GenomeNet

Database: RefSeq
Entry: NC_001802
LinkDB: NC_001802
Original site: NC_001802 
LOCUS       NC_001802               9181 bp ss-RNA     linear   VRL 13-AUG-2018
DEFINITION  Human immunodeficiency virus 1, complete genome.
ACCESSION   NC_001802
VERSION     NC_001802.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus;
            Lentivirus humimdef1.
REFERENCE   1  (bases 1 to 9181)
  AUTHORS   Martoglio,B., Graf,R. and Dobberstein,B.
  TITLE     Signal peptide fragments of preprolactin and HIV-1 p-gp160 interact
            with calmodulin
  JOURNAL   EMBO J. 16 (22), 6636-6645 (1997)
   PUBMED   9362478
REFERENCE   2  (bases 1 to 9181)
  AUTHORS   Petropoulos,C.J.
  TITLE     Appendix 2: Retroviral taxonomy, protein structure, sequences, and
            genetic maps
  JOURNAL   (in) Coffin,J.M. (Ed.);
            RETROVIRUSES: 757;
            Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York,
            NY, USA (1997)
REFERENCE   3  (bases 1 to 9181)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-AUG-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 9181)
  AUTHORS   Chappey,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAR-1999) NIH, NLM, Rockville Pike, Bethesda, MD
            20894, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 9181)
  AUTHORS   Chappey,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-NOV-1997) NIH, NLM, Rockville Pike, Bethesda, MD
            20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF033819.
            The annotation of this sequence was corrected and updated with the
            kind help of Dr. Colombe Chappey (ViroLogic Inc., South San
            Francisco, CA USA) and Roger Ptak (Southern Research Institute,
            Frederick, MD USA).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9181
                     /organism="Human immunodeficiency virus 1"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11676"
                     /note="strain for reference annotation"
     misc_feature    1..96
                     /note="repeat; positions of RNA transcription
                     initialization and polyadenylation; Region: R"
     regulatory      73..78
                     /regulatory_class="polyA_signal_sequence"
                     /note="both 5' and 3' poly A signals are transcribed into
                     RNA, but the 5' one is suppressed"
     5'UTR           97..181
     primer_bind     182..199
     gene            336..4642
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /db_xref="GeneID:155348"
     CDS             join(336..1637,1637..4642)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /ribosomal_slippage
                     /note="fusion protein consisting of the viral structural
                     proteins and enzymes; cleaved by the viral protease into
                     individual mature proteins; The processing products of the
                     Gag and Gag-Pol polyproteins were annotated with the help
                     of Pettit et al., 2003 and references therein; Pr160"
                     /codon_start=1
                     /product="Gag-Pol"
                     /protein_id="NP_057849.4"
                     /db_xref="GeneID:155348"
                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERF
                     AVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALD
                     KIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVE
                     EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPV
                     HAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM
                     YSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTIL
                     KALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKC
                     FNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLREDLAFLQGKAREFSS
                     EQTRANSPTRRELQVWGRDNNSPSEAGADRQGTVSFNFPQVTLWQRPLVTIKIGGQLK
                     EALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVG
                     PTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEI
                     CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
                     HPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW
                     KGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLR
                     WGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQ
                     IYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIA
                     EIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGK
                     TPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVD
                     GAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQY
                     ALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
                     LFLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCS
                     PGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHT
                     DNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLK
                     TAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSR
                     NPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED"
     misc_feature    339..731
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    339..731
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    762..1085
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="gag protein p24 N-terminal domain; Region: Gag_p24;
                     pfam00607"
                     /db_xref="CDD:459864"
     misc_feature    762..1085
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="gag protein p24 N-terminal domain; Region: Gag_p24;
                     pfam00607"
                     /db_xref="CDD:459864"
     misc_feature    1161..1382
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Gag protein p24 C-terminal domain; Region:
                     Gag_p24_C; pfam19317"
                     /db_xref="CDD:466038"
     misc_feature    1161..1382
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Gag protein p24 C-terminal domain; Region:
                     Gag_p24_C; pfam19317"
                     /db_xref="CDD:466038"
     misc_feature    <1380..1622
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="universal minicircle sequence binding protein
                     (UMSBP); Provisional; Region: PTZ00368"
                     /db_xref="CDD:173561"
     misc_feature    <1380..1622
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="universal minicircle sequence binding protein
                     (UMSBP); Provisional; Region: PTZ00368"
                     /db_xref="CDD:173561"
     mat_peptide     join(1632..1637,1637..1798)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="Gag-Pol Transframe peptide"
                     /experiment="DESCRIPTION:[PMID:15527852]"
                     /note="the Glu-Asp-Leu tripeptide (positions 4-6) is a
                     specific inhibitor of the HIV-1 protease. Involved in
                     regulation of the protease-mediated polyprotein
                     processing; alternative p6 protein; p6*"
                     /protein_id="NP_787043.1"
     mat_peptide     1655..4639
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="Pol"
                     /note="unprocessed Pol polyprotein; includes part of the
                     transframe peptide, protease, reverse transcriptase and
                     integrase domains."
                     /protein_id="NP_789740.1"
     mat_peptide     1799..2095
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="aspartic peptidase"
                     /experiment="DESCRIPTION:[PMID:2537531]"
                     /experiment="DESCRIPTION:[PMID:2548279]"
                     /experiment="DESCRIPTION:[PMID:3290901]"
                     /note="The proteinase domain of Gag-Pol (in the form of
                     homodimer) mediates all the cleavages in the polyprotein.
                     Cleaves itself from the polyprotein late in particle
                     assembly; protease"
                     /protein_id="NP_705926.1"
     misc_feature    1811..2092
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Retroviral aspartyl protease; Region: RVP;
                     pfam00077"
                     /db_xref="CDD:425454"
     misc_feature    1811..2092
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Retroviral aspartyl protease; Region: RVP;
                     pfam00077"
                     /db_xref="CDD:425454"
     misc_feature    order(1871..1873,1877..1879,1883..1885,1934..1942,
                     2048..2050)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="inhibitor binding site [active]"
                     /db_xref="CDD:133149"
     misc_feature    order(1871..1873,1877..1879,1883..1885,1934..1942,
                     2048..2050)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="inhibitor binding site [active]"
                     /db_xref="CDD:133149"
     misc_feature    1871..1879
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133149"
     misc_feature    1871..1879
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133149"
     misc_feature    1871..1873
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Catalytic residue [active]"
                     /db_xref="CDD:133149"
     misc_feature    1871..1873
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Catalytic residue [active]"
                     /db_xref="CDD:133149"
     misc_feature    order(1934..1948,1952..1966)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133149"
     misc_feature    order(1934..1948,1952..1966)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133149"
     mat_peptide     2096..3775
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="p66 subunit"
                     /experiment="DESCRIPTION:[PMID:1374166]"
                     /experiment="EXISTENCE:[PMID:4316300]"
                     /note="transcribes single stranded viral RNA genome into
                     double stranded proviral DNA; HIV-1 reverse transcriptase
                     is composed of the p66 subunit (this protein) and the p51
                     subunit that lacks the RNAse H domain of the larger
                     subunit"
                     /protein_id="NP_705927.1"
     mat_peptide     2096..3415
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="reverse transcriptase p51 subunit"
                     /note="HIV-1 reverse transcriptase is composed of the p66
                     subunit and the p51 subunit (this protein) that lacks the
                     RNAse H domain of the larger subunit"
                     /protein_id="NP_789739.1"
     misc_feature    2147..2797
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptases (RTs) from retroviruses
                     (Rtvs). RTs catalyze the conversion of single-stranded RNA
                     into double-stranded viral DNA for integration into host
                     chromosomes. Proteins in this subfamily contain long
                     terminal repeats (LTRs) and are...; Region: RT_Rtv;
                     cd01645"
                     /db_xref="CDD:238823"
     misc_feature    2147..2797
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptases (RTs) from retroviruses
                     (Rtvs). RTs catalyze the conversion of single-stranded RNA
                     into double-stranded viral DNA for integration into host
                     chromosomes. Proteins in this subfamily contain long
                     terminal repeats (LTRs) and are...; Region: RT_Rtv;
                     cd01645"
                     /db_xref="CDD:238823"
     misc_feature    order(2165..2170,2276..2278,2288..2290,2309..2311,
                     2315..2323,2327..2329,2336..2338,2360..2362,2366..2371,
                     2375..2377,2423..2440,2546..2551,2555..2557,2564..2566,
                     2642..2644,2648..2653,2783..2788)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="active site"
                     /db_xref="CDD:238823"
     misc_feature    order(2165..2170,2276..2278,2288..2290,2309..2311,
                     2315..2323,2327..2329,2336..2338,2360..2362,2366..2371,
                     2375..2377,2423..2440,2546..2551,2555..2557,2564..2566,
                     2642..2644,2648..2653,2783..2788)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="active site"
                     /db_xref="CDD:238823"
     misc_feature    order(2165..2170,2315..2323,2327..2329,2336..2338,
                     2360..2362,2366..2371,2375..2377,2549..2551,2555..2557,
                     2564..2566,2642..2644,2783..2788)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238823"
     misc_feature    order(2165..2170,2315..2323,2327..2329,2336..2338,
                     2360..2362,2366..2371,2375..2377,2549..2551,2555..2557,
                     2564..2566,2642..2644,2783..2788)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238823"
     misc_feature    order(2288..2290,2309..2311,2423..2440,2546..2548,
                     2648..2650)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="dNTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238823"
     misc_feature    order(2288..2290,2309..2311,2423..2440,2546..2548,
                     2648..2650)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="dNTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238823"
     misc_feature    order(2393..2404,2630..2632,2636..2638,2657..2659,
                     2663..2665,2774..2776)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="NNRTI binding site [active]"
                     /db_xref="CDD:238823"
     misc_feature    order(2393..2404,2630..2632,2636..2638,2657..2659,
                     2663..2665,2774..2776)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="NNRTI binding site [active]"
                     /db_xref="CDD:238823"
     misc_feature    2816..2983
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptase thumb domain; Region:
                     RVT_thumb; pfam06817"
                     /db_xref="CDD:429135"
     misc_feature    2816..2983
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptase thumb domain; Region:
                     RVT_thumb; pfam06817"
                     /db_xref="CDD:429135"
     misc_feature    3047..3352
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptase connection domain; Region:
                     RVT_connect; pfam06815"
                     /db_xref="CDD:462013"
     misc_feature    3047..3352
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Reverse transcriptase connection domain; Region:
                     RVT_connect; pfam06815"
                     /db_xref="CDD:462013"
     misc_feature    3404..3766
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="RNase H; Region: RNase_H; pfam00075"
                     /db_xref="CDD:395028"
     misc_feature    3404..3766
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="RNase H; Region: RNase_H; pfam00075"
                     /db_xref="CDD:395028"
     misc_feature    order(3422..3433,3527..3529,3587..3589,3698..3700,
                     3752..3754)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     misc_feature    order(3422..3433,3527..3529,3587..3589,3698..3700,
                     3752..3754)
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     mat_peptide     3776..4639
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /product="integrase"
                     /experiment="DESCRIPTION:[PMID:7983732]"
                     /experiment="DESCRIPTION:[PMID:8035478]"
                     /note="mediates integration of the viral DNA into the
                     infected cell chromosome"
                     /protein_id="NP_705928.1"
     misc_feature    3803..3907
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase Zinc binding domain; Region:
                     Integrase_Zn; pfam02022"
                     /db_xref="CDD:426567"
     misc_feature    3803..3907
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase Zinc binding domain; Region:
                     Integrase_Zn; pfam02022"
                     /db_xref="CDD:426567"
     misc_feature    3944..4210
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:459897"
     misc_feature    3944..4210
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:459897"
     misc_feature    <4109..4360
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Transposase InsO and inactivated derivatives
                     [Mobilome: prophages, transposons]; Region: Tra5; COG2801"
                     /db_xref="CDD:442053"
     misc_feature    <4109..4360
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Transposase InsO and inactivated derivatives
                     [Mobilome: prophages, transposons]; Region: Tra5; COG2801"
                     /db_xref="CDD:442053"
     misc_feature    4448..4579
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase DNA binding domain; Region: IN_DBD_C;
                     pfam00552"
                     /db_xref="CDD:425747"
     misc_feature    4448..4579
                     /gene="gag-pol"
                     /locus_tag="HIV1gp1"
                     /note="Integrase DNA binding domain; Region: IN_DBD_C;
                     pfam00552"
                     /db_xref="CDD:425747"
     gene            336..1838
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /db_xref="GeneID:155030"
     CDS             336..1838
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="The processing products of the Gag and Gag-Pol
                     polyproteins were annotated with the help of Pettit et
                     al., 2003 and references therein"
                     /codon_start=1
                     /product="Pr55(Gag)"
                     /protein_id="NP_057850.1"
                     /db_xref="GeneID:155030"
                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERF
                     AVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALD
                     KIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVE
                     EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPV
                     HAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM
                     YSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTIL
                     KALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKC
                     FNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQ
                     SRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ"
     mat_peptide     336..731
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="matrix"
                     /experiment="DESCRIPTION:[PMID:12032547]"
                     /experiment="DESCRIPTION:[PMID:1710290]"
                     /experiment="DESCRIPTION:[PMID:8610175]"
                     /note="viral structural protein; forms the outer
                     structural shell of HIV-1 virions; involved in the nuclear
                     import of the HIV-1 preintegration complex; p17"
                     /protein_id="NP_579876.2"
     misc_feature    339..731
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    339..731
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     mat_peptide     732..1424
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="capsid"
                     /experiment="DESCRIPTION:[PMID:15208690]"
                     /experiment="DESCRIPTION:[PMID:16041386]"
                     /experiment="DESCRIPTION:[PMID:21248851]"
                     /note="viral structural protein; forms the core of HIV-1
                     virions; p24"
                     /protein_id="NP_579880.1"
     misc_feature    762..1085
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="gag protein p24 N-terminal domain; Region: Gag_p24;
                     pfam00607"
                     /db_xref="CDD:459864"
     misc_feature    762..1085
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="gag protein p24 N-terminal domain; Region: Gag_p24;
                     pfam00607"
                     /db_xref="CDD:459864"
     misc_feature    1161..1382
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="Gag protein p24 C-terminal domain; Region:
                     Gag_p24_C; pfam19317"
                     /db_xref="CDD:466038"
     misc_feature    1161..1382
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="Gag protein p24 C-terminal domain; Region:
                     Gag_p24_C; pfam19317"
                     /db_xref="CDD:466038"
     misc_feature    <1380..1622
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="universal minicircle sequence binding protein
                     (UMSBP); Provisional; Region: PTZ00368"
                     /db_xref="CDD:173561"
     misc_feature    <1380..1622
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="universal minicircle sequence binding protein
                     (UMSBP); Provisional; Region: PTZ00368"
                     /db_xref="CDD:173561"
     mat_peptide     1425..1466
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="p2"
                     /note="Processing of Gag-Pol by the protease domain dimer
                     starts with cleavage between the p2 and nucleocapsid
                     proteins."
                     /protein_id="NP_579882.1"
     mat_peptide     1467..1631
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="nucleocapsid"
                     /experiment="DESCRIPTION:[PMID:1639074]"
                     /experiment="DESCRIPTION:[PMID:7666546]"
                     /note="viral structural protein; coats the genomic RNA
                     inside the virion core; binds and delivers full-length
                     viral RNAs into assembling HIV-1 virions; p7"
                     /protein_id="NP_579881.1"
     mat_peptide     1632..1679
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="p1"
                     /note="important for virus infectivity, protein
                     processing, and genomic RNA dimer stability"
                     /protein_id="NP_787042.1"
     mat_peptide     1680..1835
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /product="p6"
                     /experiment="DESCRIPTION:[PMID:10085158]"
                     /experiment="DESCRIPTION:[PMID:15527852]"
                     /note="important for incorporation of Vpr into assembling
                     HIV-1 virions; helps mediate efficient virus particle
                     release from infected cells"
                     /protein_id="NP_579883.1"
     misc_feature    1680..1793
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="Gag protein p6; Region: Gag_p6; pfam08705"
                     /db_xref="CDD:312289"
     misc_feature    1680..1793
                     /gene="gag"
                     /locus_tag="HIV1gp2"
                     /note="Gag protein p6; Region: Gag_p6; pfam08705"
                     /db_xref="CDD:312289"
     gene            4587..5165
                     /gene="vif"
                     /locus_tag="HIV1gp3"
                     /db_xref="GeneID:155459"
     CDS             4587..5165
                     /gene="vif"
                     /locus_tag="HIV1gp3"
                     /note="p23; viral infectivity factor; viral accessory
                     protein important for virus replication in vivo"
                     /codon_start=1
                     /product="Vif"
                     /protein_id="NP_057851.1"
                     /db_xref="GeneID:155459"
                     /translation="MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHY
                     ESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPEL
                     ADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIK
                     PPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH"
     misc_feature    4587..5162
                     /gene="vif"
                     /locus_tag="HIV1gp3"
                     /note="Retroviral Vif (Viral infectivity) protein; Region:
                     Vif; pfam00559"
                     /db_xref="CDD:278957"
     misc_feature    4587..5162
                     /gene="vif"
                     /locus_tag="HIV1gp3"
                     /note="Retroviral Vif (Viral infectivity) protein; Region:
                     Vif; pfam00559"
                     /db_xref="CDD:278957"
     gene            5105..5396
                     /gene="vpr"
                     /locus_tag="HIV1gp4"
                     /db_xref="GeneID:155807"
     CDS             join(5105..5319,5321..5396)
                     /gene="vpr"
                     /locus_tag="HIV1gp4"
                     /exception="artificial frameshift"
                     /note="p15; viral protein R; viral accessory protein
                     important for virus replication in vivo; involved in the
                     nuclear import of the HIV-1 preintegration complex;
                     induces G2 cell cycle arrest; influences mutation rates
                     during viral DNA synthesis; An artificial frameshift
                     eliminating the orf-disrupting nucleotide at position 5320
                     is introduced to obtain the typical HIV-1 Vpr protein
                     sequence. For this particular HIV-1 strain, HXB2, only a
                     short (78 amino acid long) variant of the Vpr sequence can
                     be obtained by translation of nucleotides 5105 through
                     5341 without the frameshift"
                     /codon_start=1
                     /product="Vpr"
                     /protein_id="NP_057852.2"
                     /db_xref="GeneID:155807"
                     /translation="MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQ
                     HIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS"
     misc_feature    join(5105..5319,5321..5351)
                     /gene="vpr"
                     /locus_tag="HIV1gp4"
                     /note="VPR/VPX protein; Region: VPR; pfam00522"
                     /db_xref="CDD:278923"
     misc_feature    join(5105..5319,5321..5351)
                     /gene="vpr"
                     /locus_tag="HIV1gp4"
                     /note="VPR/VPX protein; Region: VPR; pfam00522"
                     /db_xref="CDD:278923"
     gene            5377..7970
                     /gene="tat"
                     /locus_tag="HIV1gp5"
                     /db_xref="GeneID:155871"
     CDS             join(5377..5591,7925..7970)
                     /gene="tat"
                     /locus_tag="HIV1gp5"
                     /note="p14; transcriptional activator; viral regulatory
                     protein required for virus replication; transactivates the
                     viral LTR promoter through interactions with cellular
                     transcription factors; associated with pathogenic effects
                     of the virus; the length of Tat varies depending on virus
                     strain or clade"
                     /codon_start=1
                     /product="Tat"
                     /protein_id="NP_057853.1"
                     /db_xref="GeneID:155871"
                     /translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALG
                     ISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE"
     misc_feature    5380..5568
                     /gene="tat"
                     /locus_tag="HIV1gp5"
                     /note="Transactivating regulatory protein (Tat); Region:
                     Tat; pfam00539"
                     /db_xref="CDD:306921"
     misc_feature    5380..5568
                     /gene="tat"
                     /locus_tag="HIV1gp5"
                     /note="Transactivating regulatory protein (Tat); Region:
                     Tat; pfam00539"
                     /db_xref="CDD:306921"
     gene            5516..8199
                     /gene="rev"
                     /locus_tag="HIV1gp6"
                     /db_xref="GeneID:155908"
     CDS             join(5516..5591,7925..8199)
                     /gene="rev"
                     /locus_tag="HIV1gp6"
                     /note="p19; regulator of expression of virion proteins;
                     prevents splicing of viral RNA; shuttles unspliced viral
                     RNA to the cytoplasm for expression of viral proteins and
                     incorporation of full length viral genomic RNA into
                     virions"
                     /codon_start=1
                     /product="Rev"
                     /protein_id="NP_057854.1"
                     /db_xref="GeneID:155908"
                     /translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRR
                     WRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQI
                     LVESPTVLESGTKE"
     misc_feature    join(5516..5591,7925..8121)
                     /gene="rev"
                     /locus_tag="HIV1gp6"
                     /note="REV protein (anti-repression trans-activator
                     protein); Region: REV; pfam00424"
                     /db_xref="CDD:366091"
     misc_feature    join(5516..5591,7925..8121)
                     /gene="rev"
                     /locus_tag="HIV1gp6"
                     /note="REV protein (anti-repression trans-activator
                     protein); Region: REV; pfam00424"
                     /db_xref="CDD:366091"
     gene            5608..5856
                     /gene="vpu"
                     /locus_tag="HIV1gp7"
                     /db_xref="GeneID:155945"
     CDS             5608..5856
                     /gene="vpu"
                     /locus_tag="HIV1gp7"
                     /note="p16; viral protein U; viral accessory protein
                     important for virus replication in vivo; promotes
                     degradation of CD4 and down-regulates cell surface
                     expression of MHC class I proteins; helps mediate
                     efficient virus particle release from infected cells;
                     reported to induce apoptosis by suppressing the nuclear
                     factor kappaB-dependent expression of antiapoptotic
                     factors; may attenuate the level of Env precursor(gp160)
                     biosynthesis; Vpu and gp160 are translated from different
                     reading frames of the same bicistronic mRNA"
                     /codon_start=1
                     /product="Vpu"
                     /protein_id="NP_057855.1"
                     /db_xref="GeneID:155945"
                     /translation="MQPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLID
                     RLIERAEDSGNESEGEISALVEMGVEMGHHAPWDVDDL"
     misc_feature    <5674..5844
                     /gene="vpu"
                     /locus_tag="HIV1gp7"
                     /note="Vpu protein; Region: Vpu; pfam00558"
                     /db_xref="CDD:109608"
     misc_feature    <5674..5844
                     /gene="vpu"
                     /locus_tag="HIV1gp7"
                     /note="Vpu protein; Region: Vpu; pfam00558"
                     /db_xref="CDD:109608"
     gene            5771..8341
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /db_xref="GeneID:155971"
     CDS             5771..8341
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="gp160; envelope glycoprotein; envelope polyprotein;
                     cleaved by cellular proteases into mature proteins gp120
                     and gp41"
                     /codon_start=1
                     /product="Envelope surface glycoprotein gp160, precursor"
                     /protein_id="NP_057856.1"
                     /db_xref="GeneID:155971"
                     /translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPV
                     WKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVE
                     QMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFN
                     ISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYC
                     APAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVN
                     FTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNIS
                     RAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
                     STWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNIT
                     GLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQR
                     EKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLL
                     QLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWN
                     HTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYI
                     KLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGER
                     DRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWN
                     LLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL
                     "
     sig_peptide     5771..5854
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /product="hypothetical protein"
                     /protein_id="NP_579893.2"
     mat_peptide     5855..7303
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /product="Envelope surface glycoprotein gp120"
                     /experiment="DESCRIPTION:[PMID:24179160]"
                     /note="mediates binding of HIV-1 to CD4 and cellular
                     co-receptors; cooperates with gp41 to mediate fusion of
                     viral membrane with cellular membrane during virus entry
                     into cells; Envelope surface unit; SU"
                     /protein_id="NP_579894.2"
     misc_feature    5870..7303
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="Envelope glycoprotein GP120; Region: GP120;
                     pfam00516"
                     /db_xref="CDD:278917"
     misc_feature    5870..7303
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="Envelope glycoprotein GP120; Region: GP120;
                     pfam00516"
                     /db_xref="CDD:278917"
     mat_peptide     7304..8338
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /product="Envelope transmembrane domain"
                     /note="cooperates with gp120 to mediate fusion of viral
                     membrane with cellular membrane during virus entry into
                     cells; Envelope transmembrane glycoprotein gp41; TM"
                     /protein_id="NP_579895.1"
     misc_feature    7358..7948
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="Retroviral envelope protein; Region: GP41;
                     pfam00517"
                     /db_xref="CDD:395415"
     misc_feature    7358..7948
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="Retroviral envelope protein; Region: GP41;
                     pfam00517"
                     /db_xref="CDD:395415"
     misc_feature    order(7385..7444,7451..7549)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="HR1; other site"
                     /db_xref="CDD:197369"
     misc_feature    order(7385..7444,7451..7549)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="HR1; other site"
                     /db_xref="CDD:197369"
     misc_feature    order(7391..7393,7397..7405,7409..7426,7430..7444,
                     7451..7468,7472..7489,7493..7501,7505..7510,7514..7519,
                     7526..7531,7535..7543,7547..7576,7586..7588,7592..7594,
                     7598..7609,7637..7642,7649..7654,7661..7663,7670..7675,
                     7682..7687,7691..7696,7703..7708,7712..7717,7724..7729,
                     7745..7750,7757..7759)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:197369"
     misc_feature    order(7391..7393,7397..7405,7409..7426,7430..7444,
                     7451..7468,7472..7489,7493..7501,7505..7510,7514..7519,
                     7526..7531,7535..7543,7547..7576,7586..7588,7592..7594,
                     7598..7609,7637..7642,7649..7654,7661..7663,7670..7675,
                     7682..7687,7691..7696,7703..7708,7712..7717,7724..7729,
                     7745..7750,7757..7759)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:197369"
     misc_feature    order(7637..7696,7700..7735,7739..7765)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="HR2; other site"
                     /db_xref="CDD:197369"
     misc_feature    order(7637..7696,7700..7735,7739..7765)
                     /gene="env"
                     /locus_tag="HIV1gp8"
                     /note="HR2; other site"
                     /db_xref="CDD:197369"
     gene            complement(6919..7488)
                     /gene="asp"
                     /locus_tag="HIV1gp10"
                     /db_xref="GeneID:19424028"
     CDS             complement(6919..7488)
                     /gene="asp"
                     /locus_tag="HIV1gp10"
                     /note="minus-strand-encoded antisense protein of unknown
                     function; region is highly conserved and likely analogous
                     to the HTLV-1 encoded, HBZ, a nuclear basic region leucine
                     zipper (b-ZIP) protein"
                     /codon_start=1
                     /product="Asp"
                     /protein_id="YP_009028572.1"
                     /db_xref="GeneID:19424028"
                     /translation="MPQTVSCNRCCCASIALSKLFCCCTIPDNNCLACTVSVIEAAPI
                     VLPAAPKNPRNKAPIPTALFSLCTTLLFALVGATPNGSIFTTLYLYNSLLQLSLISPP
                     PGLKISDSLLLLPPSLVNSSPVIFDEHLICPLMGGAYIAFPTFCHMFIICFILHGRVI
                     VSLPSVLFDPSVLQVLLNQVLLNSCVELQ"
     gene            8343..8963
                     /gene="nef"
                     /locus_tag="HIV1gp9"
                     /db_xref="GeneID:156110"
     CDS             8343..8963
                     /gene="nef"
                     /locus_tag="HIV1gp9"
                     /note="p27; negative factor; viral accessory protein;
                     important for virus replication in vivo; determinant of
                     HIV-1 pathogenesis; down-regulates cell surface CD4 and
                     MHC class I molecules; enhances virus infectivity through;
                     interactions with multiple cellular signaling proteins;
                     This particular nucleotide sequence has a premature stop
                     codon in place of a well-conserved tryptophan codon at
                     position 8712-8714 that truncates the HIV1 Nef protein
                     sequence to a 123 amino acids-long N-terminal portion (not
                     shown)"
                     /codon_start=1
                     /transl_except=(pos:8712..8714,aa:Trp)
                     /product="Nef"
                     /protein_id="NP_057857.2"
                     /db_xref="GeneID:156110"
                     /translation="MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAIT
                     SSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIH
                     SQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKIEEANKGE
                     NTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC"
     misc_feature    8346..8957
                     /gene="nef"
                     /locus_tag="HIV1gp9"
                     /note="Negative factor, (F-Protein) or Nef; Region:
                     F-protein; pfam00469"
                     /db_xref="CDD:425700"
     misc_feature    8346..8957
                     /gene="nef"
                     /locus_tag="HIV1gp9"
                     /note="Negative factor, (F-Protein) or Nef; Region:
                     F-protein; pfam00469"
                     /db_xref="CDD:425700"
     3'UTR           8631..9085
     misc_feature    9086..9181
                     /note="repeat; positions of RNA transcription
                     initialization and polyadenylation; Region: R"
     regulatory      9158..9163
                     /regulatory_class="polyA_signal_sequence"
                     /note="both 5' and 3' poly A signals are transcribed into
                     RNA, but the 5' one is suppressed"
ORIGIN      
        1 ggtctctctg gttagaccag atctgagcct gggagctctc tggctaacta gggaacccac
       61 tgcttaagcc tcaataaagc ttgccttgag tgcttcaagt agtgtgtgcc cgtctgttgt
      121 gtgactctgg taactagaga tccctcagac ccttttagtc agtgtggaaa atctctagca
      181 gtggcgcccg aacagggacc tgaaagcgaa agggaaacca gaggagctct ctcgacgcag
      241 gactcggctt gctgaagcgc gcacggcaag aggcgagggg cggcgactgg tgagtacgcc
      301 aaaaattttg actagcggag gctagaagga gagagatggg tgcgagagcg tcagtattaa
      361 gcgggggaga attagatcga tgggaaaaaa ttcggttaag gccaggggga aagaaaaaat
      421 ataaattaaa acatatagta tgggcaagca gggagctaga acgattcgca gttaatcctg
      481 gcctgttaga aacatcagaa ggctgtagac aaatactggg acagctacaa ccatcccttc
      541 agacaggatc agaagaactt agatcattat ataatacagt agcaaccctc tattgtgtgc
      601 atcaaaggat agagataaaa gacaccaagg aagctttaga caagatagag gaagagcaaa
      661 acaaaagtaa gaaaaaagca cagcaagcag cagctgacac aggacacagc aatcaggtca
      721 gccaaaatta ccctatagtg cagaacatcc aggggcaaat ggtacatcag gccatatcac
      781 ctagaacttt aaatgcatgg gtaaaagtag tagaagagaa ggctttcagc ccagaagtga
      841 tacccatgtt ttcagcatta tcagaaggag ccaccccaca agatttaaac accatgctaa
      901 acacagtggg gggacatcaa gcagccatgc aaatgttaaa agagaccatc aatgaggaag
      961 ctgcagaatg ggatagagtg catccagtgc atgcagggcc tattgcacca ggccagatga
     1021 gagaaccaag gggaagtgac atagcaggaa ctactagtac ccttcaggaa caaataggat
     1081 ggatgacaaa taatccacct atcccagtag gagaaattta taaaagatgg ataatcctgg
     1141 gattaaataa aatagtaaga atgtatagcc ctaccagcat tctggacata agacaaggac
     1201 caaaggaacc ctttagagac tatgtagacc ggttctataa aactctaaga gccgagcaag
     1261 cttcacagga ggtaaaaaat tggatgacag aaaccttgtt ggtccaaaat gcgaacccag
     1321 attgtaagac tattttaaaa gcattgggac cagcggctac actagaagaa atgatgacag
     1381 catgtcaggg agtaggagga cccggccata aggcaagagt tttggctgaa gcaatgagcc
     1441 aagtaacaaa ttcagctacc ataatgatgc agagaggcaa ttttaggaac caaagaaaga
     1501 ttgttaagtg tttcaattgt ggcaaagaag ggcacacagc cagaaattgc agggccccta
     1561 ggaaaaaggg ctgttggaaa tgtggaaagg aaggacacca aatgaaagat tgtactgaga
     1621 gacaggctaa ttttttaggg aagatctggc cttcctacaa gggaaggcca gggaattttc
     1681 ttcagagcag accagagcca acagccccac cagaagagag cttcaggtct ggggtagaga
     1741 caacaactcc ccctcagaag caggagccga tagacaagga actgtatcct ttaacttccc
     1801 tcaggtcact ctttggcaac gacccctcgt cacaataaag ataggggggc aactaaagga
     1861 agctctatta gatacaggag cagatgatac agtattagaa gaaatgagtt tgccaggaag
     1921 atggaaacca aaaatgatag ggggaattgg aggttttatc aaagtaagac agtatgatca
     1981 gatactcata gaaatctgtg gacataaagc tataggtaca gtattagtag gacctacacc
     2041 tgtcaacata attggaagaa atctgttgac tcagattggt tgcactttaa attttcccat
     2101 tagccctatt gagactgtac cagtaaaatt aaagccagga atggatggcc caaaagttaa
     2161 acaatggcca ttgacagaag aaaaaataaa agcattagta gaaatttgta cagagatgga
     2221 aaaggaaggg aaaatttcaa aaattgggcc tgaaaatcca tacaatactc cagtatttgc
     2281 cataaagaaa aaagacagta ctaaatggag aaaattagta gatttcagag aacttaataa
     2341 gagaactcaa gacttctggg aagttcaatt aggaatacca catcccgcag ggttaaaaaa
     2401 gaaaaaatca gtaacagtac tggatgtggg tgatgcatat ttttcagttc ccttagatga
     2461 agacttcagg aagtatactg catttaccat acctagtata aacaatgaga caccagggat
     2521 tagatatcag tacaatgtgc ttccacaggg atggaaagga tcaccagcaa tattccaaag
     2581 tagcatgaca aaaatcttag agccttttag aaaacaaaat ccagacatag ttatctatca
     2641 atacatggat gatttgtatg taggatctga cttagaaata gggcagcata gaacaaaaat
     2701 agaggagctg agacaacatc tgttgaggtg gggacttacc acaccagaca aaaaacatca
     2761 gaaagaacct ccattccttt ggatgggtta tgaactccat cctgataaat ggacagtaca
     2821 gcctatagtg ctgccagaaa aagacagctg gactgtcaat gacatacaga agttagtggg
     2881 gaaattgaat tgggcaagtc agatttaccc agggattaaa gtaaggcaat tatgtaaact
     2941 ccttagagga accaaagcac taacagaagt aataccacta acagaagaag cagagctaga
     3001 actggcagaa aacagagaga ttctaaaaga accagtacat ggagtgtatt atgacccatc
     3061 aaaagactta atagcagaaa tacagaagca ggggcaaggc caatggacat atcaaattta
     3121 tcaagagcca tttaaaaatc tgaaaacagg aaaatatgca agaatgaggg gtgcccacac
     3181 taatgatgta aaacaattaa cagaggcagt gcaaaaaata accacagaaa gcatagtaat
     3241 atggggaaag actcctaaat ttaaactgcc catacaaaag gaaacatggg aaacatggtg
     3301 gacagagtat tggcaagcca cctggattcc tgagtgggag tttgttaata cccctccctt
     3361 agtgaaatta tggtaccagt tagagaaaga acccatagta ggagcagaaa ccttctatgt
     3421 agatggggca gctaacaggg agactaaatt aggaaaagca ggatatgtta ctaatagagg
     3481 aagacaaaaa gttgtcaccc taactgacac aacaaatcag aagactgagt tacaagcaat
     3541 ttatctagct ttgcaggatt cgggattaga agtaaacata gtaacagact cacaatatgc
     3601 attaggaatc attcaagcac aaccagatca aagtgaatca gagttagtca atcaaataat
     3661 agagcagtta ataaaaaagg aaaaggtcta tctggcatgg gtaccagcac acaaaggaat
     3721 tggaggaaat gaacaagtag ataaattagt cagtgctgga atcaggaaag tactattttt
     3781 agatggaata gataaggccc aagatgaaca tgagaaatat cacagtaatt ggagagcaat
     3841 ggctagtgat tttaacctgc cacctgtagt agcaaaagaa atagtagcca gctgtgataa
     3901 atgtcagcta aaaggagaag ccatgcatgg acaagtagac tgtagtccag gaatatggca
     3961 actagattgt acacatttag aaggaaaagt tatcctggta gcagttcatg tagccagtgg
     4021 atatatagaa gcagaagtta ttccagcaga aacagggcag gaaacagcat attttctttt
     4081 aaaattagca ggaagatggc cagtaaaaac aatacatact gacaatggca gcaatttcac
     4141 cggtgctacg gttagggccg cctgttggtg ggcgggaatc aagcaggaat ttggaattcc
     4201 ctacaatccc caaagtcaag gagtagtaga atctatgaat aaagaattaa agaaaattat
     4261 aggacaggta agagatcagg ctgaacatct taagacagca gtacaaatgg cagtattcat
     4321 ccacaatttt aaaagaaaag gggggattgg ggggtacagt gcaggggaaa gaatagtaga
     4381 cataatagca acagacatac aaactaaaga attacaaaaa caaattacaa aaattcaaaa
     4441 ttttcgggtt tattacaggg acagcagaaa tccactttgg aaaggaccag caaagctcct
     4501 ctggaaaggt gaaggggcag tagtaataca agataatagt gacataaaag tagtgccaag
     4561 aagaaaagca aagatcatta gggattatgg aaaacagatg gcaggtgatg attgtgtggc
     4621 aagtagacag gatgaggatt agaacatgga aaagtttagt aaaacaccat atgtatgttt
     4681 cagggaaagc taggggatgg ttttatagac atcactatga aagccctcat ccaagaataa
     4741 gttcagaagt acacatccca ctaggggatg ctagattggt aataacaaca tattggggtc
     4801 tgcatacagg agaaagagac tggcatttgg gtcagggagt ctccatagaa tggaggaaaa
     4861 agagatatag cacacaagta gaccctgaac tagcagacca actaattcat ctgtattact
     4921 ttgactgttt ttcagactct gctataagaa aggccttatt aggacacata gttagcccta
     4981 ggtgtgaata tcaagcagga cataacaagg taggatctct acaatacttg gcactagcag
     5041 cattaataac accaaaaaag ataaagccac ctttgcctag tgttacgaaa ctgacagagg
     5101 atagatggaa caagccccag aagaccaagg gccacagagg gagccacaca atgaatggac
     5161 actagagctt ttagaggagc ttaagaatga agctgttaga cattttccta ggatttggct
     5221 ccatggctta gggcaacata tctatgaaac ttatggggat acttgggcag gagtggaagc
     5281 cataataaga attctgcaac aactgctgtt tatccatttt cagaattggg tgtcgacata
     5341 gcagaatagg cgttactcga cagaggagag caagaaatgg agccagtaga tcctagacta
     5401 gagccctgga agcatccagg aagtcagcct aaaactgctt gtaccaattg ctattgtaaa
     5461 aagtgttgct ttcattgcca agtttgtttc ataacaaaag ccttaggcat ctcctatggc
     5521 aggaagaagc ggagacagcg acgaagagct catcagaaca gtcagactca tcaagcttct
     5581 ctatcaaagc agtaagtagt acatgtaatg caacctatac caatagtagc aatagtagca
     5641 ttagtagtag caataataat agcaatagtt gtgtggtcca tagtaatcat agaatatagg
     5701 aaaatattaa gacaaagaaa aatagacagg ttaattgata gactaataga aagagcagaa
     5761 gacagtggca atgagagtga aggagaaata tcagcacttg tggagatggg ggtggagatg
     5821 gggcaccatg ctccttggga tgttgatgat ctgtagtgct acagaaaaat tgtgggtcac
     5881 agtctattat ggggtacctg tgtggaagga agcaaccacc actctatttt gtgcatcaga
     5941 tgctaaagca tatgatacag aggtacataa tgtttgggcc acacatgcct gtgtacccac
     6001 agaccccaac ccacaagaag tagtattggt aaatgtgaca gaaaatttta acatgtggaa
     6061 aaatgacatg gtagaacaga tgcatgagga tataatcagt ttatgggatc aaagcctaaa
     6121 gccatgtgta aaattaaccc cactctgtgt tagtttaaag tgcactgatt tgaagaatga
     6181 tactaatacc aatagtagta gcgggagaat gataatggag aaaggagaga taaaaaactg
     6241 ctctttcaat atcagcacaa gcataagagg taaggtgcag aaagaatatg cattttttta
     6301 taaacttgat ataataccaa tagataatga tactaccagc tataagttga caagttgtaa
     6361 cacctcagtc attacacagg cctgtccaaa ggtatccttt gagccaattc ccatacatta
     6421 ttgtgccccg gctggttttg cgattctaaa atgtaataat aagacgttca atggaacagg
     6481 accatgtaca aatgtcagca cagtacaatg tacacatgga attaggccag tagtatcaac
     6541 tcaactgctg ttaaatggca gtctagcaga agaagaggta gtaattagat ctgtcaattt
     6601 cacggacaat gctaaaacca taatagtaca gctgaacaca tctgtagaaa ttaattgtac
     6661 aagacccaac aacaatacaa gaaaaagaat ccgtatccag agaggaccag ggagagcatt
     6721 tgttacaata ggaaaaatag gaaatatgag acaagcacat tgtaacatta gtagagcaaa
     6781 atggaataac actttaaaac agatagctag caaattaaga gaacaatttg gaaataataa
     6841 aacaataatc tttaagcaat cctcaggagg ggacccagaa attgtaacgc acagttttaa
     6901 ttgtggaggg gaatttttct actgtaattc aacacaactg tttaatagta cttggtttaa
     6961 tagtacttgg agtactgaag ggtcaaataa cactgaagga agtgacacaa tcaccctccc
     7021 atgcagaata aaacaaatta taaacatgtg gcagaaagta ggaaaagcaa tgtatgcccc
     7081 tcccatcagt ggacaaatta gatgttcatc aaatattaca gggctgctat taacaagaga
     7141 tggtggtaat agcaacaatg agtccgagat cttcagacct ggaggaggag atatgaggga
     7201 caattggaga agtgaattat ataaatataa agtagtaaaa attgaaccat taggagtagc
     7261 acccaccaag gcaaagagaa gagtggtgca gagagaaaaa agagcagtgg gaataggagc
     7321 tttgttcctt gggttcttgg gagcagcagg aagcactatg ggcgcagcct caatgacgct
     7381 gacggtacag gccagacaat tattgtctgg tatagtgcag cagcagaaca atttgctgag
     7441 ggctattgag gcgcaacagc atctgttgca actcacagtc tggggcatca agcagctcca
     7501 ggcaagaatc ctggctgtgg aaagatacct aaaggatcaa cagctcctgg ggatttgggg
     7561 ttgctctgga aaactcattt gcaccactgc tgtgccttgg aatgctagtt ggagtaataa
     7621 atctctggaa cagatttgga atcacacgac ctggatggag tgggacagag aaattaacaa
     7681 ttacacaagc ttaatacact ccttaattga agaatcgcaa aaccagcaag aaaagaatga
     7741 acaagaatta ttggaattag ataaatgggc aagtttgtgg aattggttta acataacaaa
     7801 ttggctgtgg tatataaaat tattcataat gatagtagga ggcttggtag gtttaagaat
     7861 agtttttgct gtactttcta tagtgaatag agttaggcag ggatattcac cattatcgtt
     7921 tcagacccac ctcccaaccc cgaggggacc cgacaggccc gaaggaatag aagaagaagg
     7981 tggagagaga gacagagaca gatccattcg attagtgaac ggatccttgg cacttatctg
     8041 ggacgatctg cggagcctgt gcctcttcag ctaccaccgc ttgagagact tactcttgat
     8101 tgtaacgagg attgtggaac ttctgggacg cagggggtgg gaagccctca aatattggtg
     8161 gaatctccta cagtattgga gtcaggaact aaagaatagt gctgttagct tgctcaatgc
     8221 cacagccata gcagtagctg aggggacaga tagggttata gaagtagtac aaggagcttg
     8281 tagagctatt cgccacatac ctagaagaat aagacagggc ttggaaagga ttttgctata
     8341 agatgggtgg caagtggtca aaaagtagtg tgattggatg gcctactgta agggaaagaa
     8401 tgagacgagc tgagccagca gcagataggg tgggagcagc atctcgagac ctggaaaaac
     8461 atggagcaat cacaagtagc aatacagcag ctaccaatgc tgcttgtgcc tggctagaag
     8521 cacaagagga ggaggaggtg ggttttccag tcacacctca ggtaccttta agaccaatga
     8581 cttacaaggc agctgtagat cttagccact ttttaaaaga aaagggggga ctggaagggc
     8641 taattcactc ccaaagaaga caagatatcc ttgatctgtg gatctaccac acacaaggct
     8701 acttccctga ttagcagaac tacacaccag ggccaggggt cagatatcca ctgacctttg
     8761 gatggtgcta caagctagta ccagttgagc cagataagat agaagaggcc aataaaggag
     8821 agaacaccag cttgttacac cctgtgagcc tgcatgggat ggatgacccg gagagagaag
     8881 tgttagagtg gaggtttgac agccgcctag catttcatca cgtggcccga gagctgcatc
     8941 cggagtactt caagaactgc tgacatcgag cttgctacaa gggactttcc gctggggact
     9001 ttccagggag gcgtggcctg ggcgggactg gggagtggcg agccctcaga tcctgcatat
     9061 aagcagctgc tttttgcctg tactgggtct ctctggttag accagatctg agcctgggag
     9121 ctctctggct aactagggaa cccactgctt aagcctcaat aaagcttgcc ttgagtgctt
     9181 c
//
DBGET integrated database retrieval system