GenomeNet

Database: RefSeq
Entry: NC_001806
LinkDB: NC_001806
Original site: NC_001806 
LOCUS       NC_001806             152222 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Human herpesvirus 1 strain 17, complete genome.
ACCESSION   NC_001806
VERSION     NC_001806.2
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Human alphaherpesvirus 1 (Herpes simplex virus 1)
  ORGANISM  Human alphaherpesvirus 1
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae;
            Simplexvirus.
REFERENCE   1  (bases 1 to 152222)
  AUTHORS   Davison,A.J.
  TITLE     Evolution of sexually transmitted and sexually transmissible human
            herpesviruses
  JOURNAL   Ann. N. Y. Acad. Sci. 1230, E37-E49 (2011)
   PUBMED   22417106
REFERENCE   2  (bases 1 to 152222)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAY-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 152222)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2011) MRC - University of Glasgow Centre for
            Virus Research, 8 Church Street, Glasgow G11 5JR, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JN555585.
            On May 12, 2015 this sequence version replaced NC_001806.1.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes) and non-core genes presumably
            inherited from the ancestor of alphaherpesviruses (alpha genes) are
            indicated. Initiation codons are assigned with as much confidence
            as is possible for each protein-coding region. A standard protein
            nomenclature has been applied so that orthologs have the same name
            in all herpesviruses.
            
            ##Assembly-Data-START##
            Assembly Method       :: Maq v. 0.7.1
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..152222
                     /organism="Human alphaherpesvirus 1"
                     /mol_type="genomic DNA"
                     /strain="17"
                     /db_xref="taxon:10298"
                     /country="United Kingdom: Regional Virus Laboratory,
                     Ruchill Hospital, Glasgow"
                     /collected_by="C.A.C. Ross"
                     /acronym="HHV-1"
                     /acronym="HSV-1"
                     /note="collected prior to 1972;
                     collected prior to 1972; original sequence (INSD accession
                     X14112) determined by Sanger sequencing of plasmids
                     amended by Illumina sequencing of both viral DNA and polyA
                     RNA harvested at 8 h after infection"
     repeat_region   1..9213
                     /note="TRL; inverted repeat flanking UL"
                     /rpt_type=inverted
     gene            complement(<1..7569)
                     /gene="LAT"
                     /locus_tag="HHV1gp00s01"
                     /db_xref="GeneID:24271498"
     ncRNA           complement(join(<1..4953,6910..7569))
                     /ncRNA_class="other"
                     /gene="LAT"
                     /locus_tag="HHV1gp00s01"
                     /product="LAT"
                     /db_xref="GeneID:24271498"
     repeat_region   1..399
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     repeat_region   98..320
                     /note="'a' sequence reiteration set"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=98..109
     gene            513..1540
                     /gene="RL1"
                     /locus_tag="HHV1gp00p77"
                     /db_xref="GeneID:2703395"
     CDS             513..1259
                     /gene="RL1"
                     /locus_tag="HHV1gp00p77"
                     /note="virion protein; inhibits stress-induced
                     translational arrest; related to eIF2 phosphatase
                     regulatory subunit GADD34; binds protein phosphatase 1 to
                     form a holoenzyme capable of dephosphorylating eIF2-alpha;
                     involved in translational regulation"
                     /codon_start=1
                     /product="neurovirulence protein ICP34.5"
                     /protein_id="YP_009137073.1"
                     /db_xref="GeneID:2703395"
                     /translation="MARRRRHRGPRRPRPPGPTGAVPTAQSQVTSTPNSEPAVRSAPA
                     AAPPPPPAGGPPPSCSLLLRQWLHVPESASDDDDDDDWPDSPPPEPAPEARPTAAAPR
                     PRPPPPGVGPGGGADPSHPPSRPFRLPPRLALRLRVTAEHLARLRLRRAGGEGAPEPP
                     ATPATPATPATPATPARVRFSPHVRVRHLVVWASAARLARRGSWARERADRARFRRRV
                     AEAEAVIGPCLGPEARARALARGAGPANSV"
     repeat_region   988..1040
                     /gene="RL1"
                     /locus_tag="HHV1gp00p77"
                     /note="RL reiteration set 6"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=988..996
     regulatory      1535..1540
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL1"
                     /locus_tag="HHV1gp00p77"
     gene            2087..5699
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="immediate early gene"
                     /db_xref="GeneID:2703389"
     regulatory      2087..2092
                     /regulatory_class="TATA_box"
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
     mRNA            join(2114..2318,3084..3750,3887..5699)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /product="ubiquitin E3 ligase ICP0"
                     /db_xref="GeneID:2703389"
     CDS             join(2262..2318,3084..3750,3887..5490)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="contains a RING finger; disrupts ND10;
                     proteasome-dependent degradation of several cellular
                     proteins; involved in gene regulation; involved in
                     cellular protein degradation; involved in latency"
                     /codon_start=1
                     /product="ubiquitin E3 ligase ICP0"
                     /protein_id="YP_009137074.1"
                     /db_xref="GeneID:2703389"
                     /translation="MEPRPGASTRRPEGRPQREPAPDVWVFPCDRDLPDSSDSEAETE
                     VGGRGDADHHDDDSASEADSTDTELFETGLLGPQGVDGGAVSGGSPPREEDPGSCGGA
                     PPREDGGSDEGDVCAVCTDEIAPHLRCDTFPCMHRFCIPCMKTWMQLRNTCPLCNAKL
                     VYLIVGVTPSGSFSTIPIVNDPQTRMEAEEAVRAGTAVDFIWTGNQRFAPRYLTLGGH
                     TVRALSPTHPEPTTDEDDDDLDDADYVPPAPRRTPRAPPRRGAAAPPVTGGASHAAPQ
                     PAAARTAPPSAPIGPHGSSNTNTTTNSSGGGGSRQSRAAAPRGASGPSGGVGVGVGVV
                     EAEAGRPRGRTGPLVNRPAPLANNRDPIVISDSPPASPHRPPAAPMPGSAPRPGPPAS
                     AAASGPARPRAAVAPCVRAPPPGPGPRAPAPGAEPAARPADARRVPQSHSSLAQAANQ
                     EQSLCRARATVARGSGGPGVEGGHGPSRGAAPSGAAPLPSAASVEQEAAVRPRKRRGS
                     GQENPSPQSTRPPLAPAGAKRAATHPPSDSGPGGRGQGGPGTPLTSSAASASSSSASS
                     SSAPTPAGAASSAAGAASSSASASSGGAVGALGGRQEETSLGPRAASGPRGPRKCARK
                     TRHAETSGAVPAGGLTRYLPISGVSSVVALSPYVNKTITGDCLPILDMETGNIGAYVV
                     LVDQTGNMATRLRAAVPGWSRRTLLPETAGNHVMPPEYPTAPASEWNSLWMTPVGNML
                     FDQGTLVGALDFRSLRSRHPWSGEQGASTRDEGKQ"
     misc_feature    3372..3494
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="Zinc finger, C3HC4 type (RING finger); Region:
                     zf-C3HC4; pfam00097"
                     /db_xref="CDD:333836"
     misc_feature    order(3372..3374,3381..3383,3426..3428,3432..3434,
                     3441..3443,3450..3452,3483..3485,3492..3494)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:319361"
     misc_feature    <3943..4515
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK12323"
                     /db_xref="CDD:237057"
     repeat_region   2466..2624
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
                     /note="RL reiteration set 5"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=2466..2519
     regulatory      5677..5682
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL2"
                     /locus_tag="HHV1gp00p76"
     repeat_region   5732..5878
                     /note="RL reiteration set 4"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=5732..5747
     regulatory      complement(7592..7597)
                     /regulatory_class="TATA_box"
     repeat_region   8554..8585
                     /note="RL reiteration set 3"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=8554..8558
     repeat_region   8806..8826
                     /note="RL reiteration set 2"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=8806..8808
     repeat_region   9033..9213
                     /note="RL reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=9033..9049
     misc_feature    9214..117160
                     /note="UL; long unique region"
     gene            9338..10949
                     /gene="UL1"
                     /locus_tag="HHV1gp00p75"
                     /note="core gene"
                     /db_xref="GeneID:2703393"
     CDS             9338..10012
                     /gene="UL1"
                     /locus_tag="HHV1gp00p75"
                     /note="contains a signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="YP_009137075.1"
                     /db_xref="GeneID:2703393"
                     /translation="MGILGWVGLIAVGVLCVRGGLPSTEYVIRSRVAREVGDILKVPC
                     VPLPSDDLDWRYETPSAINYALIDGIFLRYHCPGLDTVLWDRHAQKAYWVNPFLFVAG
                     FLEDLSYPAFPANTQETETRLALYKEIRQALDSRKQAASHTPVKAGCVNFDYSRTRRC
                     VGRQDLGPTNGTSGRTPVLPPDDEAGLQPKPLTTPPPIIATSDPTPRRDAATKSRRRR
                     PHSRRL"
     misc_feature    9338..9976
                     /gene="UL1"
                     /locus_tag="HHV1gp00p75"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03301"
                     /db_xref="CDD:223037"
     gene            9885..10949
                     /gene="UL2"
                     /locus_tag="HHV1gp00p74"
                     /note="core gene"
                     /db_xref="GeneID:2703370"
     CDS             9885..10889
                     /gene="UL2"
                     /locus_tag="HHV1gp00p74"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_009137076.1"
                     /db_xref="GeneID:2703370"
                     /translation="MKRACSRSPSPRRRPSSPRRTPPRDGTPPQKADADDPTPGASND
                     ASTETRPGSGGEPAACRSSGPAGAPRRPRGCPAGVTFSSSAPPDPPMDLTNGGVSPAA
                     TSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEEVLPPREDVFS
                     WTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAVKNCYPEAR
                     MSGHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFM
                     LWGTHAQNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANRYLETRSISPIDWSV
                     "
     misc_feature    9963..10886
                     /gene="UL2"
                     /locus_tag="HHV1gp00p74"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03201"
                     /db_xref="CDD:165468"
     regulatory      10944..10949
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL1, UL2"
     gene            10991..11721
                     /gene="UL3"
                     /locus_tag="HHV1gp00p73"
                     /note="alpha gene"
                     /db_xref="GeneID:2703461"
     CDS             10991..11665
                     /gene="UL3"
                     /locus_tag="HHV1gp00p73"
                     /note="colocalizes with regulatory protein ICP22 and
                     nuclear protein UL4 in small, dense nuclear bodies"
                     /codon_start=1
                     /product="nuclear protein UL3"
                     /protein_id="YP_009137077.1"
                     /db_xref="GeneID:2703461"
                     /translation="MSGVGGEGVPSALAILASWGWTFDTPNHESGISPDTTPADSIRG
                     AAVASPDQPLHGGPEREATAPSFSPTRADDGPPCTDGPYVTFDTLFMVSSIDELGRRQ
                     LTDTIRKDLRLSLAKFSIACTKTSSFSGNAPRHHRRGAFQRGTRAPRSNKSLQMFVLC
                     KRAHAARVREQLRVVIQSRKPRKYYTRSSDGRLCPAVPVFVHEFVSSEPMRLHRDNVM
                     LASGAE"
     misc_feature    11243..11647
                     /gene="UL3"
                     /locus_tag="HHV1gp00p73"
                     /note="Herpesvirus UL3 protein; Region: Herpes_UL3;
                     pfam03369"
                     /db_xref="CDD:281377"
     regulatory      11716..11721
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL3"
                     /locus_tag="HHV1gp00p73"
     gene            complement(11754..15132)
                     /gene="UL5"
                     /locus_tag="HHV1gp00p72"
                     /note="core gene"
                     /db_xref="GeneID:2703420"
     gene            complement(11754..12423)
                     /gene="UL4"
                     /locus_tag="HHV1gp00p71"
                     /note="alpha gene"
                     /db_xref="GeneID:2703362"
     regulatory      complement(11754..11759)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL4, UL5"
     CDS             complement(11824..12423)
                     /gene="UL4"
                     /locus_tag="HHV1gp00p71"
                     /note="colocalizes with regulatory protein ICP22 and
                     nuclear protein UL3 in small, dense nuclear bodies"
                     /codon_start=1
                     /product="nuclear protein UL4"
                     /protein_id="YP_009137078.1"
                     /db_xref="GeneID:2703362"
                     /translation="MSNPQTTIAYSLCHARASLTSALPDAAQVVHVFEYGTRAIMVRG
                     RERQDRLPRGGVVIQHTPIGLLVIIDCRAEFCAYRFIGRDSNQKLERGWDAHMYAYPF
                     DSWVSSSRGESARSATAGILTVVWTADTIYITATIYGSPPEETPGAAHGVGAAPPPPT
                     TACPGTAEFLQPTADLLVEVLREIQLSPALEYADKLLGS"
     misc_feature    complement(11863..12411)
                     /gene="UL4"
                     /locus_tag="HHV1gp00p71"
                     /note="Herpesvirus UL4 family; Region: Herpes_UL4;
                     pfam03277"
                     /db_xref="CDD:281294"
     CDS             complement(12484..15132)
                     /gene="UL5"
                     /locus_tag="HHV1gp00p72"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="YP_009137079.1"
                     /db_xref="GeneID:2703420"
                     /translation="MAAAGGERQLDGQKPGPPHLQQPGDRPAVPGRAEAFLNFTSMHG
                     VQPILKRIRELSQQQLDGAQVPHLQWFRDVAALESPAGLPLREFPFAVYLITGNAGSG
                     KSTCVQTINEVLDCVVTGATRIAAQNMYAKLSGAFLSRPINTIFHEFGFRGNHVQAQL
                     GQYPYTLTSNPASLEDLQRRDLTYYWEVILDLTKRALAASGGEELRNEFRALAALERT
                     LGLAEGALTRLAPATHGALPAFTRSNVIVIDEAGLLGRHLLTAVVYCWWMINALYHTP
                     QYAARLRPVLVCVGSPTQTASLESTFEHQKLRCSVRQSENVLTYLICNRTLREYARLS
                     YSWAIFINNKRCVEHEFGNLMKVLEYGLPITEEHMQFVDRFVVPENYITNPANLPGWT
                     RLFSSHKEVSAYMAKLHAYLKVTREGEFVVFTLPVLTFVSVKEFDEYRRLTHQPGLTI
                     EKWLTANASRITNYSQSQDQDAGHMRCEVHSKQQLVVARNDVTYVLNSQIAVTARLRK
                     LVFGFSGTFRAFEAVLRDDSFVKTQGETSVEFAYRFLSRLIFSGLISFYNFLQRPGLD
                     ATQRTLAYARMGELTAEILSLRPKSSGVPTQASVMADAGAPGERAFDFKQLGPRDGGP
                     DDFPDDDLDVIFAGLDEQQLDVFYCHYTPGEPETTAAVHTQFALLKRAFLGRFRILQE
                     LFGEAFEVAPFSTYVDNVIFRGCEMLTGSPRGGLMSVALQTDNYTLMGYTYARVFAFA
                     DELRRRHATANVAELLEEAPLPYVVLRDQHGFMSVVNTNISEFVESIDSTELAMAINA
                     DYGISSKLAMTITRSQGLSLDKVAICFTPGNLRLNSAYVAMSRTTSSEFLRMNLNPLR
                     ERHERDDVISEHILSALRDPNVVIVY"
     misc_feature    complement(12487..15072)
                     /gene="UL5"
                     /locus_tag="HHV1gp00p72"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     gene            15131..18041
                     /gene="UL6"
                     /locus_tag="HHV1gp00p70"
                     /note="core gene"
                     /db_xref="GeneID:2703429"
     CDS             15131..17161
                     /gene="UL6"
                     /locus_tag="HHV1gp00p70"
                     /note="dodecamer located at one capsid vertex in place of
                     a penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="YP_009137080.1"
                     /db_xref="GeneID:2703429"
                     /translation="MTAPRSRAPTTRARGDTEALCSPEDGWVKVHPTPGTMLFREILH
                     GQLGYTEGQGVYNVVRSSEATTRQLQAAIFHALLNATTYRDLEADWLGHVAARGLQPQ
                     RLVRRYRNAREADIAGVAERVFDTWRNTLRTTLLDFAHGLVACFAPGGPSGPSSFPKY
                     IDWLTCLGLVPILRKRQEGGVTQGLRAFLKQHPLTRQLATVAEAAERAGPGFFELALA
                     FDSTRVADYDRVYIYYNHRRGDWLVRDPISGQRGECLVLWPPLWTGDRLVFDSPVQRL
                     FPEIVACHSLREHAHVCRLRNTASVKVLLGRKSDSERGVAGAARVVNKVLGEDDETKA
                     GSAASRLVRLIINMKGMRHVGDINDTVRAYLDEAGGHLIDAPAVDGTLPGFGKGGNSR
                     GSAGQDQGGRAPQLRQAFRTAVVNNINGVLEGYINNLFGTIERLRETNAGLATQLQER
                     DRELRRATAGALERQQRAADLAAESVTGGCGSRPAGADLLRADYDIIDVSKSMDDDTY
                     VANSFQHPYIPSYAQDLERLSRLWEHELVRCFKILCHRNNQGQETSISYSSGAIAAFV
                     APYFESVLRAPRVGAPITGSDVILGEEELWDAVFKKTRLQTYLTDIAALFVADVQHAA
                     LPPPPSPVGADFRPGASPRGRSRSRSPGRTARGAPDQGGGIGHRDGRRDGRR"
     misc_feature    15239..16978
                     /gene="UL6"
                     /locus_tag="HHV1gp00p70"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:396361"
     gene            17136..18041
                     /gene="UL7"
                     /locus_tag="HHV1gp00p69"
                     /note="core gene"
                     /db_xref="GeneID:2703431"
     CDS             17136..18026
                     /gene="UL7"
                     /locus_tag="HHV1gp00p69"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="YP_009137081.1"
                     /db_xref="GeneID:2703431"
                     /translation="MAAATADDEGSAATILKQAIAGDRSLVEAAEAISQQTLLRLACE
                     VRQVGDRQPRFTATSIARVDVAPGCRLRFVLDGSPEDAYVTSEDYFKRCCGQSSYRGF
                     AVAVLTANEDHVHSLAVPPLVLLHRFSLFNPRDLLDFELACLLMYLENCPRSHATPST
                     FAKVLAWLGVAGRRTSPFERVRCLFLRSCHWVLNTLMFMVHVKPFDDEFVLPHWYMAR
                     YLLANNPPPVLSALFCATPTSSSFRLPGPPPRSDCVAYNPAGIMGSCWASEEVRAPLV
                     YWWLSETPKRQTSSLFYQFC"
     misc_feature    17136..18023
                     /gene="UL7"
                     /locus_tag="HHV1gp00p69"
                     /note="UL7 tegument protein; Provisional; Region:
                     PHA03361"
                     /db_xref="CDD:223055"
     regulatory      18036..18041
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL6, UL7"
     gene            complement(18211..23260)
                     /gene="UL9"
                     /locus_tag="HHV1gp00p68"
                     /note="core gene"
                     /db_xref="GeneID:2703434"
     gene            complement(18211..20477)
                     /gene="UL8"
                     /locus_tag="HHV1gp00p67"
                     /note="core gene"
                     /db_xref="GeneID:2703432"
     regulatory      complement(18211..18216)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL8, UL9"
     CDS             complement(18225..20477)
                     /gene="UL8"
                     /locus_tag="HHV1gp00p67"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="YP_009137082.1"
                     /db_xref="GeneID:2703432"
                     /translation="MDTADIVWVEESVSAITLYAVWLPPRAREYFHALVYFVCRNAAG
                     EGRARFAEVSVTATELRDFYGSADVSVQAVVAAARAATTPAASPLEPLENPTLWRALY
                     ACVLAALERQTGPVALFAPLRIGSDPRTGLVVKVERASWGPPAAPRAALLVAEANIDI
                     DPMALAARVAEHPDARLAWARLAAIRDTPQCASAASLTVNITTGTALFAREYQTLAFP
                     PIKKEGAFGDLVEVCEVGLRPRGHPQRVTARVLLPRDYDYFVSAGEKFSAPALVALFR
                     QWHTTVHAAPGALAPVFAFLGPEFEVRGGPVPYFAVLGFPGWPTFTVPATAESARDLV
                     RGAAAAYAALLGAWPAVGARVVLPPRAWPGVASAAAGCLLPAVREAVARWHPATKIIQ
                     LLDPPAAVGPVWTARFCFPGLRAQLLAALADLGGSGLADPHGRTGLARLDALVVAAPS
                     EPWAGAVLERLVPDTCNACPALRQLLGGVMAAVCLQIEETASSVKFAVCGGDGGAFWG
                     VFNVDPQDADAASGVIEDARRAIETAVGAVLRANGLRLRHPLCLALEGVYTHAVAWSQ
                     AGVWFWNSRDNTDHLGGFPLRGPAYTTAAGVVRDTLRRVLGLTTACVPEEDALTARGL
                     MEDACDRLILDAFNKRLDAEYWSVRVSPFEASDPLPPTAFRGGALLDAEHYWRRVVRV
                     CPGGGESVGVPVDLYPRPLVLPPVDCAHHLREILREIELVFTGVLAGVWGEGGKFVYP
                     FDDKMSFLFA"
     misc_feature    complement(18228..20477)
                     /gene="UL8"
                     /locus_tag="HHV1gp00p67"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03144"
                     /db_xref="CDD:223000"
     CDS             complement(20705..23260)
                     /gene="UL9"
                     /locus_tag="HHV1gp00p68"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA replication origin-binding helicase"
                     /protein_id="YP_009137083.1"
                     /db_xref="GeneID:2703434"
                     /translation="MPFVGGAESGDPLGAGRPIGDDECEQYTSSVSLARMLYGGDLAE
                     WVPRVHPKTTIERQQHGPVTFPNASAPTARCVTVVRAPMGSGKTTALIRWLREAIHSP
                     DTSVLVVSCRRSFTQTLATRFAESGLVDFVTYFSSTNYIMNDRPFHRLIVQVESLHRV
                     GPNLLNNYDVLVLDEVMSTLGQLYSPTMQQLGRVDALMLRLLRTCPRIIAMDATANAQ
                     LVDFLCGLRGEKNVHVVVGEYAMPGFSARRCLFLPRLGTELLQAALRPPGPPSGPSPD
                     ASPDARGATFFGELEARLGGGDNICIFSSTVSFAEIVARFCRQFTDRVLLLHSLTPLG
                     DVTTWGQYRVVIYTTVVTVGLSFDPLHFDGMFAYVKPMNYGPDMVSVYQSLGRVRTLR
                     KGELLIYMDGSGARSEPVFTPMLLNHVVSSCGQWPAQFSQVTNLLCRRFKGRCDASAC
                     DTSLGRGSRIYNKFRYKHYFERCTLACLSDSLNILHMLLTLNCIRVRFWGHDDTLTPK
                     DFCLFLRGVHFDALRAQRDLRELRCRDPEASLPAQAAETEEVGLFVEKYLRSDVAPAE
                     IVALMRNLNSLMGRTRFIYLALLEACLRVPMATRSSAIFRRIYDHYATGVIPTINVTG
                     ELELVALPPTLNVTPVWELLCLCSTMAARLHWDSAAGGSGRTFGPDDVLDLLTPHYDR
                     YMQLVFELGHCNVTDGLLLSEEAVKRVADALSGCPPRGSVSETDHAVALFKIIWGELF
                     GVQMAKSTQTFPGAGRVKNLTKQTIVGLLDAHHIDHSACRTHRQLYALLMAHKREFAG
                     ARFKLRVPAWGRCLRTHSSSANPNADIILEAALSELPTEAWPMMQGAVNFSTL"
     misc_feature    complement(20729..23185)
                     /gene="UL9"
                     /locus_tag="HHV1gp00p68"
                     /note="Origin of replication binding protein; Region:
                     Herpes_ori_bp; pfam02399"
                     /db_xref="CDD:280546"
     gene            23205..24649
                     /gene="UL10"
                     /locus_tag="HHV1gp00p66"
                     /note="core gene"
                     /db_xref="GeneID:2703379"
     CDS             23205..24626
                     /gene="UL10"
                     /locus_tag="HHV1gp00p66"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="YP_009137084.1"
                     /db_xref="GeneID:2703379"
                     /translation="MGRPAPRGSPDSAPPTKGMTGARTAWWVWCVQVATFVVSAVCVT
                     GLLVLASVFRARFPCFYATASSYAGVNSTAEVRGGVAVPLRLDTQSLVGTYVITAVLL
                     LAVAVYAVVGAVTSRYDRALDAGRRLAAARMAMPHATLIAGNVCSWLLQITVLLLAHR
                     ISQLAHLVYVLHFACLVYFAAHFCTRGVLSGTYLRQVHGLMELAPTHHRVVGPARAVL
                     TNALLLGVFLCTADAAVSLNTIAAFNFNFSAPGMLICLTVLFAILVVSLLLVVEGVLC
                     HYVRVLVGPHLGAVAATGIVGLACEHYYTNGYYVVETQWPGAQTGVRVALALVAAFAL
                     GMAVLRCTRAYLYHRRHHTKFFMRMRDTRHRAHSALKRVRSSMRGSRDGRHRPAPGSP
                     PGIPEYAEDPYAISYGGQLDRYGDSDGEPIYDEVADDQTDVLYAKIQHPRHLPDDDPI
                     YDTVGGYDPEPAEDPVYSTVRRW"
     misc_feature    23205..24524
                     /gene="UL10"
                     /locus_tag="HHV1gp00p66"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03242"
                     /db_xref="CDD:177566"
     regulatory      24644..24649
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL10"
                     /locus_tag="HHV1gp00p66"
     gene            complement(24801..28916)
                     /gene="UL14"
                     /locus_tag="HHV1gp00p65"
                     /note="core gene"
                     /db_xref="GeneID:2703384"
     gene            complement(24801..28503)
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="core gene"
                     /db_xref="GeneID:2703383"
     gene            complement(24801..26888)
                     /gene="UL12"
                     /locus_tag="HHV1gp00p63"
                     /note="core gene"
                     /db_xref="GeneID:24271463"
     gene            complement(24801..25092)
                     /gene="UL11"
                     /locus_tag="HHV1gp00p62"
                     /note="core gene"
                     /db_xref="GeneID:24271464"
     regulatory      complement(24801..24806)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL11, UL12, UL13, UL14"
     CDS             complement(24802..25092)
                     /gene="UL11"
                     /locus_tag="HHV1gp00p62"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="YP_009137085.1"
                     /db_xref="GeneID:24271464"
                     /translation="MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEG
                     NFYVPPDMRGVTRAPGRQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE"
     misc_feature    complement(24814..25092)
                     /gene="UL11"
                     /locus_tag="HHV1gp00p62"
                     /note="tegument protein UL11; Provisional; Region:
                     PHA03356"
                     /db_xref="CDD:177594"
     CDS             complement(25008..26888)
                     /gene="UL12"
                     /locus_tag="HHV1gp00p63"
                     /note="involved in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="YP_009137086.1"
                     /db_xref="GeneID:24271463"
                     /translation="MESTVGPACPPGRTVTKRPWALAEDTPRGPDSPPKRPRPNSLPL
                     TTTFRPLPPPPQTTSAVDPSSHSPVNPPRDQHATDTADEKPRAASPALSDASGPPTPD
                     IPLSPGGTHARDPDADPDSPDLDSMWSASVIPNALPSHILAETFERHLRGLLRGVRAP
                     LAIGPLWARLDYLCSLAVVLEEAGMVDRGLGRHLWRLTRRGPPAAADAVAPRPLMGFY
                     EAATQNQADCQLWALLRRGLTTASTLRWGPQGPCFSPQWLKHNASLRPDVQSSAVMFG
                     RVNEPTARSLLFRYCVGRADDGGEAGADTRRFIFHEPSDLAEENVHTCGVLMDGHTGM
                     VGASLDILVCPRDIHGYLAPVPKTPLAFYEVKCRAKYAFDPMDPSDPTASAYEDLMAH
                     RSPEAFRAFIRSIPKPSVRYFAPGRVPGPEEALVTQDQAWSEAHASGEKRRCSAADRA
                     LVELNSGVVSEVLLFGAPDLGRHTISPVSWSSGDLVRREPVFANPRHPNFKQILVQGY
                     VLDSHFPDCPPHPHLVTFIGRHRTSAEEGVTFRLEDGAGALGAAGPSKASILPNQAVP
                     IALIITPVRIDPEIYKAIQRSSRLAFDDTLAELWASRSPGPGPAAAETTSSSPTTGRS
                     SR"
     misc_feature    complement(<26451..>26861)
                     /gene="UL12"
                     /locus_tag="HHV1gp00p63"
                     /note="envelope glycoprotein I; Provisional; Region:
                     PHA03291"
                     /db_xref="CDD:223033"
     misc_feature    complement(25047..26513)
                     /gene="UL12"
                     /locus_tag="HHV1gp00p63"
                     /note="deoxyribonuclease; Provisional; Region: PHA03293"
                     /db_xref="CDD:223034"
     CDS             complement(26947..28503)
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="involved in protein phosphorylation; PK family"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="YP_009137087.1"
                     /db_xref="GeneID:2703383"
                     /translation="MDESRRQRPAGHVAANLSPQGARQRSFKDWLASYVHSNPHGASG
                     RPSGPSLQDAAVSRSSHGSRHRSGLRERLRAGLSRWRMSRSSHRRASPETPGTAAKLN
                     RPPLRRSQAALTAPPSSPSHILTLTRIRKLCSPVFAINPALHYTTLEIPGARSFGGSG
                     GYGDVQLIREHKLAVKTIKEKEWFAVELIATLLVGECVLRAGRTHNIRGFIAPLGFSL
                     QQRQIVFPAYDMDLGKYIGQLASLRTTNPSVSTALHQCFTELARAVVFLNTTCGISHL
                     DIKCANILVMLRSDAVSLRRAVLADFSLVTLNSNSTIARGQFCLQEPDLKSPRMFGMP
                     TALTTANFHTLVGHGYNQPPELLVKYLNNERAEFTNHRLKHDVGLAVDLYALGQTLLE
                     LVVSVYVAPSLGVPVTRFPGYQYFNNQLSPDFALALLAYRCVLHPALFVNSAETNTHG
                     LAYDVPEGIRRHLRNPKIRRAFTDRCINYQHTHKAILSSVALPPELKPLLVLVSRLCH
                     TNPCARHALS"
     misc_feature    complement(<27220..28032)
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="Serine/threonine protein kinase [Signal
                     transduction mechanisms]; Region: SPS1; COG0515"
                     /db_xref="CDD:223589"
     misc_feature    complement(order(27592..27594,27601..27603,27652..27654,
                     27658..27663,27667..27669,27673..27675,27805..27807,
                     27811..27813,27820..27831,27871..27873,27976..27978,
                     27982..27984,28009..28011,28021..28032))
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="active site"
                     /db_xref="CDD:270622"
     misc_feature    complement(order(27601..27603,27652..27654,27658..27663,
                     27667..27669,27673..27675,27811..27813,27820..27831,
                     27871..27873,27976..27978,27982..27984,28009..28011,
                     28021..28032))
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270622"
     misc_feature    complement(order(27592..27594,27661..27663,27667..27669,
                     27673..27675,27805..27807,27811..27813,28021..28023))
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270622"
     misc_feature    complement(27586..27606)
                     /gene="UL13"
                     /locus_tag="HHV1gp00p64"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270622"
     CDS             complement(28257..28916)
                     /gene="UL14"
                     /locus_tag="HHV1gp00p65"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="YP_009137088.1"
                     /db_xref="GeneID:2703384"
                     /translation="MDRDAAHAALRRRLAETHLRAEIYKDQTLQLHREGVSTQDPRFV
                     GAFMAAKAAHLELEARLKSRARLEMMRQRATCVKIRVEEQAARRDFLTAHRRYLDPAL
                     GERLDAVDDRLADQEEQLEEAATNASLWGDGDLAEGWMSPADSDLLVMWQLTSAPKVH
                     ANGPSRIGSHPTYTPTPTGPPGAPAAPLSRTPPSPAPPTGPATDPASASGFARDYPDG
                     E"
     misc_feature    complement(28260..28916)
                     /gene="UL14"
                     /locus_tag="HHV1gp00p65"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03185"
                     /db_xref="CDD:177553"
     gene            29021..34826
                     /gene="UL15"
                     /locus_tag="HHV1gp00p61"
                     /note="core gene"
                     /db_xref="GeneID:2703385"
     CDS             join(29021..30049,33636..34814)
                     /gene="UL15"
                     /locus_tag="HHV1gp00p61"
                     /note="contains an ATPase domain; involved in DNA
                     encapsidation; transiently associated with maturing
                     capsids"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="YP_009137089.1"
                     /db_xref="GeneID:2703385"
                     /translation="MFGQQLASDVQQYLERLEKQRQLKVGADEASAGLTMGGDALRVP
                     FLDFATATPKRHQTVVPGVGTLHDCCEHSPLFSAVARRLLFNSLVPAQLKGRDFGGDH
                     TAKLEFLAPELVRAVARLRFKECAPADVVPQRNAYYSVLNTFQALHRSEAFRQLVHFV
                     RDFAQLLKTSFRASSLTETTGPPKKRAKVDVATHGRTYGTLELFQKMILMHATYFLAA
                     VLLGDHAEQVNTFLRLVFEIPLFSDAAVRHFRQRATVFLVPRRHGKTWFLVPLIALSL
                     ASFRGIKIGYTAHIRKATEPVFEEIDACLRGWFGSARVDHVKGETISFSFPDGSRSTI
                     VFASSHNTNGIRGQDFNLLFVDEANFIRPDAVQTIMGFLNQANCKIIFVSSTNTGKAS
                     TSFLYNLRGAADELLNVVTYICDDHMPRVVTHTNATACSCYILNKPVFITMDGAVRRT
                     ADLFLADSFMQEIIGGQARETGDDRPVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYV
                     DPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVL
                     ALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSGPELLFYHCEP
                     PGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLN
                     NLTETVSPNTDVRTYSGKRNGASDDLMVAVIMAIYLAAQAGPPHTFAPITRVS"
     misc_feature    join(29021..30049,33636..34811)
                     /gene="UL15"
                     /locus_tag="HHV1gp00p61"
                     /note="DNA packaging terminase subunit 1; Provisional;
                     Region: PHA03368"
                     /db_xref="CDD:223060"
     gene            complement(30174..33498)
                     /gene="UL17"
                     /locus_tag="HHV1gp00p60"
                     /note="core gene"
                     /db_xref="GeneID:2703388"
     gene            complement(30174..31296)
                     /gene="UL16"
                     /locus_tag="HHV1gp00p59"
                     /note="core gene"
                     /db_xref="GeneID:24271465"
     regulatory      complement(30174..30179)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL16, UL17"
     CDS             complement(30175..31296)
                     /gene="UL16"
                     /locus_tag="HHV1gp00p59"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="YP_009137090.1"
                     /db_xref="GeneID:24271465"
                     /translation="MAQLGPRRPLAPPGPPGTLPRPDSRAGARGTRDRVDDLGTDVDS
                     IARIVNSVFVWRVVRADERLKIFRCLTVLTEPLCQVALPNPDPGRALFCEIFLYLTRP
                     KALRLPPNTFFALFFFNRERRYCAIVHLRSVTHPLTPLLCTLTFARIRAATPPEETPD
                     PTTEQLAEEPVVGELDGAYLVPAKTPPEPGACCALGPGAWWHLPSGQIYCWAMDSDLG
                     SLCPPGSRARHLGWLLARITNHPGGCESCAPPPHIDSANALWLSSVVTESCPCVAPCL
                     WAKMAQCTLAVQGDASLCPLLFGHPVDTVTLLQAPRRPCITDRLQEVVGGRCGADNIP
                     PTSAGWRLCVFSSYISRLFATSCPTVARAVARASSSDPE"
     misc_feature    complement(30178..31200)
                     /gene="UL16"
                     /locus_tag="HHV1gp00p59"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03349"
                     /db_xref="CDD:177590"
     CDS             complement(31387..33498)
                     /gene="UL17"
                     /locus_tag="HHV1gp00p60"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="YP_009137091.1"
                     /db_xref="GeneID:2703388"
                     /translation="MNAHLANEVQYDLGHGPGRPSSLVHVIISSECLAAAGIPLAALM
                     RGRPGLGTAANFQVEIQTRAHATGDCTPWCTAFAAYVPADAVGELLAPVVPAHPGLLP
                     RASSAGGLFVSLPVVCDAQGVYDPYAVAALRLAWGSGASCARVILFSYDELVPPNTRY
                     AADSTRIMRVCRHLCRYVALLGAAAPPAAKEAAAHLSMGLGESASPRPQPLARPHAGA
                     PADPPIVGASDPPISPEEQLTAPGGDTTAAQDVSIAQENEEILALVQRAVQDVTRRHP
                     VRARTGRAACGVASGLRQGALVHQAVSGGAMGAADADAVLAGLEPPGGGRFVAPAPHG
                     PGGEDILNDVLTLTPGTAKPRSLVEWLDRGWEALAGGDRPDWLWSRRSISVVLRHHYG
                     TKQRFVVVSYENSVAWGGRRARPPLLSSALATALTEACAAERVVRPHQLSPAGQAELL
                     LRFPALEVPLRHPRPVLPPFDIAAEVAFTARIHLACLRALGQAIRAALQGGPRISQRL
                     RYDFGPDQRAWLGEVTRRFPILLENLMRAVEGTAPDAFFHTAYALAVLAHLGGRGGRG
                     RRVVPLGDDLPARFADSDGHYVFDYYSTSGDTLRLNNRPIAVAMDGDVSKREQSKCRF
                     MEAVPSTAPRRVCEQYLPGESYAYLCLGFNRRLCGIVVFPGGFAFTINIAAYLSLSDP
                     VARAAVLRFCRKVSSGNGRSR"
     misc_feature    complement(31414..33498)
                     /gene="UL17"
                     /locus_tag="HHV1gp00p60"
                     /note="UL17 tegument protein; Provisional; Region:
                     PHA03359"
                     /db_xref="CDD:223054"
     regulatory      34821..34826
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL15"
                     /locus_tag="HHV1gp00p61"
     gene            complement(35024..41489)
                     /gene="UL20"
                     /locus_tag="HHV1gp00p57"
                     /note="alpha gene"
                     /db_xref="GeneID:2703371"
     gene            complement(35024..40529)
                     /gene="UL19"
                     /locus_tag="HHV1gp00p56"
                     /note="core gene"
                     /db_xref="GeneID:2703368"
     gene            complement(35024..36052)
                     /gene="UL18"
                     /locus_tag="HHV1gp00p58"
                     /note="core gene"
                     /db_xref="GeneID:2703366"
     regulatory      complement(35024..35029)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL18, UL19, UL20"
     regulatory      complement(35028..35033)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL18, UL19, UL20"
     CDS             complement(35096..36052)
                     /gene="UL18"
                     /locus_tag="HHV1gp00p58"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis; VP23"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="YP_009137092.1"
                     /db_xref="GeneID:2703366"
                     /translation="MLADGFETDIAIPSGISRPDAAALQRCEGRVVFLPTIRRQLTLA
                     DVAHESFVSGGVSPDTLGLLLAYRRRFPAVITRVLPTRIVACPLDVGLTHAGTVNLRN
                     TSPVDLCNGDPISLVPPVFEGQATDVRLDSLDLTLRFPVPLPSPLAREIVARLVARGI
                     RDLNPSPRNPGGLPDLNVLYYNGSRLSLLADVQQLGPVNAELRSLVLNMVYSITEGTT
                     IILTLIPRLFALSAQDGYVNALLQMQSVTREAAQLIHPEAPALMQDGERRLPLYEALV
                     AWLTHAGQLGDTLALAPVVRVCTFDGAAVVRSGDMAPVIRYP"
     misc_feature    complement(35099..36052)
                     /gene="UL18"
                     /locus_tag="HHV1gp00p58"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03257"
                     /db_xref="CDD:177569"
     CDS             complement(36405..40529)
                     /gene="UL19"
                     /locus_tag="HHV1gp00p56"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis; VP5"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="YP_009137093.1"
                     /db_xref="GeneID:2703368"
                     /translation="MAAPNRDPPGYRYAAAMVPTGSLLSTIEVASHRRLFDFFSRVRS
                     DANSLYDVEFDALLGSYCNTLSLVRFLELGLSVACVCTKFPELAYMNEGRVQFEVHQP
                     LIARDGPHPIEQPTHNYMTKIIDRRALNAAFSLATEAIALLTGEALDGTGIGAHRQLR
                     AIQQLARNVQAVLGAFERGTADQMLHVLLEKAPPLALLLPMQRYLDNGRLATRVARAT
                     LVAELKRSFCETSFFLGKAGHRREAVEAWLVDLTTATQPSVAVPRLTHADTRGRPVDG
                     VLVTTAPIKQRLLQSFLKVEDTEADVPVTYGEMVLNGANLVTALVMGKAVRSLDDVGR
                     HLLEMQEEQLDLNRQTLDELESAPQTTRVRADLVSIGEKLVFLEALEKRIYAATNVPY
                     PLVGAMDLTFVLPLGLFNPVMERFAAHAGDLVPAPGHPDPRAFPPRQLFFWGKDRQVL
                     RLSLEHAIGTVCHPSLMNVDAAVGGLNRDPVEAANPYGAYVAAPAGPAADMQQLFLNA
                     WGQRLAHGRVRWVAEGQMTPEQFMQPDNANLALELHPAFDFFVGVADVELPGGDVPPA
                     GPGEIQATWRVVNGNLPLALCPAAFRDARGLELGVGRHAMAPATIAAVRGAFDDRNYP
                     AVFYLLQAAIHGSEHVFCALARLVVQCITSYWNNTRCAAFVNDYSLVSYVVTYLGGDL
                     PEECMAVYRDLVAHVEALAQLVDDFTLTGPELGGQAQAELNHLMRDPALLPPLVWDCD
                     ALMRRAALDRHRDCRVSAGGHDPVYAAACNVATADFNRNDGQLLHNTQARAADAADDR
                     PHRGADWTVHHKIYYYVMVPAFSRGRCCTAGVRFDRVYATLQNMVVPEIAPGEECPSD
                     PVTDPAHPLHPANLVANTVNAMFHNGRVVVDGPAMLTLQVLAHNMAERTTALLCSAAP
                     DAGANTASTTNMRIFDGALHAGILLMAPQHLDHTIQNGDYFYPLPVHALFAGADHVAN
                     APNFPPALRDLSRQVPLVPPALGANYFSSIRQPVVQHVRESAAGENALTYALMAGYFK
                     ISPVALHHQLKTGLHPGFGFTVVRQDRFVTENVLFSERASEAYFLGQLQVARHETGGG
                     VNFTLTQPRGNVDLGVGYTAVVATATVRNPVTDMGNLPQNFYLGRGAPPLLDNAAAVY
                     LRNAVVAGNRLGPAQPVPVFGCAQVPRRAGMDHGQDAVCEFIATPVSTDVNYFRRPCN
                     PRGRAAGGVYAGDKEGDVTALMYDHGQSDPSRAFAATANPWASQRFSYGDLLYNGAYH
                     LNGASPVLSPCFKFFTSADIAAKHRCLERLIVETGSAVSTATAASDVQFKRPPGCREL
                     VEDPCGLFQEAYPLTCASDPALLRSARNGEAHARETHFAQYLVYDASPLKGLAL"
     misc_feature    complement(36414..40481)
                     /gene="UL19"
                     /locus_tag="HHV1gp00p56"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     CDS             complement(40821..41489)
                     /gene="UL20"
                     /locus_tag="HHV1gp00p57"
                     /note="type 3 membrane protein; 4 transmembrane domains;
                     involved in virion morphogenesis; involved in membrane
                     fusion"
                     /codon_start=1
                     /product="envelope protein UL20"
                     /protein_id="YP_009137094.1"
                     /db_xref="GeneID:2703371"
                     /translation="MTMRDDLPLVDRDLVDEAAFGGEEGELPLEEQFSLSSYGTSDFF
                     VSSAYSRLPPHTQPVFSKRVILFLWSFLVLKPLEMVAAGMYYGLTGRVVAPACILAAI
                     VGYYVTWAVRALLLYVNIKRDRLPLSAPVFWGMSVFLGGTALCALFAAAHETFSPDGL
                     FHFIATNQMLPPTDPLRTRALGIACAAGASMWVAAADSFAASANFFLARFWTRAILNA
                     PVAF"
     misc_feature    complement(40839..41366)
                     /gene="UL20"
                     /locus_tag="HHV1gp00p57"
                     /note="Herpesvirus egress protein UL20; Region:
                     Herpes_UL20; pfam04544"
                     /db_xref="CDD:282411"
     gene            42075..43696
                     /gene="UL21"
                     /locus_tag="HHV1gp00p55"
                     /note="alpha gene"
                     /db_xref="GeneID:2703372"
     CDS             42075..43682
                     /gene="UL21"
                     /locus_tag="HHV1gp00p55"
                     /note="interacts with microtubules; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL21"
                     /protein_id="YP_009137095.1"
                     /db_xref="GeneID:2703372"
                     /translation="MELSYATTMHYRDVVFYVTTDRNRAYFVCGGCVYSVGRPCASQP
                     GEIAKFGLVVRGTGPDDRVVANYVRSELRQRGLQDVRPIGEDEVFLDSVCLLNPNVSS
                     ELDVINTNDVEVLDECLAEYCTSLRTSPGVLISGLRVRAQDRIIELFEHPTIVNVSSH
                     FVYTPSPYVFALAQAHLPRLPSSLEALVSGLFDGIPAPRQPLDAHNPRTDVVITGRRA
                     PRPIAGSGAGSGGAGAKRATVSEFVQVKHIDRVGPAGVSPAPPPNNTDSSSLVPGAQD
                     SAPPGPTLRELWWVFYAADRALEEPRADSGLTREEVRAVRGFREQAWKLFGSAGAPRA
                     FIGAALGLSPLQKLAVYYYIIHRERRLSPFPALVRLVGRYTQRHGLYVPRPDDPVLAD
                     AINGLFRDALAAGTTAEQLLMFDLLPPKDVPVGSDVQADSTALLRFIESQRLAVPGGV
                     ISPEHVAYLGAFLSVLYAGRGRMSAATHTARLTGVTSLVLAVGDVDRLSAFDRGAAGA
                     ASRTRAAGYLDVLLTVRLARSQHGQSV"
     misc_feature    42075..43640
                     /gene="UL21"
                     /locus_tag="HHV1gp00p55"
                     /note="Herpesvirus UL21; Region: Herpes_UL21; cl28056"
                     /db_xref="CDD:332877"
     regulatory      43691..43696
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL21"
                     /locus_tag="HHV1gp00p55"
     gene            complement(43866..46383)
                     /gene="UL22"
                     /locus_tag="HHV1gp00p54"
                     /note="core gene"
                     /db_xref="GeneID:24271466"
     regulatory      complement(43866..43871)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL22"
                     /locus_tag="HHV1gp00p54"
     CDS             complement(43867..46383)
                     /gene="UL22"
                     /locus_tag="HHV1gp00p54"
                     /note="type 1 membrane protein; contains a signal peptide;
                     possible membrane fusogen; complexed with envelope
                     glycoprotein L; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="YP_009137096.1"
                     /db_xref="GeneID:24271466"
                     /translation="MGNGLWFVGVIILGVAWGQVHDWTEQTDPWFLDGLGMDRMYWRD
                     TNTGRLWLPNTPDPQKPPRGFLAPPDELNLTTASLPLLRWYEERFCFVLVTTAEFPRD
                     PGQLLYIPKTYLLGRPPNASLPAPTTVEPTAQPPPSVAPLKGLLHNPAASVLLRSRAW
                     VTFSAVPDPEALTFPRGDNVATASHPSGPRDTPPPRPPVGARRHPTTELDITHLHNAS
                     TTWLATRGLLRSPGRYVYFSPSASTWPVGIWTTGELVLGCDAALVRARYGREFMGLVI
                     SMHDSPPVEVMVVPAGQTLDRVGDPADENPPGALPGPPGGPRYRVFVLGSLTRADNGS
                     ALDALRRVGGYPEEGTNYAQFLSRAYAEFFSGDAGAEQGPRPPLFWRLTGLLATSGFA
                     FVNAAHANGAVCLSDLLGFLAHSRALAGLAARGAAGCAADSVFFNVSVLDPTARLQLE
                     ARLQHLVAEILEREQSLALHALGYQLAFVLDSPSAYDAVAPSAAHLIDALYAEFLGGR
                     VLTTPVVHRALFYASAVLRQPFLAGVPSAVQRERARRSLLIASALCTSDVAAATNADL
                     RTALARADHQKTLFWLPDHFSPCAASLRFDLDESVFILDALAQATRSETPVEVLAQQT
                     HGLASTLTRWAHYNALIRAFVPEASHRCGGQSANVEPRILVPITHNASYVVTHSPLPR
                     GIGYKLTGVDVRRPLFLTYLTATCEGSTRDIESKRLVRTQNQRDLGLVGAVFMRYTPA
                     GEVMSVLLVDTDNTQQQIAAGPTEGAPSVFSSDVPSTALLLFPNGTVIHLLAFDTQPV
                     AAIAPGFLAASALGVVMITAALAGILKVLRTSVPFFWRRE"
     misc_feature    complement(43870..46383)
                     /gene="UL22"
                     /locus_tag="HHV1gp00p54"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03294"
                     /db_xref="CDD:223035"
     gene            complement(46609..47803)
                     /gene="UL23"
                     /locus_tag="HHV1gp00p53"
                     /note="core gene"
                     /db_xref="GeneID:24271467"
     regulatory      complement(46609..46614)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL23"
                     /locus_tag="HHV1gp00p53"
     regulatory      complement(46622..46627)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL23"
                     /locus_tag="HHV1gp00p53"
     CDS             complement(46673..47803)
                     /gene="UL23"
                     /locus_tag="HHV1gp00p53"
                     /EC_number="2.7.1.21"
                     /note="thymidine kinase"
                     /codon_start=1
                     /product="involved in nucleotide metabolism"
                     /protein_id="YP_009137097.1"
                     /db_xref="GeneID:24271467"
                     /translation="MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQKATEVRLEQ
                     KMPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYT
                     TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLI
                     FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLA
                     KRQRPGERLDLAMLAAIRRVYGLLANTVRYLQGGGSWREDWGQLSGAAVPPQGAEPQS
                     NAGPRPHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLRPMHVFILDYDQSPA
                     GCRDALLQLTSGMVQTHVTTPGSIPTICDLARTFAREMGEAN"
     misc_feature    complement(46679..47803)
                     /gene="UL23"
                     /locus_tag="HHV1gp00p53"
                     /note="thymidine kinase; Provisional; Region: PHA03133"
                     /db_xref="CDD:165405"
     gene            47738..52772
                     /gene="UL24"
                     /locus_tag="HHV1gp00p52"
                     /note="core gene"
                     /db_xref="GeneID:24271468"
     CDS             47738..48547
                     /gene="UL24"
                     /locus_tag="HHV1gp00p52"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="YP_009137098.1"
                     /db_xref="GeneID:24271468"
                     /translation="MAARTRSLVERRRVLMAGVRSHTRFYKALAEEVREFHATKICGT
                     LLTLLSGSLQGRSVFEATRVTLICEVDLGPRRPDCICVFEFANDKTLGGVCVIIELKT
                     CKYISSGDTASKREQRATGMKQLRHSLKLLQSLAPPGDKIVYLCPVLVFVAQRTLRVS
                     RVTRLVPQKVSGNITAVVRMLQSLSTYTVPIEPRTQRARRRRGGAARGSASRPKRSHS
                     GARDPPESAARQLPPADQTPASTEGGGVLKRIAALFCVPVATKTKPRAASE"
     misc_feature    47738..48514
                     /gene="UL24"
                     /locus_tag="HHV1gp00p52"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03215"
                     /db_xref="CDD:223010"
     gene            48814..52772
                     /gene="UL25"
                     /locus_tag="HHV1gp00p51"
                     /note="core gene"
                     /db_xref="GeneID:2703377"
     CDS             48814..50556
                     /gene="UL25"
                     /locus_tag="HHV1gp00p51"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="YP_009137099.1"
                     /db_xref="GeneID:2703377"
                     /translation="MDPYCPFDALDVWEHRRFIVADSRNFITPEFPRDFWMSPVFNLP
                     RETAAEQVVVLQAQRTAAAAALENAAMQAAELPVDIERRLRPIERNVHEIAGALEALE
                     TAAAAAEEADAARGDEPAGGGDGGAPPGLAVAEMEVQIVRNDPPLRYDTNLPVDLLHM
                     VYAGRGATGSSGVVFGTWYRTIQDRTITDFPLTTRSADFRDGRMSKTFMTALVLSLQA
                     CGRLYVGQRHYSAFECAVLCLYLLYRNTHGAADDSDRAPVTFGDLLGRLPRYLACLAA
                     VIGTEGGRPQYRYRDDKLPKTQFAAGGGRYEHGALASHIVIATLMHHGVLPAAPGDVP
                     RDASTHVNPDGVAHHDDINRAAAAFLSRGHNLFLWEDQTLLRATANTITALGVIQRLL
                     ANGNVYADRLNNRLQLGMLIPGAVPSEAIARGASGSDSGAIKSGDNNLEALCANYVLP
                     LYRADPAVELTQLFPGLAALCLDAQAGRPVGSTRRVVDMSSGARQAALVRLTALELIN
                     RTRTNPTPVGEVIHAHDALAIQYEQGLGLLAQQARIGLGSNTKRFSAFNVSSDYDMLY
                     FLCLGFIPQYLSAV"
     misc_feature    48814..50553
                     /gene="UL25"
                     /locus_tag="HHV1gp00p51"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03248"
                     /db_xref="CDD:223022"
     gene            50810..52772
                     /gene="UL26"
                     /locus_tag="HHV1gp00p50"
                     /note="core gene"
                     /db_xref="GeneID:2703453"
     CDS             50810..52717
                     /gene="UL26"
                     /locus_tag="HHV1gp00p50"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis; VP24; VP21"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="YP_009137100.1"
                     /db_xref="GeneID:2703453"
                     /translation="MAADAPGDRMEEPLPDRAVPIYVAGFLALYDSGDSGELALDPDT
                     VRAALPPDNPLPINVDHRAGCEVGRVLAVVDDPRGPFFVGLIACVQLERVLETAASAA
                     IFERRGPPLSREERLLYLITNYLPSVSLATKRLGGEAHPDRTLFAHVALCAIGRRLGT
                     IVTYDTGLDAAIAPFRHLSPASREGARRLAAEAELALSGRTWAPGVEALTHTLLSTAV
                     NNMMLRDRWSLVAERRRQAGIAGHTYLQASEKFKMWGAEPVSAPARGYKNGAPESTDI
                     PPGSIAAAPQGDRCPIVRQRGVALSPVLPPMNPVPTSGTPAPAPPGDGSYLWIPASHY
                     NQLVAGHAAPQPQPHSAFGFPAAAGSVAYGPHGAGLSQHYPPHVAHQYPGVLFSGPSP
                     LEAQIAALVGAIAADRQAGGQPAAGDPGVRGSGKRRRYEAGPSESYCDQDEPDADYPY
                     YPGEARGGPRGVDSRRAARHSPGTNETITALMGAVTSLQQELAHMRARTSAPYGMYTP
                     VAHYRPQVGEPEPTTTHPALCPPEAVYRPPPHSAPYGPPQGPASHAPTPPYAPAACPP
                     GPPPPPCPSTQTRAPLPTEPAFPPAATGSQPEASNAEAGALVNASSAAHVDVDTARAA
                     DLFVSQMMGAR"
     misc_feature    50918..51901
                     /gene="UL26"
                     /locus_tag="HHV1gp00p50"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     misc_feature    <51710..>52450
                     /gene="UL26"
                     /locus_tag="HHV1gp00p50"
                     /note="DNA translocase FtsK; Provisional; Region:
                     PRK10263"
                     /db_xref="CDD:236669"
     gene            51728..52772
                     /gene="UL26.5"
                     /locus_tag="HHV1gp00p49"
                     /note="core gene"
                     /db_xref="GeneID:2703454"
     CDS             51728..52717
                     /gene="UL26.5"
                     /locus_tag="HHV1gp00p49"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis; VP22a"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="YP_009137101.1"
                     /db_xref="GeneID:2703454"
                     /translation="MNPVPTSGTPAPAPPGDGSYLWIPASHYNQLVAGHAAPQPQPHS
                     AFGFPAAAGSVAYGPHGAGLSQHYPPHVAHQYPGVLFSGPSPLEAQIAALVGAIAADR
                     QAGGQPAAGDPGVRGSGKRRRYEAGPSESYCDQDEPDADYPYYPGEARGGPRGVDSRR
                     AARHSPGTNETITALMGAVTSLQQELAHMRARTSAPYGMYTPVAHYRPQVGEPEPTTT
                     HPALCPPEAVYRPPPHSAPYGPPQGPASHAPTPPYAPAACPPGPPPPPCPSTQTRAPL
                     PTEPAFPPAATGSQPEASNAEAGALVNASSAAHVDVDTARAADLFVSQMMGAR"
     misc_feature    <51728..51901
                     /gene="UL26.5"
                     /locus_tag="HHV1gp00p49"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     regulatory      52767..52772
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL24, UL25, UL26, UL26.5"
     gene            complement(53059..58160)
                     /gene="UL28"
                     /locus_tag="HHV1gp00p47"
                     /note="core gene"
                     /db_xref="GeneID:2703457"
     gene            complement(53059..55795)
                     /gene="UL27"
                     /locus_tag="HHV1gp00p48"
                     /note="core gene"
                     /db_xref="GeneID:24271469"
     regulatory      complement(53059..53064)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL27, UL28"
     CDS             complement(53081..55795)
                     /gene="UL27"
                     /locus_tag="HHV1gp00p48"
                     /note="type 1 membrane protein; contains a signal peptide;
                     possible membrane fusogen; binds cell surface heparan
                     sulphate; involved in cell entry; involved in cell-to-cell
                     spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="YP_009137102.1"
                     /db_xref="GeneID:24271469"
                     /translation="MRQGAPARGRRWFVVWALLGLTLGVLVASAAPSSPGTPGVAAAT
                     QAANGGPATPAPPAPGAPPTGDPKPKKNKKPKPPKPPRPAGDNATVAAGHATLREHLR
                     DIKAENTDANFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFK
                     ATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNL
                     ETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEV
                     DARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKA
                     RATAPTTRNLLTTPKFTVAWDWVPKRPSVCTMTKWQEVDEMLRSEYGGSFRFSSDAIS
                     TTFTTNLTEYPLSRVDLGDCIGKDARDAMDRIFARRYNATHIKVGQPQYYLANGGFLI
                     AYQPLLSNTLAELYVREHLREQSRKPPNPTPPPPGASANASVERIKTTSSIEFARLQF
                     TYNHIQRHVNDMLGRVAIAWCELQNHELTLWNEARKLNPNAIASATVGRRVSARMLGD
                     VMAVSTCVPVAADNVIVQNSMRISSRPGACYSRPLVSFRYEDQGPLVEGQLGENNELR
                     LTRDAIEPCTVGHRRYFTFGGGYVYFEEYAYSHQLSRADITTVSTFIDLNITMLEDHE
                     FVPLEVYTRHEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIHADANAAMFAGLGAFFE
                     GMGDLGRAVGKVVMGIVGGVVSAVSGVSSFMSNPFGALAVGLLVLAGLAAAFFAFRYV
                     MRLQSNPMKALYPLTTKELKNPTNPDASGEGEEGGDFDEAKLAEAREMIRYMALVSAM
                     ERTEHKAKKKGTSALLSAKVTDMVMRKRRNTNYTQVPNKDGDADEDDL"
     misc_feature    complement(53096..55549)
                     /gene="UL27"
                     /locus_tag="HHV1gp00p48"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     CDS             complement(55803..58160)
                     /gene="UL28"
                     /locus_tag="HHV1gp00p47"
                     /note="involved in DNA encapsidation; transiently
                     associated with maturing capsids"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="YP_009137103.1"
                     /db_xref="GeneID:2703457"
                     /translation="MAAPVSEPTVARQKLLALLGQVQTYVFQIELLRRCDPHIGRGKL
                     PQLKLNALQVRALRRRLRPGLEAQAGAFLTPLSVTLELLLEYAWREGERLLGSLETFA
                     TAGDVAAFFTETMGLARPCPYHQRVRLDTYGGTVHMELCFLHDVENFLKQLNYCHLIT
                     PSRGATAALERVREFMVGAVGSGLIVPPELSDPSHPCAVCFEELCVTANQGATIARRL
                     ADRICNHVTQQAQVRLDANELRRYLPHAAGLSDADRARALSVLDHALARTAGGDGQPH
                     PSPENDSVRKEADALLEAHDVFQATTPGLYAISELRFWLASGDRAGQTTMDAFASNLT
                     ALARRELQQETAAVAVELALFGRRAEHFDRAFGSHLAALDMVDALIIGGQATSPDDQI
                     EALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMGAGGAADAPKGGAGPDDDGD
                     RVAVEEGARGLGAPGGGGEDEDRRRGPGGQGPETWGDIATQAAADVRERRRLYADRLT
                     KRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALTAGAGTV
                     IDNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPN
                     TALYYSVENVGLLPHLKEELARFIMGAGGSGADWAVSEFQRFYCFDGISGITPTQRAA
                     WRYIRELIIATTLFASVYRCGELELRRPDCSRPTSEGRYRYPPGVYLTYDSDCPLVAI
                     VESAPDGCIGPRSVVVYDRDVFSILYSVLQHLAPRLPDGGHDGPP"
     misc_feature    complement(56115..58127)
                     /gene="UL28"
                     /locus_tag="HHV1gp00p47"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            complement(58410..62054)
                     /gene="UL29"
                     /locus_tag="HHV1gp00p46"
                     /note="core gene"
                     /db_xref="GeneID:2703458"
     regulatory      complement(58410..58415)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL29"
                     /locus_tag="HHV1gp00p46"
     CDS             complement(58464..62054)
                     /gene="UL29"
                     /locus_tag="HHV1gp00p46"
                     /note="contains a zinc-finger; involved in DNA
                     replication; possibly involved in gene regulation; ICP8"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_009137104.1"
                     /db_xref="GeneID:2703458"
                     /translation="METKPKTATTIKVPPGPLGYVYARACPSEGIELLALLSARSGDS
                     DVAVAPLVVGLTVESGFEANVAVVVGSRTTGLGGTAVSLKLTPSHYSSSVYVFHGGRH
                     LDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCERLGLDPDRALLYLV
                     VTEGFKEAVCINNTFLHLGGSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANH
                     RSIGENFTYPLPFFNRPLNRLLFEAVVGPAAVALRCRNVDAVARAAAHLAFDENHEGA
                     ALPADITFTAFEASQGKTPRGGRDGGGKGPAGGFEQRLASVMAGDAALALESIVSMAV
                     FDEPPTDISAWPLFEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAG
                     PADPKDHSKPSFYRFFLVPGTHVAANPQVDREGHVVPGFEGRPTAPLVGGTQEFAGEH
                     LAMLCGFSPALLAKMLFYLERCDGGVIVGRQEMDVFRYVADSNQTDVPCNLCTFDTRH
                     ACVHTTLMRLRARHPKFASAARGAIGVFGTMNSMYSDCDVLGNYAAFSALKRADGSET
                     ARTIMQETYRAATERVMAELETLQYVDQAVPTAMGRLETIITNREALHTVVNNVRQVV
                     DREVEQLMRNLVEGRNFKFRDGLGEANHAMSLTLDPYACGPCPLLQLLGRRSNLAVYQ
                     DLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDMFNNGFLSAKTLTVALSEGAAIC
                     APSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQ
                     SAYQKPDKRVDILLGPLGFLLKQFHAAIFPNGKPPGSNQPNPQWFWTALQRNQLPARL
                     LSREDIETIAFIKKFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTL
                     TAIIAGSRRPPSVQAAAAWSAQGGAGLEAGARALMDAVDAHPGAWTSMFASCNLLRPV
                     MAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLMGGKNACPLLIFDRTRKFVLACPR
                     AGFVCAASSLGGGAHESSLCEQLRGIISEGGAAVASSVFVATVKSLGPRTQQLQIEDW
                     LALLEDEYLSEEMMELTARALERGNGEWSTDAALEVAHEAEALVSQLGNAGEVFNFGD
                     FGCEDDNATPFGGPGAPGPAFAGRKRAFHGDDPFGEGPPDKKGDLTLDML"
     misc_feature    complement(58467..62045)
                     /gene="UL29"
                     /locus_tag="HHV1gp00p46"
                     /note="single-stranded binding protein UL29; Provisional;
                     Region: PHA03362"
                     /db_xref="CDD:223056"
     stem_loop       62404..62547
                     /note="oriL palindrome"
     gene            62807..66553
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
                     /note="core gene"
                     /db_xref="GeneID:2703462"
     CDS             62807..66514
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
                     /EC_number="2.7.7.7"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="YP_009137105.1"
                     /db_xref="GeneID:2703462"
                     /translation="MFSGGGGPLSPGGKSAARAASGFFAPAGPRGASRGPPPCLRQNF
                     YNPYLAPVGTQQKPTGPTQRHTYYSECDEFRFIAPRVLDEDAPPEKRAGVHDGHLKRA
                     PKVYCGGDERDVLRVGSGGFWPRRSRLWGGVDHAPAGFNPTVTVFHVYDILENVEHAY
                     GMRAAQFHARFMDAITPTGTVITLLGLTPEGHRVAVHVYGTRQYFYMNKEEVDRHLQC
                     RAPRDLCERMAAALRESPGASFRGISADHFEAEVVERTDVYYYETRPALFYRVYVRSG
                     RVLSYLCDNFCPAIKKYEGGVDATTRFILDNPGFVTFGWYRLKPGRNNTLAQPRAPMA
                     FGTSSDVEFNCTADNLAIEGGMSDLPAYKLMCFDIECKAGGEDELAFPVAGHPEDLVI
                     QISCLLYDLSTTALEHVLLFSLGSCDLPESHLNELAARGLPTPVVLEFDSEFEMLLAF
                     MTLVKQYGPEFVTGYNIINFDWPFLLAKLTDIYKVPLDGYGRMNGRGVFRVWDIGQSH
                     FQKRSKIKVNGMVNIDMYGIITDKIKLSSYKLNAVAEAVLKDKKKDLSYRDIPAYYAA
                     GPAQRGVIGEYCIQDSLLVGQLFFKFLPHLELSAVARLAGINITRTIYDGQQIRVFTC
                     LLRLADQKGFILPDTQGRFRGAGGEAPKRPAAAREDEERPEEEGEDEDEREEGGGERE
                     PEGARETAGRHVGYQGARVLDPTSGFHVNPVVVFDFASLYPSIIQAHNLCFSTLSLRA
                     DAVAHLEAGKDYLEIEVGGRRLFFVKAHVRESLLSILLRDWLAMRKQIRSRIPQSSPE
                     EAVLLDKQQAAIKVVCNSVYGFTGVQHGLLPCLHVAATVTTIGREMLLATREYVHARW
                     AAFEQLLADFPEAADMRAPGPYSMRIIYGDTDSIFVLCRGLTAAGLTAVGDKMASHIS
                     RALFLPPIKLECEKTFTKLLLIAKKKYIGVIYGGKMLIKGVDLVRKNNCAFINRTSRA
                     LVDLLFYDDTVSGAAAALAERPAEEWLARPLPEGLQAFGAVLVDAHRRITDPERDIQD
                     FVLTAELSRHPRAYTNKRLAHLTVYYKLMARRAQVPSIKDRIPYVIVAQTREVEETVA
                     RLAALRELDAAAPGDEPAPPAALPSPAKRPRETPSPADPPGGASKPRKLLVSELAEDP
                     AYAIAHGVALNTDYYFSHLLGAACVTFKALFGNNAKITESLLKRFIPEVWHPPDDVAA
                     RLRTAGFGAVGAGATAEETRRMLHRAFDTLA"
     misc_feature    63884..65494
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
                     /note="DNA polymerase type-B family; Region: POLBc;
                     smart00486"
                     /db_xref="CDD:214691"
     misc_feature    64625..66334
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:365898"
     misc_feature    66404..66511
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
                     /note="DNA polymerase catalytic subunit Pol; Region:
                     DNAPolymera_Pol; pfam11590"
                     /db_xref="CDD:314473"
     gene            complement(66377..69162)
                     /gene="UL32"
                     /locus_tag="HHV1gp00p44"
                     /note="core gene"
                     /db_xref="GeneID:2703352"
     gene            complement(66377..67379)
                     /gene="UL31"
                     /locus_tag="HHV1gp00p43"
                     /note="core gene"
                     /db_xref="GeneID:2703350"
     regulatory      complement(66377..66382)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL31, UL32"
     CDS             complement(66459..67379)
                     /gene="UL31"
                     /locus_tag="HHV1gp00p43"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="YP_009137106.1"
                     /db_xref="GeneID:2703350"
                     /translation="MYDTDPHRRGSRPGPYHGKERRRSRSSAAGGTLGVVRRASRKSL
                     PPHARKQELCLHERQRYRGLFAALAQTPSEEIAIVRSLSVPLVKTTPVSLPFCLDQTV
                     ADNCLTLSGMGYYLGIGGCCPACNAGDGRFAATSREALILAFVQQINTIFEHRAFLAS
                     LVVLADRHNAPLQDLLAGILGQPELFFVHTILRGGGACDPRLLFYPDPTYGGHMLYVI
                     FPGTSAHLHYRLIDRMLTACPGYRFVAHVWQSTFVLVVRRNAEKPTDAEIPTVSAADI
                     YCKMRDISFDGGLMLEYQRLYATFDEFPPP"
     misc_feature    complement(66462..67376)
                     /gene="UL31"
                     /locus_tag="HHV1gp00p43"
                     /note="nuclear egress lamina protein UL31; Provisional;
                     Region: PHA03328"
                     /db_xref="CDD:223046"
     regulatory      66548..66553
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL30"
                     /locus_tag="HHV1gp00p45"
     CDS             complement(67372..69162)
                     /gene="UL32"
                     /locus_tag="HHV1gp00p44"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="YP_009137107.1"
                     /db_xref="GeneID:2703352"
                     /translation="MATSPPGVLASVAVCEESPGSSWKAGAFERAYVAFDPSLLALNE
                     ALCAELLTASHVIGVPPVGTLDEDVAADVVTAPSRARGGAGDGGGSGGRGGPRNPPPD
                     PCGEGLLDTGPFSAAAIDTFALDRPCLVCRTIELYKQTYRLSPQWVADYAFLCAKCLG
                     APHCAASIFVAAFEFVYVMDRHFLRTKKATLVGSFARFALTINDIHRHFFLHCCFRTD
                     GGVPGRHAQKQPKPSPSPGAAKVQYSNYSFLAQSATRALIGTLASGGEEGAGSAAGSG
                     TQPSLTTALMNWKDCARLLDCTEGRRGGGDSCCTRAAARNGEFETVAGDREPEESPDT
                     WAYADLVLLLLAGTPAVWESGPQLRAAAEARRATVRQSWEAHRGARTRDVAPRFAQFT
                     EPDAQPDLDLGPLMATVLKHGRGRGRTGGECLLCNLLLVRAYWLALRRLRASVVRYSE
                     NNTSLFDCIVPVVDQLEADPETQPGDGGRFVSLLRAAGPEAIFKHMFCDPMCAITEME
                     VDPWVLFGHPPATHPDELLLHKAKLACGNEFEGRVCIALRALIYTFKTYQVFVPKPTA
                     LATFVREAGALLRRHSISLLSLEHTLCTYV"
     misc_feature    complement(67375..69156)
                     /gene="UL32"
                     /locus_tag="HHV1gp00p44"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03232"
                     /db_xref="CDD:223015"
     gene            69161..70943
                     /gene="UL33"
                     /locus_tag="HHV1gp00p42"
                     /note="core gene"
                     /db_xref="GeneID:2703353"
     CDS             69161..69553
                     /gene="UL33"
                     /locus_tag="HHV1gp00p42"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="YP_009137108.1"
                     /db_xref="GeneID:2703353"
                     /translation="MAGREGRTRQRTLRDTIPDCALRSQTLESLDARYVSRDGAHDAA
                     VWFEDMTPAELEVVFPTTDAKLNYLSRTQRLASLLTYAGPIKAPDDAAAPQTPDTACV
                     HGELLARKRERFAAVINRFLDLHQILRG"
     misc_feature    69167..69550
                     /gene="UL33"
                     /locus_tag="HHV1gp00p42"
                     /note="DNA packaging protein UL33; Provisional; Region:
                     PHA03229"
                     /db_xref="CDD:223012"
     gene            69633..70943
                     /gene="UL34"
                     /locus_tag="HHV1gp00p41"
                     /note="core gene"
                     /db_xref="GeneID:2703355"
     CDS             69633..70460
                     /gene="UL34"
                     /locus_tag="HHV1gp00p41"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="YP_009137109.1"
                     /db_xref="GeneID:2703355"
                     /translation="MAGLGKPYTGHPGDAFEGLVQRIRLIVPSTLRGGDGEAGPYSPS
                     SLPSRCAFQFHGHDGSDESFPIEYVLRLMNDWAEVPCNPYLRIQNTGVSVLFQGFFHR
                     PHNAPGGAITPERTNVILGSTETTGLSLGDLDTIKGRLGLDARPMMASMWISCFVRMP
                     RVQLAFRFMGPEDAGRTRRILCRAAEQAITRRRRTRRSREAYGAEAGLGVAGTGFRAR
                     GDGFGPLPLLTQGPSRPWHQALRGLKHLRIGPPALVLAAGLVLGAAIWWVVGAGARL"
     misc_feature    69648..70442
                     /gene="UL34"
                     /locus_tag="HHV1gp00p41"
                     /note="nuclear egress membrane protein UL34; Provisional;
                     Region: PHA03323"
                     /db_xref="CDD:223043"
     gene            70566..70943
                     /gene="UL35"
                     /locus_tag="HHV1gp00p40"
                     /note="core gene"
                     /db_xref="GeneID:2703356"
     CDS             70566..70904
                     /gene="UL35"
                     /locus_tag="HHV1gp00p40"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport; VP26; interacts with dynein"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="YP_009137110.1"
                     /db_xref="GeneID:2703356"
                     /translation="MAVPQFHRPSTVTTDSVRALGMRGLVLATNNSQFIMDNNHPHPQ
                     GTQGAVREFLRGQAAALTDLGLAHANNTFTPQPMFAGDAPAAWLRPAFGLRRTYSPFV
                     VREPSTPGTP"
     misc_feature    70581..70877
                     /gene="UL35"
                     /locus_tag="HHV1gp00p40"
                     /note="Herpesvirus UL35 family; Region: Herpes_UL35;
                     pfam04496"
                     /db_xref="CDD:282365"
     regulatory      70938..70943
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL33, UL34, UL35"
     gene            complement(70983..80468)
                     /gene="UL36"
                     /locus_tag="HHV1gp00p39"
                     /note="core gene"
                     /db_xref="GeneID:2703357"
     regulatory      complement(70983..70988)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL36"
                     /locus_tag="HHV1gp00p39"
     CDS             complement(71049..80468)
                     /gene="UL36"
                     /locus_tag="HHV1gp00p39"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport; VP1/2"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="YP_009137111.1"
                     /db_xref="GeneID:2703357"
                     /translation="MIAGTPPHSTMERGGDRDIVVTGARNQFAPDLEPGGSVSCMRSS
                     LSFLSLIFDVGPRDVLSAEAIEGCLVEGGEWTRATAGPGPPRMCSIVELPNFLEYPGA
                     RGGLRCVFSRVYGEVGFFGEPAAGLLETQCPAHTFFAGPWALRPLSYTLLTIGPLGMG
                     LFRDGDTAYLFDPHGLPEGTPAFIAKVRAGDMYPYLTYYTRDRPDVRWAGAMVFFVPS
                     GPEPAAPADLTAAALHLYGASETYLQDEAFSERRVAITHPLRGEIAGLGEPCVGVGPR
                     EGVGGPGPHPPTAAQSPPPTRARRDDRASETSRGTAGPSAKPEAKRPNRAPDDVWAVA
                     LKGTPPTDPPSADPPSADPPSAIPPPPPSAPKTPAAEAAEEDDDDMRVLEMGVVPVGR
                     HRARYSAGLPKRRRPTWTPPSSVEDLTSGEKTKRSAPPAKTKKKSTPKGKTPVGAAVP
                     ASVPEPVLASAPPDPAGPPVAEAGEDDGPTVPASSQALEALKTRRSPEPPGADLAQLF
                     EAHPNVAATAVKFTACSAALAREVAACSRLTISALRSPYPASPGLLELCVIFFFERVL
                     AFLIENGARTHTQAGVAGPAAALLEFTLNMLPWKTAVGDFLASTRLSLADVAAHLPLV
                     QHVLDENSLIGRLALAKLILVARDVIRETDAFYGELADLELQLRAAPPANLYTRLGEW
                     LLERSQAHPDTLFAPATPTHPEPLLYRVQALAKFARGEEIRVEAEDRQMREALDALAR
                     GVDAVSQHAGPLGVMPAPAGAAPQGAPRPPPLGPEAVQVRLEEVRTQARRAIEGAVKE
                     YFYRGAVYSAKALQASDNNDRRFHVASAAVVPVVQLLESLPVFDQHTRDIAQRAAIPA
                     PPPIATSPTAILLRDLIQRGQTLDAPEDLAAWLSVLTDAANQGLIERKPLDELARSIR
                     DINDQQARRSSGLAELRRFDALDAALGQQLDSDAAFVPAPGASPYPDDGGLSPEATRM
                     AEEALRQARAMDAAKLTAELAPDARARLRERARSLEAMLEGARERAKVARDAREKFLH
                     KLQGVLRPLPDFVGLKACPAVLATLRASLPAGWSDLPEAVRGAPPEVTAALRADMWGL
                     LGQYRDALEHPTPDTATALSGLHPSFVVVLKNLFADAPETPFLLQFFADHAPIIAHAV
                     SNAINAGSAAVATADPASTVDAAVRAHRVLVDAVTALGAAASDPASPLAFLAAMADSA
                     AGYVKATRLALDARVAIAQLTTLGSAAADLVVQVRRAANQPEGEHASLIQAATRATTG
                     ARESLAGHEGRFGGLLHAEGTAGDHSPSGRALQELGKVIGATRRRADELEAATADLRE
                     KMAAQRARSSHERWAADVEAVLDRVESGAEFDVVELRRLQALAGTHGYNPRDFRKRAE
                     QALGTNAKAVTLALETALAFNPYTPENQRHPMLPPLAAIHRIDWSAAFGAAADTYADM
                     FRVDTEPLARLLRLAGGLLERAQANDGFIDYHEAVLHLSEDLGGVPALRQYVPFFQKG
                     YAEYVDIRDRLDALRADARRAIGSVALDLAAAAEEISAVRNDPAAAAELVRAGVTLPC
                     PSEDALVACVAALERVDQSPVKDTAYADYVAFVTRQDLADTKDAVVRAKQQRAEATER
                     VTAGLREVLAARERRAQLEAEGLANLKTLLKVVAVPATVAKTLDQARSAEEIADQVEI
                     LVDQTEKARELDVQAVAWLEHAQRTFETHPLSAASGDGPGLLTRQGARLQALFDTRRR
                     VEALRRSLEEAEAEWDEVWGRFGRVRGGAWKSPEGFRAACEQLRALQDTTNTVSGLRA
                     QRDYERLPAKYQGVLGAKSAERAGAVEELGGRVAQHADLSARLRDEVVPRVAWEMNFD
                     TLGGLLAEFDAVAGDLAPWAVEEFRGARELIQRRMGLYSAYAKATGQTGAGAAAAPAP
                     LLVDLRALDARARASAPPGQEADPQMLRRRGEAYLRVSGGPGPLVLREATSTLDRPFA
                     PSFLVPDGTPLQYALCFPAVTDKLGALLMCPEAACIRPPLPTDTLESASTVTAMYVLT
                     VINRLQLALSDAQAANFQLFGRFVRHRQARWGASMDAAAELYVALVATTLTREFGCRW
                     AQLEWGGDAAAPGPPLGPQSSTRHRVSFNENDVLVALVASSPEHIYTFWRLDLVRQHE
                     YMHLTLPRAFQNAADSMLFVQRLTPHPDARIRVLPAFSAGGPPTRGLMFGTRLADWRR
                     GKLSETDPLAPWRSVPELGTERGAALGKLSPAQALAAVSVLGRMCLPSTALVALWTCM
                     FPDDYTEYDSFDALLTARLESGQTLSPSGGREASPPAPPNALYRPTGQHVAVPAAATH
                     RTPAARVTAMDLVLAAVLLGAPVVVALRNTTAFSRESELELCLTLFDSRARGPDAALR
                     DAVSSDIETWAVRLLHADLNPIENACLAAQLPRLSALIAERPLARGPPCLVLVDISMT
                     PVAVLWENPDPPGPPDVRFVGSEATEELPFVAGGEDVLAASATDEDPFLARAILGRPF
                     DASLLSGELFPGHPVYQRAPDDQSPSVPNPTPGPVDLVGAEGSLGPGSLAPTLFTDAT
                     PGEPVPPRMWAWIHGLEELASDDSGGPAPLLAPDPLSPTADQSVPTSQCAPRPPGPAV
                     TAREARPGVPAESTRPAPVGPRDDFRRLPSPQSSPAPPDATAPRPPASSRASAASSSG
                     SRARRHRRARSLARATQASATTQGWRPPALPDTVAPVTDFARPPAPPKPPEPAPHALV
                     SGVPLPLGPQAAGQASPALPIDPVPPPVATGTVLPGGENRRPPLTSGPAPTPPRVPVG
                     GPQRRLTRPAVASLSESRESLPSPWDPADPTAPVLGRNPAEPTSSSPAGPSPPPPAVQ
                     PVAPPPTSGPPPTYLTLEGGVAPGGPVSRRPTTRQPVATPTTSARPRGHLTVSRLSAP
                     QPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQP
                     QPQPQPQPQPQNGHVAPGEYPAVRFRAPQNRPSVPASASSTNPRTGSSLSGVSSWASS
                     LALHIDATPPPVSLLQTLYVSDDEDSDATSLFLSDSEAEALDPLPGEPHSPITNEPFS
                     ALSADDSQEVTRLQFGPPPVSANAVLSRRYVQRTGRSALAVLIRACYRLQQQLQRTRR
                     ALLHHSDAVLTSLHHVRMLLG"
     misc_feature    complement(71052..80438)
                     /gene="UL36"
                     /locus_tag="HHV1gp00p39"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     repeat_region   71604..71814
                     /note="UL reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=71604..71609
     gene            complement(80712..84084)
                     /gene="UL37"
                     /locus_tag="HHV1gp00p38"
                     /note="core gene"
                     /db_xref="GeneID:2703358"
     regulatory      complement(80712..80717)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL37"
                     /locus_tag="HHV1gp00p38"
     CDS             complement(80713..84084)
                     /gene="UL37"
                     /locus_tag="HHV1gp00p38"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="YP_009137112.1"
                     /db_xref="GeneID:2703358"
                     /translation="MADRGLPSEAPVVTTSPAGPPSDGPMQRLLASLAGLRQPPTPTA
                     ETANGADDPAFLATAKLRAAMAAFLLSGTAIAPADARACWRPLLEHLCALHRAHGLPE
                     TALLAENLPGLLVHRLVVALPEAPDQAFREMEVIKDTILAVTGSDTSHALDSAGLRTA
                     AALGPVRVRQCAVEWIDRWQTVTKSCLAMSPRTSIEALGETSLKMAPVPLGQPSANLT
                     TPAYSLLFPAPFVQEGLRFLALVSNRVTLFSAHLQRIDDATLTPLTRALFTLALVDEY
                     LTTPERGAVVPPPLLAQFQHTVREIDPAIMIPPLEANKMVRSREEVRVSTALSRVSPR
                     SACAPPGTLMARVRTDVAVFDPDVPFLSSSALAVFQPAVSSLLQLGEQPSAGAQQRLL
                     ALLQQTWTLIQNTNSPSVVINTLIDAGFTPSHCTHYLSALEGFLAAGVPARTPTGHGL
                     GEVQQLFGCIALAGSNVFGLAREYGYYANYVKTFRRVQGASEHTHGRLCEAVGLSGGV
                     LSQTLARIMGPAVPTEHLASLRRALVGEFETAERRFSSGQPSLLRETALIWIDVYGQT
                     HWDITPTTPATPLSALLPVGQPSHAPSVHLAAATQIRFPALEGIHPNVLADPGFVPYV
                     LALVVGDALRATCSAAYLPRPVEFALRVLAWARDFGLGYLPTVEGHRTKLGALITLLE
                     PAARGGLGPTMQMADNIEQLLRELYVISRGAVEQLRPLVQLQPPPPPEVGTSLLLISM
                     YALAARGVLQDLAERADPLIRQLEDAIVLLRLHMRTLSAFFECRFESDGRRLYAVVGD
                     TPDRLGPWPPEAMGDAVSQYCSMYHDAKRALVASLASLRSVITETTAHLGVCDELAAQ
                     VSHEDNVLAVVRREIHGFLSVVSGIHARASKLLSGDQVPGFCFMGQFLARWRRLSACY
                     QAARAAAGPEPVAEFVQELHDTWKGLQTERAVVVAPLVSSADQRAAAIREVMAHAPED
                     APPQSPAADRVVLTSRRDLGAWGDYSLGPLGQTTAVPDSVDLSRQGLAVTLSMDWLLM
                     NELLRVTDGVFRASAFRPLAGPESPRDLEVRDAGNSLPAPMPMDAQKPEAYGHGPRQA
                     DREGAPHSNTPVEDDEMIPEDTVAPPTDLPLTSYQ"
     misc_feature    complement(80929..84024)
                     /gene="UL37"
                     /locus_tag="HHV1gp00p38"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03173"
                     /db_xref="CDD:223004"
     gene            84531..86021
                     /gene="UL38"
                     /locus_tag="HHV1gp00p37"
                     /note="core gene"
                     /db_xref="GeneID:2703359"
     CDS             84531..85928
                     /gene="UL38"
                     /locus_tag="HHV1gp00p37"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis; VP19C"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="YP_009137113.1"
                     /db_xref="GeneID:2703359"
                     /translation="MKTNPLPATPSVWGGSTVELPPTTRDTAGQGLLRRVLRPPISRR
                     DGPGLPRGSGPRRAASTLWLLGLDGTDAPPGALTPNDDTEQALDKILRGTMRGGAALI
                     GSPRHHLTRQVILTDLCQPNADRAGTLLLALRHPADLPHLAHQRAPPGRQTERLGEAW
                     GQLMEATALGSGRAESGCTRAGLVSFNFLVAACAASYDARDAADAVRAHVTANYRGTR
                     VGARLDRFSECLRAMVHTHVFPHEVMRFFGGLVSWVTQDELASVTAVCAGPQEAAHTG
                     HPGRPRSAVILPACAFVDLDAELGLGGPGAAFLYLVFTYRQRRDQELCCVYVIKSQLP
                     PRGLEPALERLFGRLRITNTIHGTEDMTPPAPNRNPDFPLAGLAANPQTPRCSAGQVT
                     NPQFADRLYRWQPDLRGRPTARTCTYAAFAELGMMPEDSPRCLHRTERFGAVSVPVVI
                     LEGVVWRPGEWRACA"
     misc_feature    84531..85925
                     /gene="UL38"
                     /locus_tag="HHV1gp00p37"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03261"
                     /db_xref="CDD:223026"
     regulatory      86016..86021
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL38"
                     /locus_tag="HHV1gp00p37"
     gene            86443..90987
                     /gene="UL39"
                     /locus_tag="HHV1gp00p36"
                     /note="core gene"
                     /db_xref="GeneID:2703361"
     CDS             86443..89856
                     /gene="UL39"
                     /locus_tag="HHV1gp00p36"
                     /EC_number="1.17.4.1"
                     /note="involved in nucleotide metabolism; translation
                     initiation factor-associated protein (N-terminal region)"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="YP_009137114.1"
                     /db_xref="GeneID:2703361"
                     /translation="MASRPAASSPVEARAPVGGQEAGGPSAATQGEAAGAPLAHGHHV
                     YCQRVNGVMVLSDKTPGSASYRISDSNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA
                     PFVAVTNIGAGSDGGTAVVAFGGTPRRSAGTSTGTQTADVPTEALGGPPPPPRFTLGG
                     GCCSCRDTRRRSAVFGGEGDPVGPAEFVSDDRSSDSDSDDSEDTDSETLSHASSDVSG
                     GATYDDALDSDSSSDDSLQIDGPVCRPWSNDTAPLDVCPGTPGPGADAGGPSAVDPHA
                     PTPEAGAGLAADPAVARDDAEGLSDPRPRLGTGTAYPVPLELTPENAEAVARFLGDAV
                     NREPALMLEYFCRCAREETKRVPPRTFGSPPRLTEDDFGLLNYALVEMQRLCLDVPPV
                     PPNAYMPYYLREYVTRLVNGFKPLVSRSARLYRILGVLVHLRIRTREASFEEWLRSKE
                     VALDFGLTERLREHEAQLVILAQALDHYDCLIHSTPHTLVERGLQSALKYEEFYLKRF
                     GGHYMESVFQMYTRIAGFLACRATRGMRHIALGREGSWWEMFKFFFHRLYDHQIVPST
                     PAMLNLGTRNYYTSSCYLVNPQATTNKATLRAITSNVSAILARNGGIGLCVQAFNDSG
                     PGTASVMPALKVLDSLVAAHNKESARPTGACVYLEPWHTDVRAVLRMKGVLAGEEAQR
                     CDNIFSALWMPDLFFKRLIRHLDGEKNVTWTLFDRDTSMSLADFHGEEFEKLYQHLEV
                     MGFGEQIPIQELAYGIVRSAATTGSPFVMFKDAVNRHYIYDTQGAAIAGSNLCTEIVH
                     PASKRSSGVCNLGSVNLARCVSRQTFDFGRLRDAVQACVLMVNIMIDSTLQPTPQCTR
                     GNDNLRSMGIGMQGLHTACLKLGLDLESAEFQDLNKHIAEVMLLSAMKTSNALCVRGA
                     RPFNHFKRSMYRAGRFHWERFPDARPRYEGEWEMLRQSMMKHGLRNSQFVALMPTAAS
                     AQISDVSEGFAPLFTNLFSKVTRDGETLRPNTLLLKELERTFSGKRLLEVMDSLDAKQ
                     WSVAQALPCLEPTHPLRRFKTAFDYDQKLLIDLCADRAPYVDHSQSMTLYVTEKADGT
                     LPASTLVRLLVHAYKRGLKTGMYYCKVRKATNSGVFGGDDNIVCMSCAL"
     misc_feature    87175..>87519
                     /gene="UL39"
                     /locus_tag="HHV1gp00p36"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03201"
                     /db_xref="CDD:165468"
     misc_feature    87940..89790
                     /gene="UL39"
                     /locus_tag="HHV1gp00p36"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl38938"
                     /db_xref="CDD:393308"
     gene            89925..90987
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="core gene"
                     /db_xref="GeneID:24271470"
     CDS             89925..90947
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /EC_number="1.17.4.1"
                     /note="involved in nucleotide metabolism"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 2"
                     /protein_id="YP_009137115.1"
                     /db_xref="GeneID:24271470"
                     /translation="MDSAAPALSPALTALTGQSATADLAIQIPKCPDPERYFYTSQCP
                     DINHLRSLSILNRWLETELVFVGDEEDVSKLSEGELSFYRFLFAFLSAADDLVTENLG
                     GLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIR
                     AKVDWLEARVRECASVPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLIS
                     RDEAVHTTASCYIYNNYLGGHAKPPPDRVYGLFRQAVEIEIGFIRSQAPTDSHILSPA
                     ALAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAG
                     AVVNDL"
     misc_feature    90033..90839
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="Ribonucleotide reductase, small chain; Region:
                     Ribonuc_red_sm; pfam00268"
                     /db_xref="CDD:365989"
     misc_feature    order(90063..90065,90084..90086,90276..90281,90288..90290,
                     90297..90302,90309..90311,90318..90320,90372..90377,
                     90384..90386)
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(90096..90098,90204..90206,90294..90296,90303..90305,
                     90315..90317,90579..90584,90594..90596)
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="putative radical transfer pathway; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(90204..90206,90294..90296,90303..90305,90483..90485,
                     90585..90587,90594..90596)
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="diiron center [ion binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    90315..90317
                     /gene="UL40"
                     /locus_tag="HHV1gp00p35"
                     /note="tyrosyl radical; other site"
                     /db_xref="CDD:153108"
     regulatory      90982..90987
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL39, UL40"
     gene            complement(91115..92636)
                     /gene="UL41"
                     /locus_tag="HHV1gp00p34"
                     /note="alpha gene"
                     /db_xref="GeneID:2703365"
     regulatory      complement(91115..91120)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL41"
                     /locus_tag="HHV1gp00p34"
     CDS             complement(91167..92636)
                     /gene="UL41"
                     /locus_tag="HHV1gp00p34"
                     /note="mRNA-specific RNase; involved in cellular mRNA
                     degradation"
                     /codon_start=1
                     /product="tegument host shutoff protein"
                     /protein_id="YP_009137116.1"
                     /db_xref="GeneID:2703365"
                     /translation="MGLFGMMKFAHTHHLVKRRGLGAPAGYFTPIAVDLWNVMYTLVV
                     KYQRRYPSYDREAITLHCLCRLLKVFTQKSLFPIFVTDRGVNCMEPVVFGAKAILART
                     TAQCRTDEEASDVDASPPPSPITDSRPSSAFSNMRRRGTSLASGTRGTAGSGAALPSA
                     APSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVYTTDTDLLL
                     MGCDIVLDISACYIPTINCRDILKYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLR
                     ECHWTPPSRSQTRRAIRREHTSSRSTETRPPLPPAAGGTETRVSWTEILTQQIAGGYE
                     DDEDLPLDPRDVTGGHPGPRSSSSEILTPPELVQVPNAQLLEEHRSYVANRRRHVIHD
                     APESLDWLPDPMTITELVEHRYIKYVISLIGPKERGPWTLLKRLPIYQDIRDENLARS
                     IVTRHITAPDIADRFLEQLRTQAPPPAFYKDVLAKFWDE"
     misc_feature    complement(91863..92102)
                     /gene="UL41"
                     /locus_tag="HHV1gp00p34"
                     /note="XPG I-region; Region: XPG_I; cl29533"
                     /db_xref="CDD:392123"
     gene            93112..94637
                     /gene="UL42"
                     /locus_tag="HHV1gp00p33"
                     /note="alpha gene"
                     /db_xref="GeneID:24271471"
     CDS             93112..94578
                     /gene="UL42"
                     /locus_tag="HHV1gp00p33"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="YP_009137117.1"
                     /db_xref="GeneID:24271471"
                     /translation="MTDSPGGVAPASPVEDASDASLGQPEEGAPCQVVLQGAELNGIL
                     QAFAPLRTSLLDSLLVMGDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLV
                     DQKRSLLSVFRANQYPDLRRVELAITGQAPFRTLVQRIWTTTSDGEAVELASETLMKR
                     ELTSFVVLVPQGTPDVQLRLTRPQLTKVLNATGADSATPTTFELGVNGKFSVFTTSTC
                     VTFAAREEGVSSSTSTQVQILSNALTKAGQAAANAKTVYGENTHRTFSVVVDDCSMRA
                     VLRRLQVGGGTLKFFLTTPVPSLCVTATGPNAVSAVFLLKPQKICLDWLGHSQGSPSA
                     GSSASRASGSEPTDSQDSASDAVSHGDPEDLDGAARAGEAGALHACPMPSSTTRVTPT
                     TKRGRSGGEDARADTALKKPKTGSPTAPPPADPVPLDTEDDSDAADGTAARPAAPDAR
                     SGSRYACYFRDLPTGEASPGAFSAFRGGPQTPYGFGFP"
     misc_feature    93202..93618
                     /gene="UL42"
                     /locus_tag="HHV1gp00p33"
                     /note="DNA polymerase processivity factor (UL42); Region:
                     Herpes_UL42; pfam02282"
                     /db_xref="CDD:367017"
     misc_feature    93637..94050
                     /gene="UL42"
                     /locus_tag="HHV1gp00p33"
                     /note="DNA polymerase processivity factor (UL42); Region:
                     Herpes_UL42; pfam02282"
                     /db_xref="CDD:367017"
     regulatory      94632..94637
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL42"
                     /locus_tag="HHV1gp00p33"
     gene            94799..96068
                     /gene="UL43"
                     /locus_tag="HHV1gp00p32"
                     /note="core gene"
                     /db_xref="GeneID:2703408"
     CDS             94799..96052
                     /gene="UL43"
                     /locus_tag="HHV1gp00p32"
                     /note="type 3 membrane protein; possibly involved in
                     membrane fusion; 11 transmembrane domains"
                     /codon_start=1
                     /product="envelope protein UL43"
                     /protein_id="YP_009137118.1"
                     /db_xref="GeneID:2703408"
                     /translation="MLRNDSHRAVSPEDGQGRVDDGRPHLACVGALARGFMHIWLQAA
                     TLGFAGSVVMSRGPYANAASGAFAVGCAVLGFMRAPPPLARPTARIYAWLKLAAGGAA
                     LVLWSLGEPGTQPGAPAPGPATQCLALGAAYAALLVLADDVYPLFLLAPGPLFVGTLG
                     MVVGGLTIGGSARYWWIGGPAAAALAAAVLAGPGATTARDCFSRACPDHRRVCVITAG
                     ESLSRRPPEDPERPGVPGPPSPPTPQRSHGPPADEVAPARVARPENVWVPVVTFLGAG
                     ALAVKTVREHARGTPGPGLPLWPQVFLGGHVAVALTELCQALAPWDLTDPLLFVHAGL
                     QVINLGLVFRFSEVVVYAALGGAVWISLAQVLGLRRRLHRKDPGDGARLAATLRGLFF
                     SVYALGFGVGVLLCPPGSTGGRSGD"
     misc_feature    94808..96043
                     /gene="UL43"
                     /locus_tag="HHV1gp00p32"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03179"
                     /db_xref="CDD:223006"
     regulatory      96063..96068
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL43"
                     /locus_tag="HHV1gp00p32"
     gene            96312..98669
                     /gene="UL44"
                     /locus_tag="HHV1gp00p31"
                     /note="alpha gene"
                     /db_xref="GeneID:2703410"
     CDS             96312..97847
                     /gene="UL44"
                     /locus_tag="HHV1gp00p31"
                     /note="type 1 membrane protein; contains a signal peptide;
                     binds cell surface heparan sulphate; binds complement C3b
                     to block neutralization; involved in cell attachment"
                     /codon_start=1
                     /product="envelope glycoprotein C"
                     /protein_id="YP_009137119.1"
                     /db_xref="GeneID:2703410"
                     /translation="MAPGRVGLAVVLWSLLWLGAGVSGGSETASTGPTITAGAVTNAS
                     EAPTSGSPGSAASPEVTPTSTPNPNNVTQNKTTPTEPASPPTTPKPTSTPKSPPTSTP
                     DPKPKNNTTPAKSGRPTKPPGPVWCDRRDPLARYGSRVQIRCRFRNSTRMEFRLQIWR
                     YSMGPSPPIAPAPDLEEVLTNITAPPGGLLVYDSAPNLTDPHVLWAEGAGPGADPPLY
                     SVTGPLPTQRLIIGEVTPATQGMYYLAWGRMDSPHEYGTWVRVRMFRPPSLTLQPHAV
                     MEGQPFKATCTAAAYYPRNPVEFVWFEDDHQVFNPGQIDTQTHEHPDGFTTVSTVTSE
                     AVGGQVPPRTFTCQMTWHRDSVTFSRRNATGLALVLPRPTITMEFGVRHVVCTAGCVP
                     EGVTFAWFLGDDPSPAAKSAVTAQESCDHPGLATVRSTLPISYDYSEYICRLTGYPAG
                     IPVLEHHGSHQPPPRDPTERQVIEAIEWVGIGIGVLAAGVLVVTAIVYVVRTSQSRQR
                     HRR"
     misc_feature    96312..97844
                     /gene="UL44"
                     /locus_tag="HHV1gp00p31"
                     /note="envelope glycoprotein C; Provisional; Region:
                     PHA03270"
                     /db_xref="CDD:165528"
     gene            98033..98669
                     /gene="UL45"
                     /locus_tag="HHV1gp00p30"
                     /note="alpha gene"
                     /db_xref="GeneID:24271472"
     CDS             98033..98551
                     /gene="UL45"
                     /locus_tag="HHV1gp00p30"
                     /note="type 2 membrane protein; tegument-associated;
                     possibly involved in membrane fusion"
                     /codon_start=1
                     /product="membrane protein UL45"
                     /protein_id="YP_009137120.1"
                     /db_xref="GeneID:24271472"
                     /translation="MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAA
                     LVLVPSRASWALSPCDSGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQL
                     AAVARVQSARSSGYWWVSGDGIRACLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQ
                     FVTSTRNALGLP"
     misc_feature    98042..98545
                     /gene="UL45"
                     /locus_tag="HHV1gp00p30"
                     /note="UL45 protein, carbohydrate-binding C-type
                     lectin-like; Region: UL45; pfam05473"
                     /db_xref="CDD:368457"
     regulatory      98664..98669
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL44, UL45"
     gene            complement(98727..103117)
                     /gene="UL47"
                     /locus_tag="HHV1gp00p28"
                     /note="alpha gene"
                     /db_xref="GeneID:2703415"
     gene            complement(98727..100953)
                     /gene="UL46"
                     /locus_tag="HHV1gp00p29"
                     /note="alpha gene"
                     /db_xref="GeneID:2703413"
     regulatory      complement(98727..98732)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL46, UL47"
     CDS             complement(98797..100953)
                     /gene="UL46"
                     /locus_tag="HHV1gp00p29"
                     /note="modulates transactivating tegument protein VP16;
                     possibly involved in gene regulation"
                     /codon_start=1
                     /product="tegument protein VP11/12"
                     /protein_id="YP_009137121.1"
                     /db_xref="GeneID:2703413"
                     /translation="MQRRTRGASSLRLARCLTPANLIRGDNAGVPERRIFGGCLLPTP
                     EGLLSAAVGALRQRSDDAQPAFLTCTDRSVRLAARQHNTVPESLIVDGLASDPHYEYI
                     RHYASAATQALGEVELPGGQLSRAILTQYWKYLQTVVPSGLDVPEDPVGDCDPSLHVL
                     LRPTLAPKLLARTPFKSGAVAAKYAATVAGLRDALHRIQQYMFFMRPADPSRPSTDTA
                     LRLNELLAYVSVLYRWASWMLWTTDKHVCHRLSPSNRRFLPLGGSPEAPAETFARHLD
                     RGPSGTTGSMQCMALRAAVSDVLGHLTRLANLWQTGKRSGGTYGTVDTVVSTVEVLSI
                     VHHHAQYIINATLTGYGVWATDSLNNEYLRAAVDSQERFCRTTAPLFPTMTAPSWARM
                     ELSIKAWFGAALAADLLRNGAPSLHYESILRLVASRRTTWSAGPPPDDMASGPGGHRA
                     GGGTCREKIQRARRDNEPPPLPRPRLHSTPASTRRFRRRRADGAGPPLPDANDPVAEP
                     PAAATQPATYYTHMGEVPPRLPARNVAGPDRRPPAATCPLLVRRASLGSLDRPRVWGP
                     APEGEPDQMEATYLTADDDDDDARRKATHAASARERHAPYEDDESIYETVSEDGGRVY
                     EEIPWMRVYENVCVNTANAAPASPYIEAENPLYDWGGSALFSPPGRTGPPPPPLSPSP
                     VLARHRANALTNDGPTNVAALSALLTKLKREGRRSR"
     misc_feature    complement(98800..100953)
                     /gene="UL46"
                     /locus_tag="HHV1gp00p29"
                     /note="tegument protein VP11/12; Provisional; Region:
                     PHA03321"
                     /db_xref="CDD:223041"
     CDS             complement(101036..103117)
                     /gene="UL47"
                     /locus_tag="HHV1gp00p28"
                     /note="modulates transactivating tegument protein VP16;
                     RNA-binding protein; possibly involved in gene regulation"
                     /codon_start=1
                     /product="tegument protein VP13/14"
                     /protein_id="YP_009137122.1"
                     /db_xref="GeneID:2703415"
                     /translation="MSAREPAGRRRRASTRPRASPVADEPAGDGVGFMGYLRAVFRGD
                     DDSELEALEEMAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQRPGPDAARSQSV
                     RGRLDDDDEVPRGPPQARQGGYLGPVDARAILGRVGGSRVAPSPLFLEELQYEEDDYP
                     EAVGPEDGGGARSPPKVEVLEGRVPGPELRAAFPLDRLAPQVAVWDESVRSALALGHP
                     AGFYPCPDSAFGLSRVGVMHFASPDNPAVFFRQTLQQGEALAWYITGDGILDLTDRRT
                     KTSPAQAMSFLADAVVRLAINGWVCGTRLHAEARGSDLDDRAAELRRQFASLTALRPV
                     GAAAVPLLSAGGLVSPQSGPDAAVFRSSLGSLLYWPGVRALLDRDCRVAARYAGRMTY
                     LATGALLARFNPDAVRCVLTREAAFLGRVLDVLAVMAEQTVQWLSVVVGARLHPHVHH
                     PAFADVAREELFRALPLGSPAVVGAEHEALGDTAARRLLANSGLNAVLGAAVYALHTA
                     LATVTLKYARACGDAHRRRDDAAATRAILAAGLVLQRLLGFADTVVACVTLAAFDGGF
                     TAPEVGTYTPLRYACVLRATQPLYARTTPAKFWADVRAAAEHVDLRPASSAPRAPVSG
                     TADPAFLLKDLEPFPPAPVSGGSVLGPRVRVVDIMSQFRKLLMGDEGAAALRAHVSGR
                     RATGLGGPPRP"
     misc_feature    complement(101264..102415)
                     /gene="UL47"
                     /locus_tag="HHV1gp00p28"
                     /note="Herpesvirus UL47 protein; Region: Herpes_UL47;
                     pfam03362"
                     /db_xref="CDD:281371"
     gene            complement(103538..105080)
                     /gene="UL48"
                     /locus_tag="HHV1gp00p27"
                     /note="alpha gene"
                     /db_xref="GeneID:24271473"
     regulatory      complement(103538..103543)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL48"
                     /locus_tag="HHV1gp00p27"
     CDS             complement(103608..105080)
                     /gene="UL48"
                     /locus_tag="HHV1gp00p27"
                     /note="transactivates immediate early genes; involved in
                     gene regulation; involved in virion morphogenesis"
                     /codon_start=1
                     /product="transactivating tegument protein VP16"
                     /protein_id="YP_009137123.1"
                     /db_xref="GeneID:24271473"
                     /translation="MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLS
                     QAQLMPSPPMPVPPAALFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYREC
                     KFLSTLPSDVVEWGDAYVPERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAE
                     LRAREESYRTVLANFCSALYRYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRE
                     TARLARVLFLHLYLFLTREILWAAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFV
                     NGALTVRGVPIEARRLRELNHIREHLNLPLVRSAATEEPGAPLTTPPTLHGNQARASG
                     YFMVLIRAKLDSYSSFTTSPSEAVMREHAYSRARTKNNYGSTIEGLLDLPDDDAPEEA
                     GLAAPRLSFLPAGHTRRLSTAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDG
                     DSPGPGFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"
     misc_feature    complement(103611..105080)
                     /gene="UL48"
                     /locus_tag="HHV1gp00p27"
                     /note="transactivating tegument protein VP16; Provisional;
                     Region: PHA03380"
                     /db_xref="CDD:223067"
     gene            complement(105463..106994)
                     /gene="UL49A"
                     /locus_tag="HHV1gp00p26"
                     /note="core gene"
                     /db_xref="GeneID:2703419"
     gene            complement(105463..106392)
                     /gene="UL49"
                     /locus_tag="HHV1gp00p25"
                     /db_xref="GeneID:2703417"
     regulatory      complement(105463..105468)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL49, UL49A"
     CDS             complement(105487..106392)
                     /gene="UL49"
                     /locus_tag="HHV1gp00p25"
                     /note="involved in virion morphogenesis; possibly involved
                     in RNA transport to uninfected cells"
                     /codon_start=1
                     /product="tegument protein VP22"
                     /protein_id="YP_009137124.1"
                     /db_xref="GeneID:2703417"
                     /translation="MTSRRSVKSGPREVPRDEYEDLYYTPSSGMASPDSPPDTSRRGA
                     LQTRSRQRGEVRFVQYDESDYALYGGSSSEDDEHPEVPRTRRPVSGAVLSGPGPARAP
                     PPPAGSGGAGRTPTTAPRAPRTQRVATKAPAAPAAETTRGRKSAQPESAALPDAPAST
                     APTRSKTPAQGLARKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAAMHARMAAV
                     QLWDMSRPRTDEDLNELLGITTIRVTVCEGKNLLQRANELVNPDVVQDVDAATATRGR
                     SAASRPTERPRAPARSASRPRRPVE"
     misc_feature    complement(105490..106392)
                     /gene="UL49"
                     /locus_tag="HHV1gp00p25"
                     /note="tegument protein VP22; Provisional; Region:
                     PHA03381"
                     /db_xref="CDD:177618"
     CDS             complement(106719..106994)
                     /gene="UL49A"
                     /locus_tag="HHV1gp00p26"
                     /note="type 1 membrane protein; contains a signal peptide;
                     complexed with envelope glycoprotein M; involved in virion
                     morphogenesis; involved in membrane fusion; not
                     glycosylated"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="YP_009137125.1"
                     /db_xref="GeneID:2703419"
                     /translation="MGPPRRVCRAGLLFVLLVALAAGDAGPRGEPPGEEGGRDGIGGA
                     RCETQNTGQMSAPGALVPFYVGMASMGVCIIAHVCQICQRLLAAGHA"
     gene            107011..108158
                     /gene="UL50"
                     /locus_tag="HHV1gp00p24"
                     /note="core gene"
                     /db_xref="GeneID:2703421"
     CDS             107011..108126
                     /gene="UL50"
                     /locus_tag="HHV1gp00p24"
                     /EC_number="3.6.1.23"
                     /note="involved in nucleotide metabolism; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="YP_009137126.1"
                     /db_xref="GeneID:2703421"
                     /translation="MSQWGSGAILVQPDSLGRGYDGDWHTAVATRGGGVVQLNLVNRR
                     AVAFMPKVSGDSGWAVGRVSLDLRMAMPADFCAIIHAPALASPGHHVILGLIDSGYRG
                     TVMAVVVAPKRTREFAPGTLRVDVTFLDILATPPALTEPISLRQFPQLAPPPPTGAGI
                     REDPWLEGALGAPSVTTALPARRRGRSLVYAGELTPVQTEHGDGVREAIAFLPKREED
                     AGFDIVVRRPVTVPANGTTVVQPSLRMLHADAGPAACYVLGRSSLNARGLLVVPTRWL
                     PGHVCAFVVYNLTGVPVTLEAGAKVAQLLVAGADALPWIPPDNFHGTKALRNYPRGVP
                     DSTAEPRNPPLLVFTNEFDAEAPPSERGTGGFGSTGI"
     misc_feature    107011..108123
                     /gene="UL50"
                     /locus_tag="HHV1gp00p24"
                     /note="dUTPase; Provisional; Region: PHA03130"
                     /db_xref="CDD:222995"
     regulatory      108153..108158
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL50"
                     /locus_tag="HHV1gp00p24"
     gene            complement(108277..109012)
                     /gene="UL51"
                     /locus_tag="HHV1gp00p23"
                     /note="core gene"
                     /db_xref="GeneID:2703422"
     regulatory      complement(108277..108282)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL51"
                     /locus_tag="HHV1gp00p23"
     CDS             complement(108278..109012)
                     /gene="UL51"
                     /locus_tag="HHV1gp00p23"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="YP_009137127.1"
                     /db_xref="GeneID:2703422"
                     /translation="MASLLGAICGWGARPEEQYEMIRAAVPPSEAEPRLQEALAVVNA
                     LLPAPITLDDALGSLDDTRRLVKARALARTYHACMVNLERLARHHPGLEAPTIDGAVA
                     AHQDKMRRLADTCMATILQMYMSVGAADKSADVLVSQAIRSMAESDVVMEDVAIAERA
                     LGLSAFGVAGGTRSGGIGVTEAPSLGHPHTPPPEVTLAPAARNGDALPDPKPESCPRV
                     SVPRPTASPTAPRPGPSRAAPCVLGQ"
     misc_feature    complement(108518..108991)
                     /gene="UL51"
                     /locus_tag="HHV1gp00p23"
                     /note="Herpesvirus UL51 protein; Region: Herpes_UL51;
                     pfam04540"
                     /db_xref="CDD:282408"
     gene            109049..113449
                     /gene="UL52"
                     /locus_tag="HHV1gp00p22"
                     /note="core gene"
                     /db_xref="GeneID:2703423"
     CDS             109049..112225
                     /gene="UL52"
                     /locus_tag="HHV1gp00p22"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="YP_009137128.1"
                     /db_xref="GeneID:2703423"
                     /translation="MGQEDGNRGERRAAGTPVEVTALYATDGCVITSSIALLTNSLLG
                     AEPVYIFSYDAYTHDGRADGPTEQDRFEESRALYQASGGLNGDSFRVTFCLLGTEVGG
                     THQARGRTRPMFVCRFERADDVAALQDALAHGTPLQPDHIAATLDAEATFALHANMIL
                     ALTVAINNASPRTGRDAAAAQYDQGASLRSLVGRTSLGQRGLTTLYVHHEVRVLAAYR
                     RAYYGSAQSPFWFLSKFGPDEKSLVLTTRYYLLQAQRLGGAGATYDLQAIKDICATYA
                     IPHAPRPDTVSAASLTSFAAITRFCCTSQYARGAAAAGFPLYVERRIAADVRETSALE
                     KFITHDRSCLRVSDREFITYIYLAHFECFSPPRLATHLRAVTTHDPNPAASTEQPSPL
                     GREAVEQFFCHVRAQLNIGEYVKHNVTPRETVLDGDTAKAYLRARTYAPGALTPAPAY
                     CGAVDSATKMMGRLADAEKLLVPRGWPAFAPASPGEDTAGGTPPPQTCGIVKRLLRLA
                     ATEQQGPTPPAIAALIRNAAVQTPLPVYRISMVPTGQAFAALAWDDWARITRDARLAE
                     AVVSAEAAAHPDHGALGRRLTDRIRAQGPVMPPGGLDAGGQMYVNRNEIFNGALAITN
                     IILDLDIALKEPVPFRRLHEALGHFRRGALAAVQLLFPAARVDPDAYPCYFFKSACRP
                     GPASVGSGSGLGNDDDGDWFPCYDDAGDEEWAEDPGAMDTSHDPPDDEVAYFDLCHEV
                     GPTAEPRETDSPVCSCTDKIGLRVCMPVPAPYVVHGSLTMRGVARVIQQAVLLDRDFV
                     EAIGSYVKNFLLIDTGVYAHGHSLRLPYFAKIAPDGPACGRLLPVFVIPPACKDVPAF
                     VAAHADPRRFHFHAPPTYLASPREIRVLHSLGGDYVSFFERKASRNALEHFGRRETLT
                     EVLGRYNVQPDAGGTVEGFASELLGRIVACIETHFPEHAGEYQAVSVRRAVSKDDWVL
                     LQLVPVRGTLQQSLSCLRFKHGRASRATARTFVALSVGANNRLCVSLCQQCFAAKCDS
                     NRLHTLFTIDAGTPCSPSVPCSTSQPSS"
     misc_feature    109076..112222
                     /gene="UL52"
                     /locus_tag="HHV1gp00p22"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03145"
                     /db_xref="CDD:165416"
     gene            112180..113449
                     /gene="UL53"
                     /locus_tag="HHV1gp00p21"
                     /note="alpha gene"
                     /db_xref="GeneID:2703425"
     CDS             112180..113196
                     /gene="UL53"
                     /locus_tag="HHV1gp00p21"
                     /note="type 3 membrane protein; contains a signal peptide;
                     4 transmembrane domains; involved in virion morphogenesis;
                     involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein K"
                     /protein_id="YP_009137129.1"
                     /db_xref="GeneID:2703425"
                     /translation="MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPT
                     GTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDAMN
                     RRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPAT
                     YLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIV
                     GCELMLRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCILRRGPA
                     PKNADKAAAPGRSKGLSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRR
                     LFDV"
     misc_feature    112180..113193
                     /gene="UL53"
                     /locus_tag="HHV1gp00p21"
                     /note="envelope glycoprotein K; Provisional; Region:
                     PHA03276"
                     /db_xref="CDD:165533"
     regulatory      113444..113449
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL52, UL53"
     gene            113735..115283
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
                     /note="core gene; immediate early gene"
                     /db_xref="GeneID:24271474"
     CDS             113735..115273
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport; ICP27; MER family"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="YP_009137130.1"
                     /db_xref="GeneID:24271474"
                     /translation="MATDIDMLIDLGLDLSDSDLDEDPPEPAESRRDDLESDSSGECS
                     SSDEDMEDPHGEDGPEPILDAARPAVRPSRPEDPGVPSTQTPRPTERQGPNDPQPAPH
                     SVWSRLGARRPSCSPEQHGGKVARLQPPPTKAQPARGGRRGRRRGRGRGGPGAADGLS
                     DPRRRAPRTNRNPGGPRPGAGWTDGPGAPHGEAWRGSEQPDPPGGQRTRGVRQAPPPL
                     MTLAIAPPPADPRAPAPERKAPAADTIDATTRLVLRSISERAAVDRISESFGRSAQVM
                     HDPFGGQPFPAANSPWAPVLAGQGGPFDAETRRVSWETLVAHGPSLYRTFAGNPRAAS
                     TAKAMRDCVLRQENFIEALASADETLAWCKMCIHHNLPLRPQDPIIGTAAAVLDNLAT
                     RLRPFLQCYLKARGLCGLDELCSRRRLADIKDIASFVFVILARLANRVERGVAEIDYA
                     TLGVGVGEKMHFYLPGACMAGLIEILDTHRQECSSRVCELTASHIVAPPYVHGKYFYC
                     NSLF"
     misc_feature    <113906..114640
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    114023..114145
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
                     /note="Herpes viral adaptor-to-host cellular mRNA binding
                     domain; Region: HHV-1_VABD; pfam16852"
                     /db_xref="CDD:293457"
     misc_feature    114647..115258
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:368451"
     regulatory      115278..115283
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL54"
                     /locus_tag="HHV1gp00p20"
     gene            115497..116104
                     /gene="UL55"
                     /locus_tag="HHV1gp00p19"
                     /db_xref="GeneID:2703427"
     CDS             115497..116057
                     /gene="UL55"
                     /locus_tag="HHV1gp00p19"
                     /codon_start=1
                     /product="nuclear protein UL55"
                     /protein_id="YP_009137131.1"
                     /db_xref="GeneID:2703427"
                     /translation="MTATPLTNLFLRAPDITHVAPPYCLNATWQAETAMHTSKTDSAC
                     VAVRSYLVRASCETSGTIHCFFFAVYKDTHHTPPLITELRNFADLVNHPPVLRELEDK
                     RGVRLRCARPFSVGTIKDVSGSGASSAGEYTINGIVYHCHCRYPFSKTCWMGASAALQ
                     HLRSISSSGMAARAAEHRRVKIKIKA"
     misc_feature    115500..116015
                     /gene="UL55"
                     /locus_tag="HHV1gp00p19"
                     /note="Herpesvirus UL55 protein; Region: Herpes_UL55;
                     pfam04537"
                     /db_xref="CDD:282405"
     regulatory      116099..116104
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL55"
                     /locus_tag="HHV1gp00p19"
     gene            complement(116197..116926)
                     /gene="UL56"
                     /locus_tag="HHV1gp00p18"
                     /note="alpha gene"
                     /db_xref="GeneID:2703428"
     regulatory      complement(116197..116202)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL56"
                     /locus_tag="HHV1gp00p18"
     regulatory      complement(116201..116206)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL56"
                     /locus_tag="HHV1gp00p18"
     CDS             complement(116222..116926)
                     /gene="UL56"
                     /locus_tag="HHV1gp00p18"
                     /note="type 2 membrane protein; possibly involved in
                     vesicular trafficking; UL56 family"
                     /codon_start=1
                     /product="membrane protein UL56"
                     /protein_id="YP_009137132.1"
                     /db_xref="GeneID:2703428"
                     /translation="MASEAAQPDAGLWSAGNAFADPPPPYDSLSGRNEGPFVVIDLDT
                     PTDPPPPYSAGPLLSVPIPPTSSGEGEASERGRSRQAAQRAARRARRRAERRAQRRSF
                     GPGGLLATPLFLPETRLVAPPDITRDLLSGLPTYAEAMSDHPPTYATVVAVRSTEQPS
                     GALAPDDQRRTQNSGAWRPPRVNSRELYRAQRAARGSSDHAPYRRQGCCGVVWRHAVF
                     GVVAIVVVIILVFLWR"
     misc_feature    complement(116342..116926)
                     /gene="UL56"
                     /locus_tag="HHV1gp00p18"
                     /note="Herpesvirus UL56 protein; Region: Herpes_UL56;
                     pfam04534"
                     /db_xref="CDD:282402"
     repeat_region   117160..117341
                     /note="RL reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=117160..117176
     repeat_region   117161..126373
                     /note="IRL; inverted repeat flanking UL"
                     /rpt_type=inverted
     repeat_region   117548..117568
                     /note="RL reiteration set 2"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=117548..117550
     repeat_region   117789..117820
                     /note="RL reiteration set 3"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=117789..117793
     gene            118777..127151
                     /gene="LAT"
                     /locus_tag="HHV1gp00s02"
                     /db_xref="GeneID:24271497"
     regulatory      118777..118782
                     /regulatory_class="TATA_box"
                     /gene="LAT"
                     /locus_tag="HHV1gp00s02"
     ncRNA           join(118805..119464,121421..127151)
                     /ncRNA_class="other"
                     /gene="LAT"
                     /locus_tag="HHV1gp00s02"
                     /product="LAT"
                     /db_xref="GeneID:24271497"
     repeat_region   120496..120642
                     /note="RL reiteration set 4"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=120496..120511
     gene            complement(120675..124287)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /note="immediate early gene"
                     /db_xref="GeneID:2703390"
     mRNA            complement(join(120675..122487,122624..123290,
                     124056..124287))
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /product="ubiquitin E3 ligase ICP0"
                     /db_xref="GeneID:2703390"
     regulatory      complement(120692..120697)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
     CDS             complement(join(120884..122487,122624..123290,
                     124056..124112))
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /note="ubiquitin E3 ligase ICP0"
                     /codon_start=1
                     /product="contains a RING finger; disrupts ND10;
                     proteasome-dependent degradation of several cellular
                     proteins; involved in gene regulation; involved in
                     cellular protein degradation; involved in latency"
                     /protein_id="YP_009137133.1"
                     /db_xref="GeneID:2703390"
                     /translation="MEPRPGASTRRPEGRPQREPAPDVWVFPCDRDLPDSSDSEAETE
                     VGGRGDADHHDDDSASEADSTDTELFETGLLGPQGVDGGAVSGGSPPREEDPGSCGGA
                     PPREDGGSDEGDVCAVCTDEIAPHLRCDTFPCMHRFCIPCMKTWMQLRNTCPLCNAKL
                     VYLIVGVTPSGSFSTIPIVNDPQTRMEAEEAVRAGTAVDFIWTGNQRFAPRYLTLGGH
                     TVRALSPTHPEPTTDEDDDDLDDADYVPPAPRRTPRAPPRRGAAAPPVTGGASHAAPQ
                     PAAARTAPPSAPIGPHGSSNTNTTTNSSGGGGSRQSRAAAPRGASGPSGGVGVGVGVV
                     EAEAGRPRGRTGPLVNRPAPLANNRDPIVISDSPPASPHRPPAAPMPGSAPRPGPPAS
                     AAASGPARPRAAVAPCVRAPPPGPGPRAPAPGAEPAARPADARRVPQSHSSLAQAANQ
                     EQSLCRARATVARGSGGPGVEGGHGPSRGAAPSGAAPLPSAASVEQEAAVRPRKRRGS
                     GQENPSPQSTRPPLAPAGAKRAATHPPSDSGPGGRGQGGPGTPLTSSAASASSSSASS
                     SSAPTPAGAASSAAGAASSSASASSGGAVGALGGRQEETSLGPRAASGPRGPRKCARK
                     TRHAETSGAVPAGGLTRYLPISGVSSVVALSPYVNKTITGDCLPILDMETGNIGAYVV
                     LVDQTGNMATRLRAAVPGWSRRTLLPETAGNHVMPPEYPTAPASEWNSLWMTPVGNML
                     FDQGTLVGALDFRSLRSRHPWSGEQGASTRDEGKQ"
     misc_feature    complement(122880..123002)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /note="Zinc finger, C3HC4 type (RING finger); Region:
                     zf-C3HC4; pfam00097"
                     /db_xref="CDD:333836"
     misc_feature    complement(order(122880..122882,122889..122891,
                     122922..122924,122931..122933,122940..122942,
                     122946..122948,122991..122993,123000..123002))
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:319361"
     misc_feature    complement(121859..>122431)
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK12323"
                     /db_xref="CDD:237057"
     repeat_region   123750..123908
                     /note="RL reiteration set 5"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=123750..123806
     regulatory      complement(124282..124287)
                     /regulatory_class="TATA_box"
                     /gene="RL2"
                     /locus_tag="HHV1gp00p17"
     gene            complement(124834..125861)
                     /gene="RL1"
                     /locus_tag="HHV1gp00p16"
                     /db_xref="GeneID:2703396"
     regulatory      complement(124834..124839)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL1"
                     /locus_tag="HHV1gp00p16"
     CDS             complement(125115..125861)
                     /gene="RL1"
                     /locus_tag="HHV1gp00p16"
                     /note="virion protein; inhibits stress-induced
                     translational arrest; related to eIF2 phosphatase
                     regulatory subunit GADD34; binds protein phosphatase 1 to
                     form a holoenzyme capable of dephosphorylating eIF2-alpha;
                     involved in translational regulation"
                     /codon_start=1
                     /product="neurovirulence protein ICP34.5"
                     /protein_id="YP_009137134.1"
                     /db_xref="GeneID:2703396"
                     /translation="MARRRRHRGPRRPRPPGPTGAVPTAQSQVTSTPNSEPAVRSAPA
                     AAPPPPPAGGPPPSCSLLLRQWLHVPESASDDDDDDDWPDSPPPEPAPEARPTAAAPR
                     PRPPPPGVGPGGGADPSHPPSRPFRLPPRLALRLRVTAEHLARLRLRRAGGEGAPEPP
                     ATPATPATPATPATPARVRFSPHVRVRHLVVWASAARLARRGSWARERADRARFRRRV
                     AEAEAVIGPCLGPEARARALARGAGPANSV"
     misc_feature    complement(125166..>125333)
                     /gene="RL1"
                     /locus_tag="HHV1gp00p16"
                     /note="Phosphatase-1 catalytic subunit binding region;
                     Region: PP1c_bdg; pfam10488"
                     /db_xref="CDD:256021"
     repeat_region   125334..125386
                     /note="RL reiteration set 6"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=125334..125342
     repeat_region   125975..132607
                     /note="IRS; inverted repeat flanking US"
                     /rpt_type=inverted
     repeat_region   125975..126373
                     /note="'a' sequence"
                     /rpt_type=inverted
     repeat_region   126054..126276
                     /note="'a' sequence reiteration set"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=126054..126065
     repeat_region   126573..126712
                     /note="RS reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=126573..126588
     repeat_region   126813..127145
                     /note="RS reiteration set 2"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=126813..126829
     regulatory      127146..127151
                     /regulatory_class="polyA_signal_sequence"
                     /gene="LAT"
                     /locus_tag="HHV1gp00s02"
     gene            complement(127173..131460)
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
                     /note="alpha gene; immediate early gene"
                     /db_xref="GeneID:2703392"
     mRNA            complement(127173..131431)
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
                     /product="transcriptional regulator ICP4"
                     /db_xref="GeneID:2703392"
     regulatory      complement(127187..127192)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
     CDS             complement(127235..131131)
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
                     /note="involved in gene regulation"
                     /codon_start=1
                     /product="transcriptional regulator ICP4"
                     /protein_id="YP_009137135.1"
                     /db_xref="GeneID:2703392"
                     /translation="MASENKQRPGSPGPTDGPPPTPSPDRDERGALGWGAETEEGGDD
                     PDHDPDHPHDLDDARRDGRAPAAGTDAGEDAGDAVSPRQLALLASMVEEAVRTIPTPD
                     PAASPPRTPAFRADDDDGDEYDDAADAAGDRAPARGREREAPLRGAYPDPTDRLSPRP
                     PAQPPRRRRHGRWRPSASSTSSDSGSSSSSSASSSSSSSDEDEDDDGNDAADHAREAR
                     AVGRGPSSAAPAAPGRTPPPPGPPPLSEAAPKPRAAARTPAASAGRIERRRARAAVAG
                     RDATGRFTAGQPRRVELDADAASGAFYARYRDGYVSGEPWPGAGPPPPGRVLYGGLGD
                     SRPGLWGAPEAEEARRRFEASGAPAAVWAPELGDAAQQYALITRLLYTPDAEAMGWLQ
                     NPRVVPGDVALDQACFRISGAARNSSSFITGSVARAVPHLGYAMAAGRFGWGLAHAAA
                     AVAMSRRYDRAQKGFLLTSLRRAYAPLLARENAALTGAAGSPGAGADDEGVAAVAAAA
                     PGERAVPAGYGAAGILAALGRLSAAPASPAGGDDPDAARHADADDDAGRRAQAGRVAV
                     ECLAACRGILEALAEGFDGDLAAVPGLAGARPASPPRPEGPAGPASPPPPHADAPRLR
                     AWLRELRFVRDALVLMRLRGDLRVAGGSEAAVAAVRAVSLVAGALGPALPRDPRLPSS
                     AAAAAADLLFDNQSLRPLLAAAASAPDAADALAAAAASAAPREGRKRKSPGPARPPGG
                     GGPRPPKTKKSGADAPGSDARAPLPAPAPPSTPPGPEPAPAQPAAPRAAAAQARPRPV
                     ALSRRPAEGPDPLGGWRRQPPGPSHTAAPAAAALEAYCSPRAVAELTDHPLFPVPWRP
                     ALMFDPRALASIAARCAGPAPAAQAACGGGDDDDNPHPHGAAGGRLFGPLRASGPLRR
                     MAAWMRQIPDPEDVRVVVLYSPLPGEDLAGGGASGGPPEWSAERGGLSCLLAALANRL
                     CGPDTAAWAGNWTGAPDVSALGAQGVLLLSTRDLAFAGAVEFLGLLASAGDRRLIVVN
                     TVRACDWPADGPAVSRQHAYLACELLPAVQCAVRWPAARDLRRTVLASGRVFGPGVFA
                     RVEAAHARLYPDAPPLRLCRGGNVRYRVRTRFGPDTPVPMSPREYRRAVLPALDGRAA
                     ASGTTDAMAPGAPDFCEEEAHSHRACARWGLGAPLRPVYVALGREAVRAGPARWRGPR
                     RDFCARALLEPDDDAPPLVLRGDDDGPGALPPAPPGIRWASATGRSGTVLAAAGAVEV
                     LGAEAGLATPPRREVVDWEGAWDEDDGGAFEGDGVL"
     misc_feature    complement(127397..130981)
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
                     /note="transcriptional regulator ICP4; Provisional;
                     Region: PHA03307"
                     /db_xref="CDD:223039"
     regulatory      complement(131455..131460)
                     /regulatory_class="TATA_box"
                     /gene="RS1"
                     /locus_tag="HHV1gp00p15"
     stem_loop       131980..132024
                     /note="oriS palindrome"
     gene            132101..133963
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
                     /note="immediate early gene"
                     /db_xref="GeneID:2703435"
     regulatory      132101..132106
                     /regulatory_class="TATA_box"
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
     mRNA            join(132129..132375,132544..133960)
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
                     /product="regulatory protein ICP22"
                     /db_xref="GeneID:2703435"
     repeat_region   132391..132516
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
                     /note="IRS reiteration set 3"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=132391..132413
     misc_feature    132608..145589
                     /note="US; short unique region"
     CDS             132647..133909
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
                     /note="required for expression of a subset of late genes;
                     involved in gene regulation; involved in cell cycle
                     regulation"
                     /codon_start=1
                     /product="regulatory protein ICP22"
                     /protein_id="YP_009137136.1"
                     /db_xref="GeneID:2703435"
                     /translation="MADISPGAFAPCVKARRPALRSPPLGTRKRKRPSRPLSSESEVE
                     SDTALESEVESETASDSTESGDQDEAPRIGGRRAPRRLGGRFFLDMSAESTTGTETDA
                     SVSDDPDDTSDWSYDDIPPRPKRARVNLRLTSSPDRRDGVIFPKMGRVRSTRETQPRA
                     PTPSAPSPNAMLRRSVRQAQRRSSARWTPDLGYMRQCINQLFRVLRVARDPHGSANRL
                     RHLIRDCYLMGYCRARLAPRTWCRLLQVSGGTWGMHLRNTIREVEARFDATAEPVCKL
                     PCLETRRYGPECDLSNLEIHLSATSDDEISDATDLEAAGSDHTLASQSDTEDAPSPVT
                     LETPEPRGSLAVRLEDEFGEFDWTPQEGSQPWLSAVVADTSSVERPGPSDSGAGRAAE
                     DRKCLDGCRKMRFSTACPYPCSDTFLRP"
     misc_feature    133145..133519
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
                     /note="Herpesvirus immediate early protein; Region:
                     Herpes_IE68; pfam02479"
                     /db_xref="CDD:280616"
     regulatory      133944..133949
                     /regulatory_class="polyA_signal_sequence"
                     /gene="US1"
                     /locus_tag="HHV1gp00p14"
     gene            complement(134026..135336)
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
                     /note="alpha gene"
                     /db_xref="GeneID:2703399"
     mRNA            complement(134026..135307)
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
                     /product="virion protein US2"
                     /db_xref="GeneID:2703399"
     regulatory      complement(134039..134044)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
     CDS             complement(134056..134931)
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
                     /note="possibly envelope-associated; interacts with
                     cytokeratin 18"
                     /codon_start=1
                     /product="virion protein US2"
                     /protein_id="YP_009137137.1"
                     /db_xref="GeneID:2703399"
                     /translation="MGVVVVNVMTLLDQNNALPRTSVDASPALWSFLLRQCRILASEP
                     LGTPVVVRPANLRRLAEPLMDLPKPTRPIVRTRSCRCPPNTTTGLFAEDSPLESTEVV
                     DAVACFRLLHRDQPSPPRLYHLWVVGAADLCVPFLEYAQKIRLGVRFIAIKTPDAWVG
                     EPWAVPTRFLPEWTVAWTPFPAAPNHPLETLLSRYEYQYGVVLPGTNGRERDCMRWLR
                     SLIALHKPHPATPGPLTTSHPVRRPCCACMGMPEVPDEQPTSPGRGPQETDPLIAVRG
                     ERPRLPHICYPVTTL"
     misc_feature    complement(134191..134604)
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
                     /note="US2 family; Region: US2; pfam02476"
                     /db_xref="CDD:280613"
     gene            134937..137534
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
                     /note="alpha gene"
                     /db_xref="GeneID:2703401"
     regulatory      134937..134942
                     /regulatory_class="TATA_box"
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
     mRNA            134967..137534
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
                     /product="serine/threonine protein kinase US3"
                     /db_xref="GeneID:2703401"
     regulatory      135166..135171
                     /regulatory_class="TATA_box"
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
     mRNA            135192..137534
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
                     /product="serine/threonine protein kinase US3"
                     /db_xref="GeneID:2703401"
     CDS             135225..136670
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
                     /note="tegument protein; phosphorylates nuclear egress
                     lamina protein; mediates phosphorylation of HDAC1 and
                     HDAC2 and other cellular and viral proteins; involved in
                     protein phosphorylation; involved in apoptosis; involved
                     in nuclear egress; PK family"
                     /codon_start=1
                     /product="serine/threonine protein kinase US3"
                     /protein_id="YP_009137138.1"
                     /db_xref="GeneID:2703401"
                     /translation="MACRKFCRVYGGQGRRKEEAVPPETKPSRVFPHGPFYTPAEDAC
                     LDSPPPETPKPSHTTPPSEAERLCHLQEILAQMYGNQDYPIEDDPSADAADDVDEDAP
                     DDVAYPEEYAEELFLPGDATGPLIGANDHIPPPCGASPPGIRRRSRDEIGATGFTAEE
                     LDAMDREAARAISRGGKPPSTMAKLVTGMGFTIHGALTPGSEGCVFDSSHPDYPQRVI
                     VKAGWYTSTSHEARLLRRLDHPAILPLLDLHVVSGVTCLVLPKYQADLYTYLSRRLNP
                     LGRPQIAAVSRQLLSAVDYIHRQGIIHRDIKTENIFINTPEDICLGDFGAACFVQGSR
                     SSPFPYGIAGTIDTNAPEVLAGDPYTTTVDIWSAGLVIFETAVHNASLFSAPRGPKRG
                     PCDSQITRIIRQAQVHVDEFSPHPESRLTSRYRSRAAGNNRPPYTRPAWTRYYKMDID
                     VEYLVCKALTFDGALRPSAAELLCLPLFQQK"
     misc_feature    135225..136667
                     /gene="US3"
                     /locus_tag="HHV1gp00p12"
                     /note="serine/threonine kinase US3; Provisional; Region:
                     PHA03211"
                     /db_xref="CDD:223009"
     regulatory      complement(135331..135336)
                     /regulatory_class="TATA_box"
                     /gene="US2"
                     /locus_tag="HHV1gp00p13"
     gene            136705..137534
                     /gene="US4"
                     /locus_tag="HHV1gp00p11"
                     /note="alpha gene"
                     /db_xref="GeneID:2703404"
     regulatory      136705..136710
                     /regulatory_class="TATA_box"
                     /gene="US4"
                     /locus_tag="HHV1gp00p11"
     mRNA            136732..137534
                     /gene="US4"
                     /locus_tag="HHV1gp00p11"
                     /product="envelope glycoprotein G"
                     /db_xref="GeneID:2703404"
     CDS             136747..137463
                     /gene="US4"
                     /locus_tag="HHV1gp00p11"
                     /note="type 1 membrane protein; contains a signal peptide;
                     involved in cell-to-cell spread; involved in apical
                     spread; gD family"
                     /codon_start=1
                     /product="envelope glycoprotein G"
                     /protein_id="YP_009137139.1"
                     /db_xref="GeneID:2703404"
                     /translation="MSQGAMRAVVPIIPFLLVLVGVSGVPTNVSSTTQPQLQTTGRPS
                     HEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDT
                     LPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTT
                     RLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWS
                     RRGRRTHPSVRYVCLPSERG"
     misc_feature    <136813..137277
                     /gene="US4"
                     /locus_tag="HHV1gp00p11"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      137511..137516
                     /regulatory_class="polyA_signal_sequence"
                     /note="US3, US4"
     gene            137599..141052
                     /gene="US5"
                     /locus_tag="HHV1gp00p10"
                     /note="alpha gene"
                     /db_xref="GeneID:2703406"
     regulatory      137599..137604
                     /regulatory_class="TATA_box"
                     /gene="US5"
                     /locus_tag="HHV1gp00p10"
     mRNA            137621..141052
                     /gene="US5"
                     /locus_tag="HHV1gp00p10"
                     /product="envelope glycoprotein J"
                     /db_xref="GeneID:2703406"
     CDS             137734..138012
                     /gene="US5"
                     /locus_tag="HHV1gp00p10"
                     /note="type 1 membrane protein; contains a signal peptide"
                     /codon_start=1
                     /product="envelope glycoprotein J"
                     /protein_id="YP_009137140.1"
                     /db_xref="GeneID:2703406"
                     /translation="MSLRAVWHLGLLGSLVGAVLAATHRGPAANTTDPLTHAPVSPHP
                     SPLGGFAVPLVVGGLCAVVLGAACLLELLRRTCRGWGRYHPYMDPVVV"
     misc_feature    <137779..137979
                     /gene="US5"
                     /locus_tag="HHV1gp00p10"
                     /note="Alphavirus glycoprotein J; Region: Alpha_GJ;
                     pfam03229"
                     /db_xref="CDD:251813"
     gene            138313..141052
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
                     /note="alpha gene"
                     /db_xref="GeneID:2703444"
     regulatory      138313..138318
                     /regulatory_class="TATA_box"
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
     mRNA            138337..141052
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
                     /product="envelope glycoprotein D"
                     /db_xref="GeneID:2703444"
     CDS             138423..139607
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
                     /note="type 1 membrane protein; contains a signal peptide;
                     binds cell surface receptors; involved in cell attachment;
                     gD family"
                     /codon_start=1
                     /product="envelope glycoprotein D"
                     /protein_id="YP_009137141.1"
                     /db_xref="GeneID:2703444"
                     /translation="MGGAAARLGAVILFVVIVGLHGVRGKYALVDASLKMADPNRFRG
                     KDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEA
                     PQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRW
                     NYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYAL
                     PLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTST
                     LLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPP
                     ATPNNMGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPKRIRLPHIREDDQPSSHQPL
                     FY"
     misc_feature    138609..139544
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
                     /note="envelope glycoprotein D; Provisional; Region:
                     PHA03264"
                     /db_xref="CDD:223029"
     misc_feature    138666..139040
                     /gene="US6"
                     /locus_tag="HHV1gp00p09"
                     /note="Herpesvirus glycoprotein D/GG/GX domain; Region:
                     Herpes_glycop_D; pfam01537"
                     /db_xref="CDD:366697"
     gene            139670..141052
                     /gene="US7"
                     /locus_tag="HHV1gp00p08"
                     /note="alpha gene"
                     /db_xref="GeneID:2703446"
     regulatory      139672..139677
                     /regulatory_class="TATA_box"
                     /gene="US7"
                     /locus_tag="HHV1gp00p08"
     mRNA            139698..141052
                     /gene="US7"
                     /locus_tag="HHV1gp00p08"
                     /product="envelope glycoprotein I"
                     /db_xref="GeneID:2703446"
     CDS             139789..140961
                     /gene="US7"
                     /locus_tag="HHV1gp00p08"
                     /note="type 1 membrane protein; contains a signal peptide;
                     complexed with envelope glycoprotein E to form an
                     Fc-receptor; involved in cell-to-cell spread; involved in
                     basolateral spread; gD family"
                     /codon_start=1
                     /product="envelope glycoprotein I"
                     /protein_id="YP_009137142.1"
                     /db_xref="GeneID:2703446"
                     /translation="MPCRPLQGLVLVGLWVCATSLVVRGPTVSLVSNSFVDAGALGPD
                     GVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYPMGHKCPRVVHVVTVTACPRRPA
                     VAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRDYAGVYVLRVWVGDAPNASLF
                     VLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVYQPAPNQASTPSTTTSTPS
                     TTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATRATRDSRYALTVTQIIQ
                     IAIPASIIALVFLGSCICFIHRCQRRYRRSRRPIYSPQMPTGISCAVNEAAMARLGAE
                     LKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPTTPTPTPPLLV"
     misc_feature    139792..140904
                     /gene="US7"
                     /locus_tag="HHV1gp00p08"
                     /note="envelope glycoprotein I; Provisional; Region:
                     PHA03291"
                     /db_xref="CDD:223033"
     regulatory      141017..141022
                     /regulatory_class="polyA_signal_sequence"
                     /note="US5, US6, US7"
     gene            141143..143697
                     /gene="US8"
                     /locus_tag="HHV1gp00p07"
                     /note="alpha gene"
                     /db_xref="GeneID:2703448"
     regulatory      141143..141148
                     /regulatory_class="TATA_box"
                     /gene="US8"
                     /locus_tag="HHV1gp00p07"
     mRNA            141175..143697
                     /gene="US8"
                     /locus_tag="HHV1gp00p07"
                     /product="envelope glycoprotein E"
                     /db_xref="GeneID:2703448"
     CDS             141247..142899
                     /gene="US8"
                     /locus_tag="HHV1gp00p07"
                     /note="type 1 membrane protein; contains a signal peptide;
                     complexed with envelope glycoprotein I to form an
                     Fc-receptor; involved in cell-to-cell spread; involved in
                     basolateral spread; gE family"
                     /codon_start=1
                     /product="envelope glycoprotein E"
                     /protein_id="YP_009137143.1"
                     /db_xref="GeneID:2703448"
                     /translation="MDRGAVVGFLLGVCVVSCLAGTPKTSWRRVSVGEDVSLLPAPGP
                     TGRGPTQKLLWAVEPLDGCGPLHPSWVSLMPPKQVPETVVDAACMRAPVPLAMAYAPP
                     APSATGGLRTDFVWQERAAVVNRSLVIHGVRETDSGLYTLSVGDIKDPARQVASVVLV
                     VQPAPVPTPPPTPADYDEDDNDEGEDESLAGTPASGTPRLPPPPAPPRSWPSAPEVSH
                     VRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSCAEMRI
                     YESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPPPRCSAEAHMEPVPG
                     LAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLPQ
                     RGADLAEPTHPHVGAPPHAPPTHGALRLGAVMGAALLLSALGLSVWACMTCWRRRAWR
                     AVKSRASGKGPTYIRVADSELYADWSSDSEGERDQVPWLAPPERPDSPSTNGSGFEIL
                     SPTAPSVYPRSDGHQSRRQLTTFGSGRPDRRYSQASDSSVFW"
     misc_feature    141247..142896
                     /gene="US8"
                     /locus_tag="HHV1gp00p07"
                     /note="envelope glycoprotein E; Provisional; Region:
                     PHA03282"
                     /db_xref="CDD:165539"
     gene            142748..143697
                     /gene="US8A"
                     /locus_tag="HHV1gp00p06"
                     /note="alpha gene"
                     /db_xref="GeneID:2703450"
     CDS             142748..143227
                     /gene="US8A"
                     /locus_tag="HHV1gp00p06"
                     /note="type 2 membrane protein"
                     /codon_start=1
                     /product="membrane protein US8A"
                     /protein_id="YP_009137144.1"
                     /db_xref="GeneID:2703450"
                     /translation="MDPALRSYHQRLRLYTPVAMGINLAASSQPLDPEGPIAVTPRPP
                     IRPSSGKAPHPEAPRRSPNWATAGEVDVGDELIAISDERGPPRHDRPPLATSTAPSPH
                     PRPPGYTAVVSPMALQAVDAPSLFVAWLAARWLRGASGLGAVLCGIAWYVTSIARGA"
     gene            143223..143697
                     /gene="US9"
                     /locus_tag="HHV1gp00p05"
                     /db_xref="GeneID:2703452"
     regulatory      143223..143228
                     /regulatory_class="TATA_box"
                     /gene="US9"
                     /locus_tag="HHV1gp00p05"
     mRNA            143250..143697
                     /gene="US9"
                     /locus_tag="HHV1gp00p05"
                     /product="membrane protein US9"
                     /db_xref="GeneID:2703452"
     CDS             143317..143589
                     /gene="US9"
                     /locus_tag="HHV1gp00p05"
                     /note="type 2 membrane protein; tegument-associated;
                     localizes envelope proteins; involved in axonal transport"
                     /codon_start=1
                     /product="membrane protein US9"
                     /protein_id="YP_009137145.1"
                     /db_xref="GeneID:2703452"
                     /translation="MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDF
                     LVRMGRQQSVLRRRRRRTRCVGMVIACLLVAVLSGGFGALLMWLLR"
     misc_feature    143407..143583
                     /gene="US9"
                     /locus_tag="HHV1gp00p05"
                     /note="Alphaherpesvirus tegument protein US9; Region:
                     Herpes_US9; pfam06072"
                     /db_xref="CDD:283682"
     regulatory      143672..143677
                     /regulatory_class="polyA_signal_sequence"
                     /note="US8, US8A, US9"
     repeat_region   143716..143868
                     /note="US reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=143716..143730
     gene            complement(144124..146096)
                     /gene="US12"
                     /locus_tag="HHV1gp00p04"
                     /note="immediate early gene"
                     /db_xref="GeneID:2703441"
     mRNA            complement(join(144124..145653,145822..146068))
                     /gene="US12"
                     /locus_tag="HHV1gp00p04"
                     /product="TAP transporter inhibitor ICP47"
                     /db_xref="GeneID:2703441"
     gene            complement(144124..145495)
                     /gene="US11"
                     /locus_tag="HHV1gp00p03"
                     /db_xref="GeneID:2703439"
     mRNA            complement(144124..145469)
                     /gene="US11"
                     /locus_tag="HHV1gp00p03"
                     /product="tegument protein US11"
                     /db_xref="GeneID:2703439"
     gene            complement(144124..145198)
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
                     /note="alpha gene"
                     /db_xref="GeneID:2703436"
     mRNA            complement(144124..145171)
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
                     /product="virion protein US10"
                     /db_xref="GeneID:2703436"
     regulatory      complement(144140..144145)
                     /regulatory_class="polyA_signal_sequence"
                     /note="US10, US11, US12"
     CDS             complement(144162..145100)
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
                     /codon_start=1
                     /product="virion protein US10"
                     /protein_id="YP_009137146.1"
                     /db_xref="GeneID:2703436"
                     /translation="MIKRRGNVEIRVYYESVRTLRSRSHLKPSDRQQSPGHRVFPGSP
                     GFRDHPENLGNPEYRELPETPGYRVTPGIHDNPGLPGSPGLPGSPGLPGSPGPHAPPA
                     NHVRLAGLYSPGKYAPLASPDPFSPQHGAYARARVGIHTAVRVPPTGSPTHTHLRQDP
                     GDEPTSDDSGLYPLDARALAHLVMLPADHRAFFRTVVEVSRMCAANVRDPPPPATGAM
                     LGRHARLVHTQWLRANQETSPLWPWRTAAINFITTMAPRVQTHRHMHDLLMACAFWCC
                     LTHASTCSYAGLYSTHCLHLFGAFGCGDPALTPPLC"
     misc_feature    complement(<144717..>145037)
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
     misc_feature    complement(<144171..144611)
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
                     /note="Gene 66 (IR5) protein; Region: Gene66; pfam02053"
                     /db_xref="CDD:366894"
     CDS             complement(144766..145251)
                     /gene="US11"
                     /locus_tag="HHV1gp00p03"
                     /note="dsRNA-binding protein; antagonizes PKR; inhibits
                     stress-induced translational arrest; involved in
                     translational regulation"
                     /codon_start=1
                     /product="tegument protein US11"
                     /protein_id="YP_009137147.1"
                     /db_xref="GeneID:2703439"
                     /translation="MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISG
                     PPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPRE
                     PREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGS
                     V"
     misc_feature    complement(<144787..>145032)
                     /gene="US11"
                     /locus_tag="HHV1gp00p03"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
     repeat_region   144787..145003
                     /note="US reiteration set 2"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=144787..144795
     regulatory      complement(145193..145198)
                     /regulatory_class="TATA_box"
                     /gene="US10"
                     /locus_tag="HHV1gp00p02"
     CDS             complement(145316..145582)
                     /gene="US12"
                     /locus_tag="HHV1gp00p04"
                     /note="inhibits antigen presentation; involved in immune
                     regulation"
                     /codon_start=1
                     /product="TAP transporter inhibitor ICP47"
                     /protein_id="YP_009137148.1"
                     /db_xref="GeneID:2703441"
                     /translation="MSWALEMADTFLDTMRVGPRTYADVRDEINKRGREDREAARTAV
                     HDPERPLLRSPGLLPEIAPNASLGVAHRRTGGTVTDSPRNPVTR"
     misc_feature    complement(145337..145582)
                     /gene="US12"
                     /locus_tag="HHV1gp00p04"
                     /note="Herpesvirus US12 family; Region: Herpes_US12;
                     pfam05363"
                     /db_xref="CDD:283110"
     regulatory      complement(145490..145495)
                     /regulatory_class="TATA_box"
                     /gene="US11"
                     /locus_tag="HHV1gp00p03"
     repeat_region   145590..152222
                     /note="TRS; inverted repeat flanking US"
                     /rpt_type=inverted
     repeat_region   145681..145806
                     /note="RS reiteration set 3"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=145681..145702
     regulatory      complement(146091..146096)
                     /regulatory_class="TATA_box"
                     /gene="US12"
                     /locus_tag="HHV1gp00p04"
     stem_loop       146173..146217
                     /note="oriS palindrome"
     gene            146737..151023
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
                     /note="alpha gene; immediate early gene"
                     /db_xref="GeneID:2703391"
     regulatory      146737..146742
                     /regulatory_class="TATA_box"
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
     mRNA            146766..151023
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
                     /product="transcriptional regulator ICP4"
                     /db_xref="GeneID:2703391"
     CDS             147066..150962
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
                     /note="involved in gene regulation; immediate early
                     protein; transcriptional regulator"
                     /codon_start=1
                     /product="transcriptional regulator ICP4"
                     /protein_id="YP_009137149.1"
                     /db_xref="GeneID:2703391"
                     /translation="MASENKQRPGSPGPTDGPPPTPSPDRDERGALGWGAETEEGGDD
                     PDHDPDHPHDLDDARRDGRAPAAGTDAGEDAGDAVSPRQLALLASMVEEAVRTIPTPD
                     PAASPPRTPAFRADDDDGDEYDDAADAAGDRAPARGREREAPLRGAYPDPTDRLSPRP
                     PAQPPRRRRHGRWRPSASSTSSDSGSSSSSSASSSSSSSDEDEDDDGNDAADHAREAR
                     AVGRGPSSAAPAAPGRTPPPPGPPPLSEAAPKPRAAARTPAASAGRIERRRARAAVAG
                     RDATGRFTAGQPRRVELDADAASGAFYARYRDGYVSGEPWPGAGPPPPGRVLYGGLGD
                     SRPGLWGAPEAEEARRRFEASGAPAAVWAPELGDAAQQYALITRLLYTPDAEAMGWLQ
                     NPRVVPGDVALDQACFRISGAARNSSSFITGSVARAVPHLGYAMAAGRFGWGLAHAAA
                     AVAMSRRYDRAQKGFLLTSLRRAYAPLLARENAALTGAAGSPGAGADDEGVAAVAAAA
                     PGERAVPAGYGAAGILAALGRLSAAPASPAGGDDPDAARHADADDDAGRRAQAGRVAV
                     ECLAACRGILEALAEGFDGDLAAVPGLAGARPASPPRPEGPAGPASPPPPHADAPRLR
                     AWLRELRFVRDALVLMRLRGDLRVAGGSEAAVAAVRAVSLVAGALGPALPRDPRLPSS
                     AAAAAADLLFDNQSLRPLLAAAASAPDAADALAAAAASAAPREGRKRKSPGPARPPGG
                     GGPRPPKTKKSGADAPGSDARAPLPAPAPPSTPPGPEPAPAQPAAPRAAAAQARPRPV
                     ALSRRPAEGPDPLGGWRRQPPGPSHTAAPAAAALEAYCSPRAVAELTDHPLFPVPWRP
                     ALMFDPRALASIAARCAGPAPAAQAACGGGDDDDNPHPHGAAGGRLFGPLRASGPLRR
                     MAAWMRQIPDPEDVRVVVLYSPLPGEDLAGGGASGGPPEWSAERGGLSCLLAALANRL
                     CGPDTAAWAGNWTGAPDVSALGAQGVLLLSTRDLAFAGAVEFLGLLASAGDRRLIVVN
                     TVRACDWPADGPAVSRQHAYLACELLPAVQCAVRWPAARDLRRTVLASGRVFGPGVFA
                     RVEAAHARLYPDAPPLRLCRGGNVRYRVRTRFGPDTPVPMSPREYRRAVLPALDGRAA
                     ASGTTDAMAPGAPDFCEEEAHSHRACARWGLGAPLRPVYVALGREAVRAGPARWRGPR
                     RDFCARALLEPDDDAPPLVLRGDDDGPGALPPAPPGIRWASATGRSGTVLAAAGAVEV
                     LGAEAGLATPPRREVVDWEGAWDEDDGGAFEGDGVL"
     misc_feature    147216..150800
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
                     /note="transcriptional regulator ICP4; Provisional;
                     Region: PHA03307"
                     /db_xref="CDD:223039"
     regulatory      151005..151010
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RS1"
                     /locus_tag="HHV1gp00p01"
     regulatory      complement(151046..151051)
                     /regulatory_class="polyA_signal_sequence"
                     /note="LAT"
     repeat_region   151052..151384
                     /note="RS reiteration set 2"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=151052..151068
     repeat_region   151486..151624
                     /note="RS reiteration set 1"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=151486..151501
     repeat_region   151824..152222
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     repeat_region   151921..152143
                     /note="'a' sequence reiteration set"
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_unit_range=151921..151932
ORIGIN      
        1 agcccgggcc ccccgcgggc gcgcgcgcgc gcaaaaaagg cgggcggcgg tccgggcggc
       61 gtgcgcgcgc gcggcgggcg tggggggcgg ggccgcggga gcggggggag gagcgggggg
      121 aggagcgggg ggaggagcgg ggggaggagc ggggggagga gcggggggag gagcgggggg
      181 aggagcgggg ggaggagcgg ggggaggagc ggggggagga gcggggggag gagcgggggg
      241 aggagcgggg ggaggagcgg ggggaggagc ggggggagga gcggggggag gagcgggggg
      301 aggagcgggg ggaggagcgg ccagaccccg aaaacgggcc ccccccaaaa cacacccccc
      361 gggggtcgcg cgcggccctt taaagcggcg gcggcgggca gcccgggccc cccgcggccg
      421 agactagcga gttagacagg caagcactac tcgcctctgc acgcacatgc ttgcctgtca
      481 aactctacca ccccggcacg ctctctgtct ccatggcccg ccgccgccgc catcgcggcc
      541 cccgccgccc ccggccgccc gggcccacgg gcgccgtccc aaccgcacag tcccaggtaa
      601 cctccacgcc caactcggaa cccgcggtca ggagcgcgcc cgcggccgcc ccgccgccgc
      661 cccccgccgg tgggcccccg ccttcttgtt cgctgctgct gcgccagtgg ctccacgttc
      721 ccgagtccgc gtccgacgac gacgatgacg acgactggcc ggacagcccc ccgcccgagc
      781 cggcgccaga ggcccggccc accgccgccg ccccccggcc ccggccccca ccgcccggcg
      841 tgggcccggg gggcggggct gacccctccc accccccctc gcgccccttc cgccttccgc
      901 cgcgcctcgc cctccgcctg cgcgtcaccg cggagcacct ggcgcgcctg cgcctgcgac
      961 gcgcgggcgg ggagggggcg ccggagcccc ccgcgacccc cgcgaccccc gcgacccccg
     1021 cgacccccgc gacccccgcg cgggtgcgct tctcgcccca cgtccgggtg cgccacctgg
     1081 tggtctgggc ctcggccgcc cgcctggcgc gccgcggctc gtgggcccgc gagcgggccg
     1141 accgggctcg gttccggcgc cgggtggcgg aggccgaggc ggtcatcggg ccgtgcctgg
     1201 ggcccgaggc ccgtgcccgg gccctggccc gcggagccgg cccggcgaac tcggtctaac
     1261 gttacacccg aggcggcctg ggtcttccgc ggagctcccg ggagctccgc accaagccgc
     1321 tctccggaga gacgatggca ggagccgcgc atatatacgc ttggagccag cccgccctca
     1381 cagggcgggc ccgcctcggg ggcgggactg gccaatcggc ggccgccagc gcggcggggc
     1441 ccggccaacc agcgtccgcc gagtcttcgg ggcccggccc attgggcggg agttaccgcc
     1501 caatgggccg ggccgcccac ttcccggtat ggtaattaaa aacttgcaag aggccttgtt
     1561 ccgcttcccg gtatggtaat tagaaactca ttaatgggcg gccccggccg cccttcccgc
     1621 ttccggcaat tcccgcggcc cttaatgggc aaccccggta ttccccgcct cccgcgccgc
     1681 gcgtaaccac tcccctgggg ttccgggtta tgctaattgc ttttttggcg gaacacacgg
     1741 cccctcgcgc attggcccgc gggtcgctca atgaacccgc attggtcccc tggggttccg
     1801 ggtatggtaa tgagtttctt cgggaaggcg ggaagccccg gggcaccgac gcaggccaag
     1861 cccctgttgc gtcggcggga ggggcatgct aatggggttc tttgggggac accgggttgg
     1921 gcccccaaat cgggggccgg gccgtgcatg ctaatgatat tctttggggg cgccgggttg
     1981 gtccccgggg acggggccgc cccgcggtgg gcctgcctcc cctgggacgc gcggccattg
     2041 ggggaatcgt cactgccgcc cctttgggga ggggaaaggc gtggggtata agttagccct
     2101 ggcccgacag tctggtcgca tttgcacctc ggcactcgga gcgagacgca gcagccaggc
     2161 agactcgggc cgccccctct ccgcatcacc acagaagccc cgcctacgtt gcgaccccca
     2221 gggaccctcc gtccgcgacc ctccagccgc atacgacccc catggagccc cgccccggag
     2281 cgagtacccg ccggcctgag ggccgccccc agcgcgaggt gaggggccgg gcgccatgtc
     2341 tggggcgcca tattgggggg cgccatattg gggggcgcca tgttggggga cccccgaccc
     2401 ttacactgga accggccgcc atgttggggg acccccactc atacacggga gccgggcgcc
     2461 atgttggggc gccatgttag ggggcgtgga accccgtgac actatatata cagggaccgg
     2521 gggcgccatg ttagggggtg cggaaccccc tgaccctata tatacaggga ccggggtcgc
     2581 cctgttgggg gtcgccatgt gaccccctga ctttatatat acagaccccc aacacataca
     2641 catggcccct ttgactcaga cgcagggccc ggggtcgccg tgggaccccc tgactcatac
     2701 acagagacac gcccccacaa caaacacaca gggaccgggg tcgccgtgtt gggggcgtgg
     2761 tccccactga ctcatacgca ggcccccctt actcacacgc atctaggggg gtggggagga
     2821 gccgcccgcc atatttgggg gacgccgtgg gacccccgac tccggtgcgt ctggagggcg
     2881 ggagaagagg gaagaagagg ggtcgggatc caaaggacgg acccagacca cctttggttg
     2941 cagacccctt tctcccccct cttccgaggc cagcaggggg gcaggacttt gtgaggcggg
     3001 ggggggagag ggggaactcg tgggtgctga ttgacgcggg aaatcccccc ccattcttac
     3061 ccgcccccct tttttcccct tagcccgccc cggatgtctg ggtgtttccc tgcgaccgag
     3121 acctgccgga cagcagcgac tctgaggcgg agaccgaagt gggggggcgg ggggacgccg
     3181 accaccatga cgacgactcc gcctccgagg cggacagcac ggacacggaa ctgttcgaga
     3241 cggggctgct ggggccgcag ggcgtggatg ggggggcggt ctcggggggg agcccccccc
     3301 gcgaggaaga ccccggcagt tgcgggggcg ccccccctcg agaggacggg gggagcgacg
     3361 agggcgacgt gtgcgccgtg tgcacggatg agatcgcgcc ccacctgcgc tgcgacacct
     3421 tcccgtgcat gcaccgcttc tgcatcccgt gcatgaaaac ctggatgcaa ttgcgcaaca
     3481 cctgcccgct gtgcaacgcc aagctggtgt acctgatagt gggcgtgacg cccagcgggt
     3541 cgttcagcac catcccgatc gtgaacgacc cccagacccg catggaggcc gaggaggccg
     3601 tcagggcggg cacggccgtg gactttatct ggacgggcaa tcagcggttc gccccgcggt
     3661 acctgaccct gggggggcac acggtgaggg ccctgtcgcc cacccacccg gagcccacca
     3721 cggacgagga tgacgacgac ctggacgacg gtgaggcggg gggcggcaag gaccctgggg
     3781 gaggaggagg aggagggggg gggagggagg aataggcggg cgggcgagga aagggcgggc
     3841 cggggagggg gcgtaacctg atcgcgcccc ccgttgtctc ttgcagcaga ctacgtaccg
     3901 cccgcccccc gccggacgcc ccgcgccccc ccacgcagag gcgccgccgc gccccccgtg
     3961 acgggcgggg cgtctcacgc agccccccag ccggccgcgg ctcggacagc gcccccctcg
     4021 gcgcccatcg ggccacacgg cagcagtaac accaacacca ccaccaacag cagcggcggc
     4081 ggcggctccc gccagtcgcg agccgcggcg ccgcgggggg cgtctggccc ctccgggggg
     4141 gttggggttg gggttggggt tgttgaagcg gaggcggggc ggccgagggg ccggacgggc
     4201 ccccttgtca acagacccgc cccccttgca aacaacagag accccatagt gatcagcgac
     4261 tcccccccgg cctctcccca caggcccccc gcggcgccca tgccaggctc cgccccccgc
     4321 cccgggcccc ccgcgtccgc ggccgcgtcg ggacccgcgc gcccccgcgc ggccgtggcc
     4381 ccgtgcgtgc gagcgccgcc tccggggccc ggcccccgcg ccccggcccc cggggcggag
     4441 ccggccgccc gccccgcgga cgcgcgccgt gtgccccagt cgcactcgtc cctggctcag
     4501 gccgcgaacc aagaacagag tctgtgccgg gcgcgtgcga cggtggcgcg cggctcgggg
     4561 gggccgggcg tggagggtgg gcacgggccc tcccgcggcg ccgccccctc cggcgccgcc
     4621 ccgctcccct ccgccgcctc tgtcgagcag gaggcggcgg tgcgtccgag gaagaggcgc
     4681 gggtcgggcc aggaaaaccc ctccccccag tccacgcgtc cccccctcgc gccggcaggg
     4741 gccaagaggg cggcgacgca ccccccctcc gactcagggc cgggggggcg cggccagggt
     4801 gggcccggga cccccctgac gtcctcggcg gcctccgcct cttcctcctc tgcctcttcc
     4861 tcctcggccc cgacccccgc gggggccgcc tcttccgccg ccggggccgc gtcctcctcc
     4921 gcttccgcct cctcgggcgg ggccgtcggt gccctgggag ggagacaaga ggaaacctcc
     4981 ctcggccccc gcgctgcttc tgggccgcgg gggccgagga agtgtgcccg gaagacgcgc
     5041 cacgcggaga cttccggggc cgtccccgcg ggcggcctca cgcgctacct gcccatctcg
     5101 ggggtctcta gcgtggtcgc cctgtcgcct tacgtgaaca agactatcac gggggactgc
     5161 ctgcccatcc tggacatgga gacggggaac atcggggcgt acgtggtcct ggtggaccag
     5221 acgggaaaca tggcgacccg gctgcgggcc gcggtccccg gctggagccg ccgcaccctg
     5281 ctccccgaga ccgcgggtaa ccacgtgatg ccccccgagt acccgacggc ccccgcgtcg
     5341 gagtggaaca gcctctggat gacccccgtg gggaacatgc tgttcgacca gggcacccta
     5401 gtgggcgccc tggacttccg cagcctgcgg tctcggcacc cgtggtccgg ggagcagggg
     5461 gcgtcgaccc gggacgaggg aaaacaataa gggacgcccc ccgtgtttgt ggggaggggg
     5521 gggtcgggcg ctgggtggtc tctggccgcg cccactacac cagccaatcc gtgtcgggga
     5581 ggggaaaagt gaaagacacg ggcaccacac accagcgggt cttttgtgtt ggccctaata
     5641 aaaaaaaact caggggattt ttgctgtctg ttgggaaata aaggtttact tttgtatctt
     5701 ttccctgtct gtgttggatg tatcgcgggg atgcgtggga gtgggggtgc gtgggagtgg
     5761 gggtgcgtgg gagtgggggt gcgtgggagt gggggtgcgt gggagtgggg gtgcgtggga
     5821 gtgggggtgc gtgggagtgg gggtgcgtgg gagtgggggt gcgtgggagt gggggtgcca
     5881 tgttgggcag gctctggtgt taaccacaga gccgcggccc gggctgcctg accaccgatc
     5941 cccgaaagca tcctgccact ggcatggagc cagaaccaca gtgggttggg tgtgggtgtt
     6001 aagtttccgc gagcgcctgc ccgcccggac tgacctggcc tctggccgcc acaaagggcg
     6061 gggggggtta actacactat agggcaacaa aggatgggag gggtggcggg gcgggacggg
     6121 gcgcccaaaa gggggtcggc cacaccacag acgtgggtgt tggggggtgg ggcggagggg
     6181 tggggggggg ggagacagaa acaggaacat agttagaaaa caagaatgcg gtgcagccag
     6241 agaatcacag gagacgaggg gatgggcgtg ttggttacca acccacaccc aggcatgctc
     6301 ggtggtatga aggagggggg gcggtgcttc ttagagaccg ccgggggacg tggggttggt
     6361 gtgcaaaggc acgcgcaccc gcgccggcca ggtgggccgg tactccatcc ccccctcccc
     6421 cgacccttcc cacccccgcg tgccagagat caccccggtc ccccggcacc cgccactcct
     6481 ccgtatcctc gctttaggaa caactttagg gggggtacac acgcgccgtg catttccttc
     6541 cacacccccc ctcccccgca ctcccccccc ccaggcagta agacccaagc atagagagcc
     6601 aggcacaaaa acacaggcgg ggtgggacac atgccttctt ggagtacgtg ggtcattggc
     6661 gtggggggtt acagcgacac cggccgaccc cctggcggtc ttccagccgg cccttagata
     6721 agggggcagt tggtggtcgg acgggtaagt aacagagtct gactaagggt gggagggggg
     6781 gaaaagaacg ggctggtgtg ctgtaacacg agcccacccg cgagtggcgt ggccgacctt
     6841 agcctctggg gcgccccctg tcgtttgggt cccccccctc tattggggag aagcaggtgt
     6901 ctaacctacc tggaaacgcg gcgtctttgt tgaacgacac cggggcgccc tcgacgagtg
     6961 ggataacggg ggaggaaggg agggaggagg gtactggggg tgaagaaggg gggggggaga
     7021 agcgagaaca ggaaaggcga tggagcccgg cagaacaccg aggaaaaaaa aaccacagcg
     7081 catgcgccgg gccgttgtgg ggccccgggc cggggcccct tgggtccgcc ggggccccgg
     7141 gccgggccgc cacgggggcc ggccgttggc ggtaaccccg agtgttcatc tcaggccccg
     7201 ggccgggaac ccggaaaagc ctccgggggg cctttttcgc gtcgcgtgcc ggcgagcggg
     7261 tccggacggg gcccggaccg ccgcggtcgg gggcccctcg tcccgggccg tacgcggcct
     7321 tcgccccgtg aggggacaga cgaacgaaac attccggcga cggaacgaaa aacaccccag
     7381 acgggttaaa gaaacagaaa ccgcaacccc caccaccccc gaaacgggga aaacgaaaaa
     7441 acagaccagc ggccggccgg cgcttagggg gaggatgtcg ccgacgcccc ttggccgccc
     7501 cggctgcagg ggggcccgga gagccgcggc acccggacgc gcccggaaag tctttcgcac
     7561 cacccgcgat cggcacggcc gcgcccccgc ttttataaag gctgagatga cgcagcaaaa
     7621 acaggccaca gcaccacgtg ggtaggtgat gtaattttat tttcctcgtc tgcggcctaa
     7681 tggatttccg ggcgcggtgc ccctgtctgc agagcactta acggattgat atctcgcggg
     7741 cacgcgcgcc cttaatggac cggcgcgggg cggggggccg gatacccaca cgggcggggg
     7801 gggggtgtcg cgggccgtct gctggcccgc ggccacataa acaatgactc tgggcctttc
     7861 tgcctctgcc gcttgtgagt gcgcgcgccg gctctgcggt gtcggcggcg gctgcggcgg
     7921 ctgcggcggc cgccgtgttc ggtctcggta gccggccggc gggtggactc gcggggggcc
     7981 ggagggtgga aggcaggggg gtgtaggatg ggtatcagga cttccacttc ccgtccttcc
     8041 atcccccgtt cccctcggtt gttcctcgcc tcccccaaca ccccgccgct ttccgttggg
     8101 gttgttattg ttgtcgggat cgtgcgggcc gggggtcgcc ggggcagggg cgggggcgtg
     8161 ggcgggggtg ctcgtcgatc gaccgggctc agtgggggcg tggggtgggt gggagaaggc
     8221 gaggagactg gggtgggggt gtcggtgggt ggttgttttt tgtggttgtt tttgtgtctg
     8281 ttcccgtccc ccgtcacccc ctccctccgt cccctccgtc cccccgtcgc gggtgtttgt
     8341 gtttgtttat tccgacattg gtttatttaa ataaacacag ccgttctgcg tgtctgttct
     8401 tgcgtgtggc tgggggctta tatgtggggt cccgggggcg ggatggggtt tagcggcggg
     8461 gggcggcgcg ccggacgggg cgctggagat aacggccccc ggggaacggg ggaccggggc
     8521 tgggtatccc gaggtgggtg ggtgggcggc ggtggccggg ccgggccggg ccgggccggg
     8581 ccgggtgggc ggggtttgga aaaacgagga ggaggaggag aaggcggggg ggggggagac
     8641 ggggggaaag caaggacacg gcccgggggg tgggagcgcg ggccgggccg ctcgtaagag
     8701 ccgcgacccg gccgccgggg agcgttgtcg ccgtcggtct gccggccccc gtccctccct
     8761 tttttgacca accagcgccc cccccccctc accaccattc ctactaccac caccaccacc
     8821 accaccgaca cctcccgcgc acccccgccc acatcccccc ccaacccgca ccaccagcac
     8881 gggttggggg tagcagggga tcaaaggggg gcaaagccgg cggggcggtt cggggggggg
     8941 gggggggggc gggagaccaa gtaggcccgc ccatccgcgg cccctcccgg cagccacgcc
     9001 cccagcgtcg ggtgtcacgg ggaaagagca gaggggagag gggagagggg gggagagggg
     9061 agaggggggg agaggggaga gggggggaga ggggagaggg ggggagaggg gagagggggg
     9121 gagaggggag agggggggag aggggagagg gggggagagg ggagaggggg ggagagggga
     9181 gaggggggga gaggggagag ggggggagag ggggtatata aaccaacgaa aagcgcggga
     9241 acggggatac ggggcttgtg tggcacgacg tcgtggttgt gttactgggc aaacacttgg
     9301 ggactgtagg tttctgtggg tgccgaccct aggcgctatg gggattttgg gttgggtcgg
     9361 gcttattgcc gttggggttt tgtgtgtgcg ggggggcttg ccttcaaccg aatatgttat
     9421 tcggagtcgg gtggctcgag aggtggggga tatattaaag gtgccttgtg tgccgctccc
     9481 gtctgacgat cttgattggc gttacgagac cccctcggct ataaactatg ctttgataga
     9541 cggtatattt ttgcgttatc actgtcccgg attggacacg gtcttgtggg ataggcatgc
     9601 ccagaaggca tattgggtta accccttttt atttgtggcg ggttttttgg aggacttgag
     9661 ttaccccgcg tttcctgcca acacccagga aacagaaacg cgcttggccc tttataaaga
     9721 gatacgccag gcgctggaca gtcgcaagca ggccgccagc cacacacctg tgaaggctgg
     9781 gtgtgtgaac tttgactatt cgcgcacccg ccgctgtgta gggcgacagg atttgggacc
     9841 taccaacgga acgtctggac ggaccccggt tctgccgccg gacgatgaag cgggcctgca
     9901 gccgaagccc ctcaccacgc cgccgcccat catcgccacg tcggacccca ccccgcgacg
     9961 ggacgccgcc acaaaaagca gacgccgacg accccactcc cggcgcctct aacgatgcct
    10021 cgacggaaac ccgtccgggt tcggggggcg aaccggccgc ctgtcgctcg tcagggccgg
    10081 cgggcgctcc tcgccgccct agaggctgtc ccgctggtgt gacgttttcc tcgtccgcgc
    10141 cccccgaccc tcccatggat ttaacaaacg ggggggtgtc gcctgcggcg acctcggcgc
    10201 ctctggactg gaccacgttt cggcgtgtgt ttctgatcga cgacgcgtgg cggcccctga
    10261 tggagcctga gctggcgaac cccttaaccg cccacctcct ggccgaatat aatcgtcggt
    10321 gccagaccga agaggtgctg ccgccgcggg aggatgtgtt ttcgtggact cgttattgca
    10381 cccccgacga ggtgcgcgtg gttatcatcg gccaggaccc atatcaccac cccggccagg
    10441 cgcacggact tgcgtttagc gtgcgcgcga acgtgccgcc tcccccgagt cttcggaatg
    10501 tcttggcggc cgtcaagaac tgttatcccg aggcacggat gagcggccac ggttgcctgg
    10561 aaaagtgggc gcgggacggc gtcctgttac taaacacgac cctgaccgtc aagcgcgggg
    10621 cggcggcgtc ccactctaga atcggttggg accgcttcgt gggcggagtt atccgccggt
    10681 tggccgcgcg ccgccccggc ctggtgttta tgctctgggg cacacacgcc cagaatgcca
    10741 tcaggccgga ccctcgggtc cattgcgtcc tcaagttttc gcacccgtcg cccctctcca
    10801 aggttccgtt cggaacctgc cagcatttcc tcgtggcgaa ccgatacctc gagacccggt
    10861 cgatttcacc catcgactgg tcggtttgaa aggcatcgac gtccggggtt tttgtcggtg
    10921 ggggcttttg ggtatttccg atgaataaag acggttaatg gttaaacctc tggtctcata
    10981 cgggtcggtg atgtcgggcg tcgggggaga gggagttccc tctgcgcttg cgattctagc
    11041 ctcgtggggc tggacgttcg acacgccaaa ccacgagtcg gggatatcgc cagatacgac
    11101 tcccgcagat tccattcggg gtgccgctgt ggcctcacct gaccaacctt tacacggggg
    11161 cccggaacgg gaggccacag cgccgtcttt ctccccaacg cgcgcggatg acggcccgcc
    11221 ctgtaccgac gggccctacg tgacgtttga taccctgttt atggtgtcgt cgatcgacga
    11281 attagggcgt cgccagctca cggacaccat ccgcaaggac ctgcggttgt cgctggccaa
    11341 gtttagcatt gcgtgcacca agacctcctc gttttcggga aacgccccgc gccaccacag
    11401 acgcggggcg ttccagcgcg gcacgcgggc gccgcgcagc aacaaaagcc tccagatgtt
    11461 tgtgttgtgc aaacgcgccc acgccgctcg agtgcgagag cagcttcggg tcgttattca
    11521 gtcccgcaag ccgcgcaagt attacacgcg atcttcggac gggcggctct gccccgccgt
    11581 ccccgtgttc gtccacgagt tcgtctcgtc cgagccaatg cgcctccacc gagataacgt
    11641 catgctggcc tcgggggccg agtaaccgcc ccccccccat gccaccctca ctgcccgtcg
    11701 cgcgtgtttg atgttaataa ataacacata aatttggctg gttgtttgtt gtctttaatg
    11761 gaccgcccgc aagggggggg gggcatttca gtgtcgggtg acgagcgcga tccggccggg
    11821 atcctaggac cccaaaagtt tgtctgcgta ttccagggcg gggctcagtt gaatctcccg
    11881 cagcacctct accagcaggt ccgcggtggg ctggagaaac tcggccgtcc cggggcaggc
    11941 ggttgtcggg ggtggaggcg cggcgcccac cccgtgtgcc gcgcctggcg tctcctctgg
    12001 gggcgacccg taaatggttg cagtgatgta aatggtgtcc gcggtccaga ccacggtcaa
    12061 aatgccggcc gtggcgctcc gggcgctttc gccgcgcgag gagctgaccc aggagtcgaa
    12121 cggatacgcg tacatatggg cgtcccaccc gcgttcgagc ttctggttgc tgtcccggcc
    12181 tataaagcgg taggcacaaa attcggcgcg acagtcgata atcaccaaca gcccaatggg
    12241 ggtgtgctgg ataacaacgc ctccgcgcgg caggcggtcc tggcgctccc ggccccgtac
    12301 catgatcgcg cgggtgccgt actcaaaaac atgcaccacc tgcgcggcgt cgggcagtgc
    12361 gctggtcagc gaggccctgg cgtggcatag gctatacgcg atggtcgtct gtggattgga
    12421 catctcgcgg tgggtagtga gtcccccggg ccgggttcgg tggaactgta aggggacggc
    12481 gggttaatag acaatgacca cgttcggatc gcgcagagcc gatagtatgt gctcactaat
    12541 gacgtcatcg cgctcgtggc gctcccggag cggatttaag ttcatgcgaa ggaattcgga
    12601 ggaggtggtg cgggacatgg ccacgtacgc gctgttgagg cgcaggttgc cgggcgtaaa
    12661 gcagatggcg accttgtcca ggctaaggcc ctgggagcgc gtgatggtca tggcaagctt
    12721 ggagctgatg ccgtagtcgg cgtttatggc catggccagc tccgtagagt caatggactc
    12781 gacaaactcg ctgatgttgg tgttgacgac ggacatgaag ccgtgttggt cccgcaagac
    12841 cacgtaaggc aggggggcct cttccagtaa ctcggccacg ttggccgtcg cgtgccgcct
    12901 ccgcagctcg tccgcaaagg caaacacccg tgcgtacgtg tatcccatga gcgtataatt
    12961 gtccgtctgc agggcgacgg acatcagccc cccgcgcggc gagccggtca gcatctcgca
    13021 gccccggaag ataacgttgt ccacgtacgt gctaaagggg gcgacttcaa atgcctcccc
    13081 gaagagctct tggaggattc ggaatctccc gaggaaggcc cgcttcagca gcgcaaactg
    13141 ggtgtgaacg gcggcggtgg tctccggttc cccgggggtg tagtggcagt aaaacacgtc
    13201 gagctgttgt tcgtccagcc ccgcgaaaat aacgtcgagg tcgtcgtcgg gaaaatcgtc
    13261 cgggcccccg tcccgcggcc ccagttgctt aaaatcaaac gcacgctcgc cgggggcgcc
    13321 tgcgtcggcc attaccgacg cctgcgtcgg cacccccgaa gatttggggc gcagagacag
    13381 aatctccgcc gttagttctc ccatgcgggc gtaggcgagg gtcctctggg tcgcatccag
    13441 gcccgggcgc tgcagaaagt tgtaaaagga gataagcccg ctaaatatga gccgcgacag
    13501 gaacctgtag gcaaactcca ccgaagtctc cccctgagtc tttacaaagc tgtcgtcacg
    13561 caacactgcc tcgaaggccc ggaacgtccc actaaaccca aaaaccagtt ttcgcaggcg
    13621 cgcggtcacc gcgatctggc tgttgaggac gtaagtgacg tcgttgcggg ccacgaccag
    13681 ctgctgtttg ctgtgcacct cgcagcgcat gtgccccgcg tcctggtcct ggctctgcga
    13741 gtagttggtg atgcggctgg cgttggccgt gagccacttt tcaatcgtca ggccgggctg
    13801 gtgtgtcagc cgtcggtatt cgtcaaactc cttgaccgac acgaacgtaa gcacggggag
    13861 ggtgaacacg acgaactccc cctcacgggt caccttcagg taggcgtgga gcttggccat
    13921 gtacgcgctc acctctttgt gggaggagaa cagccgcgtc cagccgggga ggttggcggg
    13981 gttggtgatg tagttttccg ggacgacgaa gcgatccacg aactgcatgt gctcctcggt
    14041 gatgggcagg ccgtactcca gcaccttcat gaggttaccg aactcgtgct cgacgcaccg
    14101 tttgttgtta ataaaaatgg cccagctata cgagaggcgg gcgtactcgc gcagcgtgcg
    14161 gttgcagatg aggtacgtga gcacgttctc gctctggcgg acggaacacc gcagtttctg
    14221 gtgctcgaag gtcgactcca gggacgccgt ctgcgtcggc gagcccacac acaccaacac
    14281 gggccgcagg cgggccgcgt actggggggt gtggtacagg gcgttaatca tccaccagca
    14341 atacaccacg gccgtgagga ggtgacgccc aaggagcccg gcctcgtcga tgacgatcac
    14401 gttgctgcgg gtaaaggccg gcagcgcccc gtgggtggcc ggggccaacc gcgtcagggc
    14461 gccctcggcc aaccccaggg tccgttccag ggcggccagg gcgcgaaact cgttccgcaa
    14521 ctcctcgccc ccggaggcgg ccagggcgcg cttcgtgagg tccaaaatca cctcccagta
    14581 gtacgtcaga tctcgtcgct gcaggtcctc cagcgaggcg gggttgctgg tcagggtgta
    14641 cgggtactgt cccagttggg cctggacgtg attcccgcga aacccaaatt catgaaagat
    14701 ggtgttgatg ggtcggctga gaaaggcgcc cgagagtttg gcgtacatgt tttgggccgc
    14761 aatgcgcgtg gcgcccgtca ccacacagtc caagacctcg ttgattgtct gcacgcacgt
    14821 gctctttccg gagccagcgt tgccggtgat aagatacacc gcgaacggaa actccctgag
    14881 gggcaggcct gcgggggact ctaaggccgc cacgtcccgg aaccactgca gatggggcac
    14941 ttgcgctccg tcgagctgtt gttgcgagag ctctcggatg cgcttaagga ttggctgcac
    15001 cccgtgcata gacgtaaaat ttaaaaaggc ctcggccctc cctggaacgg ctggtcggtc
    15061 cccgggttgc tgaaggtgcg gcgggccggg tttctgtccg tctagctggc gctccccgcc
    15121 ggccgccgcc atgaccgcac cacgctcgcg ggcccccact acgcgtgcgc ggggggacac
    15181 ggaagcgctg tgctcccccg aggacggctg ggtaaaggtt caccccaccc ccggtacgat
    15241 gctgttccgc gagattctcc acgggcagct ggggtatacc gagggccagg gggtgtacaa
    15301 cgtcgtccgg tccagcgagg cgaccacccg gcagctgcag gcggcgatct ttcacgcgct
    15361 cctcaacgcc accacttacc gggacctcga ggcggactgg ctcggccacg tggcggcccg
    15421 cggtctgcag ccccaacggc tggttcgccg gtacaggaac gcccgggagg cggatatcgc
    15481 cggggtggcc gagcgggtgt tcgacacgtg gcggaacacg cttaggacga cgctgctgga
    15541 ctttgcccac gggttggtcg cctgctttgc gccgggcggc ccgagcggcc cgtcaagctt
    15601 ccccaaatat atcgactggc tgacgtgcct ggggctggtc cccatattac gcaagcgaca
    15661 agaagggggt gtgacgcagg gtctgagggc gtttctcaag cagcacccgc tgacccgcca
    15721 gctggccacg gtcgcggagg ccgcggagcg cgccggcccc gggttttttg agctggcgct
    15781 ggccttcgac tccacgcgcg tggcggacta cgaccgcgtg tatatctact acaaccaccg
    15841 ccggggcgac tggctcgtgc gagaccccat cagcgggcag cgcggagaat gtctggtgct
    15901 gtggcccccc ttgtggaccg gggaccgtct ggtcttcgat tcgcccgtcc agcggctgtt
    15961 tcccgagatc gtcgcgtgtc actccctccg ggaacacgcg cacgtctgcc ggctgcgcaa
    16021 taccgcgtcc gtcaaggtgc tgctggggcg caagagcgac agcgagcgcg gggtggccgg
    16081 tgccgcgcgg gtcgttaaca aggtgttggg ggaggacgac gagaccaagg ccgggtcggc
    16141 cgcctcgcgc ctcgtgcggc ttatcatcaa catgaagggc atgcgccacg taggcgacat
    16201 taacgacacc gtgcgtgcct acctcgacga ggccgggggg cacctgatag acgccccggc
    16261 cgtcgacggt accctccctg gattcggcaa gggcggaaac agccgcgggt ctgcgggcca
    16321 ggaccagggg gggcgggcgc cgcagcttcg ccaggccttc cgcacggccg tggttaacaa
    16381 catcaacggc gtgttggagg gctatataaa taacctgttt ggaaccatcg agcgcctgcg
    16441 cgagaccaac gcgggcctgg cgacccaatt gcaggagcgc gaccgcgagc tccggcgcgc
    16501 aacagcgggg gccctggagc gccagcagcg cgcggccgac ctggcggccg agtccgtgac
    16561 cggtggatgc ggcagccgcc ctgcgggggc ggacctgctc cgggccgact atgacattat
    16621 cgacgtcagc aagtccatgg acgacgacac gtacgtcgcc aacagctttc agcacccgta
    16681 catcccttcg tacgcccagg acctggagcg cctgtcgcgc ctctgggagc acgagctggt
    16741 gcgctgtttt aaaattctgt gtcaccgcaa caaccagggc caagagacgt cgatctcgta
    16801 ctccagcggg gcgatcgccg cattcgtcgc cccctacttt gagtcagtgc ttcgggcccc
    16861 ccgggtaggc gcgcccatca cgggctccga tgtcatcctg ggggaggagg agttatggga
    16921 tgcggtgttt aagaaaaccc gcctgcaaac gtacctgaca gacatcgcgg ccctgttcgt
    16981 cgcggacgtc cagcacgcag cgctgccccc gcccccctcc ccggtcggcg ccgatttccg
    17041 gcccggcgcg tccccgcggg gccggtccag atcgcggtcg cccggaagaa ctgcgcgagg
    17101 cgcgccggac cagggcgggg gcatcgggca ccgggatggc cgccgcgacg gccgacgatg
    17161 aggggtcggc cgccaccatc ctcaagcagg ccatcgccgg ggaccgcagc ctggtcgagg
    17221 cggccgaggc gattagccag cagacgctgc tccgcctggc ctgcgaggtg cgccaggtcg
    17281 gcgaccgcca gccgcggttt accgccacca gcatcgcgcg cgtcgacgtc gcgcctgggt
    17341 gccggttgcg gttcgttctg gacgggagtc ccgaggacgc ctatgtgacg tcggaggatt
    17401 actttaagcg ctgctgcggc cagtccagtt atcgcggctt cgcggtggcg gtcctgacgg
    17461 ccaacgagga ccacgtgcac agcctggccg tgccccccct cgttctgctg caccggttct
    17521 ccctgttcaa ccccagggac ctcctggact ttgagcttgc ctgtctgctg atgtacctgg
    17581 agaactgccc ccgaagccac gccaccccgt cgacctttgc caaggttctg gcgtggctcg
    17641 gggtcgcggg tcgccgcacg tccccattcg aacgcgttcg ctgccttttc ctccgcagtt
    17701 gccactgggt cctaaacaca ctcatgttca tggtgcacgt aaaaccgttc gacgacgagt
    17761 tcgtcctgcc ccactggtac atggcccggt acctgctggc caacaacccg ccccccgttc
    17821 tctcggccct gttctgtgcc accccgacga gctcctcatt ccggctgccg gggccgcccc
    17881 cccgctccga ctgcgtggcc tataaccccg ccgggatcat ggggagctgc tgggcgtcgg
    17941 aggaggtgcg cgcgcctctg gtctattggt ggctttcgga gaccccaaaa cgacagacgt
    18001 cgtcgctgtt ttatcagttt tgttgaattt taggaaataa acccggtttt gtttctgtgg
    18061 cctcccgacg gatgcgcgtg tccttactcc gtcttggtgg gtgggtggct gtgtatggcg
    18121 tcccatctgt gcggggaggg gggcaagtcg gcacgtattc ggacagactc aagcacacac
    18181 gggggagcgc tcttgtctca gggcaatgtt tttattggtc aaactcaggc aaacagaaac
    18241 gacatcttgt cgtcaaaggg atacacaaac ttccccccct cgccccatac tcccgccagc
    18301 accccggtaa acaccaactc aatctcgcgc aggatttcgc gcaggtgatg agcgcagtcc
    18361 acggggggga gcacaagggg ccgcgggtat agatcgacgg ggacgccgac cgactccccg
    18421 cctccgggac agacacgcac gacgcgccgc cagtagtgct ctgcgtccag caaggcgccg
    18481 ccgcggaagg cagtgggggg caaggggtcg ctggcctcaa agggggacac ccgaacgctc
    18541 cagtactccg cgtccaaccg tttattaaac gcgtccaaga taaggcggtc gcaggcgtcc
    18601 tccataaggc cccgggccgt gagtgcgtcc tcctccggca cgcatgccgt tgtcaggccc
    18661 aggacccgtc gcagcgtgtc gcgtacgacc cctgccgccg tggtgtacgc gggcccgcgg
    18721 agaggaaatc ccccaagatg gtcagtgttg tcgcgggagt tccagaacca cactcccgcc
    18781 tggctccagg cgactgcgtg ggtgtagacg ccctcgaggg ccaggcacag tgggtgccgc
    18841 agccggaggc cgttggccct aagcacggct cccacggccg tctcgatggc ccgccgggcg
    18901 tcctcgatca ccccggaagc cgcatccgcg tcttgggggt ccacgttaaa gacaccccag
    18961 aacgcacccc catcgccccc gcagaccgcg aacttcaccg agctggccgt ctcctcgatc
    19021 tgcaggcaga cggcggccat taccccaccc aggagctgcc gcagcgcagg gcaggcgttg
    19081 cacgtgtccg ggaccaggcg ctccaagacg gccccggccc agggctctga gggagcggcc
    19141 accaccagcg cgtccagtct tgctaggccc gtccggccgt gggggtccgc cagcccgctc
    19201 cccccgaggt cggccagggc cgccaggagc tgggcgcgaa gtccggggaa gcaaaaccgc
    19261 gccgtccaga cgggcccgac ggccgcgggc gggtctaaca gttggatgat tttagtggcg
    19321 ggatgccacc gcgccaccgc ctcccgcacc gcgggcagga ggcatccggc tgccgccgag
    19381 gccacgccgg gccaggctcg cggggggagg acgaccctgg cccccaccgc gggccaggcc
    19441 cccaggagcg cggcgtaagc ggccgcggcc ccgcgcacca ggtcccgtgc cgactcggcc
    19501 gtggccggca cggtgaacgt gggccaaccc ggaaacccca ggacggcaaa gtacgggacg
    19561 ggtccccccc ggacctcaaa ctcgggcccc agaaaggcaa agacgggggc cagggccccg
    19621 ggggcggcgt ggaccgtggt atgccactgc cggaaaaggg cgacgagcgc cggcgcggag
    19681 aacttctcgc cggcgcttac aaagtagtcg taatcgcggg gcagcagcac ccgtgccgtg
    19741 actcgttgcg ggtgcccgcg tggccgcagg cccacctcgc acacctcgac caggtccccg
    19801 aacgcgccct ccttcttgat cggcggaaac gcaagagtct ggtattcgcg cgcaaatagc
    19861 gcggttccgg tggtgatgtt aacggtcagc gaagcggcgg acgcgcactg gggggtgtcg
    19921 cgaatggccg ccaggcgcgc ccacgccagc cgcgcgtcgg gatgctcggc aacgcgcgcc
    19981 gccagggcca tagggtcgat gtcaatgttg gcctccgcga ccaggagagc ggcgcgaggg
    20041 gcggcgggcg ggccccacga cgctctctca actttcacca ccagtcccgt gcgtgggtcc
    20101 gagccgatac gcagcggggc gaacagggcc accggcccgg tctggcgctc cagggccgcc
    20161 aggacgcacg cgtacagcgc ccgccacaga gtcgggttct ccaggggctc cagcggggag
    20221 gcggccggcg tcgtcgcggc gcgggcggcc gccacgacgg cctggacgga gacgtccgcg
    20281 gagccgtaga aatcccgcag ctccgtcgcg gtgacggaga cctccgcaaa gcgcgcgcga
    20341 ccctcccctg cggcgttgcg acatacaaaa tacaccaggg cgtggaagta ctcgcgagcg
    20401 cgggggggca gccataccgc gtaaagggta atggcgctga cgctctcctc cacccacacg
    20461 atatctgcgg tgtccatcgc acggccccta aggatcacgg gcggtctgtg ggtcccatgc
    20521 tgccgtgcct ggccgggccc ggtgggtcgc ggaaaccggt gacggggggg gggcggtttt
    20581 tggggttggg gtgggggtgg gaaacggccc gggtccgggg gccaacttgg cccctcggtg
    20641 cgttccggca acagcgccgc cggtccgcgg acgaccacgt accgaacgag tgcggtcccg
    20701 agacttatag ggtgctaaag ttcaccgccc cctgcatcat gggccaggcc tcggtgggga
    20761 gctccgacag cgccgcctcc aggatgatgt cagcgttggg gttggcgctg gatgagtgcg
    20821 tgcgcaaaca gcgcccccac gcgggcacgc gtagcttgaa gcgcgcgccc gcaaactccc
    20881 gcttgtgggc cataagcagg gcgtacagct gcctgtgggt ccggcaggcg ctgtggtcga
    20941 tgtggtgggc gtccaacaac cccacgattg tctgtttggt gaggttttta acgcgccccg
    21001 ccccgggaaa cgtctgcgtg cttttggcca tctgcacgcc aaacagttcg ccccagatta
    21061 tcttgaacag cgccaccgcg tggtccgtct cgctaacgga cccgcgcggg ggacagccgc
    21121 ttagggcgtc ggcgacgcgc ttgacggctt cctccgagag cagaagtccg tcggttacgt
    21181 tacagtggcc cagttcgaac accagctgca tgtagcggtc gtagtggggg gtcagtaggt
    21241 ccagcacgtc atcggggccg aaggtcctcc cagatccccc ggccgccgag tcccaatgca
    21301 ggcgcgcggc catggtgctg cacaggcaca acagctccca gacgggggtt acgttcaggg
    21361 tggggggcag ggccacgagc tccagctctc cggtgacgtt gatcgtgggg atgacgcccg
    21421 tggcgtagtg gtcatagatc cgccgaaata tggcgctgct gcgggtggcc atgggaacgc
    21481 ggagacaggc ctccagcaac gccaggtaaa taaaccgcgt gcgtcccatc aggctgttga
    21541 ggttgcgcat gagcgcgaca atttccgccg gcgcgacatc ggaccggagg tatttttcga
    21601 cgaaaagacc cacctcctcc gtctcggcgg cctgggccgg cagcgacgcc tcgggatccc
    21661 ggcaccgcag ctcccgtaga tcgcgctggg ccctgagggc gtcgaaatgt acgccccgca
    21721 aaaacagaca gaagtccttt ggggtcaggg tatcgtcgtg tccccagaag cgcacgcgta
    21781 tgcagtttag ggtcagcagc atgtgaagga tgttaaggct gtccgagaga cacgccagcg
    21841 tgcatctctc aaagtagtgt ttgtaacgga atttgttgta gatgcgcgac ccccgcccca
    21901 gcgacgtgtc gcatgccgac gcgtcacagc gccccttgaa ccggcgacac agcaggtttg
    21961 tgacctggga gaactgcgcg ggccactggc cgcaggaact gaccacgtga ttaaggagca
    22021 tgggcgtaaa gacgggctcc gagcgcgccc cggagccgtc catgtaaatc agtagctccc
    22081 ccttgcggag ggtgcgcacc cgtcccaggg actggtacac ggacaccatg tccggtccgt
    22141 agttcatggg tttcacgtag gcgaacatgc catcaaagtg caggggatcg aagctgaggc
    22201 ccacggttac gaccgtcgtg tatataacca cgcggtattg gccccacgtg gtcacgtccc
    22261 cgaggggggt gagcgagtga agcaacagca cgcggtccgt aaactgacgg cagaaccggg
    22321 ccacgatctc cgcgaaggag accgtcgacg aaaaaatgca gatgttatcg cccccgccaa
    22381 ggcgcgcttc cagctcccca aagaacgtgg ccccccgggc gtccggagag gcgtccggag
    22441 acgggccgct cggcggcccg ggcgggcgca gggcagcctg caggagctcg gtccccagac
    22501 gcgggagaaa caggcaccgg cgcgccgaaa acccgggcat ggcgtactcg ccgaccacca
    22561 catgcacgtt tttttcgccc cggagaccgc acaggaagtc caccaactgc gcgttggcgg
    22621 ttgcgtccat ggcgatgatc cgaggacagg tgcgcagcag gcgtagcatt aacgcatcca
    22681 cgcggcccag ttgctgcatc gttggcgaat agagctggcc cagcgtcgac ataacctcgt
    22741 ccagaacgag gacgtcgtag ttgttcagaa ggttggggcc cacgcgatga aggctttcca
    22801 cctggacgat aagtcggtgg aaggggcggt cgttcataat gtaattggtg gatgagaagt
    22861 aggtgacaaa gtcgaccagg cctgactcag cgaaccgcgt cgctagggtc tgggtaaaac
    22921 tccgacgaca ggagacgacg agcacactcg tgtccggaga gtggatcgct tcccgcagcc
    22981 agcggatcag cgcggtagtt tttcccgacc ccattggcgc gcggaccaca gtcacgcacc
    23041 tggccgtcgg ggcgctcgcg ttggggaagg tgacgggtcc gtgctgctgc cgctcgatcg
    23101 ttgttttcgg gtgaacccgg ggcacccatt cggccaaatc ccccccgtac aacatccgcg
    23161 ctagcgatac gctcgacgtg tactgttcgc actcgtcgtc cccaatggga cgcccggccc
    23221 ccagaggatc tcccgactcc gcgcccccca cgaaaggcat gaccggggcg cggacggcgt
    23281 ggtgggtctg gtgtgtgcag gtggcgacgt ttgtggtctc tgcggtctgc gtcacggggc
    23341 tcctcgtcct ggcctctgtg ttccgggcac ggtttccctg cttttacgcc acggcgagct
    23401 cttatgccgg ggtgaactcc acggccgagg tgcgcggggg tgtagccgtg cccctcaggt
    23461 tggacacgca gagccttgtg ggcacttatg taatcacggc cgtgttgttg ttggccgtgg
    23521 ccgtgtatgc cgtggtcggc gccgtgacct cccgctacga ccgcgccctg gacgcgggcc
    23581 gccgtctggc tgcggcccgc atggccatgc cgcacgccac gctgatcgcc ggaaacgtct
    23641 gctcttggtt gctgcagatc accgtcctgt tgctggccca tcgcatcagc cagctggccc
    23701 acctggttta cgtcctgcac tttgcgtgtc tggtgtattt tgcggcccat ttttgcacca
    23761 ggggggtcct gagcgggacg tatctgcgtc aggtgcacgg cctgatggag ctggccccga
    23821 cccatcatcg cgtcgtcggc ccggctcgcg ccgtgctgac aaacgccttg ctgttgggcg
    23881 tcttcctgtg cacggccgac gccgcggtat ccctgaatac catcgccgcg ttcaacttta
    23941 atttttcggc cccgggcatg ctcatctgcc tgaccgtgct gttcgccatt ctcgtcgtat
    24001 cgctgttgtt ggtggtcgag ggggtgttgt gtcactacgt gcgcgtgttg gtgggccccc
    24061 acctgggggc cgtggccgcc acgggcatcg tcggcctggc ctgcgagcac tattacacca
    24121 acggctacta cgttgtggag acgcagtggc cgggggctca gacgggagtc cgcgtcgccc
    24181 tcgccctggt cgccgccttt gccctcggca tggccgtgct ccgctgcacc cgcgcctatc
    24241 tgtatcacag gcggcaccac accaaatttt ttatgcgcat gcgcgacacg cgacaccgcg
    24301 cacattccgc cctcaagcgc gtacgcagtt ccatgcgcgg atcgcgagac ggccgccaca
    24361 ggcccgcacc cggcagcccg cccgggattc ccgaatatgc ggaagacccc tacgcgatct
    24421 catacggcgg ccagctcgac cggtacggag attccgacgg ggagccgatt tacgacgagg
    24481 tggcggacga ccaaaccgac gtattgtacg ccaagataca acacccgcgg cacctgcccg
    24541 acgacgatcc catctatgac accgttgggg ggtacgaccc cgagcccgcc gaggaccccg
    24601 tgtacagcac cgtccgccgt tggtagctgt ttggttccgt tttaataaac cgtttgtgtt
    24661 taacccgacc gtggtgtatg tctggtgtgt ggcgtccgat cccgttacta tcaccgtccc
    24721 cccccccccc tcaaccccgg cgattgtggg ttttttaaaa acgacacgcg tgcgaccgta
    24781 tacagaacat tgttttggtt tttattcgct atcggacatg gggggtggaa actgggtggc
    24841 ggggcaggcg cctccggggg tccgccggtg agtgtggcgc gagggggggt ccgatgaacg
    24901 caggcgctgt ctccccgggg cccgcgtaac cccgcgcata tccgggggca cgtagaaatt
    24961 accttcctct tcggactcga tatccacgac gtcaaagtcg tgggcggtca gcgagacgac
    25021 ctccccgtcg tcggtgatga ggacgttgtt tcggcagcag cagggccggg ccccggagaa
    25081 cgagaggccc atagctcggc gagcgtgtcg tcgaatgcca ggcggctgct tcgctggatg
    25141 gccttataga tctccggatc gatgcggacg ggggtaatga tcagggcgat cggaacggcc
    25201 tggttcggga gaatggacgc cttgctgggt cctgcggccc cgagagcccc ggcgccgtcc
    25261 tccaggcgga acgttacgcc ctcctccgcg ctggtgcggt gcctgccgat aaacgtcacc
    25321 agatgcgggt ggggggggca gtcggggaag tggctgtcga gcacgtagcc ctgcaccaag
    25381 atctgcttaa agttcgggtg acgggggttc gcgaagacgg gctcgcggcg gaccagatcc
    25441 ccggagctcc aggacacggg ggagatggtg tggcgtccga ggtcgggggc gccaaacaga
    25501 agcacctccg agacaacgcc gctatttaac tccaccaagg cccgatccgc ggcggagcac
    25561 cgcctttttt cgcccgaggc gtgggcctct gaccaggcct ggtcttgcgt gacgagagcc
    25621 tcctccgggc cggggacgcg cccgggcgcg aagtatcgca cgctgggctt cgggatcgac
    25681 cggataaatg cccggaacgc ctccggggac cggtgtgcca tcaagtcctc gtacgcggag
    25741 gccgtggggt cgctggggtc catggggtcg aaagcgtact tggcccggca tttgacctcg
    25801 taaaaggcca ggggggtctt ggggactggg gccaggtagc cgtgaatgtc ccgaggacag
    25861 acgagaatat ccagggacgc cccgaccatc cccgtgtgac cgtccatgag gaccccacac
    25921 gtatgcacgt tctcttcggc gaggtcgctg ggttcgtgga agataaagcg ccgcgtgtcg
    25981 gcgccggcct cgccgccgtc gtccgcgcgg cccacgcagt agcgaaacag caggcttcgg
    26041 gccgtcggct cgttcacccg cccgaacatc accgccgaag actgtacatc cggccgcagg
    26101 ctggcgttgt gcttcagcca ctggggcgag aaacacggac cctgggggcc ccagcggagg
    26161 gtggatgcgg tcgtgaggcc ccgccggagc agggcccata gctggcagtc ggcctggttt
    26221 tgcgtggccg cctcgtaaaa ccccatgagg ggccggggcg ccacggcgtc cgcggcggcc
    26281 gggggcccgc ggcgcgtcag gcgccatagg tgccgaccga gtccgcggtc caccataccc
    26341 gcctcctcga ggaccacggc cagggaacac agataatcca ggcgggccca gaggggaccg
    26401 atggccagag gggcgcggac gccgcgcagc aacccgcgca ggtggcgctc gaacgtctcg
    26461 gctagtatat gggagggcag cgcgttgggg atcaccgacg ccgaccacat agagtcaagg
    26521 tccggggagt cgggatcggc gtccgggtcg cgggcgtggg tgcccccagg agatagcgga
    26581 atgtctgggg tcggaggccc tgaggcgtca gaaagtgccg gcgacgcggc ccggggcttt
    26641 tcgtctgcgg tgtcggtggc gtgctgatca cgtggggggt taacgggcga atgggagctc
    26701 gggtccacag ctgacgtcgt ctggggtggg gggggcaggg gacggaaggt ggttgtcagc
    26761 ggaagactgt tagggcgggg gcgcttgggg gggctgtcgg ggccacgagg ggtgtcctcg
    26821 gccagggccc agggacgctt agtcacggtg cgtcccggcg gacatgctgg gcctaccgtg
    26881 gactccattt ccgagacgac gtggggggag cggtggttga gcgcgccgcc gggtgaacgc
    26941 tgattctcac gacagcgcgt gccgcgcgca cgggttggtg tgacacaggc gggacaccag
    27001 caccaggaga ggcttaagct cgggaggcag cgccaccgac gacagtatcg ccttgtgtgt
    27061 gtgctggtaa tttatacacc gatccgtaaa cgcgcgccga atcttgggat tgcggaggtg
    27121 gcgccggatg ccctctggga cgtcatacgc caggccgtgg gtgttggtct cggccgagtt
    27181 gacaaacagg gctgggtgca gcacgcagcg ataggcgagc agggccaggg cgaagtccgg
    27241 cgacagctgg ttgttaaaat actggtaacc gggaaaccgg gtcacgggta cgcccaggct
    27301 cggggcgacg tacacgctaa ccaccaactc cagcagcgtc tggcccaggg cgtacaggtc
    27361 aaccgctaac ccgacgtcgt gcttcaggcg gtggttggta aattcggccc gttcgttgtt
    27421 aaggtatttc accaacagct ccgggggctg gttatacccg tgacccacca gggtgtgaaa
    27481 gttggctgtg gttagggcgg tgggcatgcc aaacatccgg ggggacttga ggtccggctc
    27541 ctggaggcaa aactgccccc gggcgatcgt ggagttggag ttgagggtga cgaggctaaa
    27601 gtcggcgagg acggcccgcc ggagcgagac ggcgtccgac cgcagcatga cgaggatgtt
    27661 ggcgcacttg atatccaggt ggctgatccc gcaggtggtg tttaaaaaca caacggcgcg
    27721 ggccagctcc gtgaagcact ggtggagggc cgtcgagacc gaggggtttg ttgtgcgcag
    27781 ggacgccagt tggccgatat acttaccgag gtccatgtcg tacgcgggga acactatctg
    27841 tcgttgttgc agcgagaacc cgaggggcgc gatgaagccg cggatgttgt gggtgcggcc
    27901 ggcgcgtaga acgcactccc cgaccaacag ggtcgcgatg agctcaacgg caaaccactc
    27961 cttttccttt atggtcttaa cggcaagctt atgttcgcga atcagttgga cgtcaccgta
    28021 tcccccagac cccccgaagc ttcgggcccc ggggatctcg agggtcgtgt agtgtagggc
    28081 ggggttgatg gcgaacacgg ggctgcatag cttgcggatg cgcgtgaggg tgaggatgtg
    28141 cgagggggac gaggggggtg cggttaacgc cgcctgggat ctgcgcaggg gcgggcggtt
    28201 cagtttggcc gccgtaccgg gcgtctcggg ggacgcgcgg cgatgagacg agcggctcat
    28261 tcgccatcgg gatagtcccg cgcgaagccg ctcgcggagg ccggatcggt ggcgggaccc
    28321 gtgggaggag cgggagacgg cggcgtcctg gagagagggg ccgctggggc gcccggaggc
    28381 cccgtggggg ttggagtgta cgtaggatgc gagccaatcc ttgaaggacc gttggcgtgc
    28441 accttggggg ctgaggttag ctgccacatg accagcaggt cgctgtctgc gggactcatc
    28501 catccttcgg ccaggtcgcc gtctccccac agagaagcgt tggtcgctgc ttcctcgagt
    28561 tgctcctcct ggtccgcaag acgatcgtcc acggcgtcca ggcgctcacc aagcgccgga
    28621 tcgaggtacc gtcggtgtgc ggttagaaag tcacgacgcg ccgcttgctc ctccacgcga
    28681 attttaacac aggtcgcgcg ctgtcgcatc atctctaagc gcgcgcggga ctttagccgc
    28741 gcctccaatt ccaagtgggc cgcctttgca gccataaagg cgccaacaaa ccgaggatct
    28801 tgggtgctga cgccctcccg gtgcagctgc agggtctggt ccttgtaaat ctcggctcgg
    28861 aggtgcgtct cggccaggcg tcggcgcagg gccgcgtggg cggcatctcg gtccattccg
    28921 ccaccctgcg ggcgacccgg ggggtgctct gatagtctcg cgtgcccaag gcccgtgatc
    28981 ggggtacttc gccgccgcga cccgccaccc ggtgtgcgcg atgtttggtc agcagctggc
    29041 gtccgacgtc cagcagtacc tggagcgcct cgagaaacag aggcaactta aggtgggcgc
    29101 ggacgaggcg tcggcgggcc tcaccatggg cggcgatgcc ctacgagtgc cctttttaga
    29161 tttcgcgacc gcgaccccca agcgccacca gaccgtggtc cctggcgtcg ggacgctcca
    29221 cgactgctgc gagcactcgc cgctcttctc ggccgtggcg cggcggctgc tgtttaatag
    29281 cctggtgccg gcgcaactaa aggggcgtga tttcgggggc gaccacacgg ccaagctgga
    29341 attcctggcc cccgagttgg tacgggcggt ggcgcgactg cggtttaagg agtgcgcgcc
    29401 ggcggacgtg gtgcctcagc gtaacgccta ctatagcgtt ctgaatacgt ttcaggccct
    29461 ccaccgctcc gaagcctttc gccagctggt gcactttgtg cgggactttg cccagctgct
    29521 caaaacctcc ttccgggcct ccagcctcac ggagaccacg ggccccccca aaaaacgggc
    29581 caaggtggac gtggccaccc acggccggac gtacggcacg ctggagctgt tccaaaaaat
    29641 gatccttatg cacgccacct actttctggc cgccgtgctc ctcggggacc acgcggagca
    29701 ggtcaacacg ttcctgcgtc tcgtgtttga gatccccctg tttagcgacg cggccgtgcg
    29761 ccacttccgc cagcgcgcca ccgtgtttct cgtcccccgg cgccacggca agacctggtt
    29821 tctggtgccc ctcatcgcgc tgtcgctggc ctcctttcgg gggatcaaga tcggctacac
    29881 ggcgcacatc cgcaaggcga ccgagccggt gtttgaggag atcgacgcct gcctgcgggg
    29941 ctggttcggt tcggcccgag tggaccacgt taaaggggaa accatctcct tctcgtttcc
    30001 ggacgggtcg cgcagtacca tcgtgtttgc ctccagccac aacacaaacg taagtcctct
    30061 tttctttcgc atggctctcc caaggggccc cgggtcgacc cgacccacac ccacccaccc
    30121 acatacacac acaaccagac gcgggaggaa agtctgcccc gtgggcactg atttttattc
    30181 gggatcgctt gaggaggccc gggcaacggc ccgggcaacg gtggggcaac tcgtagcaaa
    30241 taggcgactg atgtacgaag agaagacaca caggcgccac ccggcgctgg tcggggggat
    30301 gttgtccgcg ccgcaccgtc ccccgacgac ctcttgcaga cggtccgtga tgcaaggacg
    30361 gcggggggcc tgcagcaggg tgaccgtatc cacgggatgg ccaaagagaa gcggacacag
    30421 gctagcatcc ccctggaccg ccagggtaca ctgggccatc ttggcccaca gacacggggc
    30481 gacgcaggga caggactccg ttacgacgga ggagagccac agtgcgttgg cggaatcgat
    30541 gtggggcggc ggggcgcagg actcgcagcc ccccgggtgg ttggtgatcc tggccaggag
    30601 ccatcccaga tggcgggccc tgcttcccgg tggacagagc gaccccaggt cgctgtccat
    30661 ggcccagcag tagatctggc cgctggggag gtgccaccag gcccccgggc ccaaggcgca
    30721 gcacgcgccc ggctccgggg gggtcttcgc ggggaccaga tacgcgccat ccagctcgcc
    30781 gaccactggc tcctccgcga gctgttcggt ggttgggtcg ggggtttcct ccgggggggt
    30841 ggccgcccgt atgcgtgcga acgtgagggt gcacaggagc ggggtcaggg ggtgcgtcac
    30901 gctccggagg tggacgatcg cgcagtagcg gcgctcgcgg ttaaagaaaa agagggcaaa
    30961 gaaggtgttc gggggcaacc gcagcgcctt ggggcgcgtc agatacagaa aaatctcgca
    31021 gaagagggcg cgcccggggt ctgggttagg aagggccacc tgacacagag gctcggtgag
    31081 gaccgttaga caccgaaaga tcttgagccg ctcgtccgcc cgaacgacgc gccacacaaa
    31141 gacggagttg acaatgcgcg cgatagagtc gacgtccgtc cccaggtcgt cgactctatc
    31201 gcgcgtgccg cgagctccgg cccgggaatc cggccggggc aaggtccccg ggggaccagg
    31261 cggcgccagg ggccgccggg gtcccagctg cgccatgccg ggggcggggg gagggcaaac
    31321 cccagaggcg ggggccaacg gcgcggggag gagtgggtgg gcgaggtggc cgggggaagg
    31381 cgcccgctag cgagaccggc cgttcccgga cgacaccttg cgacaaaacc taaggacagc
    31441 ggcccgcgcg acggggtccg agaggctaag gtaggccgcg atgttaatgg tgaacgcaaa
    31501 gccgccggga aagacaacta tgccacagag gcggcgatta aaccccaggc agaggtaggc
    31561 gtagctttcc ccgggcaggt attgctcgca gaccctgcgt ggggctgtgg aggggacggc
    31621 ctccatgaag cgacatttac tctgctcgcg tttactgacg tcaccatcca tcgccacggc
    31681 gattggacga ttgttaagcc gcagcgtgtc tccgcttgtg ctgtagtagt caaaaacgta
    31741 atggccgtcg gagtcggcaa agcgggccgg gaggtcgtcg ccgagcggga cgacccgccg
    31801 cccccgaccg ccccgtcccc ccaggtgtgc caggacggcc agggcatacg cggtgtgaaa
    31861 aaaggcgtcg ggggcggtcc cctcgacggc gcgcatcagg ttctcgagga gaatggggaa
    31921 gcgcctggtc acctccccca accacgcgcg ttggtcgggg ccaaagtcat agcgcaggcg
    31981 ctgtgagatt cgcgggccgc cctgaagcgc ggcccggatg gcctggccca gggcccggag
    32041 gcacgccaga tgtatgcgcg cggtaaaggc gacctcggcg gcgatgtcaa agggcggcag
    32101 gacggggcgc gggtggcgca ggggcacctc gagcgcggga aagcgtagca gcagctccgc
    32161 ctgcccagcg ggagacagct ggtgggggcg cacgacgcgt tctgcggcgc aggcctcggt
    32221 cagggccgtg gccagcgccg aggacagcag cggagggcgg gcgcgtcgcc cgccccacgc
    32281 cacggagttc tcgtaggaga cgacgacgaa gcgctgcttg gttccgtagt ggtggcgcag
    32341 gaccacggag atagaacgac ggctccacag ccagtccggc cggtcgccgc cggccagggc
    32401 ttcccatccg cgatccaacc actcgaccag cgaccgcggc tttgcggtac caggggtaag
    32461 ggttagaacg tcgttcagga tgtcctcgcc cccgggcccg tggggcgctg gggccacaaa
    32521 gcggcccccg ccggggggct ccagacccgc cagcaccgca tctgcgtcag ccgcccccat
    32581 ggcgcccccg ctgacggcct ggtgaaccag ggcgccctgg cgtagccccg atgcaacgcc
    32641 acaggccgca cgcccggtcc gcgctcggac cgggtggcgg cgggtgacgt cctgcactgc
    32701 ccgctgaacc aacgcgagga tctcctcgtt ctcctgtgcg atggacacgt cctgggccgc
    32761 ggtcgtgtcg ccgccggggg ccgtcagctg ctcctccggg gagatggggg ggtcggacgc
    32821 cccgacgatg ggcgggtctg cgggcgcccc cgcgtggggc cgggccaagg gctgcggacg
    32881 cggggacgcg ctttccccca gacccatgga caggtgggcc gcagcctcct tcgcggccgg
    32941 cggggcggcg gcgccaagca gagcgacgta gcggcacaaa tgccgacaga cgcgcatgat
    33001 gcgcgtgctg tcggccgcgt agcgcgtgtt gggggggacg agctcgtcgt aactaaacag
    33061 aatcacgcgg gcacagctcg cccccgagcc ccacgcaagg cgcagcgccg ccacggcgta
    33121 cgggtcatag acgccctgcg cgtcacacac cacgggcagg gagacgaaca accccccggc
    33181 gctggacgca cgcggaagga ggccagggtg tgccggcacg acgggggcca gaagctcccc
    33241 caccgcatcc gcgggcacgt aggcggcaaa cgccgtgcac cacggggtac agtcgccggt
    33301 ggcatgagcc cgagtctgga tttcgacctg gaagtttgcg gccgtcccga gtccggggcg
    33361 gccgcgcatc agggcggcca gagggattcc cgcggccgcc aggcactcgc tggatatgat
    33421 gacgtgaacc aaagacgagg gccgacccgg gccgtggccg agatcgtact ggacctcgtt
    33481 ggccaagtgc gcgttcatgg ttcgggggtg ggtgtgggtg tgtaggcgat gcgggtcccc
    33541 cgagtccgcg ggaagggcgt gggtttggcg cgcgtatgcg tattcgccaa cggaggcgtg
    33601 cgtgcttatg cgcggcgcgt ttcttctgtc tctagggaat ccgaggccag gactttaacc
    33661 tgctctttgt cgacgaggcc aactttattc gcccggatgc ggtccagacg attatgggct
    33721 ttctcaacca ggccaactgc aagattatct tcgtgtcgtc caccaacacc gggaaggcca
    33781 gtacgagctt tttgtacaac ctccgcgggg ccgcagacga gcttctcaac gtggtgacct
    33841 atatatgcga tgatcacatg ccgagggtgg tgacgcacac aaacgccacg gcctgttctt
    33901 gttatatcct caacaagccc gttttcatca cgatggacgg ggcggttcgc cggaccgccg
    33961 atttgtttct ggccgattcc ttcatgcagg agatcatcgg gggccaggcc agggagaccg
    34021 gcgacgaccg gcccgttctg accaagtctg cgggggagcg gtttctgttg taccgcccct
    34081 cgaccaccac caacagcggc ctcatggccc ccgatttgta cgtgtacgtg gatcccgcgt
    34141 tcacggccaa cacccgagcc tccgggaccg gcgtcgctgt cgtcgggcgg taccgcgacg
    34201 attatatcat cttcgccctg gagcactttt ttctccgcgc gctcacgggc tcggcccccg
    34261 ccgacatcgc ccgctgcgtc gtccacagtc tgacgcaggt cctggccctg catcccgggg
    34321 cgtttcgcgg cgtccgggtg gcggtcgagg gaaatagcag ccaggactcg gccgtcgcca
    34381 tcgccacgca cgtgcacaca gagatgcacc gcctactggc ctcggagggg gccgacgcgg
    34441 gctcgggccc cgagcttctc ttctaccact gcgagcctcc cgggagcgcg gtgctgtacc
    34501 cctttttcct gctcaacaaa cagaagacgc ccgcctttga acactttatt aaaaagttta
    34561 actccggggg cgtcatggcc tcccaggaga tcgtttccgc gacggtgcgc ctgcagaccg
    34621 acccggtcga gtatctgctc gagcagctaa ataacctcac cgaaaccgtc tcccccaaca
    34681 ctgacgtccg tacgtattcc ggaaaacgga acggcgcctc ggatgacctt atggtcgccg
    34741 tcattatggc catctacctc gcggcccagg ccggacctcc gcacacattc gctcctatca
    34801 cacgcgtctc gtgagcgccc aataaacaca cccaggtatg ctacgcacga ccacggtgtc
    34861 gtctgttaag gggggggggg gaagggggtg ttggcgggaa gcgtgggaac acgggggatt
    34921 ctctcacgac cggcaccagt accacccccc tgtgaacaca gaaaccccaa cccaaatccc
    34981 ataaacatac gacacacagg catattttgg aatttcttag gtttttattt atttaggtat
    35041 gctggggttt ctccctggat gcccaccccc acccccccgt gggtctagcc gggccttagg
    35101 gatagcgtat aacgggggcc atgtctccgg accgcacaac ggccgcgccg tcaaaggtgc
    35161 acacccgaac cacgggagcc agggccaagg tgtctcctag ttggcccgcg tgggtcagcc
    35221 aggcgacgag cgcctcgtaa agcggcagcc ttcgctctcc atcctgcatc agggccgggg
    35281 cttcggggtg aatgagctgg gcggcctccc gcgtgacact ctgcatctgc agtagagcgt
    35341 tcacgtaccc gtcctgggca cttagcgcaa agagccgggg gattagcgta aggatgatgg
    35401 tggttccctc cgtgatcgag taaaccatgt taaggaccag cgatcgcagc tcggcgttta
    35461 cgggaccgag ttgttggacg tccgccagca gcgagaggcg actcccgttg tagtacagca
    35521 cgttgaggtc tggcagccct ccggggtttc tggggctggg gttcaggtcc cggatgcccc
    35581 tggccacgag ccgcgccacg atttcgcgcg ccaggggcga tggaagcgga acgggaaacc
    35641 gcaacgtgag gtccagcgaa tccaggcgca cgtccgtcgc ttggccctcg aacacgggcg
    35701 ggacgaggct gatggggtcc ccgttacaga gatctacggg ggaggtgttg cgaaggttaa
    35761 cggtgccggc gtgggtgagg cccacgtcca gggggcaggc gacgattcgc gtgggaagca
    35821 cccgggtgat gaccgcgggg aagcgccttc ggtacgccag caacaacccc aacgtgtcgg
    35881 gactgacgcc tccggagacg aaggattcgt gcgccacgtc ggccagcgtc agttgccggc
    35941 ggatggtcgg caggaatacc acccgccctt cgcagcgctg cagcgccgcc gcatcggggc
    36001 gcgagatgcc cgagggtatc gcgatgtcag tttcaaagcc gtccgccagc atggcgccga
    36061 tccacgcggc agggagtgca gtggtggttc gggtggcggg aggagcgcgg tgggggtcag
    36121 cggcgtagca gagacgggcg accaacctcg cataggacgg ggggtgggtc ttagggggtt
    36181 gggaggcgac agggacccca gagcatgcgc ggggaggtct gtcgggccca gacgcaccga
    36241 gagcgaatcc gtccgcggag tcccggcttg ggttttatgg ggcccggccc tcggaatcgc
    36301 ggcttgtcgg cggggacaaa gggggcgggg ctaggggctt gcggaaacag aagacgcgtg
    36361 ggataaaaga atcgcactac cccaaggaag ggcggggcgg tttattacag agccagtccc
    36421 ttgagcgggg atgcgtcata gacgagatac tgcgcgaagt gggtctcccg cgcgtgggct
    36481 tccccgttgc gggcactgcg gaggagggcg gggtcgctgg cgcaggtgag cgggtaggcc
    36541 tcctgaaaca ggccacacgg gtcctccacg agttcgcggc accccggggg gcgcttaaac
    36601 tgtacgtcgc tggcggcggt ggccgtggac accgccgaac ccgtctccac gatcaggcgc
    36661 tccaggcagc gatgtttggc ggcgatgtcg gccgacgtaa agaacttaaa gcaggggctg
    36721 agcaccggcg aggccccgtt gaggtggtag gccccgttat agagcaggtc cccgtacgaa
    36781 aatcgctgcg acgcccacgg gttggccgtg gccgcgaagg cccgggacgg gtcgctctgg
    36841 ccgtggtcgt acatgagggc ggtgacatcc ccctccttgt cccccgcgta aacgcccccg
    36901 gcggcgcgtc cccgggggtt gcagggccgg cggaagtagt tgacgtcggt cgacacgggg
    36961 gtggcgataa actcacacac ggcgtcctgg ccgtggtcca tccctgcgcg ccgcggcacc
    37021 tgggcgcacc cgaacacggg gacgggctgg gccggcccca ggcggtttcc cgccacgacc
    37081 gcgttccgca ggtacacggc tgccgcgttg tccaggagag ggggagcccc gcggcccagg
    37141 taaaagtttt ggggaaggtt gcccatgtcg gtgacggggt tgcggacggt tgccgtggcc
    37201 acgacggcgg tgtagcccac gcccaggtcc acgttcccgc gcggctgggt gagcgtgaag
    37261 tttacccccc cgccagtttc gtgccgggcc acctggagct ggcccaggaa gtacgcctcc
    37321 gacgcgcgct ccgagaacag cacgttctca gtcacaaagc ggtcctgtcg gacgacggtg
    37381 aacccaaacc cgggatggag gcccgtcttg agctgatgat gcaaggccac gggactgatc
    37441 ttgaagtacc ccgccatgag cgcgtaggtc agcgcgttct ccccggccgc gctctcgcgg
    37501 acgtgctgca cgacgggctg tcggatcgac gaaaagtagt tggcccccag agccgggggg
    37561 accaggggga cctgccgcga caggtcgcgc agggccgggg ggaaattggg cgcgttcgcc
    37621 acgtggtcgg ccccggcgaa cagcgcgtgg acggggaggg ggtaaaaata gtcgccattt
    37681 tggatggtat ggtccagatg ctggggggcc atcagcagga ttccggcgtg caacgccccg
    37741 tcgaatatgc gcatgttggt ggtggacgcg gtgttggcgc ccgcgtcggg cgccgccgag
    37801 cagagcagcg ccgttgtgcg ttcggccatg ttgtgggcca gcacctgcag cgtgagcatg
    37861 gcgggcccgt ccactaccac gcgcccgttg tgaaacatgg cgttgaccgt gttggccacc
    37921 agattggccg ggtgcagggg gtgcgcgggg tccgtcacgg ggtcgctggg gcactcctcg
    37981 ccgggggcga tctccgggac caccatgttc tgcagggtgg cgtatacgcg gtcgaagcga
    38041 acccccgcgg tgcagcagcg gccccgcgag aaggcgggca ccatcacgta gtagtaaatc
    38101 ttgtggtgca cggtccagtc cgccccccgg tgcggccggt catccgcggc gtccgcggct
    38161 cgggcctggg tgttgtgcag cagctggccg tcgttgcggt tgaagtccgc ggtcgccacg
    38221 ttacatgccg ccgcgtacac ggggtcgtgg ccccccgcgc taacccggca gtcgcgatgg
    38281 cggtccaggg ccgcgcgccg catcagggcg tcacagtccc acacgagggg tggcagcagc
    38341 gccgggtctc gcattaggtg attcagctcg gcttgcgcct gcccgcccag ctccgggccg
    38401 gtcagggtaa agtcatcaac cagctgggcc agggcctcga cgtgcgccac caggtcccgg
    38461 tacacggcca tgcactcctc gggaaggtct cccccgaggt aggtcacgac gtacgagacc
    38521 agcgagtagt cgttcacgaa cgccgcgcac cgcgtgttgt tccagtagct ggtgatgcac
    38581 tggaccacga gccgggccag ggcgcagaag acgtgctcgc tgccgtgtat ggcggcctgc
    38641 agcaggtaaa acaccgccgg gtagttgcgg tcgtcgaacg ccccgcgaac ggcggcgatg
    38701 gtggcggggg ccatggcgtg gcgtcccacc cccagctcca ggccccgggc gtcccggaac
    38761 gccgccggac atagcgccag gggcaagttg ccgttcacca cgcgccaggt ggcctggatc
    38821 tcccccgggc cggccggggg aacgtccccc cccggcagct ccacgtcggc cacccccaca
    38881 aagaagtcga acgcggggtg cagctcaaga gccaggttgg cgttgtcggg ctgcataaac
    38941 tgctccgggg tcatctggcc ttccgcgacc catcggaccc gcccgtgggc caggcgctgc
    39001 ccccaggcgt tcaaaaacag ctgctgcatg tctgcggcgg ggccggccgg ggccgccacg
    39061 tacgccccgt acggattggc ggcttcgacg gggtcgcggt taaggccccc gaccgccgcg
    39121 tcaacgttca tcagcgaagg gtggcacacg gtcccgatcg cgtgttccag agacaggcgc
    39181 agcacctggc ggtccttccc ccaaaaaaac agctggcggg gcgggaaggc gcggggatcc
    39241 gggtggccgg gggcggggac taggtccccg gcgtgcgcgg caaaccgttc catgaccgga
    39301 ttgaacaggc ccaggggcag gacgaacgtc aggtccatgg cgcccaccag ggggtaggga
    39361 acgttggtgg cggcgtagat gcgcttctcc agggcctcca gaaagaccag cttctcgccg
    39421 atggacacca gatccgcgcg cacgcgcgtc gtctgggggg cgctctcgag ctcgtccagc
    39481 gtctgccggt tcaggtcgag ctgctcctcc tgcatctcca gcaggtggcg gcccacgtcg
    39541 tccagacttc gcacggcctt gcccatcacg agcgccgtga ccaggttggc cccgttcagg
    39601 accatctcgc cgtacgtcac cggcacgtcg gcttcggtgt cctccacttt caggaaggac
    39661 tgcaggaggc gctgtttgat cggggcggtg gtgacgagca ccccgtcgac cggccgcccg
    39721 cgcgtgtcgg catgcgtcag acggggcacg gccacggagg gctgcgtggc cgtggtgagg
    39781 tccacgagcc aggcctcgac ggcctcccgg cggtggcccg ccttgcccag gaaaaagctc
    39841 gtctcgcaga agcttcgctt tagctcggcg accagggtcg cccgggccac cctggtggcc
    39901 aggcggccgt tgtccaggta tcgttgcatc ggcaacaaca aagccagggg cggcgccttt
    39961 tccagcagca cgtgcagcat ctggtcggcc gtgccgcgct caaacgcccc gaggacggcc
    40021 tggacgttgc gagcgagctg ttggatggcg cgcaactggc gatgcgcgcc gatacccgtc
    40081 ccgtccaggg cctcccccgt gagcagggcg atggcctcgg tggccaggct gaaggcggcg
    40141 ttcagggccc ggcggtcgat aatcttggtc atgtaattgt gtgtgggttg ctcgatgggg
    40201 tgcgggccgt cgcgggcaat cagcggctgg tggacctcga actgtacgcg cccctcgttc
    40261 atgtaggcca gctccggaaa cttggtacac acgcacgcca ccgacaaccc gagctccaga
    40321 aagcgcacga gcgacagggt gttgcaatac gaccccagca gggcgtcgaa ctcgacgtcg
    40381 tacaggctgt ttgcatcgga gcgcacgcgg gaaaaaaaat caaacaggcg tcgatgcgac
    40441 gccacctcga tcgtgctaag gagggacccg gtcggcacca tggccgcggc ataccggtat
    40501 cccggagggt cgcggttggg agcggccatg gggtcgcgtg gagatcggct gtctctagcg
    40561 atattggccc ggggaggcta agatccaccc caacgcccgg ccacccgtgt acgtgcccga
    40621 cggcccaagg tccaccgaaa gacacgacgg gcccggaccc aaaaaggcgg gggatgctgt
    40681 gtgagaggcc gggtgccggt cgggggggaa aggcaccggg agaaggctgc ggcctcgttc
    40741 caggagaacc cagtgtcccc aacagacccg gggacgtggg atcccaggcc ttatataccc
    40801 ccccccccgc cccacccccg ttagaacgcg acgggtgcat tcaagatggc cctggtccaa
    40861 aagcgtgcca ggaagaaatt ggcagaggcg gcaaagctgt ccgccgccgc cacccacatc
    40921 gaggccccgg ccgcgcaggc tatccccagg gcccgtgtgc gcaggggatc ggtgggcggc
    40981 agcatttggt tggtggcgat aaagtggaaa agcccgtccg gactgaaggt ctcgtgggcg
    41041 gcggcgaaca aggcacacag ggccgtgcct cccaaaaaca cggacatccc ccaaaacacg
    41101 ggcgccgaca acggcagacg atccctcttg atgttaacgt acaggaggag cgcccgcacc
    41161 gcccacgtaa cgtagtagcc gacgatggcg gccaggatac aggccggcgc caccaccctt
    41221 ccggtcagcc cgtaatacat gcccgctgcc accatctcca acggcttcag gaccaaaaac
    41281 gaccaaagga acagaatcac gcgctttgaa aagaccggct gggtatgggg cggaagacgc
    41341 gagtatgccg aactgacaaa aaaatcagag gtgccgtacg aggacaatga aaactgttcc
    41401 tccagcggca gttctccctc ctcccccccg aaggcggcct cgtcgaccag atctcgatcc
    41461 accagaggaa ggtcatcccg catggtcatg gggtgtgcgg tggaggtggg gagaccgaaa
    41521 ccgcaaaggg tcgcttacgt cagcaggatc ccgagatcaa agacacccgg gttcttgcac
    41581 aaacaccacc cgggttgcat ccgcggaggc gagtgttttg ataaggccgt tccgcgcctt
    41641 gatataacct ttgatgttga ccacaaaacc cggaatttac gcctacgccc caatgcccac
    41701 gcaagatgag gtaggtaacc cccccgtggg tgtgacgttg cgtttagttc attggaggcc
    41761 aaggggaaaa atggggtggg gaggaaacgg aaaacccagt aggccgtgtc gggaacacgc
    41821 ccggggttgt cctcaaaagg cagggtccat actacggaag ccgtcgttgt attcgagacc
    41881 tgcctgtgca acgcacgtcg gggttgcctg tgtccggttc ggcccccacc gcgtgcggca
    41941 cgcacgagga cgagtccgcg tgctttattg gcgttccaag cgttgccctc cagtttctgt
    42001 tgtcggtgtt cccccatacc cacgcccaca tccaccgtag ggggcctctg ggccgtgtta
    42061 cgtcgccgcc cgcgatggag cttagctacg ccaccaccat gcactaccgg gacgttgtgt
    42121 tttacgtcac aacggaccga aaccgggcct actttgtgtg cggggggtgt gtttattccg
    42181 tggggcggcc gtgtgcctcg cagcccgggg agattgccaa gtttggtctg gtcgttcgag
    42241 ggacaggccc agacgaccgc gtggtcgcca actatgtacg aagcgagctc cgacaacgcg
    42301 gcctgcagga cgtgcgtccc attggggagg acgaggtgtt tctggacagc gtgtgtcttc
    42361 taaacccgaa cgtgagctcc gagctggatg tgattaacac gaacgacgtg gaagtgctgg
    42421 acgaatgtct ggccgagtac tgcacctcgc tgcgaaccag cccgggtgtg ctaatatccg
    42481 ggctgcgcgt gcgggcgcag gacagaatca tcgagttgtt tgaacaccca acgatagtca
    42541 acgtttcctc gcactttgtg tataccccgt ccccatacgt gttcgccctg gcccaggcgc
    42601 acctcccccg gctcccgagc tcgctggagg ccctggtgag cggcctgttt gacggcatcc
    42661 ccgccccacg ccagccactt gacgcccaca acccgcgcac ggatgtggtt atcacgggcc
    42721 gccgcgcccc acgacccatc gccgggtcgg gggcggggtc ggggggcgcg ggcgccaagc
    42781 gggccaccgt cagcgagttc gtgcaagtca aacacattga ccgcgtgggc cccgctggcg
    42841 tttcgccggc gcctccgcca aacaacaccg actcgagttc cctggtgccc ggggcccagg
    42901 attccgcccc gcccggcccc acgctaaggg agctgtggtg ggtgttttat gccgcagacc
    42961 gggcgctgga ggagccccgc gccgactctg gcctcacccg cgaggaggta cgtgccgtac
    43021 gtgggttccg ggagcaggcg tggaaactgt ttggctccgc gggggccccg cgggcgttta
    43081 tcggggccgc gttgggcctg agccccctcc aaaagctagc cgtttactac tatatcatcc
    43141 accgagagag gcgcctgtcc cccttccccg cgctagtccg gctcgtaggc cggtacacac
    43201 agcgccacgg cctgtacgtc cctcggcccg acgacccagt cttggccgat gccatcaacg
    43261 ggctgtttcg cgacgcgctg gcggccggaa ccacagccga gcagctcctc atgttcgacc
    43321 ttctcccccc aaaggacgtg ccggtgggaa gcgacgtgca ggccgacagc accgctctgc
    43381 tgcgctttat agaatcgcaa cgtctcgccg tccccggggg ggtgatctcc cccgagcacg
    43441 tcgcgtacct tggtgcgttc ctgagcgtgc tgtacgctgg ccgcgggcgc atgtccgcag
    43501 ccacgcacac cgcgcggctg acaggggtga cctccctggt gctagcggtg ggtgacgtgg
    43561 accgtctttc cgcgtttgac cgcggagcgg cgggcgcggc cagccgcacg cgggccgccg
    43621 ggtacctgga tgtgcttctt accgttcgtc tcgctcgctc ccaacacgga cagtctgtgt
    43681 aaaagacccc aataaacgta tatcgctact acacccttgt gtgtcaatgg acgcctctcc
    43741 gggggggggg gagggaaagc aaagaggggc tgggggagcg gcaccaccgg ggcctgaaca
    43801 aacaaaccac agacacggtt acagtttatt cggtcgggcg gagaaacggc cgaagccacg
    43861 cccactttat tcgcgtctcc aaaaaaacgg gacacttgtc cggagaacct ttaggatgcc
    43921 agccagggcg gcggtaatca taaccacgcc cagcgcagag gcggccagaa acccgggcgc
    43981 aattgcggcc acgggctgcg tgtcaaaggc tagcaaatga atgacggttc cgtttggaaa
    44041 tagcaacaag gccgtggacg gcacgtcgct cgaaaacacg cttggggcgc cctccgtcgg
    44101 cccggcggcg atttgctgct gtgtgttgtc cgtatccacc agcaacacag acatgacctc
    44161 cccggccggg gtgtagcgca taaacacggc ccccacgagc cccaggtcgc gctggttttg
    44221 ggtgcgcacc agccgcttgg actcgatatc ccgggtggag ccttcgcatg tcgcggtgag
    44281 gtaggttagg aacagtgggc gtcggacgtc gacgccggtg agcttgtagc cgatcccccg
    44341 gggcagaggg gagtgggtga cgacgtagct ggcgttgtgg gtgatgggta ccaggatccg
    44401 tggctcgacg ttggcagact gccccccgca ccgatgtgag gcctcaggga cgaaggcgcg
    44461 gatcagggcg ttgtagtgtg cccaacgcgt cagggtcgag gcgaggccgt gggtctgctg
    44521 ggccaggact tcgaccgggg tctcggatcg ggtggcttga gccagcgcgt ccaggataaa
    44581 cacgctctcg tctagatcaa agcgcaggga ggccgcgcat ggcgaaaagt ggtccggaag
    44641 ccaaaagagg gttttctggt ggtcggcccg ggccagcgcg gtccggaggt cggcgttggt
    44701 cgctgcggcg acgtcggacg tacacagggc cgaggctatc agaaggctcc ggcgggcgcg
    44761 ttcccgctgc accgccgagg ggacgccagc caagaacggc tgccggagga cagccgaggc
    44821 gtaaaatagc gcccggtgga cgaccggggt ggtcagcacg cggcccccta gaaactcggc
    44881 atacagggcg tcgatgagat gggctgcgct gggcgccact gcgtcgtacg ccgaggggct
    44941 atccagcacg aaggccagct gatagcccag cgcgtgtaat gccaagctct gttcgcgctc
    45001 cagaatctcg gccaccaggt gctggagccg agcctctagc tgcaggcggg ccgtgggatc
    45061 caagactgac acattaaaaa acacagaatc cgcggcacag cccgcggccc cgcgggcggc
    45121 caacccggca agcgcgcgcg agtgggccaa aaagcctagc aggtcggaga ggcagaccgc
    45181 gccgtttgcg tgggcggcgt tcacgaaagc aaaacccgac gtcgcgagca gccccgttag
    45241 gcgccagaag agaggggggc gcgggccctg ctcggcgccc gcgtcccccg agaaaaactc
    45301 cgcgtatgcc cgcgacagga actgggcgta gttcgtgccc tcctccgggt agccgcccac
    45361 gcggcggagg gcgtccagcg cggagccgtt gtcggcccgc gtcagggacc ctaggacaaa
    45421 gacccgatac cgggggccgc ccgggggccc gggaagagcc cccggggggt tttcgtccgc
    45481 ggggtccccg acccgatcta gcgtctggcc cgcggggacc accatcactt ccaccggagg
    45541 gctgtcgtgc atggatatca cgagccccat gaattcccgc ccgtagcgcg cgcgcaccag
    45601 cgcggcatcg cacccgagca ccagctcccc cgtcgtccag atgcccacgg gccacgtcga
    45661 ggccgacggg gagaaataca cgtacctacc tggggatctc aacaggcccc gggtggccaa
    45721 ccaggtcgtg gacgcgttgt gcaggtgcgt gatgtccagc tccgtcgtcg ggtgccgccg
    45781 ggccccaacc ggcggtcggg ggggcggtgt atcacgcggc ccgctcgggt ggctcgccgt
    45841 cgccacgttg tctccccgcg ggaacgtcag ggcctcgggg tcagggacgg ccgaaaacgt
    45901 tacccaggcc cgggaacgca gcaacacgga ggcggctgga ttgtgcaaga gacccttaag
    45961 gggggcgacc gaggggggag gctgggcggt cggctcgacc gtggtggggg cgggcaggct
    46021 cgcgttcggg ggccggccga gcaggtaggt cttcgggatg taaagcagct ggccggggtc
    46081 ccgcggaaac tcggccgtgg tgaccaatac aaaacaaaag cgctcctcgt accagcgaag
    46141 aaggggcaga gatgccgtag tcaggtttag ttcgtccggc ggcgccagaa atccgcgcgg
    46201 tggtttttgg gggtcggggg tgtttggcag ccacagacgc ccggtgttcg tgtcgcgcca
    46261 gtacatgcgg tccatgccca ggccatccaa aaaccatggg tctgtctgct cagtccagtc
    46321 gtggacctga ccccacgcaa cgcccaaaat aataaccccc acgaaccata aaccattccc
    46381 catgggggac cccgtcccta acccacgggg cccgtggcta tggcagggct tgccgccccg
    46441 acgttggctg cgagccctgg gccttcaccc gaacttgggg gttggggtgg ggaaaaggaa
    46501 gaaacgcggg cgtattggtc ccaatggggt ctcggtgggg tatcgacaga gtgccagccc
    46561 tgggaccgaa ccccgcgttt atgaacaaac gacccaacac ccgtgcgttt tattctgtct
    46621 ttttattgcc gtcatagcgc gggttccttc cggtattgtc tccttccgtg tttcagttag
    46681 cctcccccat ctcccgggca aacgtgcgcg ccaggtcgca gatcgtcggt atggagcctg
    46741 gggtggtgac gtgggtctgg accatcccgg aggtaagttg cagcagggcg tcccggcagc
    46801 cggcgggcga ttggtcgtaa tccaggataa agacgtgcat gggacggagg cgtttggcca
    46861 agacgtccaa agcccaggca aacacgttat acaggtcgcc gttgggggcc agcaactcgg
    46921 gggcccgaaa cagggtaaat aacgtgtccc cgatatgggg tcgtgggccc gcgttgctct
    46981 ggggctcggc accctggggc ggcacggccg cccccgaaag ctgtccccaa tcctcccgcc
    47041 acgacccgcc gccctgcaga taccgcaccg tattggcaag cagcccataa acgcggcgaa
    47101 tcgcggccag catagccagg tcaagccgct cgccggggcg ctggcgtttg gccaggcggt
    47161 cgatgtgtct gtcctccgga agggccccca acacgatgtt tgtgccgggc aaggtcggcg
    47221 ggatgagggc cacgaacgcc agcacggcct ggggggtcat gctgcccata aggtatcgcg
    47281 cggccgggta gcacaggagg gcggcgatgg gatggcggtc gaagatgagg gtgagggccg
    47341 ggggcggggc atgtgagctc ccagcctccc ccccgatatg aggagccaga acggcgtcgg
    47401 tcacggcata aggcatgccc attgttatct gggcgcttgt cattaccacc gccgcgtccc
    47461 cggccgatat ctcaccctgg tcgaggcggt gttgtgtggt gtagatgttc gcgattgtct
    47521 cggaagcccc caacacccgc cagtaagtca tcggctcggg tacgtagacg atatcgtcgc
    47581 gcgaacccag ggccaccagc agttgcgtgg tggtggtttt ccccatcccg tggggaccgt
    47641 ctatataaac ccgcagtagc gtgggcattt tctgctccag gcggacttcc gtggcttttt
    47701 gctgccggcg agggcgcaac gccgtacgtc ggttgttatg gccgcgagaa cgcgcagcct
    47761 ggtcgaacgc agacgcgtgt tgatggcagg ggtacgaagc catacgcgct tctacaaggc
    47821 gctggccgaa gaggtgcggg agtttcacgc caccaagatc tgcggcacgc tgttgacgct
    47881 gttaagcggg tcgctgcagg gtcgctcggt attcgaggcc acacgcgtca ccttaatatg
    47941 cgaagtggac ctgggaccgc gccgccccga ctgcatctgc gtgttcgaat tcgccaatga
    48001 caagacgctg ggcggggttt gtgtcatcat agaactaaag acatgcaaat atatttcttc
    48061 cggggacacc gccagcaaac gcgagcaacg ggccacgggg atgaagcagc tgcgccactc
    48121 cctgaagctc ctgcagtccc tcgcgcctcc gggtgacaag atagtgtacc tgtgccccgt
    48181 cctggtgttt gtcgcccaac ggacgctccg cgtcagccgc gtgacccggc tcgtcccgca
    48241 gaaggtctcc ggtaatatca ccgcagtcgt gcggatgctc cagagcctgt ccacgtatac
    48301 ggtccccatt gagcctagga cccagcgagc ccgtcgccgc cgcggcggcg ccgcccgggg
    48361 gtctgcgagc agaccgaaaa ggtcacactc tggggcgcgc gacccgcccg agtcagcggc
    48421 ccgccagtta ccacccgccg accaaacccc cgcctccacg gagggcgggg gggtgcttaa
    48481 gaggatcgcg gcgctcttct gcgtgcccgt ggccaccaag accaaacccc gagccgcctc
    48541 cgaatgagag tgtttcgttc cttccccctc cccccgcgtc agacaaaccc taaccaccgc
    48601 ttaagcggcc cccgcgaggt ccgaagactc atttggatcc ggcgggagcc acccgacaac
    48661 agcccccggg ttttcccacg ccagacgccg gtccgctgtg ccatcgcgcc ccctcatccc
    48721 accccccatc ttgtccccaa ataaaacaag gtctggtagt taggacaacg accgcagttc
    48781 tcgtgtgtta ttttcgctct ccgcctctcg cagatggacc cgtactgccc atttgacgct
    48841 ctggacgtct gggaacacag gcgcttcata gtcgccgatt cccgaaactt catcaccccc
    48901 gagttccccc gggacttttg gatgtcgccc gtctttaacc tcccccggga gacggcggcg
    48961 gagcaggtgg tcgtcctaca ggcccagcgc acagcggctg ccgctgccct ggagaacgcc
    49021 gccatgcagg cggccgagct ccccgtcgat atcgagcgcc ggttacgccc gatcgaacgg
    49081 aacgtgcacg agatcgcagg cgccctggag gcgctggaga cggcggcggc cgccgccgaa
    49141 gaggcggatg ccgcgcgcgg ggatgagccg gcgggtgggg gcgacggggg ggcgcccccg
    49201 ggtctggccg tcgcggagat ggaggtccag atcgtgcgca acgacccgcc gctacgatac
    49261 gacaccaacc tccccgtgga tctgctacac atggtgtacg cgggccgcgg ggcgaccggc
    49321 tcgtcggggg tggtgttcgg gacctggtac cgcactatcc aggaccgcac catcacggac
    49381 tttcccctga ccacccgcag tgccgacttt cgggacggcc gtatgtccaa gaccttcatg
    49441 acggcgctgg tactgtccct gcaggcgtgc ggccggctgt atgtgggcca gcgccactat
    49501 tccgccttcg agtgcgccgt gttgtgtctc tacctgctgt accgaaacac gcacggggcc
    49561 gccgacgata gcgaccgcgc tccggtcacg ttcggggatc tgctgggccg gctgccccgc
    49621 tacctggcgt gcctggccgc ggtgatcggg accgagggcg gccggccaca gtaccgctac
    49681 cgcgacgaca agctccccaa gacgcagttc gcggccggcg ggggccgcta cgaacacgga
    49741 gcgctggcgt cgcacatcgt gatcgccacg ctgatgcacc acggggtgct cccggcggcc
    49801 ccgggggacg tcccccggga cgcgagtacc cacgttaacc ccgacggcgt ggcgcaccac
    49861 gacgacataa accgcgccgc cgccgcgttc ctcagccggg gccacaacct attcctgtgg
    49921 gaggaccaga ctctgctgcg ggcaaccgcg aacaccataa cggccctggg cgttatccag
    49981 cggctcctcg cgaacggcaa cgtgtacgcg gaccgcctca acaaccgcct gcagctgggc
    50041 atgctgatcc ccggagccgt cccttcggag gccatcgccc gtggggcctc cgggtccgac
    50101 tcgggggcca tcaagagcgg agacaacaat ctggaggcgc tatgtgccaa ttacgtgctt
    50161 ccgctgtacc gggccgaccc ggcggtcgag ctgacccagc tgtttcccgg cctggccgcc
    50221 ctgtgtcttg acgcccaggc ggggcggccg gtcgggtcga cgcggcgggt ggtggatatg
    50281 tcatcggggg cccgccaggc ggcgctggtg cgcctcaccg ccctggaact catcaaccgc
    50341 acccgcacaa accccacccc tgtgggggag gttatccacg cccacgacgc cctggcgatc
    50401 caatacgaac aggggcttgg cctgctggcg cagcaggcac gcattggctt gggctccaac
    50461 accaagcgtt tctccgcgtt caacgttagc agcgactacg acatgttgta ctttttatgt
    50521 ctggggttca ttccacagta cctgtcggcg gtttagtggg tggtgggcga ggggggaggg
    50581 ggcattaggg agaaagaaca agagcctccg ttgggttttc tttgtgcctg tactcaaaag
    50641 gtcatacccc gtaaacggcg ggctccagtc ccggcccggc ggttggcgtg aacgcaacgg
    50701 cgggagctgg gttagcgttt agtttagcat tcgctctcgc ctttccgccc gccccccgac
    50761 cgttgcgcct tttttttttt cgtccaccaa agtctctgtg ggtgcgcgca tggcagccga
    50821 tgccccggga gaccggatgg aggagcccct gcccgacagg gccgtgccca tttacgtggc
    50881 tgggtttttg gccctgtatg acagcgggga ctcgggcgag ttggcattgg atccggatac
    50941 ggtgcgggcg gccctgcctc cggataaccc actcccgatt aacgtggacc accgcgctgg
    51001 ctgcgaggtg gggcgggtgc tggccgtggt cgacgacccc cgcgggccgt tttttgtggg
    51061 gctgatcgcc tgcgtgcagc tggagcgcgt cctcgagacg gccgccagcg ctgcgatttt
    51121 cgagcgccgc gggccgccgc tctcccggga ggagcgcctg ttgtacctga tcaccaacta
    51181 cctgccctcg gtctccctgg ccacaaaacg cctggggggc gaggcgcacc ccgatcgcac
    51241 gctgttcgcg cacgtcgcgc tgtgcgcgat cgggcggcgc ctcggcacta tcgtcaccta
    51301 cgacaccggt ctcgacgccg ccatcgcgcc ctttcgccac ctgtcgccgg cgtctcgcga
    51361 gggggcgcgg cgactggccg ccgaggccga gctcgcgctg tccgggcgca cctgggcgcc
    51421 cggcgtggag gcgctgaccc acacgctgct ttccaccgcc gttaacaaca tgatgctgcg
    51481 ggaccgctgg agcctggtgg ccgagcggcg gcggcaggcc gggatcgccg gacacaccta
    51541 cctccaggcg agcgaaaaat tcaaaatgtg gggggcggag cctgtttccg cgccggcgcg
    51601 cgggtataag aacggggccc cggagtccac ggacataccg cccggctcga tcgctgccgc
    51661 gccgcagggt gaccggtgcc caatcgtccg tcagcgcggg gtcgccttgt ccccggtact
    51721 gccccccatg aaccccgttc cgacatcggg caccccggcc cccgcgccgc ccggcgacgg
    51781 gagctacctg tggatcccgg cctcccatta caaccagctc gtcgccggcc atgccgcgcc
    51841 ccaaccccag ccgcattccg cgtttggttt cccggctgcg gcggggtccg tggcctatgg
    51901 gcctcacggt gcgggtcttt cccagcatta ccctccccac gtcgcccatc agtatcccgg
    51961 ggtgctgttc tcgggaccca gcccactcga ggcgcagata gccgcgttgg tgggggccat
    52021 agccgcggac cgccaggcgg gcggtcagcc ggccgcggga gaccctgggg tccgggggtc
    52081 gggaaagcgt cgccggtacg aggcggggcc gtcggagtcc tactgcgacc aggacgaacc
    52141 ggacgcggac tacccgtact accccgggga ggctcgaggc gggccgcgcg gggtcgactc
    52201 ccggcgcgcg gcccgccatt ctcccgggac caacgagacc atcacggcgc tgatgggggc
    52261 ggtgacgtct ctgcagcagg aactggcgca catgcgggct cggaccagcg ccccctatgg
    52321 aatgtacacg ccggtggcgc actatcgccc tcaggtgggg gagccggaac caacaacgac
    52381 ccacccggcc ctttgtcccc cggaggccgt gtatcgcccc ccaccacaca gcgcccccta
    52441 cggtcctccc cagggtccgg cgtcccatgc ccccactccc ccgtatgccc cagctgcctg
    52501 cccgccaggc ccgccaccgc ccccatgtcc ttccacccag acgcgcgccc ctctaccgac
    52561 ggagcccgcg ttcccccccg ccgccaccgg atcccaaccg gaggcatcca acgcggaggc
    52621 cggggccctt gtcaacgcca gcagcgcagc acacgtggac gttgacacgg cccgcgccgc
    52681 cgatttgttc gtctctcaga tgatgggggc ccgctgattc gccccggtct ttggtaccat
    52741 gggatgtctt actgtatatc tttttaaata aaccaggtaa taccaaataa gacccattgg
    52801 tgtatgttct ttttttattg ggaggcgcgg gtaggcgggt agctttacaa tgcaaaagcc
    52861 ttcgacgtgg aggaaggcgt gggggggggg ggaatcggca ctgaccaagg gggtccgttt
    52921 tgtcacggga aaggaaagag gaaacaggcc gcggacaccc gggggagttt gtgttccctt
    52981 ttctttcttc ccacacacac aaaaggcgta ccaaacaaac aaaccaaaag atgcacatgc
    53041 ggtttaacac ccgtggtttt tatttacaac aaacccccca tcacaggtcg tcctcgtcgg
    53101 cgtcaccgtc tttgttggga acttgggtgt agttggtgtt gcggcgcttg cgcatgacca
    53161 tgtcggtgac cttggcgctg agcagcgcgc tcgtgccctt cttcttggcc ttgtgttccg
    53221 tgcgctccat ggcagacacc agggccatgt accgtatcat ctcccgggcc tcggctagct
    53281 tggcctcgtc aaagtcgccg ccctcctcgc cctccccgga cgcgtccggg ttggtggggt
    53341 tcttgagctc cttggtggtt agcgggtaca gggccttcat ggggttgctc tgcagccgca
    53401 tgacgtagcg aaaggcgaag aaggccgccg ccaggccggc caggaccaac agacccacgg
    53461 ccagcgcccc aaaggggttg gacatgaagg aggacacgcc cgacacggcc gataccacgc
    53521 cgcccacgat gcccatcacc accttgccga ccgcgcgccc caggtcgccc atcccctcga
    53581 agaacgcgcc caggcccgca aacatggcgg cgttggcgtc ggcgtggatg accgtgtcga
    53641 tgtcggcgaa gcgcaggtcg tgcagctggt tgcggcgctg gacctccgtg tagtccagca
    53701 ggccgctgtc cttgatctcg tggcgggtgt acacctccag ggggacaaac tcgtgatcct
    53761 ccagcatggt gatgttgagg tcgatgaagg tgctgacggt ggtgatgtcg gcgcggctca
    53821 gctggtggga gtacgcgtac tcctcgaagt acacgtagcc cccaccgaag gtgaagtagc
    53881 gccggtgtcc cacggtgcac ggctcgatcg catcgcgcgt cagccgcagc tcgttgttct
    53941 cccccagctg cccctcgacc aacgggccct ggtcttcgta ccgaaagctg accagggggc
    54001 ggctgtagca ggccccgggc cgcgagctga tgcgcatcga gttttggacg atcacgttgt
    54061 ccgcggcgac cggcacgcac gtggagacgg ccatcacgtc gccgagcatc cgcgcgctca
    54121 cccgccggcc cacggtggcc gaggcgatgg cgttggggtt cagcttgcgg gcctcgttcc
    54181 acagggtcag ctcgtgattc tgcagctcgc accacgcgat ggcaacgcgg cccaacatat
    54241 cgttgacatg gcgctgtatg tggttgtacg taaactgcag cctggcgaac tcgatggagg
    54301 aggtggtctt gatgcgctcc acggacgcgt tggcgctggc cccgggcggc gggggcgtgg
    54361 ggtttggggg cttgcggctc tgctcgcgga ggtgttcccg cacgtacagc tccgcgagcg
    54421 tgttgctgag aaggggctgg tacgcgatca gaaagccccc attggccagg tagtactgcg
    54481 gctggcccac cttgatgtgc gtcgcgttgt acctgcgggc gaagatgcgg tccatggcgt
    54541 cgcgggcgtc cttgccgatg cagtccccca ggtccacgcg cgagagcggg tactcggtca
    54601 ggttggtggt gaaggtggtg gatatggcgt cggaagagaa tcggaaggag ccgccgtact
    54661 cggagcgcag catctcgtcc acctcctgcc acttggtcat ggtgcagacc gacgggcgct
    54721 ttggcaccca gtcccaggcc acggtgaact tgggggtcgt gagcaggttc cgggtggtcg
    54781 gcgccgtggc ccgggccttg gtggtgaggt cgcgcgcgta gaagccgtcg acctgcttga
    54841 agcggtcggc ggcgtagctg gtgtgttcgg tgtgcgaccc ctcccggtag ccgtaaaacg
    54901 gggacatgta cacaaagtcg ccagtcgcca acacaaactc gtcgtacggg tacaccgagc
    54961 gcgcgtccac ctcctcgacg atgcagttta ccgtcgtccc gtaccggtgg aacgcctcca
    55021 cccgcgaggg gttgtacttg aggtcggtgg tgtgccagcc ccggctcgtg cgggtcgcgg
    55081 cgttggccgg tttcagctcc atgtcggtct cgtggtcgtc ccggtgaaac gcggtggtct
    55141 ccaggttgtt gcgcacgtac ttggccgtgg accgacagac ccccttggcg ttgatcttgt
    55201 cgatcacctc ctcgaagggg acgggggcgc ggtcctcaaa gatccccata aactgggagt
    55261 agcggtggcc gaaccacacc tgcgaaacgg tgacgtcttt gtagtacatg gtggccttga
    55321 acttgtacgg ggcgatgttc tccttgaaga ccaccgcgat gccctccgtg tagttctgac
    55381 cctcgggccg ggtcgggcag cggcgcggct gctcgaactg caccaccgtg gcgcccgtgg
    55441 ggggtgggca cacgtaaaag tttgcatcgg tgttctccgc cttgatgtcc cgcaggtgct
    55501 cgcgcagggt ggcgtggccc gcggcgacgg tcgcgttgtc gccggcgggg cgcggcggct
    55561 ttgggggttt cggttttttg ttcttcttcg gtttcgggtc ccccgttggg ggggcgccag
    55621 gggcgggcgg cgccggagtg gcagggcccc cgttcgccgc ctgggtcgcg gccgcgaccc
    55681 caggcgtgcc gggggaactc ggagccgccg acgccaccag gacccccagc gtcaacccca
    55741 agagcgccca tacgacgaac caccggcgcc cccgcgcggg ggcgccctgg cgcatggcgg
    55801 gactacgggg gcccgtcgtg ccccccgtca ggtagcctgg gggcgaggtg ctggaggacc
    55861 gagtagagga tcgagaaaac gtctcggtcg tagaccacga ccgaccgggg gccgatacag
    55921 ccgtcggggg cgctctcgac gatggccacc agcggacagt cggagtcgta cgtgagatat
    55981 acgccgggcg ggtaacggta acgaccttcg gaggtcgggc ggctgcagtc cgggcggcgc
    56041 aactcgagct ccccgcaccg gtagaccgag gcaaagagtg tggtggcgat aatcagctcg
    56101 cgaatatatc gccaggcggc gcgctgagtg ggcgttattc cggaaatgcc gtcaaaacag
    56161 taaaacctct gaaattcgct gacggcccaa tcagcacccg agccccccgc ccccatgatg
    56221 aaccgggcga gctcctcctt caggtgcggc aggagcccca cgttctcgac gctgtaatac
    56281 agcgcggtgt tggggggctg ggcgaagctg tgggtggagt gatcaaagag gggcccgttg
    56341 acgagctcga agaagcgatg ggtgatgctg gggagcaggg ccgggtccac ctggtgtcgc
    56401 aggagagacg ctcgcatgaa ccggtgcgcg tcgaacacgc ccggcgccga gcggttgtcg
    56461 atgaccgtgc ccgcgcccgc cgtcagggcg cagaagcgcg cgcgcgccgc aaagccgttg
    56521 gcgaccgcgg cgaacgtcgc gggcagcacc tcgccgtgga cgctgacccg cagcatcttc
    56581 tcgagctccc cgcgctgctc gcggacgcag cgccccaggc tggccaacga ccgcttcgtc
    56641 aggcggtccg cgtacagccg ccgtcgctcc cgcacgtccg cggccgcttg cgtggcgatg
    56701 tccccccacg tctcgggccc ctgccccccg ggcccgcggc gacggtcttc gtcctcgccc
    56761 ccgcccccgg gagctcccaa cccccgtgcc ccttcctcta cggcgacacg gtccccgtcg
    56821 tcgtcggggc ccgcgccgcc cttgggcgcg tccgccgcgc cccccgcccc catgcgcgcc
    56881 agcacgcgac gcagcgcctc ctcgtcgcac tgttcggggc tgacgaggcg ccgcaagagc
    56941 ggcgtcgtca ggtggtggtc gtagcacgcg cggatgagcg cctcgatctg atcgtcgggt
    57001 gacgtggcct gaccgccgat tattagggcg tccaccatat ccagcgccgc caggtggctc
    57061 ccgaacgcgc gatcgaaatg ctccgcccgc cgcccgaaca gcgccagttc cacggccacc
    57121 gcggcggtct cctgctgcaa ctcgcgccgc gccagcgcgg tcaggttgct ggcaaacgcg
    57181 tccatggtgg tctggccggc gcggtcgccg gacgcgagcc agaatcgcaa ttcgctgatg
    57241 gcgtacaggc cgggcgtggt ggcctgaaac acgtcgtgcg cctccagcag ggcgtcggcc
    57301 tccttgcgga ccgagtcgtt ctcgggcgac gggtggggct gcccgtcgcc ccccgcggtc
    57361 cgggccagcg catggtccaa cacggagagc gcccgcgcgc ggtcggcgtc cgacagcccg
    57421 gcggcgtggg gcaggtaccg ccgcagctcg ttggcgtcca gccgcacctg cgcctgctgg
    57481 gtgacgtggt tacagatacg gtccgccagg cggcgggcga tcgtcgcccc ctggttcgcc
    57541 gtcacacaca gttcctcgaa acagaccgcg caggggtggg acgggtcgct aagctccggg
    57601 gggacgataa ggcccgaccc caccgccccc accataaact cccgaacgcg ctccagcgcg
    57661 gcggtggcgc cgcgcgaggg ggtgatgagg tggcagtagt ttagctgctt tagaaagttc
    57721 tcgacgtcgt gcaggaaaca cagctccata tggacggtcc cgccatacgt atccagcctg
    57781 acccgttggt gatacggaca gggtcgggcc aggcccatgg tctccgtgaa aaacgccgcg
    57841 acgtctcccg cggtcgcgaa cgtctccagg ctgcccagga gccgctcgcc ctcgcgccac
    57901 gcgtactcta gcagcaactc cagggtgacc gacagcgggg tgagaaaggc cccggcctgg
    57961 gcctccaggc ccggcctcag acgacgccgc agcgcccgca cctgaagcgc gttcagcttc
    58021 agttggggga gcttcccccg tccgatgtgg gggtcgcacc gccggagcag ctctatctga
    58081 aacacatagg tctgcacctg cccgagcagg gctaacaact tttgacgggc cacggtgggc
    58141 tcggacaccg gggcggccat ctcgcggcgc cgatctgtac cgcggccgga gtatgcggtg
    58201 gaccgaggcg gtccgtacgc tacccggcgt ctggctgagc cccggggtcc ccctcttcgg
    58261 ggcggcctcc cgcgggcccg ccgaccggca agccgggagt cggcggcgcg tgcgtttctg
    58321 ctctattccc agacaccgcg gagaggaatc acggcccgcc cagagatata gacacggaac
    58381 acaaacaagc acggatgtcg tagcaataat ttattttaca cacattcccc gccccgccct
    58441 aggttccccc accccccaac ccctcacagc atatccaacg tcaggtctcc ctttttgtcg
    58501 gggggcccct ccccaaacgg gtcatccccg tggaacgccc gtttgcggcc ggcaaatgcc
    58561 ggtcccgggg cccccgggcc gccgaacggc gtcgcgttgt cgtcctcgca gccaaaatcc
    58621 ccaaagttaa acacctcccc ggcgttgccg agttggctga ctagggcctc ggcctcgtgc
    58681 gccacctcca gggccgcgtc cgtcgaccac tcgccgttgc cgcgctccag ggcacgcgcg
    58741 gtcagctcca tcatctcctc gcttaggtac tcgtcctcca ggagcgccag ccagtcctcg
    58801 atctgcagct gctgggtgcg gggccccagg cttttcacgg tcgccacgaa cacgctactg
    58861 gcgacggccg ccccgccctc ggagataatg ccccggagct gctcgcacag cgagctttcg
    58921 tgcgctccgc cgccgaggct tgaggccgcg cacacaaacc cggcccgggg acaggccagg
    58981 acgaacttgc gggtgcggtc aaaaataagg agcgggcacg cgtttttgcc gcccatcagg
    59041 ctggcccagt tcccggcctg aaacacacgg tcgttgccgg ccatgccgta gtacttgctg
    59101 atgctcaacc ccaacacgac catggggcgc gccgccatga cgggccgcag caggttgcag
    59161 ctggcgaaca tggacgtcca cgcgcccgga tgcgcgtcca cggcgtccat cagcgcgcgg
    59221 gccccggcct ccaggcccgc cccgccctgc gcggaccacg cggccgcagc ctgcacgctg
    59281 gggggacggc gggaccccgc gatgatggcc gtaagggtgt tgatgaagta tgtcgagtga
    59341 tcgcagtacc gcagaatctg gtttgccatg tagtacatcg ccagctcgct cacgttgttg
    59401 ggggccaggt taataaagtt tatcgcgccg tagtccaggg aaaacttttt aatgaacgcg
    59461 atggtctcga tgtcctcgcg cgacaggagc cgggcgggaa gctggttgcg ttggagggcc
    59521 gtccagaacc actgcgggtt cggctggttg gaccccgggg gcttgccgtt ggggaagatg
    59581 gccgcgtgga actgcttcag cagaaagccc agcggtccga ggaggatgtc cacgcgcttg
    59641 tcgggcttct ggtaggcgct ctggaggctg gcgacccgcg ccttggcggc ctcggacgcg
    59701 ttggcgctcg cgcccgcgaa caacacgcgg ctcttgacgc gcagctcctt gggaaacccc
    59761 agggtcacgc gggcaacgtc gccctcgaag ctgctctcgg cgggggccgt ctggccggcc
    59821 gttaggctgg gggcgcagat agccgccccc tccgagagcg cgaccgtcag cgttttggcc
    59881 gacagaaacc cgttgttaaa catgtccatc acgcgccgcc gcagcaccgg ttggaattga
    59941 ttgcgaaagt tgcgcccctc gaccgactgc ccggcgaaca ccccgtggca ctgactcagg
    60001 gccaggtcct ggtacacggc gaggttggat cgccgcccga gaagctgaag cagggggcac
    60061 ggcccgcacg cgtacgggtc cagcgtcagg gacatggcgt ggttggcctc gcccagaccg
    60121 tcgcgaaact tgaagttcct cccctccacc aggttgcgca tcagctgctc cacctcgcgg
    60181 tccacgacct gcctgacgtt gttcaccacc gtatgcaggg cctcgcggtt ggtgatgatg
    60241 gtctccagcc gccccatggc cgtggggacc gcctggtcca cgtactgcag ggtctcgagt
    60301 tcggccatga cgcgctcggt cgccgcgcgg tacgtctcct gcatgatggt ccgggcggtc
    60361 tcggatccgt ccgcgcgctt cagggccgag aaggcggcgt agtttcccag cacgtcgcag
    60421 tcgctgtaca tgctgttcat ggtcccgaag acgccgatgg ctccgcgggc ggcgctggcg
    60481 aactttggat ggcgcgcccg gaggcgcatg agcgtcgtgt gtacgcaggc gtggcgcgtg
    60541 tcgaaggtgc ataggttaca gggcacgtcg gtctggttgg agtccgcgac gtatcgaaac
    60601 acgtccatct cctggcgccc gacgatcacg ccgccgtcgc agcgctccag gtaaaacagc
    60661 atcttggcca gcagcgccgg ggaaaaccca cacagcatgg ccaggtgctc gccggcaaat
    60721 tcctgggttc cgccgacgag gggcgcggtg ggccgaccct cgaacccggg caccacgtgt
    60781 ccctcgcggt ccacctgtgg gttggccgcc acgtgggtcc cgggcacgag gaagaagcgg
    60841 taaaaggagg gtttgctgtg gtcctttggg tccgccgggc cggcgtcgtc cacctcggtg
    60901 agatggaggg ccgagttggt gctaaatacc atggccccca cgagtcccgc ggcgcgcgcc
    60961 aggtacgccc cgacggcgtt ggcgcgggcc gcggccgtgt cctggccctc gaacagcggc
    61021 cacgcggaga tgtcggtggg cggctcgtca aagacggcca tcgacacgat agactcgagg
    61081 gccagggcgg cgtctccggc catgacggag gccaggcgct gttcgaaccc gcccgccggg
    61141 cccttgccgc cgccgtcgcg cccgccccgc ggggtcttac cctggctggc ttcgaaggcc
    61201 gtgaacgtaa tgtcggcggg gagggcggcg ccctcgtggt tttcgtcaaa cgccaggtgg
    61261 gcggccgcgc gggccacggc gtccacgttt cggcatcgca gtgccacggc ggcgggtccc
    61321 acgaccgcct cgaacaggag gcggttgagg gggcggttaa aaaacggaag cgggtaggta
    61381 aaattctccc cgatcgatcg gtggttggcg ttgaacggct ctgcgatgac acggctaaaa
    61441 tccggcatga acagctgcaa cgggtacacg ggtatgcggt gcacctccgc cccgcctatg
    61501 gttaccttgt ccgagcctcc caggtgcaga aaggtgttgt tgatgcacac ggcctccttg
    61561 aagccctcgg taacgaccag atacaggagg gcgcggtccg ggtccaggcc gaggcgctca
    61621 cacagcgcct cccccgtcgt ctcgtgtttg aggtcgccgg gccggggggt gtagtccgaa
    61681 aagccaaaat ggcggcgtgc ccgctcgcaa agtcgcgtca ggttcggggc ctgggtgctg
    61741 gggtccaggt gccggccgcc gtgaaagacg tacacggacg agctgtagtg cgagggcgtc
    61801 agtttcaggg acaccgcggt acccccgagc cccgtcgtgc gagaacccac gaccacggcc
    61861 acgttggcct caaagccgct ctccacggtc aggcccacga ccaggggcgc cacggcgacg
    61921 tcggaatcgc cgctgcgtgc cgacagtaac gccagaagct cgatgccttc ggacggacac
    61981 gcgcgagcgt acacgtatcc caggggcccg ggggggacct tgatggtggt tgccgtcttg
    62041 ggctttgtct ccatgtcctt ttgtcaatcg gtccgcgaac ggaggtaatc ccggcacgac
    62101 gacggacgcc cgacaaggta tgtctcccga gcgtcaaaat ccgggggggg gcggcgacgg
    62161 tcaaggggag ggttggagac cggggttggg gaatgaatcc ctccccttca ccgacaaccc
    62221 cccgggtaac cacggggtgc cgatgaaccc cggcggccgg caacgcgggg tccctgcgag
    62281 aggcacagat gcttacggtc aggtgctccg ggtcgggtgc gtctggtatg cggttggtat
    62341 atgtacactt tacctggggg cgtgccggtc cgccccagcc cctcccacgc cccgcgcgtc
    62401 atcagccggt gggcgtggcc gctattataa aaaaagtgag aacgcgaagc gttcgcactt
    62461 tgtcctaata atatatatat tattaggaca aagtgcgaac gcttcgcgtt ctcacttttt
    62521 ttataatagc ggccacgccc accggctacg tcactctcct gtcggccgcc ggcggtccat
    62581 aagcccggcc ggccgggccg acgcgaataa accgggccgc cggccggggc gccgcgcagc
    62641 agctcgccgc ccggatccgc cagacaaaca aggcccttgc acatgccggc ccgggcgagc
    62701 ctgggggtcc ggtaattttg ccatcccacc caagcggctt tttgggtttt tctcttcccc
    62761 cctccccaca ttcccctctt taggggttcg ggtgggaaca accgcgatgt tttccggtgg
    62821 cggcggcccg ctgtcccccg gaggaaagtc ggcggccagg gcggcgtccg ggttttttgc
    62881 gcccgccggc cctcgcggag ccagccgggg acccccgcct tgtttgaggc aaaactttta
    62941 caacccctac ctcgccccag tcgggacgca acagaagccg accgggccaa cccagcgcca
    63001 tacgtactat agcgaatgcg atgaatttcg attcatcgcc ccgcgggtgc tggacgagga
    63061 tgcccccccg gagaagcgcg ccggggtgca cgacggtcac ctcaagcgcg cccccaaggt
    63121 gtactgcggg ggggacgagc gcgacgtcct ccgcgtcggg tcgggcggct tctggccgcg
    63181 gcgctcgcgc ctgtggggcg gcgtggacca cgccccggcg gggttcaacc ccaccgtcac
    63241 cgtctttcac gtgtacgaca tcctggagaa cgtggagcac gcgtacggca tgcgcgcggc
    63301 ccagttccac gcgcggttta tggacgccat cacaccgacg gggaccgtca tcacgctcct
    63361 gggcctgact ccggaaggcc accgggtggc cgttcacgtt tacggcacgc ggcagtactt
    63421 ttacatgaac aaggaggagg tcgacaggca cctacaatgc cgcgccccac gagatctctg
    63481 cgagcgcatg gccgcggccc tgcgcgagtc cccgggcgcg tcgttccgcg gcatctccgc
    63541 ggaccacttc gaggcggagg tggtggagcg caccgacgtg tactactacg agacgcgccc
    63601 cgctctgttt taccgcgtct acgtccgaag cgggcgcgtg ctgtcgtacc tgtgcgacaa
    63661 cttctgcccg gccatcaaga agtacgaggg tggggtcgac gccaccaccc ggttcatcct
    63721 ggacaacccc gggttcgtca ccttcggctg gtaccgtctc aaaccgggcc ggaacaacac
    63781 gctagcccag ccgcgggccc cgatggcctt cgggacatcc agcgacgtcg agtttaactg
    63841 tacggcggac aacctggcca tcgagggggg catgagcgac ctaccggcat acaagctcat
    63901 gtgcttcgat atcgaatgca aggcgggggg ggaggacgag ctggcctttc cggtggccgg
    63961 gcacccggag gacctggtca tccagatatc ctgtctgctc tacgacctgt ccaccaccgc
    64021 cctggagcac gtcctcctgt tttcgctcgg ttcctgcgac ctccccgaat cccacctgaa
    64081 cgagctggcg gccaggggcc tgcccacgcc cgtggttctg gaattcgaca gcgaattcga
    64141 gatgctgttg gccttcatga cccttgtgaa acagtacggc cccgagttcg tgaccgggta
    64201 caacatcatc aacttcgact ggcccttctt gctggccaag ctgacggaca tttacaaggt
    64261 ccccctggac gggtacggcc gcatgaacgg ccggggcgtg tttcgcgtgt gggacatagg
    64321 ccagagccac ttccagaagc gcagcaagat aaaggtgaac ggcatggtga acatcgacat
    64381 gtacgggatt ataaccgaca agatcaagct ctcgagctac aagctcaacg ccgtggccga
    64441 agccgtcctg aaggacaaga agaaggacct gagctatcgc gacatccccg cctactacgc
    64501 cgccgggccc gcgcaacgcg gggtgatcgg cgagtactgc atacaggatt ccctgctggt
    64561 gggccagctg ttttttaagt ttttgcccca tctggagctc tcggccgtcg cgcgcttggc
    64621 gggtattaac atcacccgca ccatctacga cggccagcag atccgcgtct ttacgtgcct
    64681 gctgcgcctg gccgaccaga agggctttat tctgccggac acccaggggc gatttagggg
    64741 cgccgggggg gaggcgccca agcgtccggc cgcagcccgg gaggacgagg agcggccaga
    64801 ggaggagggg gaggacgagg acgaacgcga ggagggcggg ggcgagcggg agccggaggg
    64861 cgcgcgggag accgccggca ggcacgtggg gtaccagggg gccagggtcc ttgaccccac
    64921 ttccgggttt cacgtgaacc ccgtggtggt gttcgacttt gccagcctgt accccagcat
    64981 catccaggcc cacaacctgt gcttcagcac gctctccctg agggccgacg cagtggcgca
    65041 cctggaggcg ggcaaggact acctggagat cgaggtgggg gggcgacggc tgttcttcgt
    65101 caaggctcac gtgcgagaga gcctcctcag catcctcctg cgggactggc tcgccatgcg
    65161 aaagcagatc cgctcgcgga ttccccagag cagccccgag gaggccgtgc tcctggacaa
    65221 gcagcaggcc gccatcaagg tcgtgtgtaa ctcggtgtac gggttcacgg gagtgcagca
    65281 cggactcctg ccgtgcctgc acgttgccgc gacggtgacg accatcggcc gcgagatgct
    65341 gctcgcgacc cgcgagtacg tccacgcgcg ctgggcggcc ttcgaacagc tcctggccga
    65401 tttcccggag gcggccgaca tgcgcgcccc cgggccctat tccatgcgca tcatctacgg
    65461 ggacacggac tccatctttg tgctgtgccg cggcctcacg gccgccgggc tgacggccgt
    65521 gggcgacaag atggcgagcc acatctcgcg cgcgctgttt ctgcccccca tcaaactcga
    65581 gtgcgaaaag acgttcacca agctgctgct gatcgccaag aaaaagtaca tcggcgtcat
    65641 ctacgggggt aagatgctca tcaagggcgt ggatctggtg cgcaaaaaca actgcgcgtt
    65701 tatcaaccgc acctccaggg ccctggtcga cctgctgttt tacgacgata ccgtctccgg
    65761 agcggccgcc gcgttagccg agcgccccgc ggaggagtgg ctggcgcgac ccctgcccga
    65821 gggactgcag gcgttcgggg ccgtcctcgt agacgcccat cggcgcatca ccgacccgga
    65881 gagggacatc caggactttg tcctcaccgc cgaactgagc agacacccgc gcgcgtacac
    65941 caacaagcgc ctggcccacc tgacggtgta ttacaagctc atggcccgcc gcgcgcaggt
    66001 cccgtccatc aaggaccgga tcccgtacgt gatcgtggcc cagacccgcg aggtagagga
    66061 gacggtcgcg cggctggccg ccctccgcga gctagacgcc gccgccccag gggacgagcc
    66121 cgcccccccc gcggccctgc cctccccggc caagcgcccc cgggagacgc cgtcgcctgc
    66181 cgaccccccg ggaggcgcgt ccaagccccg caagctgctg gtgtccgagc tggccgagga
    66241 tcccgcatac gccattgccc acggcgtcgc cctgaacacg gactattact tctcccacct
    66301 gttgggggcg gcgtgcgtga cattcaaggc cctgtttggg aataacgcca agatcaccga
    66361 gagtctgtta aaaaggttta ttcccgaagt gtggcacccc ccggacgacg tggccgcgcg
    66421 gctccggacc gcagggttcg gggcggtggg tgccggcgct acggcggagg aaactcgtcg
    66481 aatgttgcat agagcctttg atactctagc atgagccccc cgtcgaagct gatgtccctc
    66541 attttacaat aaatgtctgc ggccgacacg gtcggaatct ccgcgtccgt gggtttctct
    66601 gcgttgcgcc ggaccacgag cacaaacgtg ctctgccaca cgtgggcgac gaaccggtac
    66661 cccgggcacg cggtgagcat ccggtctatg agccggtagt gcaggtgggc ggacgtgccg
    66721 ggaaagatga cgtacagcat gtggcccccg taagtggggt ccgggtaaaa caacagccgc
    66781 gggtcgcacg ccccgcctcc gcgcaggatc gtgtggacga aaaaaagctc gggttggcca
    66841 agaatcccgg ccaagaggtc ctggaggggg gcgttgtggc ggtcggccaa cacgaccaag
    66901 gaggccagga aggcgcgatg ctcgaatatc gtgttgatct gctgcacgaa ggccaggatt
    66961 agggcctcgc ggctggtggc ggcgaaccgc ccgtctcccg cgttgcacgc gggacagcaa
    67021 cccccgatgc ctaggtagta gcccatcccg gagagggtca ggcagttgtc ggccacggtc
    67081 tggtccagac agaagggcag cgagacggga gtggtcttca ccaggggcac cgagagcgag
    67141 cgcacgatgg cgatctcctc ggagggcgtc tgggcgaggg cggcgaaaag gccccgatag
    67201 cgctggcgct cgtgtaaaca cagctcctgt ttgcgggcgt gaggcggcag gctcttccgg
    67261 gaggcccgac gcaccacgcc cagagtcccg ccggccgcag aggagcgcga ccgccggcgc
    67321 tccttgccgt gatagggccc gggccgggag ccgcggcgat gggggtcggt gtcatacata
    67381 ggtacacagg gtgtgctcca gggacaggag cgagatcgag tggcgtctaa gcagcgcgcc
    67441 cgcctcacgg acaaatgtgg cgagcgcggt gggctttggt acaaatacct gatacgtctt
    67501 gaaggtgtag atgagggcac gcaacgctat gcagacacgc ccctcgaact cgttcccgca
    67561 ggccagcttg gccttgtgga gcagcagctc gtcgggatgg gtggcggggg gatggccgaa
    67621 cagaacccag gggtcaacct ccatctccgt aatggcgcac atggggtcac agaacatgtg
    67681 cttaaagatg gcctcgggcc ccgcggcccg aagcaggctc acaaaccggc ccccgtcccc
    67741 gggctgcgtc tcggggtcag cctcgagctg gtcgacgacg ggtacgatac agtcgaagag
    67801 gctcgtgttg ttttccgagt agcggaccac ggaggcccgg agtctgcgca gggccagcca
    67861 gtaagcacgc accagtaaca ggttacacag caggcattct ccgccggtgc gcccgcgccc
    67921 ccggccgtgt ttcagcacgg tggccatcag agggcccagg tcgaggtcgg gctgggcatc
    67981 gggttcggta aactgcgcaa agcgcggagc cacgtcgcgc gtgcgtgccc cgcgatgcgc
    68041 ttcccaggac tggcggaccg tggcgcgacg ggcctccgcg gcagcgcgca gctggggccc
    68101 cgactcccag acggcggggg tgccggcgag gagcaacagg accagatccg cgtacgccca
    68161 cgtatccggc gactcctccg gctcgcggtc cccggcgacc gtctcgaatt ccccgttgcg
    68221 agcggcggcg cgagtacagc agctgtcccc gcccccgcgc cgaccctccg tgcagtccag
    68281 gagacgggcg caatccttcc agttcatcag cgcggtggtg agcgacggct gcgtgccgga
    68341 tcccgccgcc gaccccgccc cctcctcgcc cccggaggcc aaggttccga tgagggcccg
    68401 ggtggcagac tgcgccagga acgagtagtt ggagtactgc accttggcgg ctcccgggga
    68461 gggcgagggc ttgggttgct tctgggcatg ccgcccgggc accccgccgt cggtacggaa
    68521 gcagcagtgg agaaaaaagt gccggtggat gtcgtttatg gtgagggcaa agcgtgcgaa
    68581 ggagccgacc agggtcgcct tcttggtgcg cagaaagtgg cggtccatga cgtacacaaa
    68641 ctcgaacgcg gccacgaaga tgctagcggc gcagtggggc gcccccaggc atttggcaca
    68701 gagaaacgcg taatcggcca cccactgagg cgagaggcgg taggtttgct tgtacagctc
    68761 gatggtgcgg cagaccagac agggccggtc cagcgcgaag gtgtcgatgg ccgccgcgga
    68821 aaagggcccg gtgtccaaaa gcccctcccc acagggatcc gggggcgggt tgcggggtcc
    68881 tccgcgcccg cccgaacccc ctccgtcgcc cgcccccccg cgggcccttg agggggcggt
    68941 gaccacgtcg gcggcgacgt cctcgtcgag cgtaccgacg ggcggcacac ctatcacgtg
    69001 actggccgtc aggagctcgg cgcagagagc ctcgttaaga gccaggaggc tgggatcgaa
    69061 ggccacatac gcgcgctcga acgcccccgc cttccagctg ctgccggggg actcttcgca
    69121 caccgcgacg ctcgccagga ccccgggggg cgaagttgcc atggctgggc gggaggggcg
    69181 cacgcgccag cgaactttac gggacacaat ccccgactgc gcgctgcggt cccagaccct
    69241 ggagagtcta gacgcgcgct acgtctcgcg agacggcgcg catgacgcgg ccgtctggtt
    69301 cgaggatatg acccccgccg agctggaggt tgtcttcccg actacggacg ccaagctgaa
    69361 ctacctgtcg cggacgcagc ggctggcctc cctcctgacg tacgccgggc ctataaaagc
    69421 gcccgacgac gccgccgccc cgcagacccc ggacaccgcg tgtgtgcacg gcgagctgct
    69481 cgcccgcaag cgggaaagat tcgcggcggt cattaaccgg ttcctggacc tgcaccagat
    69541 tctgcggggc tgacgcgcgt gctgttgggc gggacggttc gcgaaccctt tggtgggttt
    69601 acgcgggcac gcacgctccc atcgcgggcg ccatggcggg actgggcaag ccctacaccg
    69661 gccacccagg tgacgccttc gagggtctcg ttcagcgaat tcggcttatc gtcccatcta
    69721 cgttgcgggg cggggacggg gaggcgggcc cctactctcc ctccagcctc ccctccaggt
    69781 gcgcctttca gtttcatggc catgacgggt ccgacgagtc gtttcccatc gagtatgtac
    69841 tgcggcttat gaacgactgg gccgaggtcc cgtgcaaccc ttacctgcgc atacagaaca
    69901 ccggcgtgtc ggtgctgttt caggggtttt ttcatcgccc acacaacgcc cccgggggcg
    69961 cgattacgcc agagcggacc aatgtgatcc tgggctccac cgagacgacg gggctgtccc
    70021 tcggcgacct ggacaccatc aaggggcggc tcggcctgga tgcccggccg atgatggcca
    70081 gcatgtggat cagctgcttt gtgcgcatgc cccgcgtgca gctcgcgttt cggttcatgg
    70141 gccccgaaga tgccggacgg acgagacgga tcctgtgccg cgccgccgag caggctatta
    70201 cccgtcgccg ccgaacccgg cggtcccggg aggcgtacgg ggccgaggcc gggctggggg
    70261 tggccggaac gggtttccgg gccagggggg acggttttgg cccgctcccc ttgttaaccc
    70321 aagggccctc ccgcccgtgg caccaggccc tgcggggtct taagcaccta cggattggcc
    70381 cccccgcgct cgttttggcg gcgggactcg tcctgggggc cgctatttgg tgggtggttg
    70441 gtgctggcgc gcgcctataa aaaaggacgc accgccgccc taatcgccag tgcgttccgg
    70501 acgccttcgc cccacacagc cctcccgacc gacaccccca tatcgcttcc cgacctccgg
    70561 tcccgatggc cgtcccgcaa tttcaccgcc ccagcaccgt taccaccgat agcgtccggg
    70621 cgcttggcat gcgcgggctc gtcttggcca ccaataactc tcagtttatc atggataaca
    70681 accacccgca cccccagggc acccaagggg ccgtgcggga gtttctccgc ggtcaggcgg
    70741 cggcgctgac ggaccttggt ctggcccacg caaacaacac gtttaccccg cagcctatgt
    70801 tcgcgggcga cgccccggcc gcctggttgc ggcccgcgtt tggcctgcgg cgcacctatt
    70861 caccgtttgt cgttcgagaa ccttcgacgc ccgggacccc gtgaggcccg gggagttcct
    70921 tctggggtgt tttaatcaat aaaagaccac accaacgcac gagccttgcg tttaatgtcg
    70981 tgtttattca agggagtggg atagggttcg acggttcgaa acttaacaca ccaaataatc
    71041 gagcgcgtct agcccagtaa catgcgcacg tgatgtaggc tggtcagcac ggcgtcgctg
    71101 tgatgaagca gcgcccggcg ggtccgctgt aactgctgtt gtaggcggta acaggcgcgg
    71161 atcagtaccg ccagggcgct acgaccggtg cgttgcacgt agcgtcgcga cagaactgcg
    71221 tttgccgata cgggcggggg gccgaattgt aagcgcgtca cctcttggga gtcatcggcg
    71281 gataacgcac tgaatggttc gttggttatg ggggagtgtg gttccccagg gagtgggtcg
    71341 agcgcctcgg cctcggaatc cgagaggaac aacgaggtgg cgtcggagtc ttcgtcgtca
    71401 gagacataca gggtctgaag cagcgacacg ggcggggggg tagcgtcgat gtgtagcgcg
    71461 agggaggatg cccacgaaga caccccagac aaggagctgc ccgtgcgtgg atttgtggaa
    71521 gacgcggaag ccgggacgga tgggcggttt tgcggtgccc ggaaccgaac cgccggatac
    71581 tccccgggtg ctacatgccc gttttggggc tggggttggg gctggggttg gggctggggt
    71641 tggggctggg gttggggctg gggttggggc tggggttggg gttggggttg gggctggggt
    71701 tggggttggg gctggggctg gggctggggc tggggctggg gctggggctg gggctggggc
    71761 tggggctggg gctggggctg gggctggggc tggggctggg gctggggttg gggcgcggac
    71821 aggcggctga cggtcaaatg cccccggggg cgcgcagatg tggtgggcgt ggccaccggc
    71881 tgccgtgtag tggggcggcg ggaaaccggg cctccgggcg caacaccgcc ctccagcgtc
    71941 aagtatgtgg ggggcgggcc tgacgtcggg ggcggggcga cgggttggac cgcgggaggc
    72001 gggggagagg gacctgcggg agaggatgag gtcggctcgg ccgggttgcg gcctaaaaca
    72061 ggggccgtgg ggtcggcggg gtcccagggt gaagggaggg attcccgcga ttcggacagc
    72121 gacgcgacag cggggcgcgt aaggcgccgc tgcggcccgc ctacgggaac cctggggggg
    72181 gttggcgcgg gacccgaggt tagcgggggg cggcggtttt cgcccccggg caaaaccgtg
    72241 ccggttgcga ccgggggcgg aacgggatcg atagggagag cgggagaagc ctggccggcg
    72301 gcctggggcc cgagcgggag gggcacacca gacaccaaag cgtggggcgc tggctctggg
    72361 ggtttgggag gggccggggg gcgcgcgaaa tcggtaaccg gggcgaccgt gtcggggagg
    72421 gcaggcggcc gccaaccctg ggtggtcgcg gaagcctggg tggcgcgcgc cagggagcgt
    72481 gcccggcggt gtcggcgcgc gcgcgacccg gacgaagaag cggcagaagc gcgggaggag
    72541 gcgggggggc ggggggcggt ggcatcgggg ggcgccgggg aactttgggg ggacggcaag
    72601 cgccggaagt cgtcgcgggg gcccacgggc gccggccgcg tgctttcggc cgggacgccc
    72661 ggtcgtgctt cgcgagccgt gactgccggc ccagggggcc gcggtgcaca ctgggacgtg
    72721 gggacggact gatcggcggt gggcgaaagg gggtccgggg caaggagggg cgcggggccg
    72781 ccggagtcgt cagacgcgag ctcctccagg ccgtgaatcc atgcccacat gcgagggggg
    72841 acgggctcgc cgggggtggc gtcggtgaat agcgtggggg ccaggcttcc gggccccaac
    72901 gagccctccg ccccaacaag gtccacaggg ccgggggtcg ggttcgggac cgaggggctc
    72961 tggtcgtcgg gggcgcgctg gtacaccgga tgccccggga atagctcccc cgacaggagg
    73021 gaggcgtcga acggccgccc gaggatagct cgcgcgagga aggggtcctc gtcggtggcg
    73081 ctggcggcga ggacgtcctc gccgcccgcc acaaacggga gctcctcggt ggcctcgctg
    73141 ccaacaaacc gcacgtcggg ggggccgggg gggtccgggt tttcccacaa caccgcgacc
    73201 ggggtcatgg agatgtccac gagcaccaga cacggcgggc cccgggcgag gggccgctcg
    73261 gcgatgagcg cggacaggcg cgggagctgt gccgccagac acgcgttttc gatcgggttc
    73321 aggtcggcgt gcaggaggcg gacggcccac gtctcgatgt cggacgacac ggcatcgcgc
    73381 aaggcggcgt ccggcccgcg agcgcgtgag tcaaacagcg tgagacacag ctccagctcc
    73441 gactcgcggg aaaaggccgt ggtgttgcgg agcgccacga cgacgggcgc gcccaggagc
    73501 actgccgcca gcaccaggtc catggccgta acgcgcgccg cgggggtgcg gtgggtggcg
    73561 gcggccggca cggcgacgtg ctggcccgtg ggccggtaga gggcgttggg gggagcgggg
    73621 ggtgacgcct cgcgcccccc cgaggggctc agcgtctgcc cagattccag acgcgcggtc
    73681 agaagggcgt cgaaactgtc atactctgtg tagtcgtccg gaaacatgca ggtccaaaga
    73741 gcgaccagag cggtgcttgg gagacacatg cgcccgagga cgctcaccgc cgccagcgcc
    73801 tgggcgggac tcagctttcc cagcgcggcg ccgcgctcgg ttcccagctc ggggaccgag
    73861 cgccagggcg ccagggggtc ggtttcggac aacttgccgc ggcgccagtc tgccagccgc
    73921 gtgccgaaca tgaggccccg ggtcggaggg cctccggccg aaaacgctgg cagcacgcgg
    73981 atgcgggcgt ctggatgcgg ggtcaggcgc tgcacgaata gcatggaatc tgctgcgttc
    74041 tgaaacgcac gggggagggt gagatgcatg tactcgtgtt ggcgaaccag atccaggcgc
    74101 caaaaggtgt aaatgtgttc cggggagctg gccaccagcg ccaccagcac gtcgttctcg
    74161 ttaaaggaaa cgcggtgcct agtggagctc tggggtccga gcggcggccc cggggccgcc
    74221 gcgtcacccc cccattccag ctgggcccag cgacacccaa actcgcgcgt gagagtggtc
    74281 gcgacgaggg cgacgtagag ctcggccgcc gcatccatcg aggcccccca tctcgcctgg
    74341 cggtggcgca caaagcgtcc gaagagctga aagttggcgg cctgggcgtc gctgagggcc
    74401 agctgaagcc ggttgatgac ggtgaggacg tacatggccg tgacggtcga ggccgactcc
    74461 agggtgtccg tcggaagcgg ggggcgaatg catgccgcct cgggacacat cagcagcgcg
    74521 ccgagcttgt cggtcacggc cgggaagcag agcgcgtact gcagtggcgt tccatccggg
    74581 accaaaaagc tgggggcgaa cggccgatcc agcgtactgg tggcctcgcg cagcaccagg
    74641 ggccccgggc ctccgctcac tcgcaggtac gcctcgcccc ggcggcgcag catctgcggg
    74701 tcggcctctt ggccgggtgg ggcggacgcc cgggcgcggg cgtctagggc gcgaagatcc
    74761 acgagcaggg gcgcgggcgc ggccgccgcg cccgcgcccg tctggcctgt ggccttggcg
    74821 tacgcgctat ataagcccat gcggcgttgg atgagctccc gcgcgccccg gaactcctcc
    74881 accgcccatg gggccaggtc cccggccacc gcgtcgaatt ccgccaacag gccccccagg
    74941 gtgtcaaagt tcatctccca ggccaccctt ggcaccacct cgtcccgcag ccgggcgctc
    75001 aggtcggcgt gttgggccac gcgccccccg agctcctcca cggccccggc ccgctcggcg
    75061 ctcttggcgc ccaggacgcc ctggtacttg gcgggaaggc gctcgtagtc ccgctgggct
    75121 cgcagccccg acacagtgtt ggtggtgtcc tgcagggcgc gaagctgctc gcatgccgcg
    75181 cgaaatccct cgggcgattt ccaggccccc ccgcgaacgc ggccgaagcg accccatacc
    75241 tcgtcccact ccgcctcggc ctcctcgaga gacctccgca gggcctcgac gcggcgacgg
    75301 gtgtcgaaga gcgcctgcag gcgcgcgccc tgtcgcgtca ggaggcccgg gccgtcgccg
    75361 ctggccgcgc ttagcgggtg cgtctcaaag gtacgctggg catgttccaa ccaggcgacc
    75421 gcctgcacgt cgagctcgcg cgccttctcc gtctggtcca ccagaatttc gacctgatcc
    75481 gcgatctcct ccgccgagcg cgcctggtcc agcgtcttgg ccacggtcgc cgggacggcg
    75541 accaccttca gcagggtctt cagattggcc agaccctcgg cctcgagctg ggcccggcgc
    75601 tcgcgcgcgg ccagcacctc ccgcagcccc gccgtgaccc gctcggtggc ttcggcgcgc
    75661 tgctgtttgg cgcgcaccac ggcgtccttg gtatcggcca ggtcctgtcg ggtcacgaat
    75721 gcgacgtagt cggcgtacgc cgtgtccttc acggggctct ggtccacgcg ctccagcgcc
    75781 gccacgcacg ccaccagcgc gtcctcgctc gggcagggca gggtgacccc tgcccggaca
    75841 agctcggcgg ccgccgccgg gtcgttgcgc accgcggata tctcctccgc ggcggcggcc
    75901 aggtccagcg ccacgcttcc gatcgcgcgc cgcgcgtcgg cccggagggc gtccaggcga
    75961 tcgcggatat ccacgtactc ggcgtagccc ttttgaaaaa acggcacgta ctggcgcagg
    76021 gccggcacgc cccccaagtc ttccgacagg tgtaggacgg cctcgtggta gtcgataaac
    76081 ccgtcgttcg cctgggcccg ctccagcagc ccccccgcca gccgcagaag ccgcgccagg
    76141 ggctcggtgt ccacccgaaa catgtcggcg tacgtgtcgg ccgcggcccc gaaggccgcg
    76201 ctccagtcga tgcggtgaat ggctgcgagc ggggggagca tggggtggcg ctggttctcg
    76261 ggggtgtatg ggttaaacgc aagggccgtc tccagggcaa gggtcaccgc cttggcgttg
    76321 gttcccagcg cctgttcggc ccgctttcgg aagtcccggg ggttgtagcc gtgcgtgccc
    76381 gccagcgcct gcaggcgacg gagctcgacc acgtcaaact cggcaccgct ttccacgcgg
    76441 tccagcacgg cctccacgtc ggcggcccag cgctcgtggc tactgcgggc gcgctgggcc
    76501 gccatcttct ctctgaggtc ggcggtggcg gcctcaagtt cgtcggcgcg gcgtcgcgtg
    76561 gcgccgatga cctttcccag ctcctgcagg gcgcgcccgc tgggggagtg gtccccggcc
    76621 gtcccttcgg cgtgcaacag gcccccgaac ctgccctcgt ggcccgcgag gctttcccgc
    76681 gcgccggtgg tcgcgcgcgt cgcggcctgg atcagggagg catgctctcc ctccggttgg
    76741 ttggcggccc ggcgcacctg gacgacaagg tcggcggcag ccgaccctaa ggtcgtgagc
    76801 tgggcgatgg ccacccgcgc gtccagggcc aaccgagtcg ccttgacgta tcccgcggcg
    76861 ctgtcggcca tggccgctag gaaggccagg ggggaggccg ggtcgctggc ggccgcgccc
    76921 agggccgtca ccgcgtcgac caggacgcgg tgcgcccgca cggccgcatc caccgtcgac
    76981 gcagggtctg ccgttgcgac ggcggcgctg ccggcgttga tggcgttcga gacggcgtgg
    77041 gctatgatcg gggcgtgatc ggcgaagaac tgcaagagaa acggagtctc tggggcgtcg
    77101 gcgaacaggt tcttcagcac caccacgaag ctgggatgca agccagacag agccgtcgcc
    77161 gtgtccggag tcgggtgctc cagggcatct cggtactgcc ccagcagccc ccacatgtcc
    77221 gcccgcagcg ccgccgtaac ctcagggggc gccccccgaa cggcctcggg gaggtccgac
    77281 cagcccgccg gcagggaggc ccgcagggtc gccaggacgg ccggacaggc ctttagcccc
    77341 acaaagtcag ggagggggcg caggaccccc tggagtttgt gcaagaactt ctcccgggcg
    77401 tcgcgggcca ccttcgcccg ctcccgcgct ccctcgagca ttgcctccag ggagcgcgcg
    77461 cgctcccgca aacgggcacg cgcatcgggg gcgagctctg ccgtcagctt ggcggcatcc
    77521 atggcccgcg cctgccgcag cgcttcctcg gccatgcgcg tggcctctgg cgacagcccg
    77581 ccgtcgtcgg ggtagggcga cgcgccgggc gcaggaacaa aggccgcgtc gctgtccagc
    77641 tgctggccca gggccgcatc tagggcgtcg aagcgccgca gctcggccag acccgagctg
    77701 cggcgcgcct gttggtcgtt aatgtcgcgg atgctgcgcg ccagctcgtc cagtggcttg
    77761 cgttctatca gcccttggtt ggcggcgtcc gtcaggacgg agagccaggc cgccaggtcc
    77821 tcgggggcgt ccagcgtctg gccccgctgg atcagatccc gcaacaggat ggccgtgggg
    77881 ctggtcgcga tcgggggcgg ggcgggaatg gcggcgcgct gcgcgatgtc ccgcgtgtgc
    77941 tggtcgaaga caggcaggga ctcgagcagc tggaccacgg gcacgacggc ggccgaagcc
    78001 acgtgaaacc ggcggtcgtt gttgtcgctg gcctgtagag ccttggcgct gtatacggcc
    78061 ccccggtaaa agtactcctt aaccgcgccc tcgatcgccc gacgggcctg ggtccgcacc
    78121 tcctccagcc gaacctgaac ggcctcgggg cccagggggg gtgggcgcgg agccccctgc
    78181 ggggccgccc cggccggggc gggcattacg ccgaggggcc cggcgtgctg tgagaccgcg
    78241 tcgaccccgc gagcgagggc gtcgagggcc tcgcgcatct ggcgatcctc cgcctccacc
    78301 ctaatctctt cgccacgggc aaatttggcc agagcctgga ctctatacag aagcggttct
    78361 gggtgcgtcg gggtggcggg ggcaaaaagg gtgtccgggt gggcctgcga gcgctccaga
    78421 agccactcgc cgaggcgtgt atacagattg gccggcgggg ccgcgcgaag ctgcagctcc
    78481 aggtccgcga gttccccgta aaaggcgtcc gtctcccgaa tgacatccct agccacaagg
    78541 atcagcttcg ccagcgccag gcgaccgatc agagagtttt cgtccagcac gtgctggacg
    78601 aggggcagat gggcggccac gtcggccagg ctcaggcgcg tggaggccag aaagtccccc
    78661 acggccgttt tccagggcag catgttcagg gtaaactcca gcagggcggc ggccgggccg
    78721 gccaccccgg cctgggtgtg cgtccgggcc ccgttctcga tgagaaaggc gaggacgcgt
    78781 tcaaagaaaa aaataacaca gagctccagc agccccggag aggccggata cggcgaccgt
    78841 aaggcgctga tggtgagccg cgaacacgcg gcgacctcgc gggccagggc ggcggagcac
    78901 gcggtgaact taaccgccgt ggcggccacg tttgggtggg cctcgaacag ctgggcgagg
    78961 tctgcgcccg ggggctcggg cgagcggcga gtcttcagcg cctcgagggc ctgtgaggac
    79021 gccggaaccg tgggcccgtc gtcctcgccc gcctcggcga ccggcggccc ggccgggtcg
    79081 gggggtgccg aggcgaggac aggctccgga acggaggcgg ggaccgcggc cccgacgggg
    79141 gttttgcctt tgggggtgga tttcttcttg gttttggcag ggggggccga gcgtttcgtt
    79201 ttctcccccg aagtcaggtc ttcgacgctg gaaggcggag tccaggtggg tcggcggcgc
    79261 ttgggaaggc cggccgagta gcgtgcccgg tgccgaccaa ccgggacgac gcccatctcc
    79321 aggacccgca tgtcgtcgtc atcttcttcg gccgcctctg cggcgggggt cttgggggcg
    79381 gagggaggcg gtggtgggat cgcggagggt gggtcggcgg agggtgggtc ggcggagggg
    79441 ggatccgtgg gtggggtacc cttcagggcc accgcccata catcgtcggg cgcccgattc
    79501 gggcgcttgg cctctggttt tgccgacgga ccggccgtcc cccgggatgt ctcggaggcc
    79561 ctgtcgtcgc gacgggcccg ggtcggtggc ggcgactggg cggctgtggg cgggtgtggc
    79621 cccgggcccc ctaccccctc ccgggggccc acgccgacgc agggctcccc caggcccgcg
    79681 atctcgcccc gcagggggtg cgtgatggcc acgcgccgtt cgctgaacgc ttcgtcctgc
    79741 aggtaagtct cgctggcccc gtaaagatgc agagccgcgg ccgtcaagtc cgcaggagcc
    79801 gcgggttccg ggcccgacgg cacgaaaaac accatggctc ccgcccaccg tacgtccggg
    79861 cgatcgcggg tgtaatacgt caggtatgga tacatgtccc ccgcccgcac tttggcgatg
    79921 aacgcggggg tgccctccgg aaggccgtgc gggtcaaaaa ggtatgcggt gtcgccgtcc
    79981 ctgaacagcc ccatccctag ggggccaatg gttaggagcg tgtacgacag ggggcgcagg
    80041 gcccacgggc cggcgaagaa cgtgtgtgcg gggcattgtg tctccagcag gcccgccgcg
    80101 ggctccccga agaagcccac ctcgccgtat acgcgcgaga agacacagcg cagtccgccg
    80161 cgcgcccctg ggtactcgag gaagttgggg agctcgacga tcgaacacat gcgcggcggc
    80221 ccagggcccg cggtcgcgcg cgtccactcg cccccctcga ccaaacatcc ctcgatggcc
    80281 tccgcggaca ggacgtcgcg agggcccaca tcaaatatga ggctgagaaa ggacagcgac
    80341 gagcgcatgc acgataccga cccccccggc tccaggtcgg gcgcgaactg gttccgagca
    80401 ccggtgacca cgatgtcgcg atcccccccg cgttccatcg tggagtgcgg tggggtgccc
    80461 gcgatcatat gtgccctgct ggccagagac ccggcctgtt tatggaccgg acccccgggg
    80521 ttagtgttgt ttccgccacc catgcccccg taccatggcc ccggttcccc tgattaggct
    80581 acgagtcgcg gtgatcgctt cccaaaaacc gagctgcgtt tgtctgtctt ggtcttccac
    80641 cccccccccc gcccgcccgc acaccataac accgagaaca acacacgggg gtgggcgtaa
    80701 cataataaag ctttattggt aactagttaa cggcaagtcc gtgggtggcg cgacggtgtc
    80761 ctccgggatc atctcgtcgt cctcgacggg ggtgttggaa tgaggcgccc cctcgcggtc
    80821 cgcctggcgt gggccgtgcc cataggcctc cggcttctgt gcgtccatgg gcataggcgc
    80881 ggggagactg tttccggcgt cgcggacctc caggtccctg ggagactccg gtccggctaa
    80941 cggacgaaac gcggaagcgc gaaacacgcc gtcggtgacc cgcaggagct cgttcatcag
    81001 taaccaatcc atactcagcg taacggccag cccctggcga gacagatcca cggagtccgg
    81061 aaccgcggtc gtctggccca gggggccgag gctgtagtcc ccccaggccc ctaggtcgcg
    81121 acggctcgta agcacgacgc ggtcggccgc ggggctttgc gggggggcgt cctcgggcgc
    81181 atgcgccatt acctctcgga tggccgcggc gcgctggtcg gccgagctga ccaagggcgc
    81241 cacgaccacg gcgcgctccg tctgcaggcc cttccacgtg tcgtggagtt cctggacaaa
    81301 ctcggccacg ggctcgggtc ccgcggccgc gcgcgcggct tgatagcagg ccgacagacg
    81361 ccgccagcgc gctagaaact gacccatgaa gcaaaacccg gggacctggt ctcccgacag
    81421 cagcttcgac gcccgggcgt gaatgccgga cacgacggac agaaacccgt gaatttcgcg
    81481 ccggaccacg gccagcacgt tgtcctcgtg cgacacctgg gccgccagct cgtcgcacac
    81541 ccccaggtgc gccgtggttt cggtgatgac ggaacgcagg ctcgcgaggg acgcgaccag
    81601 cgcgcgcttg gcgtcgtgat acatgctgca gtactgactc accgcgtccc ccatggcctc
    81661 ggggggccag ggccccaggc ggtcgggcgt gtccccgacc accgcataca ggcggcgccc
    81721 gtcgctctcg aaccgacact cgaaaaaggc ggagagcgtg cgcatgtgca gccgcagcag
    81781 cacgatggcg tcctccagtt ggcgaatcag ggggtctgcg cgctcggcga ggtcctgcag
    81841 caccccccgg gcggccaggg cgtacatgct aatcaacagg aggctggtgc ccacctcggg
    81901 gggcgggggg ggctgcagct ggaccagggg ccgcagctgc tcgacggcac ccctggagat
    81961 cacgtacagc tcccggagca gctgctctat gttgtcggcc atctgcatag tggggccgag
    82021 gccgccccgg gcggccggtt cgaggagggt gatcagcgcg cccagtttgg tgcgatggcc
    82081 ctcaaccgtg gggagatagc ccagcccaaa gtcccgggcc caggccaaca cacgcagggc
    82141 gaactcgacc gggcggggaa ggtaggccgc gctacacgtg gccctcagcg cgtccccgac
    82201 caccagggcc agaacgtagg ggacgaagcc cgggtcggcg aggacgttgg ggtgaatgcc
    82261 ctcgagggcg gggaagcgga tctgggtcgc cgcggccagg tggacagagg gggcgtggct
    82321 gggctgcccg acggggagaa gcgcggacag cggcgtggcc ggggtggtgg gggtgatgtc
    82381 ccagtgggtc tgaccataca cgtcgatcca gatgagcgcc gtctcgcgga gaaggctggg
    82441 ttgaccggaa ctaaagcggc gctcggccgt ctcaaactcc cccacgagcg cccgccgcag
    82501 gctcgccaga tgttccgtcg gcacggccgg acccatgata cgcgccagcg tctggcttag
    82561 aacgcccccc gacaggccga ccgcctcgca gagccgcccg tgcgtgtgct cgctggcgcc
    82621 ctggacccgc ctgaaagttt ttacgtagtt ggcatagtac ccgtattccc gcgccaaccc
    82681 aaacacgttc gaccccgcga gggcaatgca cccaaagagc tgctggactt cgccgagtcc
    82741 gtggccggtg ggcgtccgcg cggggacgcc cgccgccaga aacccctcca gggccgaaag
    82801 gtagtgcgtg cagtgcgagg gcgtgaaccc agcgtcgatc agggtgttga tcaccacgga
    82861 gggcgaattg gtattctgga tcaacgtcca cgtctgctgc agcagagcca gcagccgctg
    82921 ctgggcgccg gcggagggct gctccccgag ctgcagcagg ctggagacgg caggctggaa
    82981 gactgccagt gccgacgaac tcaggaacgg cacgtcggga tcaaacacgg ccacgtccgt
    83041 ccgcacgcgc gccattagcg tccccggggg cgcacaggcc gagcgcgggc tgacgcggct
    83101 gagggccgtc gacacgcgca cctcctcgcg gctgcgaacc atcttgttgg cctcgagcgg
    83161 cggaatcatt atggccgggt cgatctcccg cacggtgtgc tgaaactgcg ccaacagggg
    83221 cggcgggacc acagcccccc gctcgggggt cgtcaggtac tcgtccacca gggccaacgt
    83281 aaagagggcc cgtgtgaggg gagtgagggt cgcgtcgtct atgcgctgga ggtgcgccga
    83341 gaacagcgtc acccgattac tcaccagggc caagaaccgg aggccctctt gcacgaacgg
    83401 ggcggggaag agcaggctgt acgccggggt ggtaaggttc gcgctgggct gccccaacgg
    83461 gaccggcgcc atcttgagcg acgtctcccc aagggcctcg atggaggtcc gcgggctcat
    83521 ggccaagcag ctcttggtga cggtttgcca gcggtctatc cactccacgg cgcactggcg
    83581 gacgcggacc ggccccaggg ccgccgcggt gcgcaggccg gcggaatcca gcgcatggga
    83641 cgtgtcggag ccggtgaccg cgaggatggt gtccttgatg acctccatct cccggaaggc
    83701 ctggtcgggg gcctcgggga gagccaccac caagcggtgt acgagcaacc cggggaggtt
    83761 ctcggccaag agcgccgtct ccggaagccc gtgggcccgg tggagcgcgc acaggtgttc
    83821 cagcagcggc cgccagcatg cccgcgcgtc tgccggggcg atggccgttc ccgacaacag
    83881 aaacgccgcc atggcggcgc gcagcttggc cgtggccaga aacgccgggt cgtccgcccc
    83941 gtttgccgtc tcggccgtgg gggttggcgg ttggcgaagg ccggctaggc tcgccaatag
    84001 gcgctgcata ggtccgtccg agggcggacc ggcgggtgag gtcgtgacga cgggggcctc
    84061 ggacgggaga ccgcggtctg ccatgacgcc cggctcgcgt gggtggggga cagcgtagac
    84121 caacgacgag accgggcggg aatgactgtc gtgcgctgta gggagcggcg aattatcgat
    84181 cccccgcggc cctccaggac ccccgcaggc gttgcgagta ccccgcgtct tcgcggggtg
    84241 ttatacggcc acttaagtcc cggcatcccg ttcgcggacc caggcccggg ggattgtccg
    84301 gatgtgcggg cagcccggac ggcgtgggtt gcggactttc tgcggggcgg cccaaatggc
    84361 cctttaaacg tgtgtatacg gacgcgccgg gccagtcggc caacacaacc caccggaggc
    84421 ggtagccgcg tttggctgtg gggtgggtgg ttccgccttg cgtgagtgtc ctttcgaccc
    84481 ccccccccct ccctcccccg ggtcttgcta ggtcgcgatc tggggtcgca atgaagacca
    84541 atccgctacc cgcaacccct tccgtgtggg gcgggagtac cgtggaactc ccccccacaa
    84601 cacgcgatac cgcgggacag ggcctgcttc ggcgcgtcct gcgccccccg atctctcgcc
    84661 gcgacggccc agggctcccc agggggtcgg gaccccggag ggcggccagc acgctgtggt
    84721 tgcttggcct ggacggcaca gacgcgcccc ctggggcgct gacccccaac gacgataccg
    84781 aacaggccct ggacaagatc ctgcggggca ccatgcgcgg gggggcggcc ctgatcggct
    84841 ccccgcgcca tcatctaacc cgccaagtga tcctgacgga tctgtgccaa cccaacgcgg
    84901 atcgtgctgg gacgctgctt ctggcgctgc ggcaccccgc cgacctgcct cacctggccc
    84961 accagcgcgc cccgccaggc cggcagaccg agcggctggg cgaggcctgg ggccagctga
    85021 tggaggcgac cgccctgggg tcggggcgag ccgagagcgg gtgcacgcgc gcgggcctag
    85081 tgtcgtttaa cttcctggtg gcggcgtgtg ccgcctcgta cgacgcgcgc gacgccgccg
    85141 atgcggtacg ggcccacgtc acggccaact accgcgggac gcgggtgggg gcgcgcctgg
    85201 atcgtttttc cgagtgtctg cgcgccatgg ttcacacgca cgtcttcccc cacgaggtca
    85261 tgcggttttt cggggggctg gtgtcgtggg tcacccagga cgagctagcg agcgtcaccg
    85321 ccgtgtgcgc cgggccccag gaggcggcgc acaccggcca cccgggccgg ccccgctcgg
    85381 ccgtgatcct cccggcatgt gcgttcgtgg acctggacgc cgagctgggg ctggggggcc
    85441 cgggcgcggc gtttctgtac ctggtattca cttaccgcca gcgccgggac caggagctgt
    85501 gttgtgtgta cgtgatcaag agccagctcc ccccgcgcgg gttggagccg gccctggagc
    85561 ggctgtttgg gcgcctccgg atcaccaaca cgattcacgg caccgaggac atgacgcccc
    85621 cggccccaaa ccgaaacccc gacttccccc tcgcgggcct ggccgccaat ccccaaaccc
    85681 cgcgttgctc ggctggccag gtcacgaacc cccagttcgc cgacaggctg taccgctggc
    85741 agccggacct gcgggggcgc cccaccgcac gcacctgtac gtacgccgcc tttgcagagc
    85801 tcggcatgat gcccgaggat agtccccgct gcctgcaccg caccgagcgc tttggggcgg
    85861 tcagcgtccc cgttgtcatt ctggaaggcg tggtgtggcg ccccggcgag tggcgggcat
    85921 gcgcgtgagc gtagcaaacg ccccgcccac acaacgctcc gcccccaacc ccttccccgc
    85981 tgtcactcgt tgttcgttga cccgggcgtc cgccaaataa agccactgaa acccgaaacg
    86041 cgagtgttgt aacgtccttt gggcgggagg aagccacaaa atgcaaatgg gatacatgga
    86101 aggaacacac ccccgtgact caggacatcg gtgtgtcctt ttgggtttca ctgaaactgg
    86161 cccgcgcccc acccctgcgc gatgtggata aaaagccagc gcgggtggtt tagggtacca
    86221 caggtgggtg ctttggaaac ttgccggtcg ccgtgctcct gtgagcttgc gtccctcccc
    86281 ggtttccttt gcgctcccgc cttccggacc tgctctcgcc tatcttcttt ggctctcggt
    86341 gcgattcgtc aggcagcggc cttgtcgaat ctcgacccca ccactcgccg gacccgccga
    86401 cgtcccctct cgagcccgcc gaaacccgcc gcgtctgttg aaatggccag ccgcccagcc
    86461 gcatcctctc ccgtcgaagc gcgggccccg gttgggggac aggaggccgg cggccccagc
    86521 gcagccaccc agggggaggc cgccggggcc cctctcgccc acggccacca cgtgtactgc
    86581 cagcgagtca atggcgtgat ggtgctttcc gacaagacgc ccgggtccgc gtcctaccgc
    86641 atcagcgata gcaactttgt ccaatgtggt tccaactgca ccatgatcat cgacggagac
    86701 gtggtgcgcg ggcgccccca ggacccgggg gccgcggcat cccccgctcc cttcgttgcg
    86761 gtgacaaaca tcggagccgg cagcgacggc gggaccgccg tcgtggcatt cgggggaacc
    86821 ccacgtcgct cggcggggac gtctaccggt acccagacgg ccgacgtccc caccgaggcc
    86881 cttgggggcc cccctcctcc tccccgcttc accctgggtg gcggctgttg ttcctgtcgc
    86941 gacacacggc gccgctctgc ggtattcggg ggggaggggg atccagtcgg ccccgcggag
    87001 ttcgtctcgg acgaccggtc gtccgattcc gactcggatg actcggagga cacggactcg
    87061 gagacgctgt cacacgcctc ctcggacgtg tccggcgggg ccacgtacga cgacgccctt
    87121 gactccgatt cgtcatcgga tgactccctg cagatagatg gccccgtgtg tcgcccgtgg
    87181 agcaatgaca ccgcgcccct ggatgtttgc cccgggaccc ccggcccggg cgccgacgcc
    87241 ggtggtccct cagcggtaga cccacacgcg ccgacgccag aggccggcgc tggtcttgcg
    87301 gccgatcccg ccgtggcccg ggacgacgcg gaggggcttt cggacccccg gccacgtctg
    87361 ggaacgggca cggcctaccc cgtccccctg gaactcacgc ccgagaacgc ggaggccgtg
    87421 gcgcgctttc tgggagatgc cgtgaaccgc gaacccgcgc tcatgctgga gtacttttgc
    87481 cggtgcgccc gcgaggaaac caagcgtgtc ccccccagga cattcggcag cccccctcgc
    87541 ctcacggagg acgactttgg gcttctcaac tacgcgctcg tggagatgca gcgcctgtgt
    87601 ctggacgttc ctccggtccc gccgaacgca tacatgccct attatctcag ggagtatgtg
    87661 acgcggctgg tcaacgggtt caagccgctg gtgagccggt ccgctcgcct ttaccgcatc
    87721 ctgggggttc tggtgcacct gcggatccgg acccgggagg cctcctttga ggagtggctg
    87781 cgatccaagg aagtggccct ggattttggc ctgacggaaa ggcttcgcga gcacgaagcc
    87841 cagctggtga tcctggccca ggctctggac cattacgact gtctgatcca cagcacaccg
    87901 cacacgctgg tcgagcgggg gctgcaatcg gccctgaagt atgaggagtt ttacctaaag
    87961 cgttttggcg ggcactacat ggagtccgtc ttccagatgt acacccgcat cgccggcttt
    88021 ttggcctgcc gggccacgcg cggcatgcgc cacatcgccc tggggcgaga ggggtcgtgg
    88081 tgggaaatgt tcaagttctt tttccaccgc ctctacgacc accagatcgt accgtcgacc
    88141 cccgccatgc tgaacctggg gacccgcaac tactacacct ccagctgcta cctggtaaac
    88201 ccccaggcca ccacaaacaa ggcgaccctg cgggccatca ccagcaacgt cagtgccatc
    88261 ctcgcccgca acgggggcat cgggctatgc gtgcaggcgt ttaacgactc cggccccggg
    88321 accgccagcg tcatgcccgc cctcaaggtc cttgactcgc tggtggcggc gcacaacaaa
    88381 gagagcgcgc gtccgaccgg cgcgtgcgtg tacctggagc cgtggcacac cgacgtgcgg
    88441 gccgtgctcc ggatgaaggg ggtcctcgcc ggcgaagagg cccagcgctg cgacaatatc
    88501 ttcagcgccc tctggatgcc agacctgttt ttcaagcgcc tgattcgcca cctggacggc
    88561 gagaagaacg tcacatggac cctgttcgac cgggacacca gcatgtcgct cgccgacttt
    88621 cacggggagg agttcgagaa gctctaccag cacctcgagg tcatggggtt cggcgagcag
    88681 atacccatcc aggagctggc ctatggcatt gtgcgcagtg cggccacgac cgggagcccc
    88741 ttcgtcatgt tcaaagacgc ggtgaaccgc cactacatct acgacaccca gggggcggcc
    88801 atcgccggct ccaacctctg caccgagatc gtccatccgg cctccaagcg atccagtggg
    88861 gtctgcaacc tgggaagcgt gaatctggcc cgatgcgtct ccaggcagac gtttgacttt
    88921 gggcggctcc gcgacgccgt gcaggcgtgc gtgctgatgg tgaacatcat gatcgacagc
    88981 acgctacaac ccacgcccca gtgcacccgc ggcaacgaca acctgcggtc catgggaatc
    89041 ggcatgcagg gcctgcacac ggcctgcctg aagctggggc tggatctgga gtctgccgaa
    89101 tttcaggacc tgaacaaaca catcgccgag gtgatgctgc tgtcggcgat gaagaccagc
    89161 aacgcgctgt gcgttcgcgg ggcccgtccc ttcaaccact ttaagcgcag catgtatcgc
    89221 gccggccgct ttcactggga gcgctttccg gacgcccggc cgcggtacga gggcgagtgg
    89281 gagatgctac gccagagcat gatgaaacac ggcctgcgca acagccagtt tgtcgcgctg
    89341 atgcccaccg ccgcctcggc gcagatctcg gacgtcagcg agggctttgc ccccctgttc
    89401 accaacctgt tcagcaaggt gacccgggac ggcgagacgc tgcgccccaa cacgctcctg
    89461 ctaaaggaac tggaacgcac gtttagcggg aagcgcctcc tggaggtgat ggacagtctc
    89521 gacgccaagc agtggtccgt ggcgcaggcg ctcccgtgcc tggagcccac ccaccccctc
    89581 cggcgattca agaccgcgtt tgactacgac cagaagttgc tgatcgacct gtgtgcggac
    89641 cgcgccccct acgtcgacca tagccaatcc atgaccctgt atgtcacgga gaaggcggac
    89701 gggaccctcc cagcctccac cctggtccgc cttctggtcc acgcatataa gcgcggacta
    89761 aaaacaggga tgtactactg caaggttcgc aaggcgacca acagcggggt ctttggcggc
    89821 gacgacaaca ttgtctgcat gagctgcgcg ctgtgaccga caaaccccct ccgcgccagg
    89881 cccgccgcca ctgtcgtcgc cgtcccacgc tctcccctgc tgccatggat tccgcggccc
    89941 cagccctctc ccccgctctg acggccctta cgggccagag cgcgacggcg gacctggcga
    90001 tccagattcc aaagtgcccc gaccccgaga ggtacttcta cacctcccag tgtcccgaca
    90061 ttaaccacct gcgctccctc agcatcctta accgctggct ggaaaccgag cttgttttcg
    90121 tgggggacga ggaggacgtc tccaagcttt ccgagggcga gctcagcttt taccgcttcc
    90181 tcttcgcttt cctgtcggcc gccgacgacc tggttacgga aaacctgggc ggcctctccg
    90241 gcctgtttga gcagaaggac attctccact actacgtgga gcaggaatgc atcgaagtcg
    90301 tacactcgcg cgtgtacaac atcatccagc tggtgctttt ccacaacaac gaccaggcgc
    90361 gccgcgagta cgtggccggt accatcaacc acccggccat ccgcgccaag gtggactggt
    90421 tggaagcgcg ggtgcgggaa tgcgcctccg ttccggaaaa gttcattctc atgatcctca
    90481 tcgagggcat cttttttgcc gcctcgtttg ccgccatcgc ctaccttcgc accaacaacc
    90541 ttctgcgggt cacctgccag tcaaacgacc tcatcagccg ggacgaggcc gtgcacacga
    90601 cggcctcgtg ttacatctac aacaactacc tcggcgggca cgccaagccc ccgcccgacc
    90661 gcgtgtacgg gctgttccgc caggcggtcg agatcgagat cggatttatc cgatcccagg
    90721 cgccgacgga cagccatatc ctgagcccgg cggcgctggc ggccatcgaa aactacgtgc
    90781 gattcagcgc ggatcgcctg ttgggcctta tccacatgaa gccactgttt tccgccccac
    90841 cccccgacgc cagctttccg ctgagcctca tgtccaccga caaacacacc aattttttcg
    90901 agtgtcgcag cacctcctac gccggggcgg tcgtcaacga tctgtgagtg tcgcggcgcg
    90961 cttctacccg tgtttgccca taataaacct ctgaaccaaa ctttgggtct cattgtgatt
    91021 cttgtcaggg acgcgggggt gggagaggat aaaaggcggc gcaaaaagca gtaaccaggt
    91081 ccgtccagat tctgcgggca taggatacca taattttatt ggtgggtcgt ttgttcgggg
    91141 acaagcgcgc tcgtctgacg tttgggctac tcgtcccaga atttggccag gacgtccttg
    91201 tagaacgcgg gtgggggggc ctgggtccgc aactgctcca gaaacctgtc ggcgatatca
    91261 ggggccgtga tatgccgggt cacgatagat cgcgccaggt tttcgtcgcg gatgtcctgg
    91321 tagataggca ggcgtttcag aagagtccac ggcccccgct ccttggggcc gataagcgat
    91381 atgacgtact taatgtagcg gtgttccacc agctcggtga tggtcatggg atcggggagc
    91441 cagtccaggg actctggggc gtcgtggatg acgtggcgtc gccggttggc cacataactg
    91501 cggtgctctt ccagcagctg cgcgttcggg acctggacga gctcgggcgg ggtgagtatc
    91561 tccgaggagg acgacctggg gccggggtgg cccccggtaa cgtcccgggg atccaggggg
    91621 aggtcctcgt cgtcttcgta tccgccggcg atctgttggg ttagaatttc ggtccacgag
    91681 acgcgcgtct cggtgccgcc ggcggccggc ggcagagggg gcctggtttc cgtggagcgc
    91741 gagctggtgt gttcccggcg gatggcccgc cgggtctgag agcgactcgg gggggtccag
    91801 tgacattcgc gcagcacatc ctccacggag gcgtaggtgt tattgggatg gaggtcggtg
    91861 tggcagcgga caaagagggc caggaactgg gggtagctca tcttaaagta ctttagtata
    91921 tcgcgacagt tgatcgtggg aatgtagcag gcgctaatat ccaacacaat atcacagccc
    91981 atcaacagga ggtcagtgtc cgtggtgtac acgtacgcga ccgtgttggt gtgatagagg
    92041 ttggcgcagg catcgtccgc ctccagctga cccgagttaa tgtaggcgta ccccagggcc
    92101 cggagaacgc gaatacagaa cagatgcgcc agacgcaggg ccggcttcga gggcgcggcg
    92161 gacggcagcg cggctccgga cccggccgtc ccccgggtcc ccgaggccag agaggtgccg
    92221 cgccggcgca tgttggaaaa ggcagagctg ggtctggagt cggtgatggg ggaaggcggt
    92281 ggagaggcgt ccacgtcact ggcctcctcg tccgtccggc actgggccgt cgtgcgggcc
    92341 aggatggcct tggctccaaa cacaaccggc tccatacaat tgaccccgcg atcggtaacg
    92401 aagatgggga aaagggactt ttgggtaaac acctttaata agcgacagag gcagtgtagc
    92461 gtaatggcct cgcggtcgta actggggtat cggcgctgat atttgaccac caacgtgtac
    92521 atgacgttcc acaggtccac ggcaatgggg gtgaagtacc cggccggggc cccaaggccc
    92581 cggcgcttga ccagatggtg tgtgtgggca aacttcatca tcccgaacaa acccatgtca
    92641 ggtcaattgt aactgcggat cggcctaact aaggcgtggt tggtgcgacg gtccgggaca
    92701 cccgagcctg tctctctgtg tatggtgacc cagacaacaa caccgacaca agaggacaat
    92761 aatccgttag gggacgctct ttataatttc gatggcccaa ctccacgcgg attggtgcag
    92821 caccctgcat gcgccggtgc gggccaacct tccccccgct cattgcctct tccaaaaggg
    92881 tgtggcctaa cgagctgggg gcgtatttaa tcaggctagc gcggcgggcc tgccgtagtt
    92941 tctggctcgg tgagcgacgg tccggttgct tgggtcccct ggctgccatc aaaaccccac
    93001 cctcgcagcg gcatacgccc cctccgcgtc ccgcacccga gaccccggcc cggctgccct
    93061 caccaccgaa gcccacctcg tcactgtggg gtgttcccag cccgcgttgg gatgacggat
    93121 tcccctggcg gtgtggcccc cgcctccccc gtggaggacg cgtcggacgc gtccctcggg
    93181 cagccggagg agggggcgcc ctgccaggtg gtcctgcagg gcgccgaact taatggaatc
    93241 ctacaggcgt ttgccccgct gcgcacgagc cttctggact cgcttctggt tatgggcgac
    93301 cggggcatcc ttatccataa cacgatcttt ggggagcagg tgttcctgcc cctggaacac
    93361 tcgcaattca gtcggtatcg ctggcgcgga cccacggcgg cgttcctgtc tctcgtggac
    93421 cagaagcgct ccctcctgag cgtgtttcgc gccaaccagt acccggacct acgtcgggtg
    93481 gagttggcga tcacgggcca ggccccgttt cgcacgctgg ttcagcgcat atggacgacg
    93541 acgtccgacg gcgaggccgt tgagctagcc agcgagacgc tgatgaagcg cgaactgacg
    93601 agctttgtgg tgctggttcc ccagggaacc cccgacgttc agttgcgcct gacgaggccg
    93661 cagctcacca aggtccttaa cgcgaccggg gccgatagtg ccacgcccac cacgttcgag
    93721 ctcggggtta acggcaaatt ttccgtgttc accacgagta cctgcgtcac ctttgctgcc
    93781 cgcgaggagg gcgtgtcgtc cagcaccagc acccaggtcc agatcctgtc caacgcgctc
    93841 accaaggcgg gccaggcggc cgccaacgcc aagacggtgt acggggaaaa tacccatcgc
    93901 accttctctg tggtcgtcga cgattgcagc atgcgggcgg tgctccggcg actgcaggtc
    93961 ggcgggggca ccctcaagtt cttcctcacg acccccgtcc ccagtctgtg cgtcaccgcc
    94021 accggtccca acgcggtatc ggcggtattt ctcctgaaac cccagaagat ttgcctggac
    94081 tggctgggtc atagccaggg gtctccttca gccgggagct cggcctcccg ggcctctggg
    94141 agcgagccaa cagacagcca ggactccgcg tcggacgcgg tcagccacgg cgatccggaa
    94201 gacctcgatg gcgctgcccg ggcgggagag gcgggggcct tgcatgcctg tccgatgccg
    94261 tcgtcgacca cgcgggtcac tcccacgacc aagcgggggc gctcgggggg cgaggatgcg
    94321 cgcgcggaca cggccctaaa gaaacctaag acggggtcgc ccaccgcacc cccgcccgca
    94381 gatccagtcc ccctggacac ggaggacgac tccgatgcgg cggacgggac ggcggcccgt
    94441 cccgccgctc cagacgcccg gagcggaagc cgttacgcgt gttactttcg cgacctcccg
    94501 accggagaag caagccccgg cgccttctcc gccttccggg ggggccccca aaccccgtat
    94561 ggttttggat tcccctgacg gggcggggcc ttggcggccg cccaactctc gcaccatccc
    94621 gggttaatgt aaataaactt ggtattgccc aacactttcc cgcgtgtcgc gtgtggttca
    94681 tgtgtgtgcc tggcgccccc accctcgggt tcgtgtattt cctttccctg tccttataaa
    94741 agccgtatgt ggggcgctga cggaaccacc ccgcgtgcca tcacggccaa ggcgcgggat
    94801 gctccgcaac gacagccacc gggccgtgtc cccggaggac ggccagggac gggtcgacga
    94861 cggacggcca cacctcgcgt gcgtgggggc cctggcgcgg gggttcatgc atatctggct
    94921 tcaggccgcc acgctgggtt ttgcgggatc ggtcgttatg tcgcgcgggc cgtacgcgaa
    94981 tgccgcgtct ggggcgttcg ccgtcgggtg cgccgtgctg ggctttatgc gcgcaccccc
    95041 tcccctcgcg cggcccaccg cgcggatata cgcctggctc aaactggcgg ccggtggagc
    95101 ggcccttgtt ctgtggagtc tcggggagcc cggcacgcag ccgggggccc cggccccggg
    95161 cccggccacc cagtgcctgg cgctgggcgc cgcctatgcg gcgctcctgg tgctcgccga
    95221 tgacgtctat ccgctctttc tcctcgcccc ggggcccctg ttcgtcggca ccctggggat
    95281 ggtcgtcggc gggctgacga tcggaggcag cgcgcgctac tggtggatcg gtgggcccgc
    95341 cgcggccgcc ctggccgcgg cggtgttggc gggcccgggg gcgaccaccg ccagggactg
    95401 cttttccagg gcttgccccg accaccgccg cgtctgtgtc atcaccgcag gcgagtctct
    95461 ttcccgccgc cccccggagg acccagagcg acccggggtt cccgggcccc cgtccccccc
    95521 gaccccccaa cgatcccacg ggccgccggc cgatgaggtc gcaccggcca gggtcgcgcg
    95581 gcccgaaaac gtctgggtgc ccgtggtcac ctttctgggg gcgggcgcgc ttgccgtcaa
    95641 gacggtgcga gaacatgccc ggggaacgcc gggcccgggc ctgccgctgt ggccccaggt
    95701 gtttctcgga ggccatgtgg cggtggccct gacggagctg tgtcaggcgc ttgcgccctg
    95761 ggaccttacg gacccgctgc tgtttgttca cgccggactg caggtcatca acctcgggtt
    95821 ggtgtttcgg ttttccgagg ttgtcgtgta tgcggcgcta gggggtgccg tgtggatttc
    95881 gttggcgcag gtgctggggc tccggcgtcg cctgcacagg aaggaccccg gggacggggc
    95941 ccggttggcg gcgacgcttc ggggcctctt cttctccgtg tacgcgctgg ggtttggggt
    96001 gggggtgctg ctgtgccctc cggggtcaac gggcgggcgg tcgggcgatt gatatatttt
    96061 tcaataaaag gcattagtcc cgaagaccgc cggtgtgtga tgatttcgcc ataacaccca
    96121 aaccccggat ggggcccggg tataaattcc ggaaggggac acgggctacc ctcactatcg
    96181 agggcgcttg gtcgggaggc cgcatcgaac gcacaccccc atccggtggt ccgtgtggag
    96241 gtcgttttca gtgcccggtc tcgctttgcc gggaacgcta gccgatccct cgcgaggggg
    96301 aggcgtcggg catggccccg gggcgggtgg gccttgccgt ggtcctgtgg agcctgttgt
    96361 ggctcggggc gggggtgtcc gggggctcgg aaactgcctc caccgggccc acgatcaccg
    96421 cgggagcggt gacgaacgcg agcgaggccc ccacatcggg gtcccccggg tcagccgcca
    96481 gcccggaggt cacccccaca tcgaccccaa accccaacaa tgtcacacaa aacaaaacca
    96541 cccccaccga gccggccagc cccccaacaa cccccaagcc cacctccacg cccaaaagcc
    96601 cccccacgtc cacccccgac cccaaaccca agaacaacac cacccccgcc aagtcgggcc
    96661 gccccactaa accccccggg cccgtgtggt gcgaccgccg cgacccattg gcccggtacg
    96721 gctcgcgggt gcagatccga tgccggtttc ggaattccac ccgcatggag ttccgcctcc
    96781 agatatggcg ttactccatg ggtccgtccc ccccaatcgc tccggctccc gacctagagg
    96841 aggtcctgac gaacatcacc gccccacccg ggggactcct ggtgtacgac agcgccccca
    96901 acctaacgga cccccacgtg ctctgggcgg agggggccgg cccgggcgcc gaccctccgt
    96961 tgtattctgt caccgggccg ctgccgaccc agcggctgat tatcggcgag gtgacgcccg
    97021 cgacccaggg aatgtattac ttggcctggg gccggatgga cagcccgcac gagtacggga
    97081 cgtgggtgcg cgtccgcatg ttccgccccc cgtctctgac cctccagccc cacgcggtga
    97141 tggagggtca gccgttcaag gcgacgtgca cggccgccgc ctactacccg cgtaaccccg
    97201 tggagtttgt ctggttcgag gacgaccacc aggtgtttaa cccgggccag atcgacacgc
    97261 agacgcacga gcaccccgac gggttcacca cagtctctac cgtgacctcc gaggctgtcg
    97321 gcggccaggt ccccccgcgg accttcacct gccagatgac gtggcatcgc gactccgtga
    97381 cgttctcgcg acgcaatgcc accgggctgg ccctggtgct gccgcggcca accatcacca
    97441 tggaatttgg ggtccggcat gtggtctgca cggccggctg cgtccccgag ggcgtgacgt
    97501 ttgcctggtt cctgggggac gacccctcac cggcggctaa gtcggccgtt acggcccagg
    97561 agtcgtgcga ccaccccggg ctggctacgg tccggtccac cctgcccatt tcgtacgact
    97621 acagcgagta catctgtcgg ttgaccggat atccggccgg gattcccgtt ctagaacacc
    97681 acggcagtca ccagccccca cccagggacc ccaccgagcg gcaggtgatc gaggcgatcg
    97741 agtgggtggg gattggaatc ggggttctcg cggcgggggt cctggtcgta acggcaatcg
    97801 tgtacgtcgt ccgcacatca cagtcgcggc agcgtcatcg gcggtaacgc aagacccccc
    97861 cgttaccttt ttaatatcta tatagtttgg tcccccctct atcccgccca ccgctgggcg
    97921 ctataaagcc gccaccctct cttccctcag gtcatccttg gtcgatcccg aacgacacac
    97981 ggcgtggagc aaaacgcctc cccctgagcc gctttcctac caacacaacg gcatgcctct
    98041 gcgggcatcg gaacacgcct accggcccct gggccccggg acacccccca tgcgggctcg
    98101 gctccccgcc gcggcctggg ttggcgtcgg gaccatcatc gggggagttg tgatcattgc
    98161 cgcgttggtc ctcgtgccct cgcgggcctc gtgggcactt tccccatgcg acagcggatg
    98221 gcacgagttc aacctcgggt gcatatcctg ggatccgacc cccatggagc acgagcaggc
    98281 ggtcggcggc tgtagcgccc cggcgaccct gatcccccgc gcggctgcca aacagctggc
    98341 cgccgtcgca cgcgtccagt cggcaagatc ctcgggctac tggtgggtga gcggagacgg
    98401 cattcgggcc tgcctgcggc tcgtcgacgg cgtcggcggt attgaccagt tttgcgagga
    98461 gcccgccctt cgcatatgct actatccccg cagtcccggg ggctttgttc agtttgtaac
    98521 ttcgacccgc aacgcgctgg ggctgccgtg aggcgcgtgt actgcggtct gtctcgtctc
    98581 ctcttctccc cttccctccc cctccgcatc ccaggatcac accggtcaac gagggttggg
    98641 ggggtccggc acggacccaa aataataaac acacaatcac gtgcgataaa aagaacacgc
    98701 ggtcccctgt ggtgtttttg gttattttta ttaaatctcg tcgacaaaca gggggaaagg
    98761 ggcgtggtct agcgacggca gcacgggcgg aggcgttcac cggctccggc gtccttcgcg
    98821 tttaagcttg gtcaggaggg cgctcagggc ggcgacgttg gtcgggccgt cgttggtcag
    98881 ggcgttggct cgatggcggg cgaggacggg cgaggggctc aacggcgggg gcgggggccc
    98941 ggtgcggccc gggggggaaa atagggcgga tcccccccag tcgtacaggg gattttccgc
    99001 ctcaatgtac ggggaggccg gcgctgcatt cgccgtgttc acgcagacgt tttcgtagac
    99061 ccgcatccat ggtatttcct cgtagacacg ccccccgtcc tcgctcaccg tctcgtatat
    99121 tgactcgtcg tcctcgtagg gggcgtgccg ttcgcgggcc gaggcggcgt gggtggcttt
    99181 gcggcgggcg tcgtcgtcgt cgtcgtcggc cgtcagatac gtggcttcca tctggtcggg
    99241 ttctccctcc ggggcgggtc cccacacccg tggccgatcg aggctcccca gagacgcgcg
    99301 ccggacgagg agggggcacg tcgccgccgg cggtcgcctg tcgggtcccg cgacgttacg
    99361 ggccgggagg cgcgggggca cctcccccat gtgcgtgtaa tacgtggccg gctgtgtggc
    99421 cgcagcgggg ggctcggcga ccgggtcgtt cgcatccgga agcgggggcc ccgcgccgtc
    99481 cgcgcggcgc ctccggaacc tccgggtgga cgcgggggtc gagtgtaggc gaggtcgggg
    99541 gaggggcggg ggctcgttgt cgcgccgcgc ccgctgaatc ttttcccgac aggtcccacc
    99601 ccccgcgcga tgcccccccg ggccgctggc catgtcgtcc gggggaggcc ccgcggacca
    99661 cgtcgtccgg cgagacgcca cgagccgcag gatggactcg tagtggagcg acggcgcccc
    99721 gttgcggagc agatccgcgg ccagggcggc cccgaaccaa gccttgatgc tcaactccat
    99781 ccgggcccag ctgggggcgg tcatcgtggg gaacaggggg gcggtggtcc gacagaaacg
    99841 ctcctggctg tccaccgcgg cccgcagata ctcgttgttc aggctgtcgg tggcccagac
    99901 gccgtacccg gtgagggtcg cgttgatgat atactgggcg tggtgatgga cgatcgacag
    99961 aacctccacc gtggatacga cggtatccac ggtcccgtac gtaccgccgc tccgcttgcc
   100021 ggtctgccac aggttggcta ggcgcgtcag gtggcccagg acgtcgctga ccgccgccct
   100081 gagcgccatg cactgcatgg agccggtcgt gccgctggga ccccggtcca gatggcgcgc
   100141 gaacgtttcc gcgggcgcct ccgggctgcc gccgagcggg aggaaccggc gattggaggg
   100201 actcagccgg tgacatacgt gcttgtccgt cgtccacagc atccaggacg cccaccggta
   100261 cagcacggag acgtaggcca ggagctcgtt gagccgcagt gcggtgtcgg tgctggggcg
   100321 gcttgggtcc gccgggcgca taaagaacat gtactgctga atccgatgga gggcgtcgcg
   100381 caggccggcc acggtggcgg cgtacttggc cgccacggcc ccgctcttga acggggtgcg
   100441 cgccagcagc tttggcgcca gggtgggccg cagcagcacg tgaaggctgg ggtcgcagtc
   100501 gcccacgggg tcctcgggga cgtccaggcc gctgggcacc accgtctgca ggtacttcca
   100561 gtactgcgtg aggatggcgc ggctcaactg gccgccgggc agctccacct cgcccagcgc
   100621 ctgggtggcg gccgaagcgt agtgccggat gtactcgtag tgcgggtcgc tggcgagccc
   100681 gtccacgatc aaactctcgg gaaccgtgtt gtgttgccgc gcggccaacc ggacgctgcg
   100741 atcggtgcag gtcagaaacg ccggctgcgc gtcgtcggag cgctgccgca aggcgcccac
   100801 ggccgcgcta aggagcccct ccggggtggg gagcagacac ccgccgaaga tgcgccgctc
   100861 gggaacgccc gcgttgtcgc cgcggatcag gttggcaggc gtcaggcacc gcgccagccg
   100921 cagggagctc gcgccgcgcg tccggcgctg catggtgacg cccgttcggt cgggacccgc
   100981 cggtcggagt tatgccgcgt ccagggccat cggggcgctt tttatcggga ggagcttatg
   101041 ggcgtggcgg gcctcccagc ccggtcgcgc gcctccccga cacgtgcgcc cgcagggcgg
   101101 cggccccctc gtctcccatc agcagtttcc taaactggga catgatgtcc accacgcgga
   101161 cccgcgggcc caacacggac ccgccgctta cgggggcggg ggggaagggc tccaggtcct
   101221 tgagaagaaa ggcggggtct gccgtcccgg acacgggggc ccggggcgct gaggaggcgg
   101281 ggcgcagatc cacgtgctcc gcggccgcgc ggacgtccgc ccagaacttg gcgggggtgg
   101341 tgcgcgcgta caggggctgg gtcgctcgga ggacgcacgc gtagcgcagg ggggtgtacg
   101401 tgcccacctc gggggccgtg aatcccccgt caaacgcggc cagtgtcacg cacgccacca
   101461 cggtgtcggc aaagcccagc agccgctgca ggacgagccc ggcggccaga atggcgcgcg
   101521 tggccgccgc gtcgtcccgg cgccggtgcg cgtccccgca cgcccgggcg tactttaagg
   101581 tcacggtcgc cagggccgtg tgcagcgcgt acaccgcagc gcccagcacg gcgttgagcc
   101641 cgctgttggc gagcagccgg cgcgctgcgg tgtcgcccag cgcctcgtgc tcggccccca
   101701 cgaccgcggg gcttcccagg ggcagggcgc gaaacagctc ctcccgcgcc acgtccgcaa
   101761 aggcggggtg gtgcacgtgc gggtgcaggc gcgcccccac gaccaccgag agccactgga
   101821 ccgtctgctc cgccatcacc gccagcacat ccagcacgcg ccccaggaag gcggcctccc
   101881 gcgtcaaaac gcaccggacg gcgtcgggat tgaagcgggc gagcagggcc ccggtggcca
   101941 ggtacgtcat gcggccggca tagcgggcgg ccacgcgaca gtcgcggtcc agcagcgcgc
   102001 gcaccccggg ccagtacagc agggacccca gcgagctgcg gaacaccgcg gcgtcggggc
   102061 cggattgggg ggacactaac ccccccgcgc tcagtaacgg cacggccgcg gccccgacgg
   102121 gacgcaacgc cgtgaggctc gcgaactgcc gcctcagctc ggccgccctg tcgtccaggt
   102181 cagacccgcg cgcctccgcg tgaaggcgcg tcccgcacac ccacccgttg atggccagcc
   102241 gcacgacggc atccgccaaa aagctcatcg cctgggcggg gctggttttt gttcgacgat
   102301 ccgtcaggtc aagaatccca tcgcccgtga tataccaggc caacgcctcg ccctgctgca
   102361 gggtttggcg gaaaaacacc gcggggttgt cgggggaggc gaagtgcatg acccccacgc
   102421 gcgataaccc gaacgcgcta tccggacacg ggtaaaaccc ggccggatgc cccagggcta
   102481 gggcggagcg cacggactcg tcccacacgg caacctgagg ggccagtcga tccaacggga
   102541 atgccgcccg gagctccggg cccggcacgc gtccctccag aacctccacc ttgggcgggg
   102601 aacgggcccc gccgccgtcc tccggcccga cggcttccgg gtagtcgtcc tcctcgtact
   102661 gcagctcctc taggaacagc ggcgacggcg ccacccgcga accgccgacc cgccccaaaa
   102721 tagcccgcgc gtcgacggga cccaggtatc ccccctgccg ggcctgcgga ggaccgcggg
   102781 gaacctcatc atcatcgtcc aggcgaccgc gcaccgactg gctacgggcc gcatcgggcc
   102841 cggggcgctg ccgggacgct cggcgatggg atgtgggcgg ggcttccgac gcgcgccgtc
   102901 gtcgggctcg cgggccttcc cgtcgacggc gcacgggcgg ctcgtcgccc gccatctcct
   102961 ccagagcctc tagctcgctg tcgtcatccc cgcggaacac cgcacgcagg taccccatga
   103021 accccacccc atcgcccgct ggctcgtccg ccacgggcga ggcgcggggg cgggtggatg
   103081 cgcgcctcct gcgccccgcg ggttcgcgag ccgacatggt ggcgatagac gcgggttatc
   103141 ggatgtccgc taccccccaa aaaagaaaaa gaccccacag cgcggatgga ggccggggta
   103201 ggtgccgccg gaccccctcg cgatgggaat ggacgggagc gacggggccg gcgcaaaaaa
   103261 acgcagtatc tcccgcgaag gctacccgcc gccccagccc ccggccaaat gcggaaacgg
   103321 tcccgcgctc tcgcctttat acgcgggccg ccctgcgaca caatcacccg tccgtggttt
   103381 cgaatctaca cgacaggccc gcagacgcgg ctaacacaca cgccggcaac ccagacccca
   103441 gtgggttggt tgcgcggtcc cgtctcctgg ctagttcttt cccccaccac caaataatca
   103501 gacgacaacc gcaggttttg taatgtatgt gctcgtgttt attgtggata cgaaccggtg
   103561 acgggagggg aaaacccaga cgggggatgc gggtccggtc gcgcccccta cccaccgtac
   103621 tcgtcaattc caagggcatc ggtaaacatc tgctcaaact cgaagtcggc catatccaga
   103681 gcgccgtagg gggcggagtc gtggggggta aatcccggcc ccggggaatc cccgtccccc
   103741 aacatgtcca gatcgaaatc gtctagcgcg tcggcatgcg ccatcgccac gtcctcgccg
   103801 tctaagtgga gctcgtcccc caggctgaca tcggtcgggg gggccgtcga cagtctgcgc
   103861 gtgtgtcccg cggggagaaa ggacaggcgc ggagccgcca gccccgcctc ttcgggggcg
   103921 tcgtcgtccg ggagatcgag caggccctcg atggtagacc cgtaattgtt tttcgtacgc
   103981 gcgcggctgt acgcgtgttc ccgcatgacc gcctcggagg gcgaggtcgt gaagctggaa
   104041 tacgagtcca acttcgcccg aatcaacacc ataaagtacc cagaggcgcg ggcctggttg
   104101 ccatgcaggg tgggaggggt cgtcaacggc gcccctggct cctccgtagc cgcgctgcgc
   104161 accagcggga ggttaaggtg ctcgcgaatg tggtttagct cccgcagccg gcgggcctcg
   104221 attggcactc cccggacggt gagcgctccg ttgacgaaca tgaagggctg gaacagaccc
   104281 gccaactgac gccagctctc caggtcgcaa cagaggcagt caaacaggtc gggccgcatc
   104341 atctgctcgg cgtacgcggc ccataggatc tcgcgggtca aaaatagata caaatgcaaa
   104401 aacaaaacac gcgccagacg agcggtctct cggtagtacc tgtccgcgat cgtggcgcgc
   104461 agcatttctc ccaggtcgcg atcgcgtccg cgcatgtgcg cctggcggtg cagctgccgg
   104521 acgctggcgc gcaggtaccg gtacagggcc gagcagaagt tggccaacac ggttcgatag
   104581 ctctcctccc gcgcccgtag ctcggcgtgg aagaaacgag agagcgcttc gtagtagagc
   104641 ccgaggccgt cgcgggtggc cggaagcgta gggaaggcca cgtcgccgtg ggcgcgaatg
   104701 tcgatttggg tgcgttcggg gacgtacgcg tccccccatt ccaccacatc gctgggcagc
   104761 gttgatagga atttacactc ccggtacagg tcggcgttgg tcggtagcgc cgaaaacaga
   104821 tcctcgttcc aggtatcgag catggtacat agcgcggggc ccgcgctaaa gcccaagtcg
   104881 tcgaggagac ggttaaagag ggcggcgggg gggacgggca tgggtgggga gggcatgagc
   104941 tgggcctggc tcaggcgccc cgttgcgtac agcggggggg ccgccggggt gtttttggga
   105001 cccccggccg ggcggggggg cggtggcgaa gcgccgtccg cgttcatgtc ggcaaacagc
   105061 tcgtcgacca agaggtccat tgggtggggt tgatacggga aagacgatat cgggcttttg
   105121 atgcgatcgt ccccgcccgc ccagagagtg tgggacgccc gacggcgcgg gaagagaaaa
   105181 cccccaaacg cgttagagga ccggacggac cttatggggg gaagtgggca gcgggaaccc
   105241 cgtccgttcc cgaggaatga cagcccgtgg tcgccaccac gcatttaagc aacccgcacg
   105301 ggccgccccg tacctcgtga cttcccccca cattggctcc tgtcacgtga aggcgaaccg
   105361 agggcggctg tccaacccac cccccgccac ccagtcccgg tccccgtcgg attgggaaac
   105421 aaaggcacgc aacgccaaca ccgaatgaac ccctgttggt gctttattgt ctgggtacgg
   105481 aagttttcac tcgacgggcc gtctggggcg agaagcggag cgggctgggg ctcgaggtcg
   105541 ctcggtgggg cgcgacgccg cagaacgccc tcgagtcgcc gtggccgcgt cgacgtcctg
   105601 caccacgtct ggattcacca actcgttggc gcgctgaagc aggtttttgc cctcgcagac
   105661 cgtcacgcgg atggtggtga tgccaaggag ttcgttgagg tcttcgtctg tgcgcggacg
   105721 cgacatgtcc cagagctgga ccgccgccat ccgggcatgc atggccgcca ggcgcccgac
   105781 cgcggcgcag aagacgcgct tgttaaagcc ggccacccgg ggggtccatg gcgcgtcggg
   105841 gtttgggggg gcggtgctaa agtgcagctt tctggccagc ccctgcgcgg gtgtcttgga
   105901 tcgggttggc gccgtcgacg cgggggcgtc tgggagtgcg gcggattctg gctgggccga
   105961 tttcctgccg cgggtggtct ccgccgccgg ggccgcgggg gccttagtcg ccacccgctg
   106021 ggttcggggg gcccgggggg cggtggtggg tgtgcgtccg gcccctccgg acccagcggg
   106081 tggcggaggc gcccgcgcag gccccgggcc ggacaaaacc gccccggaaa cgggacgccg
   106141 cgtccggggg acctccgggt gttcgtcgtc ttcggatgac gagcccccgt agagggcata
   106201 atccgactcg tcgtactgga cgaaacggac ctcgcccctc tggcgcgagc gtgtctgtag
   106261 ggcgccacgg cgggaggtgt caggcggact atcgggactc gccatacctg aagacggggt
   106321 gtagtacaga tcctcgtact catcgcgcgg aacctcccgc ggacccgact tcacggagcg
   106381 gcgagaggtc atggttccac gaacacgcta gggtcggatg cgcggacaat taggcctggg
   106441 ttcggacggc gggggtggtg caggtgtgga gaggtcgagc gataggggcg gcccgggaga
   106501 gaagagaggg tccgcaaaac ccactgggga tgcgtgagtg gccctctgtg ggcggtgggg
   106561 gagagtctta taggaagtgc atataaccac aacccatggg tctaaccaat ccccaggggc
   106621 caagaaacag acacgcccca aacggtctcg gtttccgcga ggaaggggaa gtcctgggac
   106681 accctccacc cccacccctc accccacaca gggcgggttc aggcgtgccc ggcagccagt
   106741 agcctctggc agatctgaca gacgtgtgcg ataatacaca cgcccatcga ggccatgcct
   106801 acataaaagg gcaccagggc ccccggggca gacatttggc cagtgttttg ggtctcgcac
   106861 cgcgcgcccc cgatcccatc gcgcccgccc tcctcgccgg gcggctcccc gcgcgggccc
   106921 gcgtctcccg ccgctaaggc gacgagcaag acaaacaaca ggcccgcccg acagaccctt
   106981 ctgggggggc ccatcgtccc taacaggaag atgagtcagt ggggatccgg ggcgatcctt
   107041 gtccagccgg acagcttggg tcgggggtac gatggcgact ggcacacggc cgtcgctact
   107101 cgcgggggcg gagtcgtgca actgaacctg gtcaacaggc gcgcggtggc ttttatgccg
   107161 aaggttagcg gggactccgg atgggccgtc gggcgcgtct ctctggacct gcgaatggct
   107221 atgccggctg acttttgcgc gattattcac gcccccgcgc tagccagccc cgggcaccac
   107281 gtaatactgg gtcttatcga ctcggggtac cgcggaaccg ttatggccgt ggtcgtagcg
   107341 cctaaaagga cgcgggaatt tgcccccggg accctgcggg tcgacgtgac gttcctggac
   107401 atcctggcga cccccccggc cctcaccgag ccgatttccc tgcggcagtt cccgcaactg
   107461 gcgccccccc ctccaaccgg ggccgggata cgcgaagatc cttggttgga gggggcgctc
   107521 ggggccccaa gcgtgactac ggccctaccg gcgcgacgcc gagggcggtc cctcgtctat
   107581 gccggcgagc tgacgccggt tcagacggaa cacggggacg gcgtacgaga agccatcgcc
   107641 ttccttccaa aacgcgagga ggatgccggt ttcgacattg tcgtccgtcg cccggtcacc
   107701 gtcccggcaa acggcaccac ggtcgtgcag ccatccctcc gcatgctcca cgcggacgcc
   107761 gggcccgcgg cctgctatgt gttggggcgg tcgtcgctca acgcccgcgg cctcctggtc
   107821 gttcctacgc gctggctccc cgggcacgta tgtgcgtttg ttgtttacaa ccttacgggg
   107881 gttcctgtga ccctcgaggc cggcgccaag gtcgcccagc tcctggttgc gggggcggac
   107941 gctcttcctt ggatcccccc ggacaacttt cacgggacca aagcgcttcg aaactacccc
   108001 aggggtgttc cggactcaac cgccgaaccc aggaacccgc cgctcctggt gtttacgaac
   108061 gagtttgacg cggaggcccc cccgagcgag cgcgggaccg ggggttttgg ctctaccggt
   108121 atttagccca cagctttggg ttcgttccgg gcaataaaaa acgtttgtat cgcatctttc
   108181 ctgtgtgtag ttgtttatgt tggatgcctg tgggtctatc acacccgccc ctccatccca
   108241 caaacacaaa acacacgggt tggatgaaaa cacgcattta ttgacccaaa acacacggag
   108301 ctgctcgaga tgggccaggg cgaggtgcgg ttggggaggc tgtaggtctg ggaacggaca
   108361 cgcggggaca cgattccggt ttggggtccg ggagggcgtc gccgtttcgg gcggcaggcg
   108421 ccagcgtaac ctccgggggc ggcgtgtggg ggtgccccaa ggagggcgcc tcggtcaccc
   108481 caatcccccc cgaccgggtt cccccggcaa ccccgaaggc ggagaggcca agggcccgtt
   108541 cggcgatggc cacatcctcc atgaccacgt cactctcggc catgctccga atagcctggg
   108601 agacgagcac atccgcggac ttgtcagccg cccccacgga catgtacatc tgcaggatgg
   108661 tggccataca cgtgtccgcc aggcgccgca tcttgtcctg atgggccgcc acggccccgt
   108721 cgatcgtggg ggcctcgagc ccggggtggt ggcgcgccag tcgttctagg ttcaccatgc
   108781 aggcgtggta cgtgcgggcc aaggcgcggg ccttcacgag gcgtcgggtg tcgtccaggg
   108841 accccagggc gtcatcgagc gtgatggggg cgggaagtag cgcgttaacg accgccaggg
   108901 cctcctgcag ccgcggctcc gcctccgagg gcggaacggc cgcgcggatc atctcatatt
   108961 gttcctcggg gcgcgctccc cagccacata tagccccgag aagagaagcc atcgcgggcg
   109021 ggtactggcc cttgggcgcg cggacgcaat ggggcaggaa gacgggaacc gcggggagag
   109081 gcgggcggcc gggactcccg tggaggtgac cgcgctttat gcgaccgacg ggtgcgttat
   109141 tacctcttcg atcgccctcc tcacaaactc tctactgggg gccgagccgg tttatatatt
   109201 cagctacgac gcatacacgc acgatggccg tgccgacggg cccacggagc aagacaggtt
   109261 cgaagagagt cgggcgctct accaagcgtc gggcgggcta aatggcgact ccttccgagt
   109321 aaccttttgt ttattgggga cggaagtggg tgggacccac caggcccgcg ggcgaacccg
   109381 acccatgttc gtctgtcgct tcgagcgagc ggacgacgtc gccgcgctac aggacgccct
   109441 ggcgcacggg accccgctac aaccggacca catcgccgcc accctggacg cggaggccac
   109501 gttcgcgctg catgcgaaca tgatcctggc tctcaccgtg gccatcaaca acgccagccc
   109561 ccgcaccgga cgcgacgccg ccgcggcgca gtatgatcag ggcgcgtccc tacgctcgct
   109621 cgtggggcgc acgtccctgg gacaacgcgg ccttaccacg ctatacgtcc accacgaggt
   109681 gcgcgtgctt gccgcgtacc gcagggcgta ttatggaagc gcgcagagtc ccttctggtt
   109741 tcttagcaaa ttcgggccgg acgaaaaaag cctggtgctc accactcggt actacctgct
   109801 tcaggcccag cgtctggggg gcgcgggggc cacgtacgac ctgcaggcca tcaaggacat
   109861 ctgcgccacc tacgcgattc cccacgcccc ccgccccgac accgtcagcg ctgcgtccct
   109921 gacctcgttt gccgccatca cgcggttctg ttgcacgagc cagtacgccc gcggggccgc
   109981 ggcggccggg tttccgcttt acgtggagcg ccgtattgcg gccgacgtcc gcgagaccag
   110041 tgcgctggag aagttcataa cccacgatcg cagttgcctg cgcgtgtccg accgtgaatt
   110101 cattacgtac atctacctgg cccattttga gtgtttcagc cccccgcgcc tagccacgca
   110161 tcttcgggcc gtgacgaccc acgaccccaa ccccgcggcc agcacggagc agccctcgcc
   110221 cctgggcagg gaggccgtgg aacaattttt ttgtcacgtg cgcgcccaac tgaatatcgg
   110281 ggagtacgtc aaacacaacg tgaccccccg ggagaccgtc ctggatggcg atacggccaa
   110341 ggcctacctg cgcgctcgca cgtacgcgcc cggggccctg acgcccgccc ccgcgtattg
   110401 cggggccgtg gactccgcca ccaaaatgat ggggcgtttg gcggacgccg aaaagctcct
   110461 ggtcccccgc gggtggcccg cgtttgcgcc cgccagtccc ggggaggaca cggcgggcgg
   110521 cacgccgccc ccacagacct gcggaattgt caagcgcctc ctgagactgg ccgccacgga
   110581 acagcagggc cccacacccc cggcgatcgc ggcgcttatc cgtaatgcgg cggtgcagac
   110641 tcccctgccc gtctaccgga tatccatggt ccccacggga caggcatttg ccgcgctggc
   110701 ctgggacgac tgggcccgca taacgcggga cgctcgcctg gccgaagcgg tcgtgtccgc
   110761 cgaagcggcg gcgcaccccg accacggcgc gctgggcagg cggctcacgg atcgcatccg
   110821 cgcccagggc cccgtgatgc cccctggcgg cctggatgcc ggggggcaga tgtacgtgaa
   110881 tcgcaacgag atattcaacg gcgcgctggc aatcacaaac atcatcctgg atctcgacat
   110941 cgccctgaag gagcccgtcc cctttcgccg gctccacgag gccctgggcc actttaggcg
   111001 cggggctctg gctgcggttc agctcctgtt tcccgcggcc cgcgtggacc ccgacgcata
   111061 tccctgttat tttttcaaaa gcgcatgtcg gcccggcccg gcgtccgtgg gttccggcag
   111121 cggactcggc aacgacgacg acggggactg gtttccctgc tacgacgacg ccggtgatga
   111181 ggagtgggcg gaggacccgg gcgccatgga cacatcccac gatcccccgg acgacgaggt
   111241 tgcctacttt gacctgtgcc acgaagtcgg ccccacggcg gaacctcgcg aaacggattc
   111301 gcccgtgtgt tcctgcaccg acaagatcgg actgcgggtg tgcatgcccg tccccgcccc
   111361 gtacgtcgtc cacggttctc taacgatgcg gggggtggca cgggtcatcc agcaggcggt
   111421 gctgttggac cgagattttg tggaggccat cgggagctac gtaaaaaact tcctgttgat
   111481 cgatacgggg gtgtacgccc acggccacag cctgcgcttg ccgtattttg ccaaaatcgc
   111541 ccccgacggg cctgcgtgcg gaaggctgct gccagtgttt gtgatccccc ccgcctgcaa
   111601 agacgttccg gcgtttgtcg ccgcgcacgc cgacccgcgg cgcttccatt ttcacgcccc
   111661 gcccacctat ctcgcttccc cccgggagat ccgtgtcctg cacagcctgg gtggggacta
   111721 tgtgagcttc tttgaaagga aggcgtcccg caacgcgctg gaacactttg ggcgacgcga
   111781 gaccctgacg gaggtcctgg gtcggtacaa cgtacagccg gatgcggggg ggaccgtcga
   111841 ggggttcgca tcggaactgc tggggcggat agtcgcgtgc atcgaaaccc actttcccga
   111901 acacgccggc gaatatcagg ccgtatccgt ccggcgggcc gtcagtaagg acgactgggt
   111961 cctcctacag ctagtccccg ttcgcggtac cctgcagcaa agcctgtcgt gtctgcgctt
   112021 taagcacggc cgggcgagtc gcgccacggc gcggacattc gtcgcgctga gcgtcggggc
   112081 caacaaccgc ctgtgcgtgt ccttgtgtca gcagtgcttt gccgccaaat gcgacagcaa
   112141 ccgcctgcac acgctgttta ccattgacgc cggcacgcca tgctcgccgt ccgttccctg
   112201 cagcacctct caaccgtcgt cttgataacg gcgtacggcc tcgtgctcgt gtggtacacc
   112261 gtcttcggtg ccagtccgct gcaccgatgt atttacgcgg tacgccccac cggcaccaac
   112321 aacgacaccg ccctcgtgtg gatgaaaatg aaccagaccc tattgtttct gggggccccg
   112381 acgcaccccc ccaacggggg ctggcgcaac cacgcccata tctgctacgc caatcttatc
   112441 gcgggtaggg tcgtgccctt ccaggtccca cctgacgcca tgaatcgtcg gatcatgaac
   112501 gtccacgagg cagttaactg tctggagacc ctatggtaca cacgggtgcg tctggtggtc
   112561 gtagggtggt tcctgtatct ggcgttcgtc gccctccacc aacgccgatg tatgtttggc
   112621 gtcgtgagtc ccgcccacaa gatggtggcc ccggccacct acctcttgaa ctacgcaggc
   112681 cgcatcgtat cgagcgtgtt cctgcagtac ccctacacga aaattacccg cctgctctgc
   112741 gagctgtcgg tccagcggca aaacctggtt cagttgtttg agacggaccc ggtcaccttc
   112801 ttgtaccacc gccccgccat cggggtcatc gtaggctgcg agttgatgct acgctttgtg
   112861 gccgtgggtc tcatcgtcgg caccgctttc atatcccggg gggcatgtgc gatcacatac
   112921 cccctgtttc tgaccatcac cacctggtgt tttgtctcca ccatcggcct gacagagctg
   112981 tattgtattc tgcggcgggg cccggccccc aagaacgcag acaaggccgc cgccccgggg
   113041 cgatccaagg ggctgtcggg cgtctgcggg cgctgctgtt ccatcatcct ctcgggcatc
   113101 gcagtgcgat tgtgttatat cgccgtggtg gccggggtgg tgctcgtggc gcttcactac
   113161 gagcaggaga tccagaggcg cctgtttgat gtatgacgtc acatccaggc cggcggaaac
   113221 cgtaacggca tatgcaaatt ggaaactgtc ctgtcttggg gcccacccac ccgacgcgtc
   113281 atatgcaaat gaaaatcggt cccccgaggc cacgtgtagc ctggatccca acgaccccgc
   113341 ccatgggtcc caattggccg tcccgttacc aagaccaacc cagccagcgt atccaccccc
   113401 gcccgggtcc ccgcggaagc ggaacggggt atgtgatatg ctaattaaat acatgccacg
   113461 tacttatggt gtctgattgg tccttgtctg tgccggaggt ggggcggggg ccccgcccgg
   113521 ggggcggaac gaggaggggt ttgggagagc cggccccggc accacgggta taaggacatc
   113581 caccacccgg ccggtggtgg tgtgcagccg tgttccaacc acggtcacgc ttcggtgcct
   113641 ctccccgatt cgggcccggt cgctcgctac cggtgcgcca ccaccagagg ccatatccga
   113701 caccccagcc ccgacggcag ccgacagccc ggtcatggcg actgacattg atatgctaat
   113761 tgacctcggc ctggacctct ccgacagcga tctggacgag gacccccccg agccggcgga
   113821 gagccgccgc gacgacctgg aatcggacag cagcggggag tgttcctcgt cggacgagga
   113881 catggaagac ccccacggag aggacggacc ggagccgata ctcgacgccg ctcgcccggc
   113941 ggtccgcccg tctcgtccag aagaccccgg cgtacccagc acccagacgc ctcgtccgac
   114001 ggagcggcag ggccccaacg atcctcaacc agcgccccac agtgtgtggt cgcgcctcgg
   114061 ggcccggcga ccgtcttgct cccccgagca gcacgggggc aaggtggccc gcctccaacc
   114121 cccaccgacc aaagcccagc ctgcccgcgg cggacgccgt gggcgtcgca ggggtcgggg
   114181 tcgcggtggt cccggggctg ccgatggttt gtcggacccc cgccggcgtg cccccagaac
   114241 caatcgcaac cctgggggac cccgccccgg ggcggggtgg acggacggcc ccggcgcccc
   114301 ccatggcgag gcgtggcgcg gcagtgagca gcccgaccca cccggaggcc agcggacacg
   114361 gggcgtgcgc caagcacccc ccccgctaat gacgctggcg attgcccccc cgcccgcgga
   114421 cccccgcgcc ccggccccgg agcgaaaggc gcccgccgcc gacaccatcg acgccaccac
   114481 gcggttggtc ctgcgctcca tctccgagcg cgcggcggtc gaccgcatca gcgagagctt
   114541 tggccgcagc gcacaggtca tgcacgaccc ctttgggggg cagccgtttc ccgccgcgaa
   114601 tagcccctgg gccccggtgc tggcgggcca aggagggccc tttgacgccg agaccagacg
   114661 ggtctcctgg gaaaccttgg tcgcccacgg cccgagcctc tatcgcactt ttgccggcaa
   114721 tcctcgggcc gcatcgaccg ccaaggccat gcgcgactgc gtgctgcgcc aagaaaattt
   114781 catcgaggcg ctggcctccg ccgacgagac gctggcgtgg tgcaagatgt gcatccacca
   114841 caacctgccg ctgcgccccc aggaccccat tatcgggacg gccgcggctg tgctggataa
   114901 cctcgccacg cgcctgcggc cctttctcca gtgctacctg aaggcgcgag gcctgtgcgg
   114961 cctggacgaa ctgtgttcgc ggcggcgtct ggcggacatt aaggacattg catccttcgt
   115021 gtttgtcatt ctggccaggc tcgccaaccg cgtcgagcgt ggcgtcgcgg agatcgacta
   115081 cgcgaccctt ggtgtcgggg tcggagagaa gatgcatttc tacctccccg gggcctgcat
   115141 ggcgggcctg atcgaaatcc tagacacgca ccgccaggag tgttcgagtc gtgtctgcga
   115201 gttgacggcc agtcacatcg tcgccccccc gtacgtgcac ggcaaatatt tttattgcaa
   115261 ctccctgttt taggtacaat aaaaacaaaa catttcaaac aaatcgcccc tcgtgttgtc
   115321 cttctttgct catggccggc ggggcgtggg tcacggcaga tggcgggggt gggcccggcg
   115381 tacggcctgg gtgggcggag ggaactaacc caacgtataa atccgtcccc gttccaaggc
   115441 cggtgtcata gtgcccttag gagcttcccg cccgggcgca tccccccttt tgcactatga
   115501 cagcgacccc cctcaccaac ctgttcttac gggccccgga cataacccac gtggcccccc
   115561 cttactgcct caacgccacc tggcaggccg aaacggccat gcacaccagc aaaacggact
   115621 ccgcttgcgt ggccgtgcgg agttacctgg tccgcgcctc ctgtgagacc agcggcacaa
   115681 tccactgctt tttctttgcg gtatacaagg acacccacca cacccctccg ctgattaccg
   115741 agctccgcaa ctttgcggac ctggttaacc acccgccggt cctacgcgaa ctggaggata
   115801 agcgcggggt gcggctgcgg tgtgcgcggc cgtttagcgt cgggacgatt aaggacgtct
   115861 ctgggtccgg cgcgtcctcg gcgggagagt acacgataaa cgggatcgtg taccactgcc
   115921 actgtcggta tccgttctca aaaacatgct ggatgggggc ctccgcggcc ctacagcacc
   115981 tgcgctccat cagctccagc ggcatggccg cccgcgcggc agagcatcga cgcgtcaaga
   116041 ttaaaattaa ggcgtgatct ccaacccccc catgaatgtg tgtaaccccc cccaaaaaaa
   116101 taaagagccg taacccaacc aaaccaggcg tggtgtgagt ttgtggaccc aaagccctca
   116161 gagacaacgc gacaggccag tatggaccgt gatactttta tttattaact cacaggggcg
   116221 cttaccgcca caggaatacc agaataatga ccaccacaat cgcgaccacc ccaaatacag
   116281 catggcgcca caccacgcca caacagccct gtcgccggta tggggcatga tcagacgagc
   116341 cgcgcgccgc gcgttgggcc ctgtacagct cgcgcgaatt gaccctagga ggccgccacg
   116401 cgcccgagtt ttgcgttcgt cgctggtcgt cgggcgccaa agccccggac ggctgttcgg
   116461 tcgaacgaac ggccacgaca gtggcatagg ttggggggtg gtccgacata gcctcggcgt
   116521 acgtcgggag gcccgacaag aggtcccttg tgatgtcggg tggggccaca agcctggttt
   116581 ccggaagaaa caggggggtt gccaataacc cgccagggcc aaaactccgg cgctgcgcac
   116641 gtcgttcggc gcggcgccgg gcgcgccgag cggctcgctg ggcggcttgg cgtgagcggc
   116701 cccgctccga cgcctcgccc tctccggagg aggttggcgg aattggcacg gacaacaggg
   116761 gcccagcaga gtacggtgga ggtgggtccg tgggggtgtc cagatcaata acgacaaacg
   116821 gcccctcgtt cctaccagac aagctatcgt aggggggcgg gggatcagca aacgcgttcc
   116881 ccgcgctcca taaacccgcg tcgggttgcg ccgcctccga agccatggat gcgccccaaa
   116941 gccacgactc ccgcgcgcta ggtccttggg gtaatggaaa aggccctact ccccatccaa
   117001 gccagccaag ttaacgggct acgccttcgg gaatgggact ggcaccccgg cggattttgt
   117061 tgggctggca tgcgtcgccc aaccgagggc cgcgtccacg ggacgcgcct tttataaccc
   117121 cgggggtcat tcccaacgat cacatgcaat ctaactggct cccctctccc cccctctccc
   117181 ctctcccccc ctctcccctc tccccccctc tcccctctcc ccccctctcc cctctccccc
   117241 cctctcccct ctccccccct ctcccctctc cccccctctc ccctctcccc ccctctcccc
   117301 tctccccccc tctcccctct ccccccctct cccctctccc ctctgctctt tccccgtgac
   117361 acccgacgct gggggcgtgg ctgccgggag gggccgcgga tgggcgggcc tacttggtct
   117421 cccgcccccc cccccccccc ccgaaccgcc ccgccggctt tgcccccctt tgatcccctg
   117481 ctacccccaa cccgtgctgg tggtgcgggt tgggggggga tgtgggcggg ggtgcgcggg
   117541 aggtgtcggt ggtggtggtg gtggtggtag taggaatggt ggtgaggggg ggggggcgct
   117601 ggttggtcaa aaaagggagg gacgggggcc ggcagaccga cggcgacaac gctccccggc
   117661 ggccgggtcg cggctcttac gagcggcccg gcccgcgctc ccaccccccg ggccgtgtcc
   117721 ttgctttccc cccgtctccc ccccccccgc cttctcctcc tcctcctcgt ttttccaaac
   117781 cccgcccacc cggcccggcc cggcccggcc cggcccggcc accgccgccc acccacccac
   117841 ctcgggatac ccagccccgg tcccccgttc cccgggggcc gttatctcca gcgccccgtc
   117901 cggcgcgccg ccccccgccg ctaaacccca tcccgccccc gggaccccac atataagccc
   117961 ccagccacac gcaagaacag acacgcagaa cggctgtgtt tatttaaata aaccaatgtc
   118021 ggaataaaca aacacaaaca cccgcgacgg ggggacggag gggacggagg gagggggtga
   118081 cgggggacgg gaacagacac aaaaacaacc acaaaaaaca accacccacc gacaccccca
   118141 ccccagtctc ctcgccttct cccacccacc ccacgccccc actgagcccg gtcgatcgac
   118201 gagcaccccc gcccacgccc ccgcccctgc cccggcgacc cccggcccgc acgatcccga
   118261 caacaataac aaccccaacg gaaagcggcg gggtgttggg ggaggcgagg aacaaccgag
   118321 gggaacgggg gatggaagga cgggaagtgg aagtcctgat acccatccta cacccccctg
   118381 ccttccaccc tccggccccc cgcgagtcca cccgccggcc ggctaccgag accgaacacg
   118441 gcggccgccg cagccgccgc agccgccgcc gacaccgcag agccggcgcg cgcactcaca
   118501 agcggcagag gcagaaaggc ccagagtcat tgtttatgtg gccgcgggcc agcagacggc
   118561 ccgcgacacc ccccccccgc ccgtgtgggt atccggcccc ccgccccgcg ccggtccatt
   118621 aagggcgcgc gtgcccgcga gatatcaatc cgttaagtgc tctgcagaca ggggcaccgc
   118681 gcccggaaat ccattaggcc gcagacgagg aaaataaaat tacatcacct acccacgtgg
   118741 tgctgtggcc tgtttttgct gcgtcatctc agcctttata aaagcggggg cgcggccgtg
   118801 ccgatcgcgg gtggtgcgaa agactttccg ggcgcgtccg ggtgccgcgg ctctccgggc
   118861 ccccctgcag ccggggcggc caaggggcgt cggcgacatc ctccccctaa gcgccggccg
   118921 gccgctggtc tgttttttcg ttttccccgt ttcgggggtg gtgggggttg cggtttctgt
   118981 ttctttaacc cgtctggggt gtttttcgtt ccgtcgccgg aatgtttcgt tcgtctgtcc
   119041 cctcacgggg cgaaggccgc gtacggcccg ggacgagggg cccccgaccg cggcggtccg
   119101 ggccccgtcc ggacccgctc gccggcacgc gacgcgaaaa aggccccccg gaggcttttc
   119161 cgggttcccg gcccggggcc tgagatgaac actcggggtt accgccaacg gccggccccc
   119221 gtggcggccc ggcccggggc cccggcggac ccaaggggcc ccggcccggg gccccacaac
   119281 ggcccggcgc atgcgctgtg gttttttttt cctcggtgtt ctgccgggct ccatcgcctt
   119341 tcctgttctc gcttctcccc ccccccttct tcacccccag taccctcctc cctcccttcc
   119401 tcccccgtta tcccactcgt cgagggcgcc ccggtgtcgt tcaacaaaga cgccgcgttt
   119461 ccaggtaggt tagacacctg cttctcccca atagaggggg gggacccaaa cgacaggggg
   119521 cgccccagag gctaaggtcg gccacgccac tcgcgggtgg gctcgtgtta cagcacacca
   119581 gcccgttctt ttccccccct cccaccctta gtcagactct gttacttacc cgtccgacca
   119641 ccaactgccc ccttatctaa gggccggctg gaagaccgcc agggggtcgg ccggtgtcgc
   119701 tgtaaccccc cacgccaatg acccacgtac tccaagaagg catgtgtccc accccgcctg
   119761 tgtttttgtg cctggctctc tatgcttggg tcttactgcc tggggggggg gagtgcgggg
   119821 gagggggggt gtggaaggaa atgcacggcg cgtgtgtacc ccccctaaag ttgttcctaa
   119881 agcgaggata cggaggagtg gcgggtgccg ggggaccggg gtgatctctg gcacgcgggg
   119941 gtgggaaggg tcgggggagg gggggatgga gtaccggccc acctggccgg cgcgggtgcg
   120001 cgtgcctttg cacaccaacc ccacgtcccc cggcggtctc taagaagcac cgccccccct
   120061 ccttcatacc accgagcatg cctgggtgtg ggttggtaac caacacgccc atcccctcgt
   120121 ctcctgtgat tctctggctg caccgcattc ttgttttcta actatgttcc tgtttctgtc
   120181 tccccccccc ccacccctcc gccccacccc ccaacaccca cgtctgtggt gtggccgacc
   120241 cccttttggg cgccccgtcc cgccccgcca cccctcccat cctttgttgc cctatagtgt
   120301 agttaacccc ccccgccctt tgtggcggcc agaggccagg tcagtccggg cgggcaggcg
   120361 ctcgcggaaa cttaacaccc acacccaacc cactgtggtt ctggctccat gccagtggca
   120421 ggatgctttc ggggatcggt ggtcaggcag cccgggccgc ggctctgtgg ttaacaccag
   120481 agcctgccca acatggcacc cccactccca cgcaccccca ctcccacgca cccccactcc
   120541 cacgcacccc cactcccacg cacccccact cccacgcacc cccactccca cgcaccccca
   120601 ctcccacgca cccccactcc cacgcacccc cactcccacg catccccgcg atacatccaa
   120661 cacagacagg gaaaagatac aaaagtaaac ctttatttcc caacagacag caaaaatccc
   120721 ctgagttttt ttttattagg gccaacacaa aagacccgct ggtgtgtggt gcccgtgtct
   120781 ttcacttttc ccctccccga cacggattgg ctggtgtagt gggcgcggcc agagaccacc
   120841 cagcgcccga cccccccctc cccacaaaca cggggggcgt cccttattgt tttccctcgt
   120901 cccgggtcga cgccccctgc tccccggacc acgggtgccg agaccgcagg ctgcggaagt
   120961 ccagggcgcc cactagggtg ccctggtcga acagcatgtt ccccacgggg gtcatccaga
   121021 ggctgttcca ctccgacgcg ggggccgtcg ggtactcggg gggcatcacg tggttacccg
   121081 cggtctcggg gagcagggtg cggcggctcc agccggggac cgcggcccgc agccgggtcg
   121141 ccatgtttcc cgtctggtcc accaggacca cgtacgcccc gatgttcccc gtctccatgt
   121201 ccaggatggg caggcagtcc cccgtgatag tcttgttcac gtaaggcgac agggcgacca
   121261 cgctagagac ccccgagatg ggcaggtagc gcgtgaggcc gcccgcgggg acggccccgg
   121321 aagtctccgc gtggcgcgtc ttccgggcac acttcctcgg cccccgcggc ccagaagcag
   121381 cgcgggggcc gagggaggtt tcctcttgtc tccctcccag ggcaccgacg gccccgcccg
   121441 aggaggcgga agcggaggag gacgcggccc cggcggcgga agaggcggcc cccgcggggg
   121501 tcggggccga ggaggaagag gcagaggagg aagaggcgga ggccgccgag gacgtcaggg
   121561 gggtcccggg cccaccctgg ccgcgccccc ccggccctga gtcggagggg gggtgcgtcg
   121621 ccgccctctt ggcccctgcc ggcgcgaggg ggggacgcgt ggactggggg gaggggtttt
   121681 cctggcccga cccgcgcctc ttcctcggac gcaccgccgc ctcctgctcg acagaggcgg
   121741 cggaggggag cggggcggcg ccggaggggg cggcgccgcg ggagggcccg tgcccaccct
   121801 ccacgcccgg cccccccgag ccgcgcgcca ccgtcgcacg cgcccggcac agactctgtt
   121861 cttggttcgc ggcctgagcc agggacgagt gcgactgggg cacacggcgc gcgtccgcgg
   121921 ggcgggcggc cggctccgcc ccgggggccg gggcgcgggg gccgggcccc ggaggcggcg
   121981 ctcgcacgca cggggccacg gccgcgcggg ggcgcgcggg tcccgacgcg gccgcggacg
   122041 cggggggccc ggggcggggg gcggagcctg gcatgggcgc cgcggggggc ctgtggggag
   122101 aggccggggg ggagtcgctg atcactatgg ggtctctgtt gtttgcaagg ggggcgggtc
   122161 tgttgacaag ggggcccgtc cggcccctcg gccgccccgc ctccgcttca acaaccccaa
   122221 ccccaacccc aacccccccg gaggggccag acgccccccg cggcgccgcg gctcgcgact
   122281 ggcgggagcc gccgccgccg ctgctgttgg tggtggtgtt ggtgttactg ctgccgtgtg
   122341 gcccgatggg cgccgagggg ggcgctgtcc gagccgcggc cggctggggg gctgcgtgag
   122401 acgccccgcc cgtcacgggg ggcgcggcgg cgcctctgcg tgggggggcg cggggcgtcc
   122461 ggcggggggc gggcggtacg tagtctgctg caagagacaa cggggggcgc gatcaggtta
   122521 cgccccctcc ccggcccgcc ctttcctcgc ccgcccgcct attcctccct ccccccccct
   122581 cctcctcctc ctcccccagg gtccttgccg ccccccgcct caccgtcgtc caggtcgtcg
   122641 tcatcctcgt ccgtggtggg ctccgggtgg gtgggcgaca gggccctcac cgtgtgcccc
   122701 cccagggtca ggtaccgcgg ggcgaaccgc tgattgcccg tccagataaa gtccacggcc
   122761 gtgcccgccc tgacggcctc ctcggcctcc atgcgggtct gggggtcgtt cacgatcggg
   122821 atggtgctga acgacccgct gggcgtcacg cccactatca ggtacaccag cttggcgttg
   122881 cacagcgggc aggtgttgcg caattgcatc caggttttca tgcacgggat gcagaagcgg
   122941 tgcatgcacg ggaaggtgtc gcagcgcagg tggggcgcga tctcatccgt gcacacggcg
   123001 cacacgtcgc cctcgtcgct ccccccgtcc tctcgagggg gggcgccccc gcaactgccg
   123061 gggtcttcct cgcggggggg gctccccccc gagaccgccc ccccatccac gccctgcggc
   123121 cccagcagcc ccgtctcgaa cagttccgtg tccgtgctgt ccgcctcgga ggcggagtcg
   123181 tcgtcatggt ggtcggcgtc cccccgcccc cccacttcgg tctccgcctc agagtcgctg
   123241 ctgtccggca ggtctcggtc gcagggaaac acccagacat ccggggcggg ctaaggggaa
   123301 aaaagggggg cgggtaagaa tgggggggga tttcccgcgt caatcagcac ccacgagttc
   123361 cccctctccc ccccccgcct cacaaagtcc tgcccccctg ctggcctcgg aagagggggg
   123421 agaaaggggt ctgcaaccaa aggtggtctg ggtccgtcct ttggatcccg acccctcttc
   123481 ttccctcttc tcccgccctc cagacgcacc ggagtcgggg gtcccacggc gtcccccaaa
   123541 tatggcgggc ggctcctccc caccccccta gatgcgtgtg agtaaggggg gcctgcgtat
   123601 gagtcagtgg ggaccacgcc cccaacacgg cgaccccggt ccctgtgtgt ttgttgtggg
   123661 ggcgtgtctc tgtgtatgag tcagggggtc ccacggcgac cccgggccct gcgtctgagt
   123721 caaaggggcc atgtgtatgt gttgggggtc tgtatatata aagtcagggg gtcacatggc
   123781 gacccccaac agggcgaccc cggtccctgt atatataggg tcagggggtt ccgcaccccc
   123841 taacatggcg cccccggtcc ctgtatatat agtgtcacgg ggttccacgc cccctaacat
   123901 ggcgccccaa catggcgccc ggctcccgtg tatgagtggg ggtcccccaa catggcggcc
   123961 ggttccagtg taagggtcgg gggtccccca acatggcgcc ccccaatatg gcgcccccca
   124021 atatggcgcc ccagacatgg cgcccggccc ctcacctcgc gctgggggcg gccctcaggc
   124081 cggcgggtac tcgctccggg gcggggctcc atgggggtcg tatgcggctg gagggtcgcg
   124141 gacggagggt ccctgggggt cgcaacgtag gcggggcttc tgtggtgatg cggagagggg
   124201 gcggcccgag tctgcctggc tgctgcgtct cgctccgagt gccgaggtgc aaatgcgacc
   124261 agactgtcgg gccagggcta acttataccc cacgcctttc ccctccccaa aggggcggca
   124321 gtgacgattc ccccaatggc cgcgcgtccc aggggaggca ggcccaccgc ggggcggccc
   124381 cgtccccggg gaccaacccg gcgcccccaa agaatatcat tagcatgcac ggcccggccc
   124441 ccgatttggg ggcccaaccc ggtgtccccc aaagaacccc attagcatgc ccctcccgcc
   124501 gacgcaacag gggcttggcc tgcgtcggtg ccccggggct tcccgccttc ccgaagaaac
   124561 tcattaccat acccggaacc ccaggggacc aatgcgggtt cattgagcga cccgcgggcc
   124621 aatgcgcgag gggccgtgtg ttccgccaaa aaagcaatta gcataacccg gaaccccagg
   124681 ggagtggtta cgcgcggcgc gggaggcggg gaataccggg gttgcccatt aagggccgcg
   124741 ggaattgccg gaagcgggaa gggcggccgg ggccgcccat taatgagttt ctaattacca
   124801 taccgggaag cggaacaagg cctcttgcaa gtttttaatt accataccgg gaagtgggcg
   124861 gcccggccca ttgggcggta actcccgccc aatgggccgg gccccgaaga ctcggcggac
   124921 gctggttggc cgggccccgc cgcgctggcg gccgccgatt ggccagtccc gcccccgagg
   124981 cgggcccgcc ctgtgagggc gggctggctc caagcgtata tatgcgcggc tcctgccatc
   125041 gtctctccgg agagcggctt ggtgcggagc tcccgggagc tccgcggaag acccaggccg
   125101 cctcgggtgt aacgttagac cgagttcgcc gggccggctc cgcgggccag ggcccgggca
   125161 cgggcctcgg gccccaggca cggcccgatg accgcctcgg cctccgccac ccggcgccgg
   125221 aaccgagccc ggtcggcccg ctcgcgggcc cacgagccgc ggcgcgccag gcgggcggcc
   125281 gaggcccaga ccaccaggtg gcgcacccgg acgtggggcg agaagcgcac ccgcgcgggg
   125341 gtcgcggggg tcgcgggggt cgcgggggtc gcgggggtcg cggggggctc cggcgccccc
   125401 tccccgcccg cgcgtcgcag gcgcaggcgc gccaggtgct ccgcggtgac gcgcaggcgg
   125461 agggcgaggc gcggcggaag gcggaagggg cgcgaggggg ggtgggaggg gtcagccccg
   125521 ccccccgggc ccacgccggg cggtgggggc cggggccggg gggcggcggc ggtgggccgg
   125581 gcctctggcg ccggctcggg cggggggctg tccggccagt cgtcgtcatc gtcgtcgtcg
   125641 gacgcggact cgggaacgtg gagccactgg cgcagcagca gcgaacaaga aggcgggggc
   125701 ccaccggcgg ggggcggcgg cggggcggcc gcgggcgcgc tcctgaccgc gggttccgag
   125761 ttgggcgtgg aggttacctg ggactgtgcg gttgggacgg cgcccgtggg cccgggcggc
   125821 cgggggcggc gggggccgcg atggcggcgg cggcgggcca tggagacaga gagcgtgccg
   125881 gggtggtaga gtttgacagg caagcatgtg cgtgcagagg cgagtagtgc ttgcctgtct
   125941 aactcgctag tctcggccgc ggggggcccg ggctgcccgc cgccgccgct ttaaagggcc
   126001 gcgcgcgacc cccggggggt gtgttttggg gggggcccgt tttcggggtc tggccgctcc
   126061 tccccccgct cctccccccg ctcctccccc cgctcctccc cccgctcctc cccccgctcc
   126121 tccccccgct cctccccccg ctcctccccc cgctcctccc cccgctcctc cccccgctcc
   126181 tccccccgct cctccccccg ctcctccccc cgctcctccc cccgctcctc cccccgctcc
   126241 tccccccgct cctccccccg ctcctccccc cgctcccgcg gccccgcccc ccacgcccgc
   126301 cgcgcgcgcg cacgccgccc ggaccgccgc ccgccttttt tgcgcgcgcg cgcgcccgcg
   126361 gggggcccgg gctgccacag gtgaaaccaa cagagcacgg cgcactccgc acgtcacacg
   126421 tcacgtcatc caccacacct gcccaacaac acaactcaca gcgacaactc accgcgcaac
   126481 aactcctgtt cctcatccac acgtcaccgc gcacctcccg ctcctccaga cgtaccccgg
   126541 cgcaacacac cgctcctgct acacaccacc gcccctcccc agccccagcc ctccccggcc
   126601 ccagccctcc ccggccccag ccctccccgg ccccagccct ccccggcccc agccctcccc
   126661 ggccccagcc ctccccggcc ccagccctcc ccggccccag ccctccccgg ccgcgtcccg
   126721 cgctccctcg ggggggttcg ggcatctcta cctcagtgcc gccaatctca ggtcagagat
   126781 ccaaaccctc cgggggcgcc cgcgcaccac caccgcccct cgccccctcc cgcccctcgc
   126841 cccctcccgc ccctcgcccc ctcccgcccc tcgccccctc ccgcccctcg ccccctcccg
   126901 cccctcgccc cctcccgccc ctcgccccct cccgcccctc gccccctccc gcccctcgcc
   126961 ccctcccgcc cctcgccccc tcccgcccct cgccccctcc cgcccctcgc cccctcccgc
   127021 ccctcgcccc ctcccgcccc tcgccccctc ccgcccctcg ccccctcccg cccctcgccc
   127081 cctcccgccc ctcgccccct cccgcccctc gccccctccc gcccctcgcc ccctcccgcc
   127141 cctcgaataa acaacgctac tgcaaaactt aatcaggttg ttgccgttta ttgcgtcttc
   127201 gggtctcaca agcgccccgc cccgtcccgg cccgttacag caccccgtcc ccctcgaacg
   127261 cgccgccgtc gtcttcgtcc caggcgcctt cccagtccac aacttcccgc cgcgggggcg
   127321 tggccaagcc cgcctccgcc cccagcacct ccacggcccc cgccgccgcc agcacggtgc
   127381 cgctgcggcc cgtggccgag gcccagcgaa tcccgggcgg cgccggcggc agggcccccg
   127441 ggccgtcgtc gtcgccgcgc agcaccagcg ggggggcgtc gtcgtcgggc tccagcaggg
   127501 cgcgggcgca aaagtccctc cgcggcccgc gccaccgggc cgggccggcg cgcaccgcct
   127561 cgcgccccag cgccacgtac acgggccgca gcggcgcgcc caggccccag cgcgcgcagg
   127621 cgcggtgcga gtgggcctcc tcctcgcaga agtccggcgc gccgggcgcc atggcgtcgg
   127681 tggtccccga ggccgccgcc cggccgtcca gcgccggcag cacggcccgg cggtactcgc
   127741 gcggggacat gggcaccggc gtgtccgggc cgaagcgcgt gcgcacgcgg tagcgcacgt
   127801 tgccgccgcg gcacaggcgc agcggcggcg cgtcggggta caggcgcgcg tgcgcggcct
   127861 ccacgcgcgc gaagaccccc gggccgaaca cgcggcccga ggccagcacc gtgcggcgca
   127921 ggtcccgcgc cgccggccag cgcacggcgc actgcacggc gggcagcagc tcgcacgcca
   127981 ggtaggcgtg ctgccgcgac accgcgggcc cgtcggcggg ccagtcgcag gcgcgcacgg
   128041 tgttgaccac gatgagccgc cggtcgccgg cgctggcgag cagccccaga aactccacgg
   128101 ccccggcgaa ggccaggtcc cgcgtggaca gcagcagcac gccctgtgcg cccagcgccg
   128161 acacgtcggg ggcgccggtc cagttgcccg cccaggcggc cgtgtccggc ccgcacagcc
   128221 ggttggccag ggccgccagc aggcaggaca gcccgccgcg ctcggcggac cactccggcg
   128281 gcccccccga ggccccgccg ccggccaggt cctcgcccgg cagcggcgag tacagcacca
   128341 ccacgcgcac gtcctcgggg tcggggatct ggcgcatcca ggccgccatg cggcgcagcg
   128401 ggcccgaggc gcgcaggggg ccaaagaggc ggcccccggc ggccccgtgg gggtgggggt
   128461 tatcgtcgtc gtcgccgccg ccgcacgcgg cctgggcggc gggggcgggc ccggcgcacc
   128521 gcgcggcgat cgaggccagg gcccgcgggt caaacatgag ggccggtcgc caggggacgg
   128581 ggaacagcgg gtggtccgtg agctcggcca cggcgcgcgg ggagcagtag gcctccaggg
   128641 cggcggccgc gggcgccgcc gtgtggctgg gccccggggg ctgccgccgc cagccgccca
   128701 gggggtcggg gccctcggcg ggccggcgcg acagcgccac ggggcgcggg cgggcctgcg
   128761 ccgcggcggc ccggggcgcc gcgggctggg cgggggcggg ctcgggcccc gggggcgtgg
   128821 aggggggcgc gggcgcgggg aggggggcgc gggcgtccga gccgggggcg tccgcgccgc
   128881 tcttcttcgt cttcgggggt cgcgggccgc cgcctccggg cggccgggcc gggccgggac
   128941 tcttgcgctt gcgcccctcc cgcggcgcgg cggaggcggc ggcggccgcc agcgcgtcgg
   129001 cggcgtccgg tgcgctggcc gccgccgcca gcagggggcg caggctctgg ttgtcaaaca
   129061 gcaggtccgc ggcggcggcg gccgcggagc tcggcaggcg cgggtcccgc ggcagcgcgg
   129121 ggcccagggc cccggcgacc aggctcacgg cgcgcacggc ggccacggcg gcctcgctgc
   129181 cgccggccac gcgcaggtcc ccgcgcaggc gcatgagcac cagcgcgtcg cgcacgaacc
   129241 gcagctcgcg cagccacgcg cgcaggcggg gcgcgtcggc gtgcggcggc ggcggggaag
   129301 cggggcccgc gggtccctcc ggccgcgggg ggctggcggg ccgggccccg gccagccccg
   129361 ggacggccgc caggtcgccg tcgaagccct cggccagcgc ctccaggatc ccgcggcagg
   129421 cggccaggca ctcgacggcc acgcggccgg cctgggcgcg gcgcccggcg tcgtcgtcgg
   129481 cgtcggcgtg gcgggcggcg tcggggtcgt cgccccccgc gggggaggcg ggcgcggcgg
   129541 acagccgccc cagggcggcg aggatccccg cggcgccgta cccggcgggc accgcgcgct
   129601 cgcccggtgc ggcggcggcg acggcggcga ccccctcgtc atctgcgccg gcgccggggc
   129661 tccccgcggc ccccgtcagc gccgcgttct cgcgcgccaa caggggcgcg taggcgcggc
   129721 gcaggctggt cagcaggaag cccttctgcg cgcggtcgta tcggcggctc atggccacgg
   129781 cggccgccgc gtgcgccagg ccccagccga agcggccggc cgccatggcg tagcccaggt
   129841 ggggcacggc ccgcgccacg ctgccggtga tgaaggagct gctgttgcgc gcggcgcccg
   129901 agatccggaa gcaggcctgg tccagcgcca cgtccccggg gaccacgcgc gggttctgga
   129961 gccaccccat ggcctccgcg tccggggtgt acagcagccg cgtgatcagg gcgtactgct
   130021 gcgcggcgtc gcccagctcg ggcgcccaca cggccgccgg ggcgcccgag gcctcgaacc
   130081 ggcgtcgcgc ctcctccgcc tcgggcgccc cccagaggcc cgggcggctg tcgcccaggc
   130141 cgccgtacag cacccgcccc gggggcgggg gcccggcgcc gggccacggc tccccgctga
   130201 cgtacccgtc gcgatagcgc gcgtagaagg cgccggaggc cgcgtcggcg tccagctcga
   130261 cccgccgggg ctgcccggcc gtgaagcggc ccgtggcgtc gcggccggcc accgccgcgc
   130321 gggcccggcg gcgctcgatg cggcccgcgg aggccgcggg ggtcctcgcc gccgcccggg
   130381 gcttgggcgc ggcctcggag agggggggtg gcccgggcgg gggcggcgtc cgcccggggg
   130441 ctgccggcgc cgcgctcgac ggaccccgcc cgacggcccg cgcctcgcgt gcgtggtcgg
   130501 ccgcgtcgtt gccgtcgtcg tcctcgtcct cgtcggacga cgaggacgaa gaggatgcgg
   130561 acgacgagga cgaggacccg gagtccgacg aggtcgatga cgccgatggc cgccaccggc
   130621 cgtgacgacg tctccgcggc ggctgggccg gcgggcgcgg cgacaggcgg tccgtggggt
   130681 ccggatacgc gccgcgtagc ggggcctccc gttcgcggcc ccgggccggg gcccggtcgc
   130741 cggcggcgtc ggctgcgtcg tcgtactcgt ccccgtcatc gtcgtcggct cgaaaggcgg
   130801 gggtccgggg cggcgaggcc gcggggtcgg gcgtcgggat cgtccggacg gcctcctcta
   130861 ccatggaggc cagcagagcc agctgtcgcg gcgagacggc gtccccggcg tcctcgccgg
   130921 cgtcggtgcc cgccgcgggg gccctcccgt cccgccgggc gtcgtcgagg tcgtgggggt
   130981 ggtcggggtc gtggtcgggg tcgtccccgc cctcctccgt ctccgcgccc cacccgaggg
   131041 ccccccgctc gtcgcggtct gggctcgggg tgggcggcgg cccgtcggtg gggcccgggg
   131101 agccggggcg ctgcttgttc tccgacgcca tcgccgatgc ggggcgatcc tccggggata
   131161 cggctgcgac ggcggacgta gcacggtagg tcacctacgg actctcgatg gggggagggg
   131221 gcgagaccca cggaccccga cgacccccgc cgtcgacgcg gaactagcgc ggaccggtcg
   131281 atgcttgggt gggaaaaagg acagggacgg ccgatccccc tcccgcgctt cgtccgcgta
   131341 tcggcgtccc ggcgcggcga gcgtctgacg gtctgtctct ggcggtcccg cgtcgggtcg
   131401 tggatccgtg tcggcagccg cgctccgtgt ggacgatcgg ggcgtcctcg ggctcatata
   131461 gtcccagggg ccggcgggaa ggaggagcag cggaggccgc cggccccccg cccccccggc
   131521 gggcccaccc cgaacggaat tccattatgc acgaccccgc cccgacgccg gcacgccggg
   131581 ggcccgtggc cgcggcccgt tggtcgaacc cccggccccg cccatccgcg ccatctgcca
   131641 tgggcggggc gcgagggcgg gtgggtccgc gccccgcccc gcatggcatc tcattaccgc
   131701 ccgatccggc ggtttccgct tccgttccgc atgctaacga ggaacgggca gggggcgggg
   131761 cccgggcccc gacttcccgg ttcggcggta atgagatacg agccccgcgc gcccgttggc
   131821 cgtccccggg ccccccggtc ccgcccgccg gacgccggga ccaacgggac ggcgggcggc
   131881 ccaagggccg cccgccttgc cgccccccca ttggccggcg ggcgggaccg ccccaagggg
   131941 gcggggccgc cgggtaaaag aagtgagaac gcgaagcgtt cgcacttcgt cccaatatat
   132001 atatattatt agggcgaagt gcgagcactg gcgccgtgcc cgactccgcg ccggccccgg
   132061 gggcgggccc gggcggcggg gggcgggtct ctccggcgca cataaaggcc cggcgcgacc
   132121 gacgcccgca gacggcgccg gccacgaacg acgggagcgg ctgcggagca cgcggaccgg
   132181 gagcgggagt cgcagagggc cgtcggagcg gacggcgtcg gcatcgcgac gccccggctc
   132241 gggatcggga tcgcatcgga aagggacacg cggacgcggg ggggaaagac ccgcccaccc
   132301 cacccacgaa acacagggga cgcaccccgg gggcctccga cgacagaaac ccaccggtcc
   132361 gccttttttg cacgggtaag caccttgggt gggcggagga gggggggacg cgggggcgga
   132421 ggagggggga cgcgggggcg gaggaggggg gacgcggggg cggaggaggg gggacgcggg
   132481 ggcggaggag gggggacgcg ggggcggagg agggggctca cccgcgttcg tgccttcccg
   132541 caggaggaac gtcctcgtcg aggcgaccgg cggcgaccgt tgcgtggacc gcttcctgct
   132601 cgtcgggcgg ggggaagcca ctgtggtcct ccgggacgtt ttctggatgg ccgacatttc
   132661 cccaggcgct tttgcgcctt gtgtaaaagc gcggcgtccc gctctccgat ccccgcccct
   132721 gggcacgcgc aagcgcaagc gcccttcccg ccccctctca tcggagtctg aggtagaatc
   132781 cgatacagcc ttggagtctg aggtcgaatc cgagacagca tcggattcga ccgagtctgg
   132841 ggaccaggat gaagcccccc gcatcggtgg ccgtagggcc ccccggaggc ttggggggcg
   132901 gttttttctg gacatgtcgg cggaatccac cacggggacg gaaacggatg cgtcggtgtc
   132961 ggacgacccc gacgacacgt ccgactggtc ttatgacgac attcccccac gacccaagcg
   133021 ggcccgggta aacctgcggc tcacgagctc tcccgatcgg cgggatgggg ttatttttcc
   133081 taagatgggg cgggtccggt ctacccggga aacgcagccc cgggccccca ccccgtcggc
   133141 cccaagccca aatgcaatgc tacggcgctc ggtgcgccag gcccagaggc ggagcagcgc
   133201 acgatggacc cccgacctgg gctacatgcg ccagtgtatc aatcagctgt ttcgggtcct
   133261 gcgggtcgcc cgggaccccc acggcagtgc caaccgcctg cgccacctga tacgcgactg
   133321 ttacctgatg ggatactgcc gagcccgtct ggccccgcgc acgtggtgcc gtttgctgca
   133381 ggtgtccggc ggaacctggg gcatgcacct gcgcaacacc atacgggagg tggaggctcg
   133441 attcgacgcc accgcggaac ccgtgtgcaa gcttccttgt ttggagacca gacggtacgg
   133501 cccggagtgt gatcttagta atctcgagat tcatctcagc gcgacaagcg atgatgaaat
   133561 ctccgatgcc accgatctgg aggccgccgg ttcggaccac acgctcgcgt cccagtccga
   133621 cacggaggat gccccctccc ccgttacgct ggaaacccca gaaccccgcg ggtccctcgc
   133681 tgtgcgtctg gaggatgagt ttggggagtt tgactggacc ccccaggagg gctcccagcc
   133741 ctggctgtct gcggtcgtgg ccgataccag ctccgtggaa cgcccgggcc catccgattc
   133801 tggggcgggt cgcgccgcag aagaccgcaa gtgtctggac ggctgccgga aaatgcgctt
   133861 ctccaccgcc tgcccctatc cgtgcagcga cacgtttctc cggccgtgag tccggtcgcc
   133921 ccgaccccct tgtatgtccc caaaataaaa gaccaaaatc aaagcgtttg tcccagcgtc
   133981 ttaatggcgg gaagggcgga gagaaacaga ccacgcggac atggggggtg tttgggggtt
   134041 tattggcacc gggggctaaa gggtggtaac cggatagcag atgtgaggaa gtcggggccg
   134101 ttcgccgcga acggcgatca gagggtcagt ttcttgcgga ccacggcccg gcgatgtggg
   134161 ttgctcgtct gggacctcgg gcatgcccat acacgcacaa cacggacgcc gcaccggatg
   134221 ggacgtcgta agggggcctg gggtagctgg gtggggtttg tgcagagcaa tcagggaccg
   134281 cagccagcgc atacaatcgc gctcccgtcc gtttgtcccg ggcagtacca cgccgtactg
   134341 gtattcgtac cggctgagca gggtctccag ggggtggttg ggggccgcgg ggaacggggt
   134401 ccacgccacg gtccactcgg gcaaaaaccg agtcggcacg gcccacggtt ctcccaccca
   134461 cgcgtctggg gtcttgatgg cgataaatct taccccgagc cggatttttt gggcgtattc
   134521 gagaaacggc acacacagat ccgccgcgcc taccacccac aagtggtaga ggcgaggggg
   134581 gctgggttgg tctcggtgca gcagtcggaa gcacgccacg gcgtccacga cctcggtgct
   134641 ctccaagggg ctgtcctccg caaacaggcc cgtggtggtg tttggggggc agcgacagga
   134701 cctagtgcgc acgatcgggc gggtgggttt gggtaagtcc atcagcggct cggccaaccg
   134761 tcgaaggttg gccggacgaa cgacgaccgg ggtacccagg ggttctgatg ccaaaatgcg
   134821 gcactgccta agcaggaagc tccacagggc cgggcttgcg tcgacggaag tccggggcag
   134881 ggcgttgttc tggtcaagga gggtcattac gttgacgaca acaacgccca tgttggtata
   134941 ttacaggccc gtgtccgatt tggggcactt gcagatttgt aaggccacgc acggcgggga
   135001 gacaggccga cgcgggggct gctctaaaaa tttaagggcc ctacggtcca cagacccgcc
   135061 ttcccggggg ggcccttgga gcgaccggca gcggaggcgt ccgggggagg ggagggtgat
   135121 ttacgggggg gtaggtcagg gggtgggtcg tcaaactgcc gctccttaaa accccggggc
   135181 ccgtcgttcg gggtgctcgt tggttggcac tcacggtgcg gcgaatggcc tgtcgtaagt
   135241 tttgtcgcgt ttacggggga cagggcagga ggaaggagga ggccgtcccg ccggagacaa
   135301 agccgtcccg ggtgtttcct catggcccct tttatacccc agccgaggac gcgtgcctgg
   135361 actccccgcc cccggagacc cccaaacctt cccacaccac accacccagc gaggccgagc
   135421 gcctgtgtca tctgcaggag atccttgccc agatgtacgg aaaccaggac taccccatag
   135481 aggacgaccc cagcgcggat gccgcggacg atgtcgacga ggacgccccg gacgacgtgg
   135541 cctatccgga ggaatacgca gaggagcttt ttctgcccgg ggacgcgacc ggtcccctta
   135601 tcggggccaa cgaccacatc cctcccccgt gtggcgcatc tccccccggt atacgacgac
   135661 gcagccggga tgagattggg gccacgggat ttaccgcgga agagctggac gccatggaca
   135721 gggaggcggc tcgagccatc agccgcggcg gcaagccccc ctcgaccatg gccaagctgg
   135781 tgactggcat gggctttacg atccacggag cgctcacccc aggatcggag gggtgtgtct
   135841 ttgacagcag ccatccagat tacccccaac gggtaatcgt gaaggcgggg tggtacacga
   135901 gcacgagcca cgaggcgcga ctgctgaggc gactggacca cccggcgatc ctgcccctcc
   135961 tggacctgca tgtcgtctcc ggggtcacgt gtctggtcct ccccaagtac caggccgacc
   136021 tgtataccta tctgagtagg cgcctgaacc cactgggacg cccgcagatc gcagcggtct
   136081 cccggcagct cctaagcgcc gttgactaca ttcaccgcca gggcattatc caccgcgaca
   136141 ttaagaccga aaatattttt attaacaccc ccgaggacat ttgcctgggg gactttggcg
   136201 ccgcgtgctt cgtgcagggt tcccgatcaa gccccttccc ctacggaatc gccggaacca
   136261 tcgacaccaa cgcccccgag gtcctggccg gggatccgta taccacgacc gtcgacattt
   136321 ggagcgccgg tctggtgatc ttcgagactg ccgtccacaa cgcgtccttg ttctcggccc
   136381 cccgcggccc caaaaggggc ccgtgcgaca gtcagatcac ccgcatcatc cgacaggccc
   136441 aggtccacgt tgacgagttt tccccgcatc cagaatcgcg cctcacctcg cgctaccgct
   136501 cccgcgcggc cgggaacaat cgcccgccgt acacccgacc ggcctggacc cgctactaca
   136561 agatggacat agacgtcgaa tatctggttt gcaaagccct caccttcgac ggcgcgcttc
   136621 gccccagcgc cgcagagctg ctttgtttgc cgctgtttca acagaaatga ccgccccctg
   136681 ggggcggtgc tgtttgcggg ttggcacaaa aagaccccga tccgcgtctg tggtgttttt
   136741 ggcatcatgt cgcagggcgc catgcgtgcc gttgttccca ttatcccatt ccttttggtt
   136801 cttgtcggtg tatcgggggt tcccaccaac gtctcctcca ccacccaacc ccaactccag
   136861 accaccggtc gtccctcgca tgaagccccc aacatgaccc agaccggcac caccgactct
   136921 cccaccgcca tcagccttac cacgcccgac cacacacccc ccatgccaag tattggactg
   136981 gaggaggagg aagaggagga gggggccggg gacggcgaac atcttgaggg gggagatggg
   137041 acccgtgaca ccctacccca gtccccgggc ccagccttcc cgttggctga ggacgtcgag
   137101 aaggacaaac ccaaccgtcc cgtagtccca tcccccgatc ccaacaactc ccccgcgcgc
   137161 cccgagacca gtcgcccgaa gacacccccc accattatcg ggccgctggc aactcgcccc
   137221 acgacccgac tcacctcaaa gggacgaccc ttggttccga cgcctcaaca taccccgctg
   137281 ttctcgttcc tcactgcctc ccccgccctg gacaccctct tcgtcgtcag caccgtcatc
   137341 cacaccttat cgtttttgtg tattggtgcg atggcgacac acctgtgtgg cggttggtcc
   137401 agacgcgggc gacgcacaca ccctagcgtg cgttacgtgt gcctgccgtc cgaacgcggg
   137461 tagggtatgg ggcgggggat ggggagagcc cacatgcgga aagcaagaac aataaaggcg
   137521 gtggtatcta gttgatatgc atctctgggt gtttttgggg tgtggcggac gcggggcggt
   137581 cattggacgg ggtgcagtta aatacatgcc cgggacccat gaagcatgcg cgacttccgg
   137641 gcctcagaac ccacccgaaa cggccaacgg acgtctgagc caggcctggc tatccggaga
   137701 aacagcacac gacttggcgt tctgtgtgtc gcgatgtctc tgcgcgcagt ctggcatctg
   137761 gggcttttgg gaagcctcgt gggggctgtt cttgccgcca cccatcgggg acctgcggcc
   137821 aacacaacgg accccttaac gcacgcccca gtgtcccctc accccagccc cctggggggc
   137881 tttgccgtcc ccctcgtagt cggtgggctg tgcgccgtag tcctgggggc ggcatgtctg
   137941 cttgagctcc tgcgtcgtac gtgccgcggg tgggggcgtt accatcccta catggaccca
   138001 gttgtcgtat aatttccccc cccccccccc ttctccgcgt gggtgatgtc gggtccaaac
   138061 tcccgacacc accagctggc atggtataaa tcaccggtgc gccccccaaa ccatgtccgg
   138121 cagggggatg ggggggcgaa tgcggagggc acccaacaac accgggctaa ccaggaaatc
   138181 cgtggccccg gcccccaata aagatcgcgg tagcccggcc gtgtgacact atcgtccata
   138241 ccgaccacac cgacgaatcc cccaaggggg aggggccatt ttacgaggag gaggggtata
   138301 acaaagtctg tctttaaaaa gcaggggtta gggagttgtt cggtcataag cttcagcgcg
   138361 aacgaccaac taccccgatc atcagttatc cttaaggtct cttttgtgtg gtgcgttccg
   138421 gtatgggggg ggctgccgcc aggttggggg ccgtgatttt gtttgtcgtc atagtgggcc
   138481 tccatggggt ccgcggcaaa tatgccttgg tggatgcctc tctcaagatg gccgacccca
   138541 atcgctttcg cggcaaagac cttccggtcc tggaccagct gaccgaccct ccgggggtcc
   138601 ggcgcgtgta ccacatccag gcgggcctac cggacccgtt ccagcccccc agcctcccga
   138661 tcacggttta ctacgccgtg ttggagcgcg cctgccgcag cgtgctccta aacgcaccgt
   138721 cggaggcccc ccagattgtc cgcggggcct ccgaagacgt ccggaaacaa ccctacaacc
   138781 tgaccatcgc ttggtttcgg atgggaggca actgtgctat ccccatcacg gtcatggagt
   138841 acaccgaatg ctcctacaac aagtctctgg gggcctgtcc catccgaacg cagccccgct
   138901 ggaactacta tgacagcttc agcgccgtca gcgaggataa cctggggttc ctgatgcacg
   138961 cccccgcgtt tgagaccgcc ggcacgtacc tgcggctcgt gaagataaac gactggacgg
   139021 agattacaca gtttatcctg gagcaccgag ccaagggctc ctgtaagtac gccctcccgc
   139081 tgcgcatccc cccgtcagcc tgcctctccc cccaggccta ccagcagggg gtgacggtgg
   139141 acagcatcgg gatgctgccc cgcttcatcc ccgagaacca gcgcaccgtc gccgtataca
   139201 gcttgaagat cgccgggtgg cacgggccca aggccccata cacgagcacc ctgctgcccc
   139261 cggagctgtc cgagaccccc aacgccacgc agccagaact cgccccggaa gaccccgagg
   139321 attcggccct cttggaggac cccgtgggga cggtggcgcc gcaaatccca ccaaactggc
   139381 acataccgtc gatccaggac gccgcgacgc cttaccatcc cccggccacc ccgaacaaca
   139441 tgggcctgat cgccggcgcg gtgggcggca gtctcctggc agccctggtc atttgcggaa
   139501 ttgtgtactg gatgcgccgc cacactcaaa aagccccaaa gcgcatacgc ctcccccaca
   139561 tccgggaaga cgaccagccg tcctcgcacc agcccttgtt ttactagata ccccccctta
   139621 atgggtgcgg gggggtcagg tctgcggggt tgggatggga ccttaactcc atataaagcg
   139681 agtctggaag gggggaaagg tggacagtcg ataagtcggt agcgggggac gcgcacctgt
   139741 tccgcctgtc gcacccacag ctttttttgc gaaccgtccc gttccgggat gccgtgccgc
   139801 ccgttgcagg gcctggtgct cgtgggcctc tgggtctgtg ccaccagcct ggttgtccgt
   139861 ggccccacgg tcagtctggt atcaaactca tttgtggacg ccggggcctt ggggcccgac
   139921 ggcgtagtgg aggaagacct gcttattctc ggggagcttc gctttgtggg ggaccaggtc
   139981 ccccacacca cctactacga tgggggcgta gagctgtggc actaccccat gggacacaaa
   140041 tgcccacggg tcgtgcatgt cgtcacggtg accgcgtgcc cacgtcgccc cgccgtggca
   140101 ttcgccctgt gtcgcgcgac cgacagcact cacagccccg catatcccac cctggagctc
   140161 aatctggccc aacagccgct tttgcgggtc cagagggcaa cgcgggacta tgccggggtg
   140221 tacgtgttac gcgtatgggt cggtgacgcg ccaaacgcca gcctgtttgt cctggggatg
   140281 gccatagccg ccgaagggac tctggcgtac aacggctcgg cctatggctc ctgcgacccg
   140341 aaactgcttc cgtcttcggc cccgcgtctg gccccggcga gcgtatacca acccgcccct
   140401 aaccaggcct ccaccccctc gaccaccacc tccaccccct cgaccaccat ccccgctccc
   140461 tcgaccacca tccccgctcc ccaagcatcg accacgccct tccccacggg agatccaaaa
   140521 ccacaacctc ccggggtcaa ccacgaaccc ccatctaatg ccacgcgagc gacccgcgac
   140581 tcgcgatacg cgctaacggt gacccagata atccagatag ccatccccgc gtccatcata
   140641 gccctggtgt ttctggggag ctgtatttgc tttatacaca gatgtcaacg ccgctaccga
   140701 cgctcccgtc gcccgattta cagcccccag atgcccacgg gcatctcatg cgcggtgaac
   140761 gaagcggcca tggcccgcct cggagccgag ctcaaatcgc atccgagcac cccccccaaa
   140821 tcccggcgcc ggtcgtcacg cacgccaatg ccctccctga cggccatcgc cgaagagtcg
   140881 gagcccgctg gggcggctgg gcttccgacg ccccccgtgg accccacgac acccacccca
   140941 acgcctcccc tgttggtata ggtccacggc cactggccgg gagcaccaca taaccgaccg
   141001 cagtccctga gttgggaata aaccggtatt atttacctat atccgtgtat gtcgatttct
   141061 ttccccccct ccccggaaac caaagaagga agcaaagaat ggatgggagg agttcaggaa
   141121 gccggggaga gggcccgcgg cgcatttaag gcgttgttgt gttgactttg cctcttctgg
   141181 cgggttggtg cggtgctgtt tgttgggctc ccattttacc cgaagatcgg ctgctatccc
   141241 cgggacatgg atcgcggggc ggtggtgggg tttcttctcg gtgtttgtgt tgtatcgtgc
   141301 ttggcgggaa cgcccaaaac gtcctggaga cgggtgagtg tcggcgagga cgtttcgttg
   141361 cttccagctc cggggcctac ggggcgcggc ccgacccaga aactactatg ggccgtggaa
   141421 cccctggatg ggtgcggccc cttacacccg tcgtgggtct cgctgatgcc ccccaagcag
   141481 gtgcccgaga cggtcgtgga tgcggcgtgc atgcgcgctc cggtcccgct ggcgatggcg
   141541 tacgcccccc cggccccatc tgcgaccggg ggtctacgaa cggacttcgt gtggcaggag
   141601 cgcgcggccg tggttaaccg gagtctggtt attcacgggg tccgagagac ggacagcggc
   141661 ctgtataccc tgtccgtggg cgacataaag gacccggctc gccaagtggc ctcggtggtc
   141721 ctggtggtgc aaccggcccc agttccgacc ccacccccga ccccagccga ttacgacgag
   141781 gatgacaatg acgagggcga ggacgaaagt ctcgccggca ctcccgccag cgggaccccc
   141841 cggctcccgc ctccccccgc ccccccgagg tcttggccca gcgcccccga agtctcacat
   141901 gtgcgtgggg tgaccgtgcg tatggagact ccggaagcta tcctgttttc ccccggggag
   141961 acgttcagca cgaacgtctc catccatgcc atcgcccacg acgaccagac ctactccatg
   142021 gacgtcgtct ggttgaggtt cgacgtgccg acctcgtgtg ccgagatgcg aatatacgaa
   142081 tcgtgtctgt atcacccgca gctcccagaa tgtctgtccc cggccgacgc gccgtgcgcc
   142141 gcgagtacgt ggacgtctcg cctggccgtc cgcagctacg cggggtgttc cagaacaaac
   142201 cccccaccgc gctgttcggc cgaggctcac atggagcccg tcccggggct ggcgtggcag
   142261 gcggcctccg tcaatctgga gttccgggac gcgtccccac aacactccgg cctgtatctg
   142321 tgtgtggtgt acgtcaacga ccatattcac gcctggggcc acattaccat cagcaccgcg
   142381 gcgcagtacc ggaacgcggt ggtggaacag cccctcccac agcgcggcgc ggatttggcc
   142441 gagcccaccc acccgcacgt cggggcccct ccccacgcgc ccccaaccca cggcgccctg
   142501 cggttagggg cggtgatggg ggccgccctg ctgctgtctg cactggggtt gtcggtgtgg
   142561 gcgtgtatga cctgttggcg caggcgtgcc tggcgggcgg ttaaaagcag ggcctcgggt
   142621 aaggggccca cgtacattcg cgtggccgac agcgagctgt acgcggactg gagctcggac
   142681 agcgagggag aacgcgacca ggtcccgtgg ctggcccccc cggagagacc cgactctccc
   142741 tccaccaatg gatccggctt tgagatctta tcaccaacgg ctccgtctgt atacccccgt
   142801 agcgatgggc atcaatctcg ccgccagctc acaacctttg gatccggaag gcccgatcgc
   142861 cgttactccc aggcctccga ttcgtccgtc ttctggtaag gcgccccatc ccgaggcccc
   142921 acgtcggtcg ccgaactggg cgaccgccgg cgaggtggac gtcggagacg agctaatcgc
   142981 gatttccgac gaacgcggac ccccccgaca tgaccgcccg cccctcgcca cgtcgaccgc
   143041 gccctcgcca cacccgcgac ccccgggcta cacggccgtt gtctccccga tggccctcca
   143101 ggctgtcgac gccccctccc tgtttgtcgc ctggctggcc gctcggtggc tccggggggc
   143161 ttccggcctg ggggccgtcc tgtgtgggat tgcgtggtat gtgacgtcaa ttgcccgagg
   143221 cgcataaagg gccggtggtc cgcctagccg cagcaaatta aaaatcgtga gtcacagcga
   143281 ccgcaacttc ccacccggag ctttcttccg gcctcgatga cgtcccggct ctccgatccc
   143341 aactcctcag cgcgatccga catgtccgtg ccgctttatc ccacggcctc gccagtttcg
   143401 gtcgaagcct actactcgga aagcgaagac gaggcggcca acgacttcct cgtacgcatg
   143461 ggccgccaac agtcggtatt aaggcgtcga cgcagacgca cccgctgcgt cggcatggtg
   143521 atcgcctgtc tcctcgtggc cgttctgtcg ggcggatttg gggcgctcct gatgtggctg
   143581 ctccgctaaa agaccgcatc gacacgcgcg tccttcttgt cgtctctctt cccccccatc
   143641 accccgcaat ttgcacccag cctttaacta cattaaattg ggttcgattg gcaatgttgt
   143701 ctcccggttg atttttgggt gggtggggag tgggtgggtg gggagtgggt gggtggggag
   143761 tgggtgggtg gggagtgggt gggtggggag tgggtgggtg gggagtgggt gggtggggag
   143821 tgggtgggtg gggagtgggt gggtggggag tgggtgggtg gggagtggca aggaagaaac
   143881 aagcccgacc accagacaga aaatgtaacc atacccaaac cgactctggg ggctgtttgt
   143941 ggggtcggaa ccataggatg aacaaaccac cccgtaccac ccgcacccaa gggtgcgggt
   144001 ggctcatcgg catctgtccg gtatgggttg ttccccaccc actcgcgttc ggacgtctta
   144061 gaatcatggc ggttttctat gccgacatcg gttttctccc ccgcaataag acacgatgcg
   144121 ataaaatctg tttgtaaaat ttattaaggg tacaaattgc cctagcacag gggtggggtt
   144181 agggccgggt ccccacaccc aaacgcacca aacagatgca ggcagtgggt cgagtacagc
   144241 cccgcgtacg aacacgtcga tgcgtgtgtc agacagcacc agaaagcaca ggccatcaac
   144301 aggtcgtgca tgtgtcggtg ggtttggacg cggggggcca tggtggtgat aaagttaatg
   144361 gccgccgtcc gccagggcca caggggcgac gtctcttggt tggcccggag ccactgggtg
   144421 tggaccagcc gcgcgtggcg gcccaacatg gcccctgtag ccgggggcgg gggatcgcgc
   144481 acgtttgcag cgcacatgcg agacacctcg accacggttc gaaagaaggc ccggtggtcc
   144541 gcgggcaaca tcaccaggtg cgcaagcgcc cgggcgtcca gagggtagag ccctgagtca
   144601 tccgaggttg gctcatcgcc cgggtcttgc cgcaagtgcg tgtgggttgg gcttccggtg
   144661 ggcgggacgc gaaccgcggt gtggatcccg acgcgggccc gagcgtatgc tccatgttgt
   144721 ggggagaagg ggtctgggct cgccaggggg gcatacttgc ccgggctata cagacccgcg
   144781 agccgtacgt ggttcgcggg gggtgcgtgg ggtccggggc tcccggggag accggggctc
   144841 ccggggagac cggggctccc tgggagaccg gggttgtcgt ggatccctgg ggtcacgcgg
   144901 taccctgggg tctctgggag ctcgcggtac tctgggttcc ctaggttctc ggggtggtcg
   144961 cggaacccgg ggctcccggg gaacacgcgg tgtcctgggg attgttggcg gtcggacggc
   145021 ttcagatggc ttcgagatcg tagtgtccgc accgactcgt agtagacccg aatctccaca
   145081 ttgccccgcc gcttgatcat tatcaccccg ttgcgggggt ccggagatca tgcgcgggtg
   145141 tcctcgaggt gcgtgaacac ctctggggtg catgccggcg gacggcacgc cttttaagta
   145201 aacatctggg tcgcccggcc caactggggc cgggggttgg gtctggctca tctcgagagc
   145261 cacggggggg aaccaccctc cgcccagaga ctcgggtgat ggtcgtaccc gggactcaac
   145321 gggttaccgg attacgggga ctgtcggtca cggtcccgcc ggttcttcga tgtgccacac
   145381 ccaaggatgc gttgggggcg atttcgggca gcagcccggg agagcgcagc aggggacgct
   145441 ccgggtcgtg cacggcggtt ctggccgcct cccggtcctc acgccccctt ttattgatct
   145501 catcgcgtac gtcggcgtac gtcctgggcc caacccgcat ggtgtccagg aaggtgtccg
   145561 ccatttccag ggcccacgac atgctccccc ccgacgagca ggaagcggtc cacgcaacgg
   145621 tcgccgccgg tcgcctcgac gaggacgttc ctcctgcggg aaggcacgaa cgcgggtgag
   145681 ccccctcctc cgcccccgcg tcccccctcc tccgcccccg cgtcccccct cctccgcccc
   145741 cgcgtccccc ctcctccgcc cccgcgtccc ccctcctccg cccccgcgtc cccccctcct
   145801 ccgcccaccc aaggtgctta cccgtgcaaa aaaggcggac cggtgggttt ctgtcgtcgg
   145861 aggcccccgg ggtgcgtccc ctgtgtttcg tgggtggggt gggcgggtct ttcccccccg
   145921 cgtccgcgtg tccctttccg atgcgatccc gatcccgagc cggggcgtcg cgatgccgac
   145981 gccgtccgct ccgacggccc tctgcgactc ccgctcccgg tccgcgtgct ccgcagccgc
   146041 tcccgtcgtt cgtggccggc gccgtctgcg ggcgtcggtc gcgccgggcc tttatgtgcg
   146101 ccggagagac ccgccccccg ccgcccgggc ccgcccccgg ggccggcgcg gagtcgggca
   146161 cggcgccagt gctcgcactt cgccctaata atatatatat attgggacga agtgcgaacg
   146221 cttcgcgttc tcacttcttt tacccggcgg ccccgccccc ttggggcggt cccgcccgcc
   146281 ggccaatggg ggggcggcaa ggcgggcggc ccttgggccg cccgccgtcc cgttggtccc
   146341 ggcgtccggc gggcgggacc ggggggcccg gggacggcca acgggcgcgc ggggctcgta
   146401 tctcattacc gccgaaccgg gaagtcgggg cccgggcccc gccccctgcc cgttcctcgt
   146461 tagcatgcgg aacggaagcg gaaaccgccg gatcgggcgg taatgagatg ccatgcgggg
   146521 cggggcgcgg acccacccgc cctcgcgccc cgcccatggc agatggcgcg gatgggcggg
   146581 gccgggggtt cgaccaacgg gccgcggcca cgggcccccg gcgtgccggc gtcggggcgg
   146641 ggtcgtgcat aatggaattc cgttcggggt gggcccgccg ggggggcggg gggccggcgg
   146701 cctccgctgc tcctccttcc cgccggcccc tgggactata tgagcccgag gacgccccga
   146761 tcgtccacac ggagcgcggc tgccgacacg gatccacgac ccgacgcggg accgccagag
   146821 acagaccgtc agacgctcgc cgcgccggga cgccgatacg cggacgaagc gcgggagggg
   146881 gatcggccgt ccctgtcctt tttcccaccc aagcatcgac cggtccgcgc tagttccgcg
   146941 tcgacggcgg gggtcgtcgg ggtccgtggg tctcgccccc tccccccatc gagagtccgt
   147001 aggtgaccta ccgtgctacg tccgccgtcg cagccgtatc cccggaggat cgccccgcat
   147061 cggcgatggc gtcggagaac aagcagcgcc ccggctcccc gggccccacc gacgggccgc
   147121 cgcccacccc gagcccagac cgcgacgagc ggggggccct cgggtggggc gcggagacgg
   147181 aggagggcgg ggacgacccc gaccacgacc ccgaccaccc ccacgacctc gacgacgccc
   147241 ggcgggacgg gagggccccc gcggcgggca ccgacgccgg cgaggacgcc ggggacgccg
   147301 tctcgccgcg acagctggct ctgctggcct ccatggtaga ggaggccgtc cggacgatcc
   147361 cgacgcccga ccccgcggcc tcgccgcccc ggacccccgc ctttcgagcc gacgacgatg
   147421 acggggacga gtacgacgac gcagccgacg ccgccggcga ccgggccccg gcccggggcc
   147481 gcgaacggga ggccccgcta cgcggcgcgt atccggaccc cacggaccgc ctgtcgccgc
   147541 gcccgccggc ccagccgccg cggagacgtc gtcacggccg gtggcggcca tcggcgtcat
   147601 cgacctcgtc ggactccggg tcctcgtcct cgtcgtccgc atcctcttcg tcctcgtcgt
   147661 ccgacgagga cgaggacgac gacggcaacg acgcggccga ccacgcacgc gaggcgcggg
   147721 ccgtcgggcg gggtccgtcg agcgcggcgc cggcagcccc cgggcggacg ccgcccccgc
   147781 ccgggccacc ccccctctcc gaggccgcgc ccaagccccg ggcggcggcg aggacccccg
   147841 cggcctccgc gggccgcatc gagcgccgcc gggcccgcgc ggcggtggcc ggccgcgacg
   147901 ccacgggccg cttcacggcc gggcagcccc ggcgggtcga gctggacgcc gacgcggcct
   147961 ccggcgcctt ctacgcgcgc tatcgcgacg ggtacgtcag cggggagccg tggcccggcg
   148021 ccgggccccc gcccccgggg cgggtgctgt acggcggcct gggcgacagc cgcccgggcc
   148081 tctggggggc gcccgaggcg gaggaggcgc gacgccggtt cgaggcctcg ggcgccccgg
   148141 cggccgtgtg ggcgcccgag ctgggcgacg ccgcgcagca gtacgccctg atcacgcggc
   148201 tgctgtacac cccggacgcg gaggccatgg ggtggctcca gaacccgcgc gtggtccccg
   148261 gggacgtggc gctggaccag gcctgcttcc ggatctcggg cgccgcgcgc aacagcagct
   148321 ccttcatcac cggcagcgtg gcgcgggccg tgccccacct gggctacgcc atggcggccg
   148381 gccgcttcgg ctggggcctg gcgcacgcgg cggccgccgt ggccatgagc cgccgatacg
   148441 accgcgcgca gaagggcttc ctgctgacca gcctgcgccg cgcctacgcg cccctgttgg
   148501 cgcgcgagaa cgcggcgctg acgggggccg cggggagccc cggcgccggc gcagatgacg
   148561 agggggtcgc cgccgtcgcc gccgccgcac cgggcgagcg cgcggtgccc gccgggtacg
   148621 gcgccgcggg gatcctcgcc gccctggggc ggctgtccgc cgcgcccgcc tcccccgcgg
   148681 ggggcgacga ccccgacgcc gcccgccacg ccgacgccga cgacgacgcc gggcgccgcg
   148741 cccaggccgg ccgcgtggcc gtcgagtgcc tggccgcctg ccgcgggatc ctggaggcgc
   148801 tggccgaggg cttcgacggc gacctggcgg ccgtcccggg gctggccggg gcccggcccg
   148861 ccagcccccc gcggccggag ggacccgcgg gccccgcttc cccgccgccg ccgcacgccg
   148921 acgcgccccg cctgcgcgcg tggctgcgcg agctgcggtt cgtgcgcgac gcgctggtgc
   148981 tcatgcgcct gcgcggggac ctgcgcgtgg ccggcggcag cgaggccgcc gtggccgccg
   149041 tgcgcgccgt gagcctggtc gccggggccc tgggccccgc gctgccgcgg gacccgcgcc
   149101 tgccgagctc cgcggccgcc gccgccgcgg acctgctgtt tgacaaccag agcctgcgcc
   149161 ccctgctggc ggcggcggcc agcgcaccgg acgccgccga cgcgctggcg gccgccgccg
   149221 cctccgccgc gccgcgggag gggcgcaagc gcaagagtcc cggcccggcc cggccgcccg
   149281 gaggcggcgg cccgcgaccc ccgaagacga agaagagcgg cgcggacgcc cccggctcgg
   149341 acgcccgcgc ccccctcccc gcgcccgcgc ccccctccac gcccccgggg cccgagcccg
   149401 cccccgccca gcccgcggcg ccccgggccg ccgcggcgca ggcccgcccg cgccccgtgg
   149461 cgctgtcgcg ccggcccgcc gagggccccg accccctggg cggctggcgg cggcagcccc
   149521 cggggcccag ccacacggcg gcgcccgcgg ccgccgccct ggaggcctac tgctccccgc
   149581 gcgccgtggc cgagctcacg gaccacccgc tgttccccgt cccctggcga ccggccctca
   149641 tgtttgaccc gcgggccctg gcctcgatcg ccgcgcggtg cgccgggccc gcccccgccg
   149701 cccaggccgc gtgcggcggc ggcgacgacg acgataaccc ccacccccac ggggccgccg
   149761 ggggccgcct ctttggcccc ctgcgcgcct cgggcccgct gcgccgcatg gcggcctgga
   149821 tgcgccagat ccccgacccc gaggacgtgc gcgtggtggt gctgtactcg ccgctgccgg
   149881 gcgaggacct ggccggcggc ggggcctcgg gggggccgcc ggagtggtcc gccgagcgcg
   149941 gcgggctgtc ctgcctgctg gcggccctgg ccaaccggct gtgcgggccg gacacggccg
   150001 cctgggcggg caactggacc ggcgcccccg acgtgtcggc gctgggcgca cagggcgtgc
   150061 tgctgctgtc cacgcgggac ctggccttcg ccggggccgt ggagtttctg gggctgctcg
   150121 ccagcgccgg cgaccggcgg ctcatcgtgg tcaacaccgt gcgcgcctgc gactggcccg
   150181 ccgacgggcc cgcggtgtcg cggcagcacg cctacctggc gtgcgagctg ctgcccgccg
   150241 tgcagtgcgc cgtgcgctgg ccggcggcgc gggacctgcg ccgcacggtg ctggcctcgg
   150301 gccgcgtgtt cggcccgggg gtcttcgcgc gcgtggaggc cgcgcacgcg cgcctgtacc
   150361 ccgacgcgcc gccgctgcgc ctgtgccgcg gcggcaacgt gcgctaccgc gtgcgcacgc
   150421 gcttcggccc ggacacgccg gtgcccatgt ccccgcgcga gtaccgccgg gccgtgctgc
   150481 cggcgctgga cggccgggcg gcggcctcgg ggaccaccga cgccatggcg cccggcgcgc
   150541 cggacttctg cgaggaggag gcccactcgc accgcgcctg cgcgcgctgg ggcctgggcg
   150601 cgccgctgcg gcccgtgtac gtggcgctgg ggcgcgaggc ggtgcgcgcc ggcccggccc
   150661 ggtggcgcgg gccgcggagg gacttttgcg cccgcgccct gctggagccc gacgacgacg
   150721 cccccccgct ggtgctgcgc ggcgacgacg acggcccggg ggccctgccg ccggcgccgc
   150781 ccgggattcg ctgggcctcg gccacgggcc gcagcggcac cgtgctggcg gcggcggggg
   150841 ccgtggaggt gctgggggcg gaggcgggct tggccacgcc cccgcggcgg gaagttgtgg
   150901 actgggaagg cgcctgggac gaagacgacg gcggcgcgtt cgagggggac ggggtgctgt
   150961 aacgggccgg gacggggcgg ggcgcttgtg agacccgaag acgcaataaa cggcaacaac
   151021 ctgattaagt tttgcagtag cgttgtttat tcgaggggcg ggagggggcg aggggcggga
   151081 gggggcgagg ggcgggaggg ggcgaggggc gggagggggc gaggggcggg agggggcgag
   151141 gggcgggagg gggcgagggg cgggaggggg cgaggggcgg gagggggcga ggggcgggag
   151201 ggggcgaggg gcgggagggg gcgaggggcg ggagggggcg aggggcggga gggggcgagg
   151261 ggcgggaggg ggcgaggggc gggagggggc gaggggcggg agggggcgag gggcgggagg
   151321 gggcgagggg cgggaggggg cgaggggcgg gagggggcga ggggcgggag ggggcgaggg
   151381 gcggtggtgg tgcgcgggcg cccccggagg gtttggatct ctgacctgag attggcggca
   151441 ctgaggtaga gatgcccgaa cccccccgag ggagcgcggg acgcggccgg ggagggctgg
   151501 ggccggggag ggctggggcc ggggagggct ggggccgggg agggctgggg ccggggaggg
   151561 ctggggccgg ggagggctgg ggccggggag ggctggggcc ggggagggct ggggctgggg
   151621 aggggcggtg gtgtgtagca ggagcggtgt gttgcgccgg ggtacgtctg gaggagcggg
   151681 aggtgcgcgg tgacgtgtgg atgaggaaca ggagttgttg cgcggtgagt tgtcgctgtg
   151741 agttgtgttg ttgggcaggt gtggtggatg acgtgacgtg tgacgtgcgg agtgcgccgt
   151801 gctctgttgg tttcacctgt ggcagcccgg gccccccgcg ggcgcgcgcg cgcgcaaaaa
   151861 aggcgggcgg cggtccgggc ggcgtgcgcg cgcgcggcgg gcgtgggggg cggggccgcg
   151921 ggagcggggg gaggagcggg gggaggagcg gggggaggag cggggggagg agcgggggga
   151981 ggagcggggg gaggagcggg gggaggagcg gggggaggag cggggggagg agcgggggga
   152041 ggagcggggg gaggagcggg gggaggagcg gggggaggag cggggggagg agcgggggga
   152101 ggagcggggg gaggagcggg gggaggagcg gggggaggag cggccagacc ccgaaaacgg
   152161 gcccccccca aaacacaccc cccgggggtc gcgcgcggcc ctttaaagcg gcggcggcgg
   152221 gc
//
DBGET integrated database retrieval system