GenomeNet

Database: RefSeq
Entry: NC_001693
LinkDB: NC_001693
Original site: NC_001693 
LOCUS       NC_001693               7313 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Human papillomavirus type 60, complete genome.
ACCESSION   NC_001693
VERSION     NC_001693.1
DBLINK      Project: 14028
KEYWORDS    RefSeq.
SOURCE      Human papillomavirus type 60
  ORGANISM  Human papillomavirus type 60
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Gammapapillomavirus.
REFERENCE   1  (sites)
  AUTHORS   Matsukura,T., Iwasaki,T. and Kawashima,M.
  TITLE     Molecular cloning of a novel human papillomavirus (type 60) from a
            plantar cyst with characteristic pathological changes
  JOURNAL   Virology 190 (1), 561-564 (1992)
   PUBMED   1326820
REFERENCE   2  (bases 1 to 7313)
  AUTHORS   Delius,H.
  TITLE     Sequenced by Hajo Delius, Deutsches Krebsforschungzentrum,
            Angewandte Tumorvirologie, I.N.F. 506, W-6900 Heidelberg, Germany
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7313)
  AUTHORS   Farmer,A.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-1995) Andrew D. Farmer, HIV Sequence Database,
            Los Alamos National Labroatory, T-10, Mail Stop K710, Los Alamos,
            NM 87501, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to U31792.
            HPV60 was originally isolated from a keratinous plantar cyst
            composed of the wall of the squamous cell layer and the horny inner
            substance in the lower dermis displaying cytoplasmic amorphous
            eosinophilic inclusions and vacuolated  structure with or without
            pyknotic nuclei. These morphological changes are not characteristic
            of skin lesions associated with other HPV types (1, 2, 3, 4, and
            7). HPV 60 was found in three out of three other plantar cysts with
            similar pathological changes; a fourth cyst without the associated
            pathological changes as negative for HPV60. These results strongly
            suggest that HPV 60 has unique biological properties which can
            induce a plantar cyst. The HPV60 genome appeared to be in an
            episomal form. HPV 60 showed no similarity with other known
            prototypes (HPVs 1-59) by Southern blot analysis under stringent
            conditions. Phylogenetically, it is associated with HPV 4, 48, 50,
            and 65, a group of primarily cutaneous types.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7313
                     /organism="Human papillomavirus type 60"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:40540"
                     /note="cloned HPV-60 DNA was obtained from the
                     Papillomavirus Reference Center, Heidelberg and sequenced
                     by Dr. H. Delius"
     gene            102..530
                     /gene="E6"
                     /db_xref="GeneID:1403638"
     CDS             102..530
                     /gene="E6"
                     /note="putative"
                     /codon_start=1
                     /product="transforming protein E6"
                     /protein_id="NP_043437.1"
                     /db_xref="GeneID:1403638"
                     /translation="MQMEEDRFPTTVADYCSEFDIPLKDLKLKCVFCRFYLTEQQLAA
                     FYIKNLKLVWKNRYCFACCTPCLRLTAKFEAENYFQCMCKGEVLEVLTRIPLSSLSVR
                     CFDCLTLLSFAEKIDCIISGQNFYLVRGRWRSYCRNCIEK"
     misc_feature    189..518
                     /gene="E6"
                     /note="Early Protein (E6); Region: E6; cl27673"
                     /db_xref="CDD:452769"
     gene            527..817
                     /gene="E7"
                     /db_xref="GeneID:1403639"
     CDS             527..817
                     /gene="E7"
                     /note="putative"
                     /codon_start=1
                     /product="transforming protein E7"
                     /protein_id="NP_043438.1"
                     /db_xref="GeneID:1403639"
                     /translation="MIGNQPNVNNLDVNLEELVLPVSLLADEELSPDGDPEEEEHYPY
                     TIDTCCKPCGAGVRFTIIATPSAVITLRQLLLQEVFLTCLRCSRSLFRHGRS"
     misc_feature    533..784
                     /gene="E7"
                     /note="E7 protein, Early protein; Region: E7; cl02891"
                     /db_xref="CDD:295537"
     gene            804..2636
                     /gene="E1"
                     /db_xref="GeneID:1403640"
     CDS             804..2636
                     /gene="E1"
                     /note="putative"
                     /codon_start=1
                     /product="replication protein E1"
                     /protein_id="NP_043439.1"
                     /db_xref="GeneID:1403640"
                     /translation="MADPNKGINSLELNEGHSEWYVVTEAECINSLDTMEELFEESTD
                     GSIVSNLIDDSEELEEGNSLALYNEQLTEDCNRAILALKRKLTKTPLKSQDRTVADLS
                     PRLEAVTISPQRQSKRRLFEDSGLGEDEATNSIEKKVVSNSLESNESGTLVVETDSIF
                     RSTNRKATLLAKFKEYFGVAYGDLTRPFKSDRSCCENWVISVCAAAEEVIEASKTVMQ
                     QHCDFLQVISYGFYALYLVKFKTAKSRDTIMKLFSLTLNVQEQQLMCDPPKSRSTPTA
                     LYFYRRSFGNASFIYGPFPDWLAKLTMLDHESAASSEQFELAQMIQFAYDNNLTTESE
                     IAYKYALLADSDANAAAFLKSNQQVKYVRDCYAMLRYYKRQEMKDMSISEWIWKCCDD
                     CNQEGNWKLIAQFLRYQEVNFISFLCALKTLFKGIPKRNCLVFWGPPDTGKSYICSSL
                     TRFMQGKVVSFMNRHSQFWLQPLQDCKLGFLDDATFQCWQYMDVNMRNALDGNHISLD
                     LKHKAPLQIKLPPLLITTNVDVENEASLMYLKSRLVFFKFPNKLPLKENDEVLYEITD
                     ASWKCFFIKFASHLELTARGDEQHESGRSDRAFRCTAGTNTESI"
     misc_feature    804..2633
                     /gene="E1"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     gene            2572..3786
                     /gene="E2"
                     /db_xref="GeneID:1403641"
     CDS             2572..3786
                     /gene="E2"
                     /note="putative"
                     /codon_start=1
                     /product="regulatory protein E2"
                     /protein_id="NP_043440.1"
                     /db_xref="GeneID:1403641"
                     /translation="MNQADLTERSDALQEQILNLYEQDSKDIQAQIQYWDLNRKLYVT
                     YYYARKEGYSHLGLQPLPALQVSEYKAKQAIEMGLLLTSLSKSQYASELWGLTDTSAE
                     LLLTPPRNTFKKKGYTVNVWFDNNENNTFPYTNWEYIYYQDDIEQWHRTRGEVDYNGL
                     YFTENNGNRAYFLLFDSDAQTYSQTGTWTVHYKNQIISAPVTSSSKQSSDDYTSKAGQ
                     QPHFFASSSSPTTTDGGQTSQEGVSSSTTSPSAVRLRRRRSNEQQRELSSRESPRTKR
                     RRVPDEVDRQSAVGSAPTAEEVGSRHRSLPRSGISRLARLQGEARDPPILLIKGLANS
                     LKCWRYRLKKYTRYFKCMSTVFRWVDIDVPESSRHKLLVVFNDTTQRDVFMKLVTLPR
                     GCTYTFGTLNSL"
     misc_feature    2587..3168
                     /gene="E2"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    <3178..>3543
                     /gene="E2"
                     /note="transcriptional regulator ICP4; Provisional;
                     Region: PHA03307"
                     /db_xref="CDD:223039"
     misc_feature    3541..3774
                     /gene="E2"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:395411"
     gene            2930..3553
                     /gene="E4"
                     /db_xref="GeneID:1403642"
     CDS             <2930..3553
                     /gene="E4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_043441.1"
                     /db_xref="GeneID:1403642"
                     /translation="MCGLIIMKIIHFPIQIGNIFTIRMILNNGTGPEERWTIMDFISQ
                     KIMEIEHIFSYLIVMHKHIHKLGHGQCIIKTKLFLLLLPAPQNNPPTTTLPKPGSNPT
                     SSPHPHRRLLPTEDRPHKRESLALPRRRVLFDYDAEDPTSNKENYPPESRPVPKDAEY
                     PTKSTDRVPWGLPQLLKRWEADIDLFLEAVYQDLQDFKEKLGILQSC"
     misc_feature    3074..3544
                     /gene="E4"
                     /note="E4 protein; Provisional; Region: PHA03419"
                     /db_xref="CDD:223079"
     gene            3807..5384
                     /gene="L2"
                     /db_xref="GeneID:1403643"
     CDS             3807..5384
                     /gene="L2"
                     /note="putative"
                     /codon_start=1
                     /product="minor capsid protein L2"
                     /protein_id="NP_043442.1"
                     /db_xref="GeneID:1403643"
                     /translation="MYARVKRVKRDSVENLYKQCQLGADCPPDVRNKVEGTTLADRLL
                     QIFGSILYLGNLGIGTGKGSGGATGYTPLGTARVPASTPGTVIKPTRPFSVPLDPIGS
                     GIPSQPVGGRLPVDIIDASASSIIPLQEVLPETTIIVGGDSGPGLGASEIDIVSEPRP
                     DVVGVDTQPTVYTSIDNTVATLDITPATPPVKKIILDPISSGSEGAAAITFSDISAAD
                     LNVFVDPQGAGDRISFGEEIELGPINQPAQFEIEEPPRTSTPGEGFQRVTTRARELYN
                     RFVQQQPTQNIDFLGRPSRAVQFEFENPAFFNDEVTMQFEQDLQEVAAAPDQDFADVR
                     ELGRARFSETSAGTIRVSRLGTKGTMKTRSGLTIGQKVHFYFDISDIPAAETIQLRTL
                     GESSHDFSAVDNITESTYINLTETTNEGLIPDNILEDEFTENFNNAQLIFATIDEGES
                     MIMPTIPPGVALKLFIPEIAASVLNVVHPSSEWTILIPNVPDEIIQPAMAVDVYDDFY
                     LHPHLLRRRKRKRLDFF"
     misc_feature    3822..5339
                     /gene="L2"
                     /note="Late Protein L2; Region: Late_protein_L2; cl28153"
                     /db_xref="CDD:332973"
     gene            5395..6921
                     /gene="L1"
                     /db_xref="GeneID:1403644"
     CDS             5395..6921
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /product="major capsid protein L1"
                     /protein_id="NP_043443.1"
                     /db_xref="GeneID:1403644"
                     /translation="MALWLQTAGQLYLPPSKPVARVLSTDEYVQPTNLVFHTGTDRML
                     IVGHPYFDIIDSGSNNITVPKCSGNQFRVMRLLFPDPNKFAMIDRAVFNPERERLVWR
                     LEGLEIGRGGPLGIGTSGHPLFNKYGDTENPAAYPLKQNNGDDNRMDVSMDPKQMQLF
                     IVGCKPATGEHWDIAKPCDPAPAKGSCPPIKLTQSIIQDGEMCDTGFGNANFITLQED
                     KSGVPLDITNEICKYPDLLKMTKDIYGDAVFFFGKREQIYSRHYFVRGGIDGDSLPDS
                     GYYLAPQTDKPQNNLGGYSYFPTPSGSVASSDNQLFNRPYWLHRAQGANNGICWGNQL
                     FITIVDNTRNTNLSISVYKQDAAIDNRYKYKQEDFRQYLRHTEEYEVELILRLCKVPL
                     NPDVLAHLNVMDKNILEDWQLSFVPPPPQGIEDAYRYIMSQATMCPTDVPNTEREDPY
                     KQYTFWTIDLQERFSNELSQFSLGKRYLYQYGLLNGRKRSASSFVTKKSKTVKRKRTK
                     "
     misc_feature    5395..6918
                     /gene="L1"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 tataggatat acactgattg ttggcaacta tcattaaatc ataaaaaaaa tatgaccaga
       61 agaggtatat ataaatagct gagacgttcg taaactttag gatgcagatg gaagaagaca
      121 ggtttccaac aacagtggct gattattgct ctgaatttga tattccttta aaagatctta
      181 agttaaaatg tgtattttgt agattttact taactgaaca gcagttggct gcattttata
      241 ttaagaattt aaagttagtt tggaaaaacc gttattgctt tgcttgttgt actccgtgtc
      301 ttagacttac tgctaaattt gaagctgaaa actattttca gtgtatgtgt aaaggagaag
      361 tattagaagt tctaactcgt attcctttga gttctctttc tgtacgctgt tttgattgcc
      421 ttacattgtt atcttttgca gaaaaaatag attgtataat tagtggtcaa aacttttatc
      481 ttgtaagggg tcgctggaga tcatattgta gaaattgcat tgagaaatga ttggtaatca
      541 gcctaatgtt aataaccttg atgtaaattt ggaggagttg gttttacctg tcagtctttt
      601 agctgatgag gagttgtcac ccgatggtga tcctgaggag gaggagcact atccctatac
      661 aatagacacc tgttgcaaac cttgtggagc aggtgttaga tttactatta ttgctactcc
      721 ttctgctgta ataactcttc gtcaactatt gcttcaagaa gtgttcctga cctgtttgag
      781 gtgctccaga tccctttttc gacatggcag atcctaataa aggtattaat tctcttgaat
      841 taaatgaggg gcatagcgaa tggtatgttg tgacagaagc tgagtgtatt aatagtttgg
      901 atacaatgga agagctattt gaagaaagta cagatggatc tattgtgtcc aatctgatag
      961 acgattccga ggaactggag gagggaaatt ccctggcact ctacaatgaa cagttaacag
     1021 aggattgcaa tagagctatt ttagcgctaa aacgaaagtt aactaaaaca cctttgaaaa
     1081 gccaggacag aacggttgct gacctaagtc caaggttgga agctgtcaca atttcacctc
     1141 agagacaaag caaaaggaga ttatttgagg acagtggatt aggagaagat gaagctacaa
     1201 attctattga aaaaaaggta gtttcgaact ctttagagag taatgaaagt gggaccttgg
     1261 ttgtggaaac ggacagtata tttcgcagta ctaatagaaa agccacttta ttggctaaat
     1321 ttaaagaata ctttggtgta gcatatggag atttaacgcg accgtttaaa agtgatagat
     1381 catgttgtga aaactgggtt ataagtgtgt gtgccgctgc agaagaagta atagaagctt
     1441 caaaaacagt tatgcagcaa cattgtgatt ttttacaggt tatttcatat gggttttatg
     1501 ctttatattt ggtaaaattt aaaacagcaa aaagtagaga tactataatg aaattatttt
     1561 ctttaacatt gaatgtacaa gaacaacaat taatgtgtga tccaccaaaa tctagaagta
     1621 ccccaacagc tctttatttt tatagaaggt catttggaaa tgcatcgttt atttatggac
     1681 cgtttccaga ttggttagca aaattaacta tgttagacca tgaatccgcc gcgagctcag
     1741 aacagtttga acttgctcaa atgattcaat ttgcttatga caataacttg acaactgaat
     1801 ctgaaatagc ttataaatat gcattgttag ctgattctga tgctaatgca gctgcatttt
     1861 taaaaagtaa tcaacaggta aaatatgtac gagactgcta tgcaatgtta agatattata
     1921 aaagacaaga aatgaaagat atgtcaattt ctgagtggat atggaaatgt tgcgatgatt
     1981 gtaatcaaga gggcaactgg aaattaatag cacaattttt acgttatcaa gaagttaatt
     2041 tcatttcatt tttatgtgca ttaaagacat tgtttaaagg tattccaaaa agaaattgtt
     2101 tagtgttttg gggacctcca gatacaggaa agtcttatat ttgttcttca cttacacggt
     2161 ttatgcaggg aaaagtggta tctttcatga atagacacag tcaattttgg ctacaacctt
     2221 tacaagattg taagcttgga ttcttagatg atgctacatt tcaatgttgg caatacatgg
     2281 atgtaaatat gcgaaatgca ttagatggta atcatatttc attagattta aaacataaag
     2341 ctcctttaca aataaaatta cctcctttat taataactac caatgttgat gttgaaaatg
     2401 aagctagctt aatgtattta aagagtagac tagtattttt taagtttcct aacaaattac
     2461 ctttaaaaga aaatgatgaa gtactttatg aaattactga tgcatcatgg aaatgttttt
     2521 ttatcaaatt tgcaagccat ttagagctga cagccagagg agacgagcag catgaatcag
     2581 gccgatctga ccgagcgttc cgatgcactg caggaacaaa tactgaatct atatgagcaa
     2641 gattcaaagg acattcaggc ccaaatacaa tattgggatt taaatagaaa actatatgtc
     2701 acatactatt atgcaagaaa agaaggctat tcgcatttgg gtcttcaacc cttaccagct
     2761 ttgcaagtat cagagtacaa agccaagcag gcaatcgaaa tgggattgtt attaaccagt
     2821 ttaagcaaat cccaatatgc ttcagaacta tggggtttaa cagatacaag tgcagaattg
     2881 ttattaaccc ctccaagaaa tacatttaaa aagaagggat atactgtaaa tgtgtggttt
     2941 gataataatg aaaataatac atttccctat acaaattggg aatatattta ctatcaggat
     3001 gatattgaac aatggcacag gaccagagga gaggtggact ataatggact ttatttcaca
     3061 gaaaataatg gaaatagagc atattttctc ctatttgata gtgatgcaca aacatattca
     3121 caaactggga catggacagt gcattataaa aaccaaatta tttctgctcc tgttaccagc
     3181 tcctcaaaac aatcctccga cgactacact tccaaagccg ggcagcaacc ccacttcttc
     3241 gcctcatcct catcgccgac tactaccgac ggaggacaga cctcacaaga gggagtctct
     3301 agctctacca cgtcgccgag tgctgttcga ttacgacgcc gaagatccaa cgagcaacaa
     3361 agagaactat cctccagaga gtcgccccgt accaaaagac gcagagtacc cgacgaagtc
     3421 gaccgacaga gtgccgtggg gtctgcccca actgctgaag aggtgggaag cagacataga
     3481 tctcttccta gaagcggtat atcaagactt gcaagacttc aaggagaagc tcgggatcct
     3541 ccaatcctgc taattaaagg tctagcaaac tcccttaaat gttggagata tcgattgaaa
     3601 aagtatacac gttattttaa atgtatgagt acagtattta gatgggtaga catagacgta
     3661 ccagaatctt ctagacataa attgttagtt gtttttaatg ataccacaca acgagatgtt
     3721 tttatgaaat tagtaacttt gccaagaggt tgtacatata catttggaac attaaactct
     3781 ttgtaatatt tgtaaaacaa aacaaaatgt atgctagagt aaagcgtgtt aaaagagact
     3841 ctgttgaaaa cttatataaa caatgtcaac ttggtgctga ctgccctcct gatgtacgaa
     3901 ataaagtaga aggaaccaca cttgcagatc gattattaca aatatttgga agtatcttat
     3961 acctggggaa tttgggtata gggacaggta aaggatcggg gggtgctaca ggctatacac
     4021 ctcttggtac tgcaagagtg ccagcgtcta cacctggaac agttataaaa cccacacgac
     4081 cgttttcggt tcctttagat ccaataggtt ctggaattcc atcgcaacct gtaggaggtc
     4141 ggttacctgt ggacattata gatgccagtg cttcctctat tatacccttg caggaggtcc
     4201 tgccagagac caccattata gtaggcggtg acagcggtcc tggattgggt gcaagtgaaa
     4261 ttgatatagt ttcagaacca agaccagatg tggtcggtgt tgatactcaa ccaacagtat
     4321 atacctccat tgataataca gttgctacat tagacattac accagctaca ccaccagtga
     4381 agaaaataat attagaccct ataagttcag gttctgaagg tgctgcagca ataacatttt
     4441 cagatataag tgctgcagat ttaaatgtat ttgttgatcc tcagggagca ggagatagaa
     4501 taagttttgg agaagaaata gagttaggcc ctattaatca gcctgctcaa tttgaaatag
     4561 aagaacctcc acgtaccagt acacctgggg agggatttca acgtgttaca acacgggcaa
     4621 gggaattata taatagattt gtgcagcaac agccaacaca aaatattgac ttcttaggac
     4681 gtccttcccg cgctgtacaa tttgaatttg aaaatcccgc cttttttaat gatgaggtga
     4741 ctatgcagtt tgagcaagat ttgcaagagg tggctgcagc gccagaccag gattttgcag
     4801 atgtcaggga attaggacga gctcggtttt cagaaacatc tgcaggaaca atacgagtca
     4861 gcagattagg aacaaaagga acaatgaaaa cacgaagtgg actaactatt ggtcagaaag
     4921 ttcactttta ttttgatatt agtgatattc cagctgcaga aaccatacaa ctaagaacat
     4981 taggcgagtc ttcccacgat ttttctgcag tagataatat tactgaaagt acatatatta
     5041 atttaactga aactacaaat gaaggcctaa tacctgacaa tatactagag gatgaattta
     5101 cagaaaactt taataatgca cagctgatat ttgcaacaat agatgaagga gaatctatga
     5161 tcatgcccac aattcctcca ggtgtagctt taaagttatt tattccagaa atagctgcaa
     5221 gcgtgttaaa tgtggttcat ccttcttctg agtggactat tttgattcct aatgttccag
     5281 atgaaattat tcagcctgct atggcagtag atgtttatga tgacttttat ttacatcctc
     5341 atcttcttag gcgacgcaaa cgaaaacggt tggatttttt ttaatgtttt acagatggct
     5401 ctttggttgc agacagctgg acaattgtat cttccaccaa gcaagcctgt tgctcgtgta
     5461 ctcagtacgg atgaatatgt acagccaaca aatttagttt ttcatacagg aactgacaga
     5521 atgctaattg taggacaccc ttattttgat attatagaca gtggttcaaa taatattact
     5581 gtacctaaat gtagtggaaa tcagtttaga gttatgcgac tactatttcc agatccaaac
     5641 aaatttgcaa tgatagacag agctgtcttt aacccagaaa gagagagatt agtctggaga
     5701 ttggaaggcc ttgaaattgg tagaggtggg cctttaggaa ttggaacttc tggccatcca
     5761 ttatttaata aatatggaga tacagaaaat cctgccgcat atcctttaaa gcagaataat
     5821 ggtgatgaca atagaatgga tgtttcaatg gatccaaaac aaatgcaatt gtttattgta
     5881 ggatgtaaac cagccactgg tgaacactgg gatattgcta aaccttgtga tcctgctcca
     5941 gcaaaaggat cctgtccccc aattaaatta acacagtcta taattcagga cggtgaaatg
     6001 tgcgatacag gctttggaaa tgcaaatttt attaccttgc aagaagataa atcaggtgtt
     6061 cctctagata ttaccaatga aatttgtaaa tatcctgatt tactaaaaat gacaaaagat
     6121 atctatggag atgcagtatt tttctttggt aaacgtgaac aaatttattc caggcattat
     6181 tttgtaagag gagggataga tggagatagt ttgccagatt ctggatatta cttagcacca
     6241 caaactgata aacctcaaaa taaccttggt ggttatagtt acttccctac accaagtggt
     6301 tctgtagctt ctagtgataa tcaacttttt aatagacctt attggcttca cagagcccaa
     6361 ggtgcaaata atggtatttg ttggggtaac caattattca ttactatagt agataatact
     6421 cgaaatacta atttatctat ttcagtttac aaacaagatg ctgctattga taacagatat
     6481 aaatataaac aggaagattt tagacagtat ttacgccata ctgaagaata tgaagtagag
     6541 ttaattctga gactctgtaa agtgcctttg aatccagatg ttctagctca tttaaatgta
     6601 atggacaaaa atattttaga ggattggcaa ctttcatttg tacctccacc accacaaggt
     6661 attgaagatg cttacagata tataatgtct caggcaacaa tgtgtccaac agatgttcct
     6721 aatactgaaa gggaagaccc ttataaacag tatacatttt ggacaataga tttgcaagaa
     6781 cgtttttcta acgaattatc ccagttttct cttggaaaaa gatatttata tcagtatggc
     6841 ttacttaacg gacgaaaacg gtctgctagt agttttgtaa cgaagaaatc aaaaactgtg
     6901 aaacgtaaaa gaactaaata aatacatata tatattatat gattaatgaa ggatatatta
     6961 attaataatg ctgctgttgt aaaatgaagg attaataaat tgcacatcag caagtgtctg
     7021 actcacgggg tctacatttt tgtctaccgc gccttcataa ttatcttggc attgcatatc
     7081 gagactataa gaaacaatca cttggcacac tctcggattt aacaagcatt gctggacact
     7141 taccaaccgt aactggttaa aaaagagcgc caaaggggaa acaggcaacc gttttcgttc
     7201 tcctgaagga acgttttcca ggtaagtaca tgttcataca aagttttgac tcactctctt
     7261 tgttagaaac catttccgtt ctgtggatat gcgccagacc aaaaacggtt gcc
//
DBGET integrated database retrieval system