNND
                     EDHAHWTEAKMLLDNINTPEGIIPALFEPEREKSAAIDGEYRLRGEARKTFVELMRRG
                     DLPVWLSYKVASEGFQYSDRRWCFDGERNNQVLEENMDVEIWTKEGERKKLRPRWLDA
                     RTYSDPLALREFKEFAAGRRSVSGDLILEIGKLPQHLTQRAQNALDNLVMLHNSEQGG
                     KAYRHAMEELPDTIETLMLLALIAVLTGGVTLFFLSGRGLGKTSIGLLCVIASSALLW
                     MASVEPHWIAASIILEFFLMVLLIPEPDRQRTPQDNQLAYVVIGLLFMILTVAANEMG
                     LLETTKKDLGIGHAAAENHHHAAMLDVDLHPASAWTLYAVATTIITPMMRHTIENTTA
                     NISLTAIANQAAILMGLDKGWPISKMDIGVPLLALGCYSQVNPLTLTAAVLMLVAHYA
                     IIGPGLQAKATREAQKRTAAGIMKNPTVDGIVAIDLDPVVYDAKFEKQLGQIMLLILC
                     TSQILLMRTTWALCESITLATGPLTTLWEGSPGKFWNTTIAVSMANIFRGSYLAGAGL
                     AFSLMKSLGGGRRGTGAQGETLGEKWKRQLNQLSKSEFNTYKRSGIIEVDRSEAKEGL
                     KRGETTKHAVSRGTAKLRWFVERNLVKPEGKVIDLGCGRGGWSYYCAGLKKVTEVKGY
                     TKGGPGHEEPIPMATYGWNLVKLYSGKDVFFTPPEKCDTLLCDIGESSPNPTIEEGRT
                     LRVLKMVEPWLRGNQFCIKILNPYMPSVVETLEQMQRKHGGMLVRNPLSRNSTHEMYW
                     VSCGTGNIVSAVNMTSRMLLNRFTMAHRKPTYERDVDLGAGTRHVAVEPEVANLDIIG
                     QRIENIKNEHKSTWHYDEDNPYKTWAYHGSYEVKPSGSASSMVNGVVRLLTKPWDVIP
                     MVTQIAMTDTTPFGQQRVFKEKVDTRTPKAKRGTAQIMEVTARWLWGFLSRNKKPRIC
                     TREEFTRKVRSNAAIGAVFVDENQWNSAKEAVEDERFWDLVHRERELHKQGKCATCVY
                     NMMGKREKKLGEFGKAKGSRAIWYMWLGARFLEFEALGFMNEDHWFSRENSLSGVEGE
                     GLHKLGYILRDISKIPGGNMYADDTAGWDTRITEDDLQNEAKITDIMEPEHALLATSI
                     FKLTYQNKVVRVQRPAKNGTVMDVISRRDQRGSGQVGTYGLNTFTNMEAQLIRQMESE
                     GIFSPSELETPNLAERVLDWLKKHGTERLKRMAISGDDCVVKPIDDRFATALTALNDM
                     GKVRKDIPQWEPSKGWNDWQQVPFCSHHFHQLIMKDGREIVVPCRNQDELVGRARVSQ
                     GAGWSLRETACLGKSYAQMWQLMYFHRRDLRLAANAICSAVPVDWVPTSRTTWSIHAH
                     HQWMTTEDMLSVWNRVWIEENPWMEDKTHVSSWEDVPYLGKREDQWCGSLIGLTARAT
                     WATNIQVAINQVRRLIGNENYLDFMTSMKRFKNESDPEGALW"
     mat_peptide     95..436
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="anchored capsid protein ancC"
                     /protein_id="NP_722457.2"
                     /db_xref="VBRC:35735"
     mat_peptide     95..394
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="capsid protein C"
                     /note="added by NCBI staff following more recent
                     annotations of this virus sequence"
                     /protein_id="NP_722466.2"
                     /db_xref="VBRC:67793"
     misc_feature    107..436
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus capsid protein C; Region: Flavi_capsid;
                     pfam01003"
                     /db_xref="CDD:250285"
     mat_peptide     437..934
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein precursor prM"
                     /protein_id="NP_733807.2"
     mat_peptide     437..709
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein pr"
                     /note="peptide pr"
                     /protein_id="YP_009164956.1"
     misc_feature    470..706
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus polyprotein propeptide; Region:
                     Flavi_propep; pfam01570"
                     /db_xref="CDD:279856"
     mat_peptide     710..934
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="membrane glycoprotein M"
                     /protein_id="NP_722459.2"
     misc_feature    713..934
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus envelope glycoprotein M; Region:
                     Flavi_M; pfam01004"
                     /db_xref="CDD:279358"
     mat_peptide     935..2419
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="envelope protein E"
                     /protein_id="NP_722460.2"
     misc_feature    938..1822
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus glycoprotein, central and dimerization
                     domains; Region: Flavi_glycoprot; pfam00869"
                     /db_xref="CDD:279241"
     misc_feature    1826..2113
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus glycoprotein, immunoglobulin-like
                     domain; Region: Flavi_glycop_C; pfam02832"
                     /db_xref="CDD:280922"
     misc_feature    2129..2419
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="flavivirus envelope glycoprotein E, stem/anchor
                     domain; Region: flavi_E_stem; TIGR04240"
                     /db_xref="CDD:213897"
     mat_peptide     2420..3475
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS1"
                     /protein_id="NP_722461.1"
                     /db_xref="VBRC:35739"
     misc_feature    2423..3484
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural Protein NS1; Region:
                     Flavi_NS1; pfam00948"
                     /db_xref="CDD:279316"
     mat_peptide     3476..4129
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2A"
                     /protein_id="NP_733808.1"
                     /db_xref="VBRC:35740"
     misc_feature    3506..4054
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2A; Region:
                     Flavi_NS2A; pfam01005"
                     /db_xref="CDD:279359"
     mat_peptide     4130..4519
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS2B"
                     /protein_id="NP_733809.1"
                     /db_xref="VBRC:35741"
     misc_feature    4139..4519
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS2B; Region:
                     Flavi_NS2B; pfam01002"
                     /db_xref="CDD:279357"
     mat_peptide     4520..6376
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS3"
                     /protein_id="NP_722463.1"
                     /db_xref="VBRC:35742"
     misc_feature    4577..5020
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Peptidase S7, Flavivirus NS3 serine protease;
                     Region: Peptidase_S7; pfam00949"
                     /db_xref="CDD:279317"
     misc_feature    5075..5512
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus DEAD domain; Region: Flavi_DEAD;
                     pfam07652"
                     /db_xref="CDD:284962"
     misc_feature    5087..5497
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    5108..5122
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    5372..5383
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    5573..5944
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(5768..5770,5888..5890,5900..5902,5909..5911)
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     mat_peptide     6377..6757
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4A"
                     /protein_id="NP_733810.1"
                     /db_xref="VBRC:35743"
     misc_feature    6389..6820
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4A; Region:
                     Flavi_NS4A; pfam01350"
                     /db_xref="CDD:279666"
     mat_peptide     6758..6826
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="protein 2K"
                     /note="added by NCBI staff following more recent
                     annotations of this virus sequence"
                     /protein_id="NP_722467.1"
                     /db_xref="VBRC:67794"
     mat_peptide     6827..7573
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="nonstructural protein NS4B"
                     /protein_id="NP_733811.1"
                     /db_xref="VBRC:35744"
     misc_feature    6827..7552
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus non-structural protein NS4B; Region:
                     Flavi_NS4B; pfam01349"
                     /db_xref="CDD:279665"
     mat_peptide     7574..10270
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /product="RNA-dependent RNA polymerase NS5"
                     /protein_id="NP_722465.1"
                     /db_xref="VBRC:35745"
     misc_feature    7736..8236
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="FtsJ-like methyltransferase; Region: FtsJ;
                     pfam01728"
                     /db_xref="CDD:279986"
     misc_feature    8321..10252
                     /gene="POLY"
                     /locus_tag="DV1_gp1"
                     /gene_synonym="polyprotein gene"
                     /note="Flavivirus RNA-directed RNA polymerase; Region:
                     Flavi_NS5; pfam00972"
                     /db_xref="CDD:279336"
     stem_loop       114..130
                     /note="capsid region hairpin (cHP)"
     regulatory      132..142
                     /regulatory_class="other"
                     /note="5' conserved sequence (CS); also called cyclization
                     sequence"
     3'UTR           10274..10735
     ncRNA           10320..10735
                     /ncRNA_class="lncRNA"
                     /product="sfRNA1"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10324..10389
                     /note="flaviviral nuclease-resistant RNA 1 (fNR1); also
                     called stem-loop 1 or xrRNA1"
     ncRNA           10393..10735
                     /ncRNA_class="lncRNA"
                     /product="sfRNA2"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10397..10458
                     /note="flaviviral nuclease-resistant RNA 2 (fNR2); also
                     called stem-loop 2 or xrRNA2"
     ncRNA           10463..10735
                     /ncRNA_class="lncRNA"
                     /product="sfRNA3"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10467..10549
                     /note="dumbbell 1 (DBI); also called xrRNA3"
     ncRNA           10551..10735
                     /ncRNA_class="lncRNA"
                     /product="sfRNA4"
                     /note="subgenomic flavivirus RNA"
     stem_loop       10551..10633
                     /note="dumbbell 2 (DBII); also called xrRNA4"
     regulatory      10630..10640
                     /regulatory_class="other"
                     /note="3' conserved sequence (CS); also called cyclization
                     sequence"
     stem_loop       10643..10656
                     /note="short hairpin (sHP)"
     regulatory      10654..10670
                     /regulatory_class="promoter"
                     /note="3' upstream AUG region (UAR)"
     stem_loop       10657..10735
                     /note="3' stem-loop (3'SL)"
ORIGIN      
        1 agttgttagt ctacgtggac cgacaagaac agtttcgaat cggaagcttg cttaacgtag
       61 ttctaacagt tttttattag agagcagatc tctgatgaac aaccaacgga aaaagacggg
      121 tcgaccgtct ttcaatatgc tgaaacgcgc gagaaaccgc gtgtcaactg tttcacagtt
      181 ggcgaagaga ttctcaaaag gattgctttc aggccaagga cccatgaaat tggtgatggc
      241 ttttatagca ttcctaagat ttctagccat acctccaaca gcaggaattt tggctagatg
      301 gggctcattc aagaagaatg gagcgatcaa agtgttacgg ggtttcaaga aagaaatctc
      361 aaacatgttg aacataatga acaggaggaa aagatctgtg accatgctcc tcatgctgct
      421 gcccacagcc ctggcgttcc atctgaccac ccgaggggga gagccgcaca tgatagttag
      481 caagcaggaa agaggaaaat cacttttgtt taagacctct gcaggtgtca acatgtgcac
      541 ccttattgca atggatttgg gagagttatg tgaggacaca atgacctaca aatgcccccg
      601 gatcactgag acggaaccag atgacgttga ctgttggtgc aatgccacgg agacatgggt
      661 gacctatgga acatgttctc aaactggtga acaccgacga gacaaacgtt ccgtcgcact
      721 ggcaccacac gtagggcttg gtctagaaac aagaaccgaa acgtggatgt cctctgaagg
      781 cgcttggaaa caaatacaaa aagtggagac ctgggctctg agacacccag gattcacggt
      841 gatagccctt tttctagcac atgccatagg aacatccatc acccagaaag ggatcatttt
      901 tattttgctg atgctggtaa ctccatccat ggccatgcgg tgcgtgggaa taggcaacag
      961 agacttcgtg gaaggactgt caggagctac gtgggtggat gtggtactgg agcatggaag
     1021 ttgcgtcact accatggcaa aagacaaacc aacactggac attgaactct tgaagacgga
     1081 ggtcacaaac cctgccgtcc tgcgcaaact gtgcattgaa gctaaaatat caaacaccac
     1141 caccgattcg agatgtccaa cacaaggaga agccacgctg gtggaagaac aggacacgaa
     1201 ctttgtgtgt cgacgaacgt tcgtggacag aggctggggc aatggttgtg ggctattcgg
     1261 aaaaggtagc ttaataacgt gtgctaagtt taagtgtgtg acaaaactgg aaggaaagat
     1321 agtccaatat gaaaacttaa aatattcagt gatagtcacc gtacacactg gagaccagca
     1381 ccaagttgga aatgagacca cagaacatgg aacaactgca accataacac ctcaagctcc
     1441 cacgtcggaa atacagctga cagactacgg agctctaaca ttggattgtt cacctagaac
     1501 agggctagac tttaatgaga tggtgttgtt gacaatgaaa aaaaaatcat ggctcgtcca
     1561 caaacaatgg tttctagact taccactgcc ttggacctcg ggggcttcaa catcccaaga
     1621 gacttggaat agacaagact tgctggtcac atttaagaca gctcatgcaa aaaagcagga
     1681 agtagtcgta ctaggatcac aagaaggagc aatgcacact gcgttgactg gagcgacaga
     1741 aatccaaacg tctggaacga caacaatttt tgcaggacac ctgaaatgca gattaaaaat
     1801 ggataaactg attttaaaag ggatgtcata tgtaatgtgc acagggtcat tcaagttaga
     1861 gaaggaagtg gctgagaccc agcatggaac tgttctagtg caggttaaat acgaaggaac
     1921 agatgcacca tgcaagatcc ccttctcgtc ccaagatgag aagggagtaa cccagaatgg
     1981 gagattgata acagccaacc ccatagtcac tgacaaagaa aaaccagtca acattgaagc
     2041 ggagccacct tttggtgaga gctacattgt ggtaggagca ggtgaaaaag ctttgaaact
     2101 aagctggttc aagaagggaa gcagtatagg gaaaatgttt gaagcaactg cccgtggagc
     2161 acgaaggatg gccatcctgg gagacactgc atgggacttc ggttctatag gaggggtgtt
     2221 cacgtctgtg ggaaaactga tacaccagat ttttgggact gcgtatggag ttttgttcag
     2281 cggtgtttct tggaccatga agataggaat agggattctg ctgacatggc taggattaaa
     2341 ctcaaggagc acgtcccttt caatgacgtg tatcgcagtt ggcatggtca cactgtacct
     2401 aggagtcatg gttcaggcgg actcgggatg tgtaatcaac tggaaaggca gagaactcaa
     2461 atgtggaagc ggcatttttg tcaccaatga agtccacacc tggacagagc aatataaatt
     2521 ccaggccgac tcccctaaga gactatcagc ggccattggg aaggcatggg aggagggtgt
     2581 gtgtggaatt cgatcagcca ctcgtctcga gaacatcatg tggaagcaaa tatcaaatga
     2641 attaaaccac atcttacttg aaaatgacat gaaatttaca gtggtcgtag gagacgttag
     2701 tggaatcttg gcccaaggaa agaaaatgat taggccacaa cccatggaac acaaatactc
     2761 gtggaaaagc tggggaaaag ccaaaatcat aggagcagat gtacagaata ccaccttcat
     2821 catcgacggc ccaaacaccc cagaatgccc tgataaccaa agagcatgga acatttggga
     2881 agttgaagac tatggatttg gaattttcac gacaaacata tggttgaaat tgcgtgactc
     2941 ctacactcaa gtgtgtgacc accggctaat gtcagctgcc atcaaggata gcaaagcagt
     3001 ccatgctgac atggggtact ggatagaaag tgaaaagaac gagacttgga agttggcaag
     3061 agcctccttc atagaagtta agacatgcat ctggccaaaa tcccacactc tatggagcaa
     3121 tggagtcctg gaaagtgaga tgataatccc aaagatatat ggaggaccaa tatctcagca
     3181 caactacaga ccaggatatt tcacacaaac agcagggccg tggcacttgg gcaagttaga
     3241 actagatttt gatttatgtg aaggtaccac tgttgttgtg gatgaacatt gtggaaatcg
     3301 aggaccatct cttagaacca caacagtcac aggaaagaca atccatgaat ggtgctgtag
     3361 atcttgcacg ttaccccccc tacgtttcaa aggagaagac gggtgctggt acggcatgga
     3421 aatcagacca gtcaaggaga aggaagagaa cctagttaag tcaatggtct ctgcagggtc
     3481 aggagaagtg gacagttttt cactaggact gctatgcata tcaataatga tcgaagaggt
     3541 aatgagatcc agatggagca gaaaaatgct gatgactgga acattggctg tgttcctcct
     3601 tctcacaatg ggacaattga catggaatga tctgatcagg ctatgtatca tggttggagc
     3661 caacgcttca gacaagatgg ggatgggaac aacgtaccta gctttgatgg ccactttcag
     3721 aatgagacca atgttcgcag tcgggctact gtttcgcaga ttaacatcta gagaagttct
     3781 tcttcttaca gttggattga gtctggtggc atctgtagaa ctaccaaatt ccttagagga
     3841 gctaggggat ggacttgcaa tgggcatcat gatgttgaaa ttactgactg attttcagtc
     3901 acatcagcta tgggctacct tgctgtcttt aacatttgtc aaaacaactt tttcattgca
     3961 ctatgcatgg aagacaatgg ctatgatact gtcaattgta tctctcttcc ctttatgcct
     4021 gtccacgact tctcaaaaaa caacatggct tccggtgttg ctgggatctc ttggatgcaa
     4081 accactaacc atgtttctta taacagaaaa caaaatctgg ggaaggaaaa gctggcctct
     4141 caatgaagga attatggctg ttggaatagt tagcattctt ctaagttcac ttctcaagaa
     4201 tgatgtgcca ctagctggcc cactaatagc tggaggcatg ctaatagcat gttatgtcat
     4261 atctggaagc tcggccgatt tatcactgga gaaagcggct gaggtctcct gggaagaaga
     4321 agcagaacac tctggtgcct cacacaacat actagtggag gtccaagatg atggaaccat
     4381 gaagataaag gatgaagaga gagatgacac actcaccatt ctcctcaaag caactctgct
     4441 agcaatctca ggggtatacc caatgtcaat accggcgacc ctctttgtgt ggtatttttg
     4501 gcagaaaaag aaacagagat caggagtgct atgggacaca cccagccctc cagaagtgga
     4561 aagagcagtc cttgatgatg gcatttatag aattctccaa agaggattgt tgggcaggtc
     4621 tcaagtagga gtaggagttt ttcaagaagg cgtgttccac acaatgtggc acgtcaccag
     4681 gggagctgtc ctcatgtacc aagggaagag actggaacca agttgggcca gtgtcaaaaa
     4741 agacttgatc tcatatggag gaggttggag gtttcaagga tcctggaacg cgggagaaga
     4801 agtgcaggtg attgctgttg aaccggggaa gaaccccaaa aatgtacaga cagcgccggg
     4861 taccttcaag acccctgaag gcgaagttgg agccatagct ctagacttta aacccggcac
     4921 atctggatct cctatcgtga acagagaggg aaaaatagta ggtctttatg gaaatggagt
     4981 ggtgacaaca agtggtacct acgtcagtgc catagctcaa gctaaagcat cacaagaagg
     5041 gcctctacca gagattgagg acgaggtgtt taggaaaaga aacttaacaa taatggacct
     5101 acatccagga tcgggaaaaa caagaagata ccttccagcc atagtccgtg aggccataaa
     5161 aagaaagctg cgcacgctag tcttagctcc cacaagagtt gtcgcttctg aaatggcaga
     5221 ggcgctcaag ggaatgccaa taaggtatca gacaacagca gtgaagagtg aacacacggg
     5281 aaaggagata gttgacctta tgtgtcacgc cactttcact atgcgtctcc tgtctcctgt
     5341 gagagttccc aattataata tgattatcat ggatgaagca cattttaccg atccagccag
     5401 catagcagcc agagggtata tctcaacccg agtgggtatg ggtgaagcag ctgcgatttt
     5461 catgacagcc actccccccg gatcggtgga ggcctttcca cagagcaatg cagttatcca
     5521 agatgaggaa agagacattc ctgaaagatc atggaactca ggctatgact ggatcactga
     5581 tttcccaggt aaaacagtct ggtttgttcc aagcatcaaa tcaggaaatg acattgccaa
     5641 ctgtttaaga aagaatggga aacgggtggt ccaattgagc agaaaaactt ttgacactga
     5701 gtaccagaaa acaaaaaata acgactggga ctatgttgtc acaacagaca tatccgaaat
     5761 gggagcaaac ttccgagccg acagggtaat agacccgagg cggtgcctga aaccggtaat
     5821 actaaaagat ggcccagagc gtgtcattct agccggaccg atgccagtga ctgtggctag
     5881 cgccgcccag aggagaggaa gaattggaag gaaccaaaat aaggaaggcg atcagtatat
     5941 ttacatggga cagcctctaa acaatgatga ggaccacgcc cattggacag aagcaaaaat
     6001 gctccttgac aacataaaca caccagaagg gattatccca gccctctttg agccggagag
     6061 agaaaagagt gcagcaatag acggggaata cagactacgg ggtgaagcga ggaaaacgtt
     6121 cgtggagctc atgagaagag gagatctacc tgtctggcta tcctacaaag ttgcctcaga
     6181 aggcttccag tactccgaca gaaggtggtg ctttgatggg gaaaggaaca accaggtgtt
     6241 ggaggagaac atggacgtgg agatctggac aaaagaagga gaaagaaaga aactacgacc
     6301 ccgctggctg gatgccagaa catactctga cccactggct ctgcgcgaat tcaaagagtt
     6361 cgcagcagga agaagaagcg tctcaggtga cctaatatta gaaataggga aacttccaca
     6421 acatttaacg caaagggccc agaacgcctt ggacaatctg gttatgttgc acaactctga
     6481 acaaggagga aaagcctata gacacgccat ggaagaacta ccagacacca tagaaacgtt
     6541 aatgctccta gctttgatag ctgtgctgac tggtggagtg acgttgttct tcctatcagg
     6601 aaggggtcta ggaaaaacat ccattggcct actctgcgtg attgcctcaa gtgcactgtt
     6661 atggatggcc agtgtggaac cccattggat agcggcctct atcatactgg agttctttct
     6721 gatggtgttg cttattccag agccggacag acagcgcact ccacaagaca accagctagc
     6781 atacgtggtg ataggtctgt tattcatgat attgacagtg gcagccaatg agatgggatt
     6841 actggaaacc acaaagaagg acctggggat tggtcatgca gctgctgaaa accaccatca
     6901 tgctgcaatg ctggacgtag acctacatcc agcttcagcc tggactctct atgcagtggc
     6961 cacaacaatt atcactccca tgatgagaca cacaattgaa aacacaacgg caaatatttc
     7021 cctgacagct attgcaaacc aggcagctat attgatggga cttgacaagg gatggccaat
     7081 atcaaagatg gacataggag ttccacttct cgccttgggg tgctattctc aggtgaaccc
     7141 gctgacgctg acagcggcgg tattgatgct agtggctcat tatgccataa ttggacccgg
     7201 actgcaagca aaagctacta gagaagctca aaaaaggaca gcagccggaa taatgaaaaa
     7261 cccaactgtc gacgggatcg ttgcaataga tttggaccct gtggtttacg atgcaaaatt
     7321 tgaaaaacag ctaggccaaa taatgttgtt gatactttgc acatcacaga tcctcctgat
     7381 gcggaccaca tgggccttgt gtgaatccat cacactagcc actggacctc tgactacgct
     7441 ttgggaggga tctccaggaa aattctggaa caccacgata gcggtgtcca tggcaaacat
     7501 ttttagggga agttatctag caggagcagg tctggccttt tcattaatga aatctctagg
     7561 aggaggtagg agaggcacgg gagcccaagg ggaaacactg ggagaaaaat ggaaaagaca
     7621 gctaaaccaa ttgagcaagt cagaattcaa cacttacaaa aggagtggga ttatagaggt
     7681 ggatagatct gaagccaaag aggggttaaa aagaggagaa acgactaaac acgcagtgtc
     7741 gagaggaacg gccaaactga ggtggtttgt ggagaggaac cttgtgaaac cagaagggaa
     7801 agtcatagac ctcggttgtg gaagaggtgg ctggtcatat tattgcgctg ggctgaagaa
     7861 agtcacagaa gtgaaaggat acacgaaagg aggacctgga catgaggaac caatcccaat
     7921 ggcaacctat ggatggaacc tagtaaagct atactccggg aaagatgtat tctttacacc
     7981 acctgagaaa tgtgacaccc tcttgtgtga tattggtgag tcctctccga acccaactat
     8041 agaagaagga agaacgttac gtgttctaaa gatggtggaa ccatggctca gaggaaacca
     8101 attttgcata aaaattctaa atccctatat gccgagtgtg gtagaaactt tggagcaaat
     8161 gcaaagaaaa catggaggaa tgctagtgcg aaatccactc tcaagaaact ccactcatga
     8221 aatgtactgg gtttcatgtg gaacaggaaa cattgtgtca gcagtaaaca tgacatctag
     8281 aatgctgcta aatcgattca caatggctca caggaagcca acatatgaaa gagacgtgga
     8341 cttaggcgct ggaacaagac atgtggcagt agaaccagag gtggccaacc tagatatcat
     8401 tggccagagg atagagaata taaaaaatga acacaaatca acatggcatt atgatgagga
     8461 caatccatac aaaacatggg cctatcatgg atcatatgag gtcaagccat caggatcagc
     8521 ctcatccatg gtcaatggtg tggtgagact gctaaccaaa ccatgggatg tcattcccat
     8581 ggtcacacaa atagccatga ctgacaccac accctttgga caacagaggg tgtttaaaga
     8641 gaaagttgac acgcgtacac caaaagcgaa acgaggcaca gcacaaatta tggaggtgac
     8701 agccaggtgg ttatggggtt ttctctctag aaacaaaaaa cccagaatct gcacaagaga
     8761 ggagttcaca agaaaagtca ggtcaaacgc agctattgga gcagtgttcg ttgatgaaaa
     8821 tcaatggaac tcagcaaaag aggcagtgga agatgaacgg ttctgggacc ttgtgcacag
     8881 agagagggag cttcataaac aaggaaaatg tgccacgtgt gtctacaaca tgatgggaaa
     8941 gagagagaaa aaattaggag agttcggaaa ggcaaaagga agtcgcgcaa tatggtacat
     9001 gtggttggga gcgcgctttt tagagtttga agcccttggt ttcatgaatg aagatcactg
     9061 gttcagcaga gagaattcac tcagtggagt ggaaggagaa ggactccaca aacttggata
     9121 catactcaga gacatatcaa agattccagg gggaaatatg tatgcagatg acacagccgg
     9181 atgggacaca agaataacag aggatgatct tcagaatgag gccaaaatca ctgacatcat
     9241 ggaacctgaa catgccctat tggccacgtc aatctttaag ctaacctacc aaaacaaggt
     9301 agtaagggtg cagagaccag cgaaaaatgg aaccgtgatg gatgtcatat ccagacgtga
     9361 ccagagagga agtggacagg ttggaaccta tggcttaaac accttcacca acatggaggc
     9421 ccaactaata agacaaatgg agtctgaggg aatcttttca cccagcgaat tggaaacccc
     9481 aaatctagcc gaaagagtcc tcgactggtt gaaaaaacat ggcaccgaga ggctgaaaag
     9541 aatggcaatc agtggagatg actgtgtggt gaaaccaatc gatgacagat ttgcaacagc
     9601 cttaacagct ttgaatgaca tgggaaaggt aagaaaagac ataccgcaat gggaaccttc
     9661 aaaaggatgg aatgattggc aacaagtgcc tttctgttca caccatttcc accagctgat
     9721 tatgaaggat gggagggaga tagtggtgcc atgccgcaac caagatgaac ttgtaggtag
     9781 ggccagagta tcacaaggcg ccggatggag cttgagagaa actgcatgcc taggcaagtc
     9841 atatgcacaa atgtggcagc tgatgtactt ccacaggaga gacttgagat tagcggctaa
     9901 tgctatctgt tcagccgttc cagttgattg ggtcccaacc agccgcacca cctggtcgat
     9961 ccatgcccac catcaatgga tgacaacaga agacatgttg tcagtgtgga atagggtttg
    10021 gatagaggaa aacccatgga tggaggacaa gactcatgtg tccagttggg aagacgttcc
    10081 atacctagga aaaagggaag atcaatggtg tggttcccta ataggcttaa cagcacgagc
    10141 cacctgggcc accaacatac aagtggccat aaaccaagtg agaaggctca ttgggaatga
    10201 gaattatcta gacttcatga catcaatgaa gagattcaaa aacgagagtg atcccgaagg
    10261 ggcactctgg taagccaact cattcacaaa ataaaggaaa ataaaaaatc aaacaaggca
    10321 agaagtcagg ccggattaag ccatagcacg gtaagagcta tgctgcctgt gagccccgtc
    10381 caaggacgta aaatgaagtc aggccgaaag ccacggttcg agcaagccgt gctgcctgta
    10441 gctccatcgt ggggatgtaa aaacccggga ggctgcaaac catggaagct gtacgcatgg
    10501 ggtagcagac tagtggttag aggagacccc tcccaagaca caacgcagca gcggggccca
    10561 acaccagggg aagctgtacc ctggtggtaa ggactagagg ttagaggaga ccccccgcac
    10621 aacaacaaac agcatattga cgctgggaga gaccagagat cctgctgtct ctacagcatc
    10681 attccaggca cagaacgcca aaaaatggaa tggtgctgtt gaatcaacag gttct
//
DBGET integrated database retrieval system