GenomeNet

Database: RefSeq
Entry: NC_004065
LinkDB: NC_004065
Original site: NC_004065 
LOCUS       NC_004065             230278 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Murid herpesvirus 1, complete genome.
ACCESSION   NC_004065
VERSION     NC_004065.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Murid betaherpesvirus 1 (Mouse cytomegalovirus)
  ORGANISM  Murid betaherpesvirus 1
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Muromegalovirus.
REFERENCE   1  (bases 1 to 230278)
  AUTHORS   Rawlinson,W.D., Farrell,H.E. and Barrell,B.G.
  TITLE     Analysis of the complete DNA sequence of murine cytomegalovirus
  JOURNAL   J. Virol. 70 (12), 8833-8849 (1996)
   PUBMED   8971012
REFERENCE   2  (bases 1 to 230278)
  AUTHORS   Cranmer,L.D., Clark,C.L., Morello,C.S., Farrell,H.E.,
            Rawlinson,W.D. and Spector,D.H.
  TITLE     Identification, analysis, and evolutionary relationships of the
            putative murine cytomegalovirus homologs of the human
            cytomegalovirus UL82 (pp71) and UL83 (pp65) matrix phosphoproteins
  JOURNAL   J. Virol. 70 (11), 7929-7939 (1996)
   PUBMED   8892916
REFERENCE   3  (bases 1 to 230278)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 230278)
  AUTHORS   Rawlinson,W.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-AUG-1996) William D. Rawlinson, Virology, University
            of Syndey, Institute of Clinical Pathology Medical Research
            (ICPMR), Westmead, NSW 2145, Australia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U68299.
            Protein annotation was added by the NCBI staff as indicated in
            publication 1, except that a few problematic coding regions were
            left out; YP_214057 and YP_214114 were modified to better match
            their putative homologs in other Betaherpesvirinae.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..230278
                     /organism="Murid betaherpesvirus 1"
                     /mol_type="genomic DNA"
                     /strain="Smith"
                     /host="Mus musculus"
                     /db_xref="taxon:10366"
                     /common="Mouse cytomegalovirus"
     gene            complement(480..836)
                     /locus_tag="MuHV1_gp001"
                     /db_xref="GeneID:3293894"
     CDS             complement(480..836)
                     /locus_tag="MuHV1_gp001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214009.1"
                     /db_xref="GeneID:3293894"
                     /translation="MKRIGLERCFLSTSYRSTRFPSTALPRLTAERRSTFFTPDPKPR
                     GGGCPANTPRVLYPPPHPGVRRAVKRLLPRNIRRRSRNARFTALRAGRRSSRKLHTLA
                     GRLTPPSRGRGARPGG"
     gene            999..1979
                     /locus_tag="MuHV1_gp002"
                     /db_xref="GeneID:3293895"
     CDS             999..1979
                     /locus_tag="MuHV1_gp002"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214010.1"
                     /db_xref="GeneID:3293895"
                     /translation="MAAAVGRRACPAGRRSDAVIRVARSERLEMRHRSSWYASRPRGV
                     CRLRVLLLVCAAVVPIVSSAPLPGYYCYAKNATERRTPNIDRDYWRPGVSVFGCRMPK
                     GVCIEGEWTIEWYIPSLQASVINQVFFKSQTWLGPSMQYIIPSYERGKEVTCRQGFCV
                     DRAEGNLIITDNNTRKEEWARKPTRDVVCKLTACLRATSVSPYSRTTYEECNGTLEDY
                     LSLPDFENIYDISKVVPYVPPPKAPAVPPKVPGKAEDAPPDESCIGCDNPGLNAAAIA
                     VPVVTVIVLVSGIGYLCRSTESRQRTLELYRDLWSSLRRRLHRGDYARDG"
     misc_feature    1113..1913
                     /locus_tag="MuHV1_gp002"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            2236..3102
                     /locus_tag="MuHV1_gp003"
                     /db_xref="GeneID:3293896"
     CDS             2236..3102
                     /locus_tag="MuHV1_gp003"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214011.1"
                     /db_xref="GeneID:3293896"
                     /translation="MTIGRVSYPSAHVRLRLTRLLLLFVFCVVISYAQECPNYGGKKT
                     DDSVWKYRKDLGCLFRRIINITLYENKGIKTAYFILPGPAAVYVNASWTFEWFIKPLF
                     ASVDAASYFTSTTTSAAKSATDTVPIFSYYDMHSGRLKKTVGLKDGFKADHSGKLYIF
                     QNASVAGNITVNDTICVLRLCLWTTKDSTISIDDAGLKNNLSSILSLPTYDEIRGVLY
                     MYPQYNYSIPIKRIVQRSNDAGLVAAILFFIASVFVAALLLGYSYKPTLFRRLSTLIN
                     GQQLRQSDRQPL"
     misc_feature    2305..3075
                     /locus_tag="MuHV1_gp003"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            3270..4070
                     /locus_tag="MuHV1_gp004"
                     /db_xref="GeneID:3293897"
     CDS             3270..4070
                     /locus_tag="MuHV1_gp004"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214012.1"
                     /db_xref="GeneID:3293897"
                     /translation="MSLVCRLVLVTVVLSSLFTFAISRNDNECEKMQKEYKEKMKYRH
                     SLGCYFKGINPTKVPSSDPRTILKCTLPDVKVNASWTLEWVVVNLHTSVDVTSYYESS
                     PNSEPRFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSAD
                     SVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRDEFYTKNESPN
                     TIVTTLTVIVTLLFVGLLLVLIYLYGPSLYRRFFSNDCCSNFKPLKSN"
     misc_feature    3270..4049
                     /locus_tag="MuHV1_gp004"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            4185..5210
                     /locus_tag="MuHV1_gp005"
                     /db_xref="GeneID:3293898"
     CDS             4185..5210
                     /locus_tag="MuHV1_gp005"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214013.1"
                     /db_xref="GeneID:3293898"
                     /translation="MWLSVCPCTVMWRSVLVFLLFSSWLTTSGDSSHRSRRPPLQSPK
                     SGITTWIGGSSRTRFPSASFDKYKTIALGGDKFSPWKSISKCFNSKDATPFLKKSVNQ
                     KTGDKTFTCMPAENVYANASWRIEWVLGNGTTWLTPAIRFVSTDRSPPTFNGTLSVAY
                     STRLLYTDEKDNQNANNTGLYVDKSGLHISSAVRADLVKDVHDVKCTLSVCLWTDKIS
                     LYNTSDGYVETHVEVDPIAVANLSIIATLDDFVYPLGYPMEYTKKSAYSWPSETSQPQ
                     MSMSVFFGILSVYIVLIIGEVYICLKCHYNHKHESAADVAVEYRGTESDPSVVVSSDL
                     ESIEILD"
     misc_feature    4206..5141
                     /locus_tag="MuHV1_gp005"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            5300..6337
                     /locus_tag="MuHV1_gp006"
                     /db_xref="GeneID:3293899"
     CDS             5300..6337
                     /locus_tag="MuHV1_gp006"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214014.1"
                     /db_xref="GeneID:3293899"
                     /translation="MPSWSDTLTMDTTARGSTRSRPVQLLALVTVLASMTFQMGESLI
                     PIIPDFSSFMMNPLPMPQIMPPSTNETKESYVKTEEPIVGCNVSRTEINRLKNQMKKI
                     PNTFKCFKKDGVRTSLDMQTTGEKRFACEIPNNVYVNATWYVHWVVGKIAASVSPIVY
                     FTSTTSSPPTLDGNMHPFYRRKIVTAANGFKVDEKTGDITVARSNASLADSVRCRLIV
                     CLWTKNDSISDLPDDDPQMKNMSGVIKLPDYSGPDTLLTDGVPFDYAAWRQRMRTEME
                     EPSRRRRQLLLVISVIASLLWLAVGAMLFYTYGREPLARLLKRYGKQLAAVRIPADGK
                     DQSLTSPLLTK"
     misc_feature    5438..6286
                     /locus_tag="MuHV1_gp006"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            6463..7407
                     /locus_tag="MuHV1_gp007"
                     /db_xref="GeneID:3293900"
     CDS             6463..7407
                     /locus_tag="MuHV1_gp007"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214015.1"
                     /db_xref="GeneID:3293900"
                     /translation="MRGYTGDTMVLMVFCVWLAYVFSVESKANGCDPSLATNYSNLTQ
                     GQCVTRKGVKNDTEEGSYSCLTDAICIPASWEGTWLVDGWPLPFGVYFKSSNSSPPLF
                     SMTFNQTQPTTTPPTINATDYTLDPTSGRLIVSSNLTRSVSVTCKLTICRQTDGYGPK
                     PPPRRPKKRTTTVLPTTTSYTTLSVTHTSTIRKLITTRRATESPTVNHTSPIPTSSRV
                     NVSVDSNTDDETTGSMERQKRSNMIAIVMLVCFSFGACVLLVGLAYYYGFFDDTQSHA
                     PGHGSEPRSGESEPLRPPADVSANNSTYLSPPTPAVSM"
     misc_feature    6472..>6927
                     /locus_tag="MuHV1_gp007"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            7459..8529
                     /locus_tag="MuHV1_gp008"
                     /db_xref="GeneID:3293901"
     CDS             7459..8529
                     /locus_tag="MuHV1_gp008"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214016.1"
                     /db_xref="GeneID:3293901"
                     /translation="MRLYLDLSQFLLLAVIVTDSVVLSMICDTNAHSNLPQGSCTILS
                     KTPVRNDSNLGVDGWGYECPLGDICIPASWQVKWYIGLYQMDTGGFFRSSLTKPPTFQ
                     GLSMYVKDKNNARPDGFDIKHEDGRLIVTVDAGRPFTVGCKVTVCKREPDYGPATEEP
                     TTKERSTTKPVPIPTTQRRTTRSEPQTTVRPTTRPTTTVRPTTRPTTTVSPTTRPTTT
                     VRPTTKPIPHPTQKPVPPARPKPITRKHTSITQALVKFSTSSPTTLFPGPDNADDTVA
                     ATAEMQTSHTVTITVSVAVTIFIVTLIALAVLYHYGFLGRSAILDLYAERLRARFSSR
                     DPETFRPTDESEPLRTTSSPAS"
     misc_feature    <7645..>7968
                     /locus_tag="MuHV1_gp008"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            8632..9513
                     /locus_tag="MuHV1_gp009"
                     /db_xref="GeneID:3293902"
     CDS             8632..9513
                     /locus_tag="MuHV1_gp009"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214017.1"
                     /db_xref="GeneID:3293902"
                     /translation="MKLFFSSRLLLHFLIFAVIAAKSLITSAATCNSVRDLAFSGTVT
                     PGQCRTISVTLKDMYGFGTSSVWVYTCEFPAFCINATWRLEWLLNKSPINVSVLYEST
                     SSSPPTFKKLITNNATTRPPPTGFELNSGNGYLYIYPSAGNSFDLSCTGFVCVPPKPI
                     TTTPSTTRSRSSTETRTTRSGTKFITHKITPSRSQSVTPQVDDTTQLEIDNAIIVASA
                     EMQTSHTPTAIAVSLVVIVVVTVIVLGLLYHYGFLGKWALLDSYVDRFRVRFMGNSPD
                     RPTVETEPLRSTASRAS"
     misc_feature    8647..>9054
                     /locus_tag="MuHV1_gp009"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            9624..10499
                     /locus_tag="MuHV1_gp010"
                     /db_xref="GeneID:3293903"
     CDS             9624..10499
                     /locus_tag="MuHV1_gp010"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214018.1"
                     /db_xref="GeneID:3293903"
                     /translation="MKVSPDRLLQLSLVLAVFAPHLVIFASRKCDPVISKSYSSRTPP
                     GTCTGASVYLEIISKSHSTQTWKYECQLPEACIEATWQVKWTVNRIPMNATALYNSTD
                     SSLPKFDKILVINATTKPPPKGFTVNPHDGYLYLVSSPEETVSVHLQCEGFVCLPNKT
                     IHVTTNPPTTISRTKRDTTKFISLSSRSQPVTRQATDTTVSNTASSTDNAVIVANAEM
                     QTSNTTVAIVVPLMVILVATVIVLGFLYHYGFLRKWALLDSYLARVRGHFTTSDPESS
                     RPESDPLNSPPTSVL"
     misc_feature    9651..10382
                     /locus_tag="MuHV1_gp010"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            10715..11614
                     /locus_tag="MuHV1_gp011"
                     /db_xref="GeneID:3293904"
     CDS             10715..11614
                     /locus_tag="MuHV1_gp011"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214019.1"
                     /db_xref="GeneID:3293904"
                     /translation="MAHRYLGRSLFILVIYFVALSISRVTPAARAPAPKTNNCTKFSY
                     PGVSPGYCTERRDMKLITKFKNGTKVFSCPLLTDICVNARMSGVWCVNNSAIGSLFFT
                     STSHTPPMFHGFTPTHHRRLSGLWVDYQTGYLYVYPNATKKPEKEIYCTLTICITAIT
                     TRRPTTTRSSRGVSTGISTTGLWTDETSVVFPFVSAGENFGVSASPQTASSGTIAAIV
                     IVIVICVGLVVLAVLYYRGYIGHSRRLNLYRERLRARFLVSHSSYPTSYSTRYPSTYI
                     DRHHDPSDPTYFLPPLHISTSAA"
     misc_feature    10721..11497
                     /locus_tag="MuHV1_gp011"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            11686..12504
                     /locus_tag="MuHV1_gp012"
                     /db_xref="GeneID:3293905"
     CDS             11686..12504
                     /locus_tag="MuHV1_gp012"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214020.1"
                     /db_xref="GeneID:3293905"
                     /translation="MSTFRWSSYKFIYIRIILTLHSTRIEDIIRAEMFRHHLTSFITV
                     TFSLASISITLPLAQATNVLAAPKNTSCVKKFTVSERRPPPEPGKCMSLLGSTLVNKQ
                     AANKQVDKPVTILKIFRCPVEEYLCMNATWSGRLFVRTQDNREIIFGNISFTSTDSSP
                     TTLTGISTLKPWPLSSDLWIHSGTGDIYMFSNASFSDPKCYITLCVLRKNAHIPVQRA
                     NFAFGVTDENLVTPTSTRTVDNGTIAAIVLVSAIVVGLIILAALYRRRGFDRFK"
     misc_feature    11791..12498
                     /locus_tag="MuHV1_gp012"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:256904"
     gene            12599..13000
                     /locus_tag="MuHV1_gp013"
                     /db_xref="GeneID:3293906"
     CDS             12599..13000
                     /locus_tag="MuHV1_gp013"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214021.1"
                     /db_xref="GeneID:3293906"
                     /translation="MRTMSLSKSTAQSASRRRGSTRRTAPAGDMNKSLSASTTNVGKR
                     CGDKRPRKSTDTKRIKRDPNSDTPTTIYLNGDGVRSPIVAPNDRPTTSTRAHTRTSAE
                     TTSIIVLTIGLLLGLLFAATIYSFGAAIRNR"
     gene            13085..13990
                     /locus_tag="MuHV1_gp014"
                     /db_xref="GeneID:3293907"
     CDS             13085..13990
                     /locus_tag="MuHV1_gp014"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214022.1"
                     /db_xref="GeneID:3293907"
                     /translation="MRRLGIVIVIASLLSAVESTETECDTYNVTIKPETCDFFDNLYE
                     VRVRVDEKDTNRVHYSCQFKWNICTQATWYGTWIRMSFDEEMNPSPRVLAHVQLMSTP
                     TSPPTLVGFWNDSSSDKQYVLSHNSSAEIWHDPVTDNIYISSQVSSNQLGLICQLTGC
                     LNSKMDETYPAFAREKIETQTAIAIGKPADKQSELASQSLSKPTSSRRIDIPSPTPKS
                     LQMIRPTTRGTSVSRKPEITVSSAQNPTSSAAPLRHAAQAYVTVVLGVIAGLFLWTLT
                     DFRYVIADPRQDQRTIDRKMCQHSS"
     misc_feature    <13259..>13591
                     /locus_tag="MuHV1_gp014"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            14085..15065
                     /locus_tag="MuHV1_gp015"
                     /db_xref="GeneID:3293908"
     CDS             14085..15065
                     /locus_tag="MuHV1_gp015"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214023.1"
                     /db_xref="GeneID:3293908"
                     /translation="MYRHVGYILLSAFTVSLNKNAFATNCQSPSSGMDFTPGMCVRVP
                     FASVASASRNGVQLLTCQLLPVCIPAIWYATWTVRTSTSVPDITSISDTEDEYSGSGA
                     PPKHRQPRSYGAYLDTSNIMIIDFITFNSTSTSIPYYTGTWNNDSDTRVHVNQSLLGI
                     HFNQQNGSITLPHNSLLKYHNFECEVIACIDPTTTTSSQTHVPSTPPPNGSTPPPIRS
                     TPSPSKSTESQTTSKVTTRKDVMISKIYSNTTAASIISSITSSHVVTSRTTNRAIAPS
                     TTSHTEDEIIHTAIDEEEFVFLHSGHISINSDSNVLLIVAMSLLWIYIFI"
     gene            15044..15676
                     /locus_tag="MuHV1_gp016"
                     /db_xref="GeneID:3293909"
     CDS             15044..15676
                     /locus_tag="MuHV1_gp016"
                     /codon_start=1
                     /product="Glycoprotein family m02"
                     /protein_id="YP_214024.1"
                     /db_xref="GeneID:3293909"
                     /translation="MDLYIHLKIMTIPRPYKMTVNILFFALFLQRFLCTAAKCREYDL
                     DIALDACKEQDGGTLQKQDTDKCIFSCNIDTAVCASASWYATWVASSSGTQYVIGFVS
                     YTSSSTSGATFTDLWTNSSDTRPRLTIDKLKLDNKTGEVHVSPSCSSSGYVIECHVTA
                     CRSSTTPFPPTVPHPPTLLRSSATIPKLSNPIISLLIMTIISVLYAILLS"
     misc_feature    <15224..>15526
                     /locus_tag="MuHV1_gp016"
                     /note="Immune evasion protein; Region: m04gp34like;
                     pfam12216"
                     /db_xref="CDD:314992"
     gene            complement(15749..16951)
                     /locus_tag="MuHV1_gp017"
                     /db_xref="GeneID:3293910"
     CDS             complement(15749..16951)
                     /locus_tag="MuHV1_gp017"
                     /codon_start=1
                     /product="Member of MGP family m145 (right end)"
                     /protein_id="YP_214025.1"
                     /db_xref="GeneID:3293910"
                     /translation="MGTGGKADGTFSGFYLLFWLALAVRAQNCGVSFGPDDLLADEYL
                     TATVRSECGTIINIEFYAGMVLNTSEVWMMGGFDTTAALFEVLPNGTINNDVRWVNIT
                     ERDGEYKFLMSQTEHVKKFHEVWKRAGNVTRPQDFTHIGVRYNCRVSHVTVRCRVKHE
                     RNFLQLVQYNRNYRNHTYPVGDVGKLFESVARGVGVQYLDNDNSHIYQRWKEVCVRVA
                     HASMRRYANFSYERSNGTVRCRIESPSPARFMAGMNTPYGMYTRYNYTTGVSSTVNVE
                     ETNETNSTCDFQTLFGRWSYELPTPGHVRGCEFKHVEIDVRRFFDTKSKTKRCASGQL
                     CVHLGQILNLALIFLPIFAICLILNLCIGNRRAICDRLMYHKEGISRSRYRGIGITHH
                     RFQRLPQV"
     misc_feature    complement(16001..16654)
                     /locus_tag="MuHV1_gp017"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:314492"
     gene            complement(17071..20193)
                     /locus_tag="MuHV1_gp018"
                     /db_xref="GeneID:3293911"
     CDS             complement(17071..20193)
                     /locus_tag="MuHV1_gp018"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214026.1"
                     /db_xref="GeneID:3293911"
                     /translation="MADTGHGTRTRGSRVVRAPVVPVDMPSDGSAAAEPVGGNNSTAR
                     SQRQQRQQQQSRTHTQQQQQQQQEQQQVPTVSVVTTATTATVFDSSAATGWIRVSSTP
                     FGSFVPTPPLPQIQSPAPTSWTTLLTPAPSPTPPHAPVFLGYAPHLGWPHASAFQPLP
                     GPAYATFQPFPWLPAAYPTINPLPLDTSVYDFSQPTLPPPPTPTQFILPFGIVSPFGS
                     GSAVPIATMGAPPTPVPTTLIASSAVPPAPPPTPAGNVPILPRPERETETPPERPPRC
                     SVRPPGRMTPVAGRSRSPVARGKKKAASNNNLLNGGPVETTTGSRRAAGGVPPRQKAA
                     SAASSSSSASSSGPSRGRIISVSDPNLGAVSSSSSQMWATAAVVQPFGVVDQFAPGQQ
                     GQQQHSHHTQVQQQQMHDQQYQQHTRHRVTGSGRSGGSGRAGMSHSSVGGGGGEDGSC
                     DNLFLGSPISSDAKTNVSFSSSPLLSLLLDSVIDSGTFDDSVVGESGTAGEDATRDGR
                     GGGGGGNVGLGGDDNTNEAPPLLGGVAGEVVGVESEPSGSALRVVGGDDAPSLVPSSG
                     PFEESGGCPRSRSSTIASDSTTTDSESKWALRSCGSFEGEPSNDQKRSGIERASPARV
                     GFRPIGATPSDASSRETTPERRGRKSRLVDSREPSSSDSSRERPADDTANIPSRGGPG
                     GSSATEMPATRLRRSLPPSSRSDSTSRSPTNQTSTTTTPSSSPTPKRSRGRRTTVTAT
                     CDPIVPAPISRRRQSLDGRPSAATFPESSAARLGGNPRPVENGVITRDRAKRDGHPLS
                     KPLHTPPRKKKPPRSPEAQQQSDDDGHGDGATDDRRSSSDSGADLPRKTRRDHKISVD
                     EGTQKKHKTRSPSKGNERAKSPAAMTAEDEPKDTRGPGFVQRNLRRVASRVAREAAKR
                     PLLPPSPLRPSTPQQQLVNPNNSLSRHQTEDTGLEGGSEAVVSAAPDTTSGGEEEEVD
                     EIEAAEALSDALALLKGPGDEDDPLGDAVVPDGMTGVARVVEVVSDYDVECFAEILND
                     EIGGPLWWDD"
     misc_feature    complement(19312..>19893)
                     /locus_tag="MuHV1_gp018"
                     /note="Atrophin-1 family; Region: Atrophin-1; cl26464"
                     /db_xref="CDD:331285"
     gene            20338..20781
                     /locus_tag="MuHV1_gp019"
                     /db_xref="GeneID:3293912"
     CDS             20338..20781
                     /locus_tag="MuHV1_gp019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214027.1"
                     /db_xref="GeneID:3293912"
                     /translation="MSIIATPIPYHYVSPVHLEILKETRSETRTSDSNGMIFYYKRLI
                     LTARPPASRPGLLQSRGRDVLVRGEREEKASRKGGRVSRVTLVGPWATAPRRPSVPLP
                     GRVPRPYRRLRRRPRSTRLPPRRWHRAVPSSTRRHRRRRRRSRRG"
     gene            complement(20802..23045)
                     /locus_tag="MuHV1_gp020"
                     /db_xref="GeneID:3293913"
     CDS             complement(20802..23045)
                     /locus_tag="MuHV1_gp020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214028.1"
                     /db_xref="GeneID:3293913"
                     /translation="MARVWFLFAIGAISGVSASMPATNLTTRRNRRPPPLTALGGCDS
                     SVLRNASAVNLAHVLSVGMLKGTKIATVAGREDDDGIFLALVLGVTEQFVSQTVSGRW
                     TLDLIWEVEYNDTATGRSYSRMLLGPYRIPVMKTPLPGTNYTTSWGEPCAGVEVGSGT
                     GNTVVRVGLKVARPPKDVDYKKFQDLSCRLTVREHATGDKAVALGIFPMDILSNRISR
                     VGLHHWTASFHPADVAGKNGKDPRFESSPGFRFLVGTMLGAGTMTVIATVGILFAVIF
                     KIVTTLWESRYGSDSNRHFQRFENPVDAHMIFGARGLGRRDRPEGYRGLPGAVAGLVP
                     AAMTVGVAVAALTVLPTTALAAHQHQHQHQHSGYSHETSKWWSGGMGHVPSEFDKPRY
                     PPGGRGFKRCTSTTPDEPNASFYDAEEALTTYQDSGSETFLTFDCPDGDCVATCRFKT
                     RGQVLDVIIGWASQSGYELQDLHREWNDQRCNIRRVCEIEHYINPYGQRDKRIMCGNS
                     GTCVWNFGKWANDLAGMYRCAVYFTAMFSDLHNGNVSIGQVLVDYSNTKEKMLTAAHA
                     EAVVHGCSESTMTPYTESIIDIPLVYYRIGIFNWTFDSPDRTGDNGEPLRILAGAVLF
                     NRDMYDLIHGTEGADRAYVMSPTDTVWRDGGGNLTFRFVVRKAGVYRGLLTIDGVRRY
                     SCVFTVVEDQCARLQSGQRGESERIPQRRGRVARLSTYRSRTGAFLDDPREGRCWNSR
                     RVFGAVR"
     gene            22645..23334
                     /locus_tag="MuHV1_gp021"
                     /db_xref="GeneID:3293914"
     CDS             22645..23334
                     /locus_tag="MuHV1_gp021"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214029.1"
                     /db_xref="GeneID:3293914"
                     /translation="MTGIRYGPRSILLYDLPVAVSLYSTSQIKSRVHRPETVWLTNCS
                     VTPKTRAKNIPSSSSRPATVAILVPFNIPTLKTCARFTAEAFRSTLLSQPPNAVSGGG
                     RRFRLVVRFVAGIEAETPEIAPIANRNHTRAIANGSRRDTEGSGDLKILVTCLSWAPL
                     LFRLSVVSHRSSRSRENPTHRRLVTSDSRAGRPRRSRPNSQQATEKSPDTLPPPTAVD
                     KRAKLRQMVSI"
     gene            23586..23900
                     /locus_tag="MuHV1_gp022"
                     /db_xref="GeneID:3293953"
     CDS             23586..23900
                     /locus_tag="MuHV1_gp022"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214030.1"
                     /db_xref="GeneID:3293953"
                     /translation="MRAGGQAGGLVNRKAGGEAGRRVDGRLASGRRRSPFTIHTVPRP
                     YRGQTPARQAVAVRPVRPIRSPPFDGAHQSVDCLSHAVPPGFLLPGWFATMRHPIGRP
                     GV"
     gene            complement(23778..24953)
                     /locus_tag="MuHV1_gp023"
                     /db_xref="GeneID:3293954"
     CDS             complement(23778..24953)
                     /locus_tag="MuHV1_gp023"
                     /note="UL23 (GF2) P"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214031.1"
                     /db_xref="GeneID:3293954"
                     /translation="MAPPEALESIFSDFATVEAAVAANIGRRVRLHHPKGLSLCIGMR
                     WREIPAPANGGPPNECARLAALLCCHENIKFIGSVVASDSNLEGRQNTRSRLLNWRFR
                     NTGGGGGGDDTRGPRDPDEGLVSAAVVAAAAILGPALRAGGGAIYAPMSELPHYRQPP
                     EVYVGSSGKIYIYLLLTRSEAFAHVADSMREIVKDGIKNIYLPVRRPIICRGAASREL
                     TECRTNNDILSWRERNLANRVFLGDKSELSACDEFFVGYDVVALDGWAAEADVGAMDV
                     LGIIIEPLMLPPLTILTDDLCRVYVVQGVSSLCLIAEDYFEFVERGISRYHKNRYFII
                     DPLEAMLTKKTECPNNFLHSRATNGVPHGSEPTWEKKTGRNSMRKAVNRLMRSIKRR"
     gene            24826..25161
                     /locus_tag="MuHV1_gp024"
                     /db_xref="GeneID:3293955"
     CDS             24826..25161
                     /locus_tag="MuHV1_gp024"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214032.1"
                     /db_xref="GeneID:3293955"
                     /translation="MPMQSESPFGWWRRTRRPMLAATAASTVAKSLKMLSRASGGAIS
                     SDRQRFSSSRRWVGRGWASLGLLCVGVRGRGKGPCPDPPTCVPRSRLTIDRSTEKGGK
                     VGHGKTRTR"
     gene            complement(25148..26119)
                     /locus_tag="MuHV1_gp025"
                     /db_xref="GeneID:3293885"
     CDS             complement(25148..26119)
                     /locus_tag="MuHV1_gp025"
                     /note="UL24 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214033.1"
                     /db_xref="GeneID:3293885"
                     /translation="MDSTGKIGSRFDAACEPLVDDAEATVSDVLYELAHAAGRGSLEL
                     REKLFLFAGGNLRMAWPAGAVITFVPDIQGWEPQSGRRNRVLRYFCCDVFVYPIGYAS
                     GLKVADDTLVLVDVFGRFYCYRGPPDDAIYYLAASPEQFSVIGFRYFYPIHCTAGPIE
                     IGLLLSRLWMMIRRGADADAVCRFVVRAHGETVVVARRLVGRREVLRVCSLGCSRWRK
                     RDSSGRLHGYAPCPPPLGEYSTVPLGRVKKGLPQDPGIAVFVGLPSGRVYARQAGDSS
                     YYLIADSIPGFVGIGATRYFENRRFGLISERDSGRNCERPPPRLSEF"
     misc_feature    complement(25151..26119)
                     /locus_tag="MuHV1_gp025"
                     /note="US22 family homolog; Provisional; Region: PHA03338"
                     /db_xref="CDD:165582"
     gene            26015..28813
                     /locus_tag="MuHV1_gp026"
                     /db_xref="GeneID:3293886"
     CDS             26015..28813
                     /locus_tag="MuHV1_gp026"
                     /note="UL25 (GF1)"
                     /codon_start=1
                     /product="UL25 family homolog"
                     /protein_id="YP_214034.1"
                     /db_xref="GeneID:3293886"
                     /translation="MSQFVQHVADRGLGVVHQRLARGVEPRADFPRRIHLRIRTLPRD
                     GDVQLYKITRAGVCVPAVLFPVPARPFRPRTPVREPPLTRTMNRRSSKDRRMFVTDDS
                     SDDDDDDVMIMDPPETTSSSSSALATAAGIRGVPHAPASNSATAAAASESTYKPLSIP
                     SEELNGEEEERDEEDMSRDGPRRHSQDDDFTYADPADVRLRAMMGNRYGGQSRSAATA
                     GAASRNDSGSVSPVTLFDEDGYAIIPDPPTSRDDSRHVVVDDDDDGDYDSHYGVMTVA
                     PSPPKLPRKSRPSTKKSAEEKQSSTAGRSRGRSTARRTPKKAQETAPAAAAGSGARQK
                     QRQQQQQQPPRRQSYHPPPDYPPPPPPVQATVSRPLPRTPNANDDDDDDDNDEPGPSN
                     TRRGKTPCRRVDHTENNHLYETPISATAMVIDIEDDEDEETGGAADDASIVVEDDDEE
                     EENDCEEICDGEEEPAAAAAAAAASSSTPHRTQPLPVPPSSPRITRELGFLPGVVSGQ
                     DARFIAACLHHSHAPQVDIINTCYPMPPYTLDALSEPVLTKKALRCAGVLRPVIKLAI
                     LVNYYCVGIGRLARARALSKDLMTPPRIETLRRRLEGLLPQQTSPSPPMCLRVLGRLN
                     ITAAQHKASCDTIDQLMKPMQERERRRQKTQCAQLFRSKNLLFSPPRFTREGAKTLYM
                     RNIKILNSDEEDTTLNLVMTLNPHPTREDVLNDAIFCLSLGNFVYNFSRALEELRGMI
                     RCQFEDLTETLYAAYYQCPIMRDDYRVLCSEVANEITSPREDGQGLSALCRRSLAFAR
                     RCYNEGVFFSPSYVKYLIKCAAMEEAGFEGYSLESAARSLANPDIFRPLPDESSARRM
                     LRRTIHFVRVDGTPSSSRQIPTTHIPTHANYELFLQASRMIVPQQQQSRRSSTPPPSS
                     SPPPPAAGGPKYSKRTFL"
     misc_feature    <27494..28696
                     /locus_tag="MuHV1_gp026"
                     /note="Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV
                     UL25); Region: Herpes_pp85; cl27999"
                     /db_xref="CDD:332820"
     gene            complement(28998..30602)
                     /locus_tag="MuHV1_gp027"
                     /db_xref="GeneID:3293888"
     CDS             complement(28998..30602)
                     /locus_tag="MuHV1_gp027"
                     /note="UL23 (GF2)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214035.1"
                     /db_xref="GeneID:3293888"
                     /translation="MYPTVARRLRLRFRNAPGIIQRRRLILKQRAKPLHRRFTTVYIW
                     TFWHGGRLKLYQTAYGRFHWGRSRGLCHSSRRVKAAQTRRISGYVLQDRHQEVFSQLS
                     RGTEQMWGRQVLFESGLRRYDGFGDVGNSRYIPRLGPVAPPPALPRPPGLQLSLPLAS
                     LPPPPSTITLPLSSFVPVTTAPVTVAQPLAIPLPPPPPPAPVPEKSPPQRIIEPEDFA
                     RAVNNPDLCREFVKIRKGWRMPLTWPKNYTLWLETEAELRMPVGEISRLSQEYLCCPE
                     DLIVLGGVRRSTGDDKNEDLGVLFAGEEGRVYIYAPDVDDAIYLVGDSPEGFIKRGLR
                     RFYPIYREIETDGCSAGVTEYLERLTKSTALSIAKFSATYPGTVFSLPWPTGAYIKTI
                     PPRRRKFVTGRGSDTMVYFAAVIGRYLDPVFREVLLAVNEKGAIFSYNPWDDEITKIC
                     EGVMQLFTLGLRGIKKNYRFRARLPVALGDRPPKCPHVSPVFFTGQDLCGENSTLRCL
                     GRSFNLLAKGGSENDDNNADINKVRH"
     misc_feature    complement(29193..>29933)
                     /locus_tag="MuHV1_gp027"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03175; cl28637"
                     /db_xref="CDD:333457"
     gene            complement(28998..30281)
                     /locus_tag="MuHV1_gp028"
                     /db_xref="GeneID:3293887"
     CDS             complement(28998..30281)
                     /locus_tag="MuHV1_gp028"
                     /note="UL23 (GF2); translation started on the 2nd
                     methionine"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214036.1"
                     /db_xref="GeneID:3293887"
                     /translation="MWGRQVLFESGLRRYDGFGDVGNSRYIPRLGPVAPPPALPRPPG
                     LQLSLPLASLPPPPSTITLPLSSFVPVTTAPVTVAQPLAIPLPPPPPPAPVPEKSPPQ
                     RIIEPEDFARAVNNPDLCREFVKIRKGWRMPLTWPKNYTLWLETEAELRMPVGEISRL
                     SQEYLCCPEDLIVLGGVRRSTGDDKNEDLGVLFAGEEGRVYIYAPDVDDAIYLVGDSP
                     EGFIKRGLRRFYPIYREIETDGCSAGVTEYLERLTKSTALSIAKFSATYPGTVFSLPW
                     PTGAYIKTIPPRRRKFVTGRGSDTMVYFAAVIGRYLDPVFREVLLAVNEKGAIFSYNP
                     WDDEITKICEGVMQLFTLGLRGIKKNYRFRARLPVALGDRPPKCPHVSPVFFTGQDLC
                     GENSTLRCLGRSFNLLAKGGSENDDNNADINKVRH"
     misc_feature    complement(29583..29945)
                     /locus_tag="MuHV1_gp028"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(29145..29924)
                     /locus_tag="MuHV1_gp028"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     gene            complement(30245..31657)
                     /locus_tag="MuHV1_gp029"
                     /db_xref="GeneID:3293890"
     CDS             complement(30245..31657)
                     /locus_tag="MuHV1_gp029"
                     /note="US22 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214037.1"
                     /db_xref="GeneID:3293890"
                     /translation="MPASSCTSRTTSRSSSRTASLEGTSRYSATCVRASYRRSSRSAS
                     VTSRGLPGYRRPSASGCPSSSEAYSAPGSRPRGSAGRSDSVPRIFRTGCLRRPWLCPT
                     CERRRRRRPPLRPWRPQRRSDTVARKRTRSRTRTRIRNGAKGDQTMLAPAAAVSMPES
                     ETETVTVVPARSTLAAKAAAMRKAYAVNRLLALGRAAAEGKLEQWLSARRGERIPLVF
                     PEKCAKYLILCAPGDVDGHECDPDALRALEPAVDRLVVVGFVEGREDAHRDGDDRCIV
                     LVNPSSAVFIYDPAPYGGLYRLANTMIGFVRRGLRRFDSIYRDPCCVEDAIRVKDGHA
                     SLPRNADEALAAAERGLVCTLQWPEDYDFVFGTPPESSNAVASSLNKEQSPCIDALRL
                     STFGHFGTAAGLNSTRPRTAVFIGADHAVYAIHHAVSKLLRLAESLDMFYKIGIRRFF
                     HNYRVVPSRCGDDRFFLKAV"
     misc_feature    complement(30707..31054)
                     /locus_tag="MuHV1_gp029"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     misc_feature    complement(30299..30631)
                     /locus_tag="MuHV1_gp029"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(30245..31216)
                     /locus_tag="MuHV1_gp030"
                     /db_xref="GeneID:3293889"
     CDS             complement(30245..31216)
                     /locus_tag="MuHV1_gp030"
                     /note="US22 (GF2); translation started on the 2nd
                     methionine"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214038.1"
                     /db_xref="GeneID:3293889"
                     /translation="MLAPAAAVSMPESETETVTVVPARSTLAAKAAAMRKAYAVNRLL
                     ALGRAAAEGKLEQWLSARRGERIPLVFPEKCAKYLILCAPGDVDGHECDPDALRALEP
                     AVDRLVVVGFVEGREDAHRDGDDRCIVLVNPSSAVFIYDPAPYGGLYRLANTMIGFVR
                     RGLRRFDSIYRDPCCVEDAIRVKDGHASLPRNADEALAAAERGLVCTLQWPEDYDFVF
                     GTPPESSNAVASSLNKEQSPCIDALRLSTFGHFGTAAGLNSTRPRTAVFIGADHAVYA
                     IHHAVSKLLRLAESLDMFYKIGIRRFFHNYRVVPSRCGDDRFFLKAV"
     misc_feature    complement(30707..31054)
                     /locus_tag="MuHV1_gp030"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(30299..30631)
                     /locus_tag="MuHV1_gp030"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(31347..31925)
                     /locus_tag="MuHV1_gp031"
                     /db_xref="GeneID:3293891"
     CDS             complement(31347..31925)
                     /locus_tag="MuHV1_gp031"
                     /note="UL26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214039.1"
                     /db_xref="GeneID:3293891"
                     /translation="MGGECLRGCVQRLRGIEVALPFPTGYIFYIGGEEDTILTSCDLH
                     FWRMHPLMCGELTVIGTLGHRRTFAWDRRVVGVNAVGQVFTYEINDACFIMYVSDNLT
                     QLISDGVSRRYIQVQRDLREGVLPQIVEICQCNEPRSPWLPPSFSQWLPVELGGVLCA
                     RVPAERIRRPIRLRPADFPDGVFKAALALSHM"
     misc_feature    complement(31593..31925)
                     /locus_tag="MuHV1_gp031"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(32247..34295)
                     /locus_tag="MuHV1_gp032"
                     /db_xref="GeneID:3293892"
     CDS             complement(32247..34295)
                     /locus_tag="MuHV1_gp032"
                     /note="UL27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214040.1"
                     /db_xref="GeneID:3293892"
                     /translation="MADRGPCAEGSGGTVRRRSSPSESSEVDDTQFVFELVVDETADS
                     FCRRFIADHLVQLRNYEQASRFGFVMDAWSRESGKATEIRSFIRLNKPFNHIELKYSY
                     LKNARLATANGGYGIRGLTLAWDSAIWGLLREIEFVPFANPFSFPSCDGIAKILFDLE
                     WRPEASDSCKALGRATVAIQYAISLLYGYDRSASMSRYLRRLVNELIDLHDRMRNMSL
                     MSSLRIPGHDLEIVQRLLPERICQQLGIPFSFESCLLDSYYEYVEMTMEVIYDQLCYC
                     RECRMRRGERLERLRAQKIGTKYRRRNPDGIRLFEENYVRVAAYPNIGVLRLPKIRHL
                     SDEHQTLVCGHLARDLMYDVHFGSSSPLARVNGIPLPFTAVDCMDIDLGYALYMANNV
                     YFMLFLIRCVRDVVRSEQREYVDLVTGLVREASVMLRRDVDARIRAGADRPVFVASDP
                     RQDGISDEERDLSIANALDRLTFSDERPDGYEDDDNEALERMFLEQRYERMGGFSRDA
                     AKFMDLLDAFRVPKALRENRAREELLLHTFFIKRMYDERPLAGFYGDRLIPYYMFVGG
                     YRRRDGAVIRMGAVTLSDTEIVKGHWRADDLVGMRLRYYDTFEYVDMLRNISVNKQTL
                     MMELDRLYVPKRELVELVISDKDSSGSDEETEDADSGHSEPSDDGGESDGSEFVVERV
                     "
     misc_feature    complement(32277..34088)
                     /locus_tag="MuHV1_gp032"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            complement(34486..35778)
                     /locus_tag="MuHV1_gp033"
                     /db_xref="GeneID:3293893"
     CDS             complement(34486..35778)
                     /locus_tag="MuHV1_gp033"
                     /note="UL28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214041.1"
                     /db_xref="GeneID:3293893"
                     /translation="MSLEAVGMRIISDDDLDEVFLRDDEQGDPVADDIPAAAAAVDPA
                     PTPPTPPIPPVAAFSEMVIQPTVPVPTSVASKTPVVPVNVVTGTAQRVDLDSGSRGTS
                     VDNFHARGELLRCARACNGSSFDEVKAFVKRNTGRRFGLDHMADITLRIGDADNICPT
                     FDVEKLLGYRCSERSSEMTVVGRIVFGARSHGDLIAVYTGGDRCYVHSQDTDLLYIVS
                     ERGLVDLLSREGHRHIYEMFDAPPTTGDDVEVPSCLLPLTELRDLESIECFVRDRTGL
                     STFRQASNLRFMGEFFGYFMVGDEESLRLGQVVPGRVFFYLRRAGYRVIGRSEMQFIV
                     LCNEKLEVFVLLGGARVLKVANTIAGFLRDRLRINLQPYRRVFARNGVAERTVCVGQV
                     VNFYCEIDYVVPGGADFAKWLALRAPSGIAETCVPTLG"
     gene            35747..36730
                     /locus_tag="MuHV1_gp034"
                     /db_xref="GeneID:3293962"
     CDS             35747..36730
                     /locus_tag="MuHV1_gp034"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214042.1"
                     /db_xref="GeneID:3293962"
                     /translation="MIRIPTASRLISTDFYLGSAEKTKEIEMHTEKKLLPEWLYAIAR
                     NRNAHYSYDRTTNLLYDLSWQMAKPPAWRPFGALSRPQVVGLAPLLLPHLLDGGVSPA
                     RFSDRDRRWLSLLADRDTPHEQRSGVSGNNRGGNGAAAGGGCGGCVGGSAGVAADEAT
                     AAGMVAVTAAPWSPFLLRLAFRSERRFSLEHASILFIRRFILSISSKVATKSFMSEPR
                     QASASLSSLSLPPPLSLSSSSLDASMEWYLACTSSATSLSKRASSSLVNIVASRDTTF
                     MSLTGIRPAPAKLTMRSKALPHNSSLVSITVRETRPPDQRRRSRIYRHKPR"
     gene            complement(36109..36660)
                     /locus_tag="MuHV1_gp035"
                     /db_xref="GeneID:3293795"
     CDS             complement(36109..36660)
                     /locus_tag="MuHV1_gp035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214043.1"
                     /db_xref="GeneID:3293795"
                     /translation="METKEELWGKAFDLMVNFAGAGRMPVSDMKVVSRLATMLTKEEE
                     ARFDKEVADEVHARYHSILASSEEDESESGGGSESDDSDALACRGSDMNDFVATFEDI
                     ERMNLLMNKMLACSSEKRRSERKAKRKRKGDHGAAVTATIPAAVASSAATPADPPTQP
                     PQPPPAAAPLPPRLFPLTPLLCS"
     gene            36884..37729
                     /locus_tag="MuHV1_gp036"
                     /db_xref="GeneID:3293796"
     CDS             36884..37729
                     /locus_tag="MuHV1_gp036"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214044.1"
                     /db_xref="GeneID:3293796"
                     /translation="MEAPETERASPPSSRRPDADNISRLSTTSSRERSRSRSVSRDHH
                     RDKSRSVSVPKPYKDRYRPPESRPSSSSSHKNAETPRERRSVSAIKEPAPAPQIRSCS
                     VNIGGSSVSNSAAVTESGCLKRSAQTPPSPCRRSSENRTRRPPQRRAPVSAASRAPGR
                     HQLPSSGAAHRRGRTPTRRITVPLSKTCVVSRTSSIRIMRSTSVTPPPSPKLIPQGCA
                     DPWRLSAKRWTSACNSPPSSSGHPVRRWRSMPEISMLRSSCCTAHRPPSWTRPQSLCA
                     IPATA"
     gene            37279..38829
                     /locus_tag="MuHV1_gp037"
                     /db_xref="GeneID:3293797"
     CDS             37279..38829
                     /locus_tag="MuHV1_gp037"
                     /note="UL31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214045.1"
                     /db_xref="GeneID:3293797"
                     /translation="MQAKQRKPDTTTTPEKSASFGGLKSPRSAPASVIRSSPPQRKNP
                     DATHYRATIEDLRRLQNILDPHHAVDERDTTAFSEAHPAGLCGPLAALRQAVDLSVQQ
                     PSIIVGAPSSSVALNAGDFHAQVVMLYGSQATVLDTAAESMRDTCNSMIAYTNSIDAS
                     CPDTRVKLDRTERRHVSNYRYRLALSASQYNEVVPSELRARYYKGAIHFATAVIGTMF
                     RTSDELTYTWTTLLVPRVSNIPGGQFLLCSLKGNAAVCQPTVTTGGPHTILLAHDPSN
                     VPPDNRPVRLELSAFFFVPYVAPDFGVRMLTLEDAAIRASGISFGIMTPVRRTGGVCI
                     GLFSALSWTPRTIMNENGVSTTSYVAWFECTQENSYSLCKYWRPYRKVTYECGDFEAG
                     INVESMYVVDGGRRLIGTLVVGSDTTTNTPSLSPELMPSMIVLRFELCNSRHREPTIV
                     FSTNPTLHLTWPSESPDDPITMYAPYDLCFREGKCAVFMDIRYAKAADNRCFFISGVP
                     ASTVSTPG"
     misc_feature    37801..38802
                     /locus_tag="MuHV1_gp037"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            complement(39280..41436)
                     /locus_tag="MuHV1_gp038"
                     /db_xref="GeneID:3293798"
     CDS             complement(39280..41436)
                     /locus_tag="MuHV1_gp038"
                     /note="UL32 (pp150)"
                     /codon_start=1
                     /product="Tegument protein of HCMV"
                     /protein_id="YP_214046.1"
                     /db_xref="GeneID:3293798"
                     /translation="MSARGRAAGDDGRQAELMATLGFVRLSKSSVGKVKKFLNNLYDL
                     KSINLCRHPRVIAECRGTDLSRETQLYNEMVLWLRYHEKLTARRPGHLPLLTRIRQDY
                     DKLFGFVAARPELCGFDGLTEVNVFDDAVYGDDYVPRVDVFLRGLEDLARCLCAQGPD
                     KPARAVIMGFINMRAEEVNRLMDNVRDAAERVLVYEVLDVRDPLNEDPSVLVHNRLVY
                     LCRLAYAISKSWQTLSHMCLDRINSLRRRLILAFHDRPAFARVYARNALERPVDGTTA
                     YNLLRRLEEDFLLFRNALRWGDPDWGLESELESEGDNSDAGSDLDLEDEEDDDDGGGP
                     GGHDDESGGNRTPDPGMSLHDDTGIANTCLIGGDDEDCGGGSGRCLEFDPDSERCLGV
                     KMVNGRALRWWNPTGIMVDNEAAVWIDEHGRVMDKPPPKELRKASSDDGGNKKNPPPK
                     KNVTPPVSGSNSVGGGVQTPSTASGKRTGKKKEGGGGYLLRSRSTDDDEVRKMKKDGT
                     IDDRADRELKMALQKARESTADSDLSTILPRTEPLRKVAFVGDPVAAFGDTVRTTSSS
                     KGFDDGPFTTQGASVLLPPPLGGPGSTLTLPPDLPDLSGVLADEDVQDSRYGKIPKSR
                     TKKHPTFPENYKQRPPPHNKDDEYYWDETGDNMPVGEDGGGVLEDLRKGLEGIDLKTG
                     GGGSLQPPLSQQFAGSPFAGSDGDGGGLVKKSSSSH"
     misc_feature    complement(<40558..41379)
                     /locus_tag="MuHV1_gp038"
                     /note="Herpesvirus large structural phosphoprotein UL32;
                     Region: Herpes_UL32; pfam06070"
                     /db_xref="CDD:283680"
     gene            43083..45647
                     /locus_tag="MuHV1_gp039"
                     /db_xref="GeneID:3293799"
     CDS             43083..45647
                     /locus_tag="MuHV1_gp039"
                     /note="UL34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214047.1"
                     /db_xref="GeneID:3293799"
                     /translation="METASASRGVGATDRTFGRSGHPRPGADPRSRRPPAAEDTRTDG
                     GNGRHRHRRRKRSRSDNNNNEGVRGAFIKRPRSFSKSSSSTRDQTTTKTTSSSGPAGT
                     PHAPRPRHSSESTTYRRPDHPFDRHHPPHHRHSSSSSSQPHHPPQHVSSAPPIHHLER
                     RRSDPVRAQRRYSDREQQHQQQQQGGGGNGRKESGGGSRHEPPTQPPPSHHRETTMPS
                     SAPSKIVRYEAAHRYTMAEGFIRSVSGTYKMMNRAEDRKRMLSNQLPSCIKSKSIANS
                     FIFCTSSDGDILESEIASMRRHQKHITDFSKLDRAIHGVSCRIRKHPISPNLSEQQVA
                     MIRAIRIIAISFNRITYVARVKHYCDKDSRFSNYLRDQLTKRCSEGSRLNLGIRRFIS
                     SVNVEKNRDLCMILVGMLCQTPHMWARSIRLLCRLKIFYQNVLIKMFADEKIDLRDVF
                     ELQYHSTGYKIQSQIRQYTSSAFVLNDAVGTVVNMIRQRQSSSSGGAMLPGTVAALPP
                     DPHHHHLHHHSSSSSSHHHHHHPHHHHSPHRFEDDGVVGDEAMVVDQSGFPSFSPPKT
                     PIIREDILDEYIFYPRPGTLSDVSSDTDSPRHHRDTDSDTGRSSVASRSSRTPPFAEA
                     AEETSDLEEEDGEETAKSTPTFDSDPFSPGRGGVVGGEEEEEEEENNKRASSSKSSSR
                     GGSSTCSSGSSSGGEGDSSDSSTGGSRSHTGSPTLSDRGNTPPLPPPPPLRHRPPPPV
                     ASSPSPPPPPLHHLPPPIDSIGSHDMMTMGGEEEGMMMIVDDLDAFHHQAQQFHHPYH
                     HYSPSPHELGYFSPNEINGSPPKNFISVHVGRSTPPGAAAAAAAAQKHSECINILL"
     misc_feature    43764..44873
                     /locus_tag="MuHV1_gp039"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            45909..47468
                     /locus_tag="MuHV1_gp040"
                     /db_xref="GeneID:3293800"
     CDS             45909..47468
                     /locus_tag="MuHV1_gp040"
                     /note="UL35 (GF1)"
                     /codon_start=1
                     /product="UL25 family homolog"
                     /protein_id="YP_214048.1"
                     /db_xref="GeneID:3293800"
                     /translation="MAAPTEEDPRRDTSLMINERCNFPHNMLSEENINFIQDAVCNGD
                     LGAVAALNSGLPMAPYMLEALLAVRVKHRLTKVRQTLEPVICYTISVAHLINGTRILR
                     SATAKHATAWGPNDKHRAESGLRRIYRALNLEDNPFDLVEAVGDLDLSQGAYEGYVRH
                     IYSLMKSLGHDVGHLSRSLDYSTMTVFNYLYESPLFTSQEAVTMYSRNLAGITKMSRE
                     PFETLSVVHRSKEPPEILNDMLFLLSVGRMIVLHQESLRALRKNLILTASALCSILYT
                     AYTQVPETKSLFREVAHEAHALLSSRSPDTPNFRPFVACMLQFIKQIIAADVYTCPRY
                     LTNQILAVTARMHGLEGAAMGHDDDLDIEVDPGNPYSAKYRMNNPYNDQNIFKCPRSL
                     VHYVGDALFKKTMTQELLVSCTDQEATYQTYELPSVSELVGEGVAKRAHLTPDQLSHY
                     LSVVSTPVEVVTDDIEDGEQEEDLFADVSVAPASPVRPIRGGGQRMANMRGARPYSTV
                     QRGRRRHESEV"
     misc_feature    45909..47465
                     /locus_tag="MuHV1_gp040"
                     /note="UL35; Provisional; Region: PHA03250"
                     /db_xref="CDD:165509"
     gene            complement(49441..50478)
                     /locus_tag="MuHV1_gp041"
                     /db_xref="GeneID:3293801"
     CDS             complement(49441..50478)
                     /locus_tag="MuHV1_gp041"
                     /note="UL37"
                     /codon_start=1
                     /product="Glycoprotein present at IE times"
                     /protein_id="YP_214049.1"
                     /db_xref="GeneID:3293801"
                     /translation="MVLTHKSESRADSLVRMTAGGLGIAAVATRATTLCCCLAIAART
                     AVSGPESGVFECSYDVCLVQRKDNRTSVGCIVDCKYGSELVFSGSCQDAFTLVSTWFG
                     KVNRRWSFRDIQLVDIGIAYYFTGYILRPLSSCPGLVSHRADGRTSSFSGKGRCHPDG
                     RGSVELKTTMDGGFRLEVDSSKSSDTNWVSDDGNHTETVQFLMKNISLDVYVFRACPD
                     LLRAVSVGHRSELSPGIMERTAVIRRDACSGGTATGNWSTVWGNWTKYCEMNERFVRD
                     PGFLVAMHGYVAGDPLPKMVGMFFFVFGGLALLILFCFMTIRQRESLFKDMRGQSSLR
                     LRNEDFAAENV"
     misc_feature    complement(49498..50319)
                     /locus_tag="MuHV1_gp041"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03170"
                     /db_xref="CDD:165441"
     gene            complement(50462..51955)
                     /locus_tag="MuHV1_gp042"
                     /db_xref="GeneID:3293802"
     CDS             complement(50462..51955)
                     /locus_tag="MuHV1_gp042"
                     /note="UL38 (72)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214050.1"
                     /db_xref="GeneID:3293802"
                     /translation="MAVSTTTIVPNTERMFANAMDRESAIRAAKLVQALETSTYTFVR
                     TLRECTIQKMEITHSSGLVISVCDSSYEHLTIKEPALSWIRRDFCPLSGPLMIIFGVA
                     EEWRFASNRPSRQVIFIIGRDGVVMAYDRGVMFYICPSLQDFWTADIVFEHDNSIFPS
                     PLRRYVKQLNIDLKDLMGFYNKLRLQRVIIESKEKRQKSGTVLPLKCNRLMRILISAA
                     SAIQQGSIPPLFSDRATLHQNVDMGFLEMYWKSRRYVPQQSAQNGVVRRNGTIILEST
                     PRGSQSIQSTPCIDLAAASPPIARRAIEGPPMPMTVTLISSPPMFRVPVNPVPGGGGV
                     PSSPVPVDLSVRGPAPGVHVLFGPVDEEDENDDNAFNSVRFAVSPPRDHTEPPCIDLT
                     LDSSEDQQEQPMDLTVNGSPPVALSYNGCIQVASVPRKRPAPEDSRVLEDGSVGAKIT
                     KTEECFEQKERGDAQLWGPAVMTTSIVLGAEGAPRVCDRASSDGPDT"
     misc_feature    complement(51518..51835)
                     /locus_tag="MuHV1_gp042"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(52484..53200)
                     /locus_tag="MuHV1_gp043"
                     /db_xref="GeneID:3293803"
     CDS             complement(52484..53200)
                     /locus_tag="MuHV1_gp043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214051.1"
                     /db_xref="GeneID:3293803"
                     /translation="MLCTQFLGILFGATHLLVRGEDAVRIFVRGQERVIKTYRYGIDK
                     MPDFPNGSSICCGACDLIGHNTIVRQGLAPEYAVLCVIGGFTAGVFFAFLVDRIVGSP
                     LPVTFAEGGRALLASAFPFLRKKWYSDEALSPTVQVVCTDLDPEMGLPQQSHPPPPPP
                     AAAKVFVGGDLSKKSKARQAVAIADALEMQMMRSAGAHGGAAGGQYPLPRFQLQQSDE
                     DDDYDGVDDGCYENVTVHNF"
     gene            complement(53265..53630)
                     /locus_tag="MuHV1_gp044"
                     /db_xref="GeneID:3293804"
     CDS             complement(53265..53630)
                     /locus_tag="MuHV1_gp044"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214052.1"
                     /db_xref="GeneID:3293804"
                     /translation="MSGRGGGTGTVGVLSRTILSDEEVTIFPESSAVLNLSGTTTVGR
                     GENDVGTIRDGSGDASLLHLAWWRTESVFYFMIAVVLSVVLLCGAWFAYNIYAVRREF
                     VRHDRAGGARWTRLREESR"
     gene            complement(53783..54199)
                     /locus_tag="MuHV1_gp045"
                     /db_xref="GeneID:3293805"
     CDS             complement(53783..54199)
                     /locus_tag="MuHV1_gp045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214053.1"
                     /db_xref="GeneID:3293805"
                     /translation="MGDDDRRGDDGGVYGSGSADGEKIAAPANLSSRPPRRPNLRRLG
                     GLFTMPYRELGGSTPSLGDNVSSEGVIFVGDHARLELFPVDANGVAIPARPPRRVGTV
                     AKLCNGVRKKITPDVVYASVLAVICIVILIVVIIDR"
     gene            complement(54352..54843)
                     /locus_tag="MuHV1_gp046"
                     /db_xref="GeneID:3293806"
     CDS             complement(54352..54843)
                     /locus_tag="MuHV1_gp046"
                     /codon_start=1
                     /product="Possible glycoprotein"
                     /protein_id="YP_214054.1"
                     /db_xref="GeneID:3293806"
                     /translation="MTSSEPEHRLPTYLEAVGENARYETVFLNDTATTRLVVTNLRQQ
                     ADDDPPPSYESLFGNNDERRARDNSSLRAALRGENSISISVSSSTASTTSSSTEVAAR
                     ALAADRARTASERLRRTLSLERMDKEFQWTAITVGVCVSLLVILVLVITAVVTGRGGG
                     GDD"
     gene            complement(55351..57144)
                     /locus_tag="MuHV1_gp047"
                     /db_xref="GeneID:3293807"
     CDS             complement(55351..57144)
                     /locus_tag="MuHV1_gp047"
                     /note="UL43 P"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214055.1"
                     /db_xref="GeneID:3293807"
                     /translation="MTTTLTGPCPSCRRRAMARELGYTLAVTARWRRNITSVPAPFSM
                     YPERLADARFRPQPRIIRTLDTRSEARGRAVVRFSAPRGRDWSPSDDLTALIDKLTPR
                     ERSFRKKGRGGETAAAAAAAAAAEKSREEEEIYENVEPTVKGAAAAATASTSAAACSL
                     DDGRSSNKDKRKSIISACGVAATLKKSRVRRRSSTRNDIFDNDEHHTTSNKRKSTDRL
                     TFTLDRHSLIGAPPTLPDPVQLSKDFVEKLAARLSQVDSKMILCTDETLYIHELIAAR
                     DIRRLNCLIYRFHLHHVLLTWPPGWVFTVIDATRSPRLQKASAAVVRDGHVCCEQNLI
                     AIGVVHDLGREPSEAEYPVILVNLDGFVYMYDDGGVVPVLHLLTKCGFSDFCRRGLRE
                     RCGIGLDAGSTPIDYTEDPLKSILESRSSIDDLVVSRDRLLGAETAIFHSDSMWTLLT
                     VSNLCDTGYDSFDYECWKHETGQCRLEPVFMVKACVSGVWVNAPILVSDGGTVYYVDP
                     GHGNIKFLAADLFTFLVLGVMRFRNSNCFLPNTFPQRRLEDPRPGQPIRPVFCPLGQR
                     CRRKRRVSIISRFWHWLWGTWGYVTVCCRHQ"
     misc_feature    complement(55357..57120)
                     /locus_tag="MuHV1_gp047"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03175; cl28637"
                     /db_xref="CDD:333457"
     gene            complement(57885..59120)
                     /locus_tag="MuHV1_gp048"
                     /db_xref="GeneID:3293808"
     CDS             complement(57885..59120)
                     /locus_tag="MuHV1_gp048"
                     /note="UL44 (DPAP)"
                     /codon_start=1
                     /product="DNA binding protein"
                     /protein_id="YP_214056.1"
                     /db_xref="GeneID:3293808"
                     /translation="MEGGRKVREHEPPTLAFRLKSYKTAIQQLRCVVRSLKENTTVSF
                     LPTPALIVQTVKNQFIAKIVFNSSCLYITDKSFSAKTINNSIPLLGNLMYMTSSRDLT
                     KFTVQDTSDLSAKVCMSAPDYNMEFSSACVHNQDIIRETGDSAARVDLDSAVVGELIR
                     WIAPNIRPKRNSKKQSTSSSTVQITLHANPPTVKFSLGCNSELEFTASNRIAFHEVKN
                     LRITVQAKNLHQALCNCVVTKLACTLRVMTDHETMLYVASKNANFTIENFLSEEPFVR
                     GDVGFDRMPVANSNNYQNSSSSAGDDFAACVDQVIDNCTKKHERVSRKAGGGGGGGGG
                     VVVNDDHQGGGGSGKDNKYDQHKITSFMVSKGAVGGGAGGGGSDRGGYFNDTKEESDS
                     EDSVTFEYTPNTKKQKCAA"
     misc_feature    complement(57891..58769)
                     /locus_tag="MuHV1_gp048"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            complement(59515..62876)
                     /locus_tag="MuHV1_gp049"
                     /db_xref="GeneID:3293809"
     CDS             complement(join(59515..62145,62769..62876))
                     /locus_tag="MuHV1_gp049"
                     /exception="nonconsensus splice site"
                     /note="UL45 (RRL); the N-terminus was extended to include
                     stretches of similarity with other Betaherpesvirinae"
                     /codon_start=1
                     /product="viral inhibitor of RIP activation"
                     /protein_id="YP_214057.2"
                     /db_xref="GeneID:3293809"
                     /translation="MNGVSGIQIGNHNAMSIASCWSPSYTDRRRRSYPKTIRILTCRF
                     GTTSSSSDGDRGRRRRSVVFLVRERRRPRRIRRSAHRRAPRQGRDAPPDPDDDGHSRQ
                     QALPRGARQRRDALFDDAVESVRCYCHGILGNSRFCALVNEKCSEPAKERMARIRRYA
                     ADVTRCGPLALYTAIVSSANRLIQTDPSCDLDLAECYVETASKRNAVPLSAFYRDCDR
                     LRDAVAAFFKTYGMVVDAMAQRITERVGPALGRGLYSTVVMMDRCGNSFQGREETPIS
                     VFARVAAALAVECEVDGGVSYKILSSKPVDAAQAFDAFLSALCSFAIIPSPRVLAYAG
                     FGGSNPIFDAVSYRAQFYSAESTINGTLHDICDMVTNGLSVSVSAADLGGDIVASLHI
                     LGQQCKALRPYARFKTVLRIYFDIWSVDALKIFSFILDVGREYEGLMAFAVNTPRIFW
                     DRYLDSSGDKMWLMFARREAAALCGLDLKSFRNVYEKMERDGRSAITVSPWWAVCQLD
                     ACVARGNTAVVFPHNVKSMIPENIGRPAVCGPGVSVVSGGFVGCTPIHELCINLENCV
                     LEGAAVESSVDVVLGLGCRFSFKALESLVRDAVVLGNLLIDMTVRTNAYGAGKLLTLY
                     RDLHIGVVGFHAVMNRLGQKFADMESYDLNQRIAEFIYYTAVRASVDLCMAGADPFPK
                     FPKSLYAAGRFYPDLFDDDERGPRRMTKEFLEKLREDVVKHGIRNASFITGCSADEAA
                     NLAGTTPGFWPRRDNVFLEQTPLMMTPTKDQMLDECVRSVKIEPHRLHEEDLSCLGEN
                     RPVELPVLNSRLRQISKESATVAVRRGRSAPFYDDSDDEDEVACSETGWTVSTDAVIK
                     MCVDRQPFVDHAQSLPVAIGFGGSSVELARHLRRGNALGLSVGVYKCSMPPSVNYR"
     misc_feature    complement(62826..>62876)
                     /locus_tag="MuHV1_gp049"
                     /note="RIP homotypic interaction motif; Region: RHIM;
                     pfam12721"
                     /db_xref="CDD:289491"
     misc_feature    complement(61252..61509)
                     /locus_tag="MuHV1_gp049"
                     /note="Ribonucleotide reductase, all-alpha domain; Region:
                     Ribonuc_red_lgN; pfam00317"
                     /db_xref="CDD:278732"
     misc_feature    complement(59641..61461)
                     /locus_tag="MuHV1_gp049"
                     /note="ribonucleoside-diphosphate reductase, alpha
                     subunit; Region: NrdE_NrdA; TIGR02506"
                     /db_xref="CDD:274170"
     misc_feature    complement(60049..>60576)
                     /locus_tag="MuHV1_gp049"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:299130"
     gene            complement(61764..63038)
                     /locus_tag="MuHV1_gp050"
                     /db_xref="GeneID:3293810"
     CDS             complement(61764..63038)
                     /locus_tag="MuHV1_gp050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214058.1"
                     /db_xref="GeneID:3293810"
                     /translation="MDRQPKVYSDPDNGFFFLDVPMPDDGQGGQQTATTAAGGAFGVG
                     GGHSVPYVRIMNGVSGIQIGNHNAMSIASCWSPSYTDRRRRSYPKTATNAAADRVAAA
                     VSAANAAVNAAAAAAAAGGGGGANLLAAAVTCANQRGCCGGNGGHSLPPTRMPKTNAT
                     AAAAPAVAGASNAKSDNNHANATSGAGSAAATPAATTPAATAVENRRPSPSPSTASTA
                     PCDEGSSPRHHRPSHVSVGTQATPSTPIPIPAPRCSTGQQQQQPQAKKLKPAKADPLL
                     YAATMPPPASVTTAAAAAVAPESESSPAASAPPAAAAMATGGDDEDQSSFSFVSDDVL
                     GEFEDLRIAGLPVRDEMRPPTPTMTVIPVSRPFRAGRDSGATPCLTTPSSPCAATATA
                     SSATADSAPSSTRSAPNPPRSAWLASAATPRT"
     misc_feature    complement(62826..62978)
                     /locus_tag="MuHV1_gp050"
                     /note="RIP homotypic interaction motif; Region: RHIM;
                     pfam12721"
                     /db_xref="CDD:315404"
     gene            complement(63040..63924)
                     /locus_tag="MuHV1_gp051"
                     /db_xref="GeneID:3293811"
     CDS             complement(63040..63924)
                     /locus_tag="MuHV1_gp051"
                     /note="UL46"
                     /codon_start=1
                     /product="Minor capsid protein"
                     /protein_id="YP_214059.1"
                     /db_xref="GeneID:3293811"
                     /translation="MANVSSFGPMKREVMEFDPEDPYKVSKMRKLERSIAKGYVYGAD
                     HQAITARFFVRESLGEVEQKNLGVLMFRLDTGIEMPSTVLVSLFFLSMVAENVSAATK
                     NTLAAIYGREGEAIRTWLRDGAWRLHRVVHPLGCTNSITPGATCLITCSMRGHSYNML
                     KTEIYPLLVPKEIYLDLDGESTDEIRFVYFVITYDYNSDRQGRPSAFVVVSRITHRHT
                     LINVLRYRFRVSRFHFLNNSISGYGPSTGCLGTLQRLGWFCSRDSRSGIVASRAGQLS
                     VVKLEKFYVDVGPLVEFA"
     misc_feature    complement(63043..63831)
                     /locus_tag="MuHV1_gp051"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            73562..73873
                     /locus_tag="MuHV1_gp052"
                     /db_xref="GeneID:3293812"
     CDS             73562..73873
                     /locus_tag="MuHV1_gp052"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214060.1"
                     /db_xref="GeneID:3293812"
                     /translation="MCVLLYDGGFFSDREHPQKVQLVGEFVLVSSHLHIFRNHGRDDG
                     LCNHRRRQVEYVGAELLPPFLFFLAAAAASSSSAAAAGATAAAATPASRGRATNVGRH
                     E"
     gene            complement(73571..73867)
                     /locus_tag="MuHV1_gp053"
                     /db_xref="GeneID:3293813"
     CDS             complement(73571..73867)
                     /locus_tag="MuHV1_gp053"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214061.1"
                     /db_xref="GeneID:3293813"
                     /translation="MSTNVSSAASGGGSSGGSSGASSGGGGGGSGGSSKKEEERRKQF
                     GANVLNLAPAMVAQPVISTMIPKYMKMGGHEDKLAYQLDLLRMLSIAKKATVIQ"
     misc_feature    complement(73592..73762)
                     /locus_tag="MuHV1_gp053"
                     /note="Small capsid protein of Herpesviridae; Region:
                     HV_small_capsid; pfam17086"
                     /db_xref="CDD:293691"
     gene            complement(73919..75529)
                     /locus_tag="MuHV1_gp054"
                     /db_xref="GeneID:3293814"
     CDS             complement(73919..75529)
                     /locus_tag="MuHV1_gp054"
                     /note="UL49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214062.1"
                     /db_xref="GeneID:3293814"
                     /translation="MRPVRRVIRELFGGVCQHRDKYHLQLLLSGTVEDERDGRRVYCV
                     LNMFMNGKRFLCKDVVDELYCRFLERWSSCSALVKSIVREISQKEVMTRHVFVLLAYF
                     YAVRCMERVSRNVSCLYLRSGMSSRLEHVFKRYSRSKVDALVDNASYQGLTDLHQFVF
                     HFPFGIPIPNQASSPCVAFLRAREYEVGCDLPVYHRRLNLRRLGPDPGVSTLVSILRE
                     RCRETPCGNPFYVMAKVFVERYCRRRPRFLIPIGNRTLRYGGRAAVRTSDPGSGGGGS
                     GNSAATATDGTNCPWPLSKLSTFATSVVLRNGLISSLIDLPVWCFCKTKCQRYAEDGV
                     LEAILCDNCGHCLNMGKDKLEGNHTFALNCIFYYRDRQEKSVIYSTHNDTAHCSLCGN
                     QYLSRERIYEVTRADYHHGLRFATVRWRAVIGSNAACGVLGPGTRLDVLVPCSSRTCF
                     GTVVLRESSVEKLLRLVSHSGEFFCQSCQNVYRETCLDRDDLDLADACLGCQIHSRCS
                     CLEIRRRNYNNNNTGAAGPINTIITELN"
     misc_feature    complement(74093..74905)
                     /locus_tag="MuHV1_gp054"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            complement(75501..76451)
                     /locus_tag="MuHV1_gp055"
                     /db_xref="GeneID:3293815"
     CDS             complement(75501..76451)
                     /locus_tag="MuHV1_gp055"
                     /note="UL50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214063.1"
                     /db_xref="GeneID:3293815"
                     /translation="MEIDKNVGADLISNTRRILRLDENELRITDTALICKNPNYSLCD
                     AMLTTDIVYPVEYLLSYWECRSGRTACFVFKNTGCRVSLSCYIGFPERLKDLKRVCDF
                     NFLSVNEALVVTLADIERIKPCDKGVLTNCVVRKSNSGMSYNIEVVAFGPDNEAEYQA
                     LLRDIYARRMTSVPTDCGSLICRRARCLAAAPPRRPPPPPPPGQRWGSLRKHGPVLTR
                     RYAGGGGAAKNQPAAASPTSTSTSSPAAPSRDQDQTQRPPPAGDTNVTAAETTYSERT
                     ISFLTRHANAIHCALILAAAIALVLLWLLYWHAARSAGHP"
     misc_feature    complement(75504..76451)
                     /locus_tag="MuHV1_gp055"
                     /note="nuclear egress membrane protein; Provisional;
                     Region: PHA03326"
                     /db_xref="CDD:223045"
     gene            complement(76515..77216)
                     /locus_tag="MuHV1_gp056"
                     /db_xref="GeneID:3293816"
     CDS             complement(76515..77216)
                     /locus_tag="MuHV1_gp056"
                     /note="UL51; translation started on the 2nd methionine"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214064.1"
                     /db_xref="GeneID:3293816"
                     /translation="MLTIAHRLQRESISSGRHSSRISAVFSSPIRASSESRSQHAASS
                     SSSIVSRPESVDEDEEEDGVWPSVTSGGVLVGCACSNSSLTRNESIVVSEGSQALYIA
                     SAATAMNGDSVRRRGGDAPDDDEAAGAAPVPAEECNLDALFERFFGDGGADAIRFEPM
                     LPRVYELTLPSIDSRLNFINVGRRHAAFLRHVYGGCDRCEHAAVLNEKMKLFTAVITK
                     LLDVNGILERRETTD"
     misc_feature    complement(76536..76754)
                     /locus_tag="MuHV1_gp056"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            76915..78468
                     /locus_tag="MuHV1_gp057"
                     /db_xref="GeneID:3293817"
     CDS             76915..78468
                     /locus_tag="MuHV1_gp057"
                     /note="UL52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214065.1"
                     /db_xref="GeneID:3293817"
                     /translation="MYRAWDPSLTTIDSFLVNELLLHAHPTKTPPEVTEGQTPSSSSS
                     SSTDSGRETMLEEEEAACCDLDSELARIGDENTAEIRELCLPLEIDSRCNLCAIVSIC
                     LRRDPQQKWLLDYCFLCHKCAAAPRTAMATLIVATEFLHLMKLHFRDIAFDNIFKERI
                     VTIFDFHAHFFINRCYTQRDEHPVMVENITLAHMAVTRALLTDDDAVPYTKRRKIQYK
                     LPKKPAPAEPEELRLLDKYRRATEGSFARVLFYIWSGTNVMFNTTLTDLAIKKSKALK
                     ALKTRQSEIEPSVGPVFLSPIPTFRLRNATTTVCLLCELMACSYRDNVFLQQLRERIT
                     NYSRNNLKIIDRTQLTMAEILSHGRNSEFPQQLKNKDVSIYVTSSPETLAAASRPGTE
                     EPFELSALTYLVLRQVGVIGVYKHLFADPLCAANMRSTDPNILFFDVPNEYLNEAKLA
                     ICSTNAYPSRVERDFWLYAHMFKAFQIIKRNFKTKTQLSDFLRDFSQVLESHDFSLVD
                     PSFTVEKYV"
     misc_feature    76915..78465
                     /locus_tag="MuHV1_gp057"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            78461..79462
                     /locus_tag="MuHV1_gp058"
                     /db_xref="GeneID:3293818"
     CDS             78461..79462
                     /locus_tag="MuHV1_gp058"
                     /note="UL53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214066.1"
                     /db_xref="GeneID:3293818"
                     /translation="MFRSPEGEERDAADREEEEGGEARRRSRMMMSPRRVKRARHRPA
                     GSGLRTPLRSPSACRCSSPSPERQWQQRRRAEKRSTTPTDPPPPPKRSAASAAAGAAA
                     PESEYLNVKLSELHDVFQRHPDLEQKYLKIMKLPITGKESIRLPFDFKSHRQHTCLDL
                     SPYGNDQVSRSACTTCKETTRLPTASDSMVAFINQTSNVMKHRKFYFGFRKNMELLKM
                     AANQPQLFQIYYIVQSCVQEIVPLIYYDREMAHMQLIFEKETVHIPSQCIEQILTVAK
                     DAYGVSLDIAHQRITLTARCLRLESSSLRIDVLMLQRKVDELEIPNETNEKFESYSL"
     misc_feature    78779..79456
                     /locus_tag="MuHV1_gp058"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     cl27388"
                     /db_xref="CDD:332209"
     gene            complement(83003..85816)
                     /locus_tag="MuHV1_gp059"
                     /db_xref="GeneID:3293819"
     CDS             complement(83003..85816)
                     /locus_tag="MuHV1_gp059"
                     /note="UL55 (gB)"
                     /codon_start=1
                     /product="Glycoprotein B"
                     /protein_id="YP_214067.1"
                     /db_xref="GeneID:3293819"
                     /translation="MSRRNERGCRSSSWYAMSTALAVTIWCLLACTSEVIAAASTPGT
                     TPKAKTDTSSETASAETETATSGAATGKKEATPTQASKITGTTIVPFVNETENMVSVD
                     IDKYPYRVCMSVSTDLVRFGKSIDCINHTPKTPVQEGIMIVYKQNIVAHTFEVITYHK
                     DAIFQRSYADTTTNYFLGTSVTKMAFPVWELDEVNRNNRCYSAASRILNGEVYVAYHE
                     DSYRNYTMVLVEDDYRSKNSKRYVTTKSRYHKGAWTWRYTESCNMNCVVVVTKARSNT
                     PYEFFVLSSGEVVEISPFYDGENSEPFEEDTRNFWIRKNYTMKTYFGELAAPKKVVPL
                     MAFLEREDMTIGWEIFPKQNVTCDWKKWQTVSRAIRTDTNTSYHFVSKSLTATFVASK
                     HKIDYNTTTEGKNYNTFRCVYDEFVEEVNRVFEDEYNETHVKDGELEMYRTTGGLIVL
                     WQGLKAKSLHNLEKFAALNNVSVGTVSPPVTSATENGTTAASVAARRKRSLDHIDDVV
                     TDITYAQLQFTYDVLKDYINDALRNIMDAWCRDQKRTAEMLKELSKINPSNILSAIYE
                     RPVTAKLAGDVIAMSECVKVDQSSVKVLKDMRIFQDGKVVNCYSRPLVVFQFINSTKL
                     ESGQLGENNEIMLGTFRTENCDTNSRKIFVVGTVGYEYRDYRFRNVTSLEHIQLVDTL
                     IGLDIEPLENTDFKVLELYSKGELRASNVFSLDEIMREYNSQKQHIRTLSAKVNDNTP
                     SYLLGLDTFMQGLGVAGKGIGVAIGAVGGAVSSVVNAVTGFLTNPFGGFTTILLVIGV
                     LAVVYLIFTRQRSAAARPVEYFFPYATQTAVQYAPPGGAHGGLESGPPGAPGLHRRVN
                     AGGSDDSGKAWTSDKKGLERTYTEQDALLILRALKQLDDSQRTEKAQQKATRLPTGIL
                     DRLKGNDTSGYQRLPAEDSDFEY"
     misc_feature    complement(83009..85603)
                     /locus_tag="MuHV1_gp059"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            complement(85716..88112)
                     /locus_tag="MuHV1_gp060"
                     /db_xref="GeneID:3293820"
     CDS             complement(85716..88112)
                     /locus_tag="MuHV1_gp060"
                     /note="UL56 (NM)"
                     /codon_start=1
                     /product="HSV ICP18.5 homolog"
                     /protein_id="YP_214068.1"
                     /db_xref="GeneID:3293820"
                     /translation="MAMNTLQKLCVVCSKCNECAMDVECLKYCDPNIVSMDSTAFRRN
                     GVMVIHLYRTLYPALVSQNAVQTSVLTLYMEMLLQGLYDTMREIDMALTDFGTHRDRQ
                     RYYRRVLKLDSCNRHESITITFAPELALTIDLATLNDVERLLCKINCVYGAVDASQGV
                     AVCRRLLSLLARLCDICPVAGPEIYRETVTCFQCYEELMAVPNQGRSINRRMQGLLCD
                     HITIKKVLVQLDMDAQTVEQDMGDIAIRAPSVKGIIRAIKSLASFSPASYAYINDAEE
                     ALRGYNLFSEIPDRIYSLSDYTYWSKTSEAIVRHVGITMRQLNVSHSLWKTLRTELSR
                     YHYGEDLEDVFTLGEGRFGGDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRLH
                     ESNEIYAKIKSLIEEIRGVGDGPAAGAAASRAEAASGAGAGGEEGAGAAAGRGNTGGD
                     EGAGTTTAMSSALECGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHL
                     VTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYPDVAESLGYDEHLYVINNLV
                     HKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLV
                     RCADGTVVPSDWMTVGYMGFFRFADIRELNDLQKMVWAHIRELVLSVALYNETFGKQL
                     ALWRVEDGDEIGDGIILTYNPESPLILRRGDRSYRSRDLYLLLYKHLSVDSETLADAG
                     SRASVADLCQVERPGPIAEQRSSTQNVKKKRKRMSLLELVRDVDGAGGDDLVPPCLYK
                     "
     misc_feature    complement(86133..88097)
                     /locus_tag="MuHV1_gp060"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            91761..92465
                     /locus_tag="MuHV1_gp061"
                     /db_xref="GeneID:3293821"
     CDS             91761..92465
                     /locus_tag="MuHV1_gp061"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214069.1"
                     /db_xref="GeneID:3293821"
                     /translation="MTTGVALSQSDIAATMSASSRVFLRKNIQTAGATGARLERSSSA
                     MATSPASKLYRSGGRSGRPRHQNLYIREAPGGFSSTKTSQSSRKRPRSLCHNVLDMVC
                     AATCTNLNRPEGLRAPQSQRTAGSWRARGISRALGGPRVAPAAPSPARQTALTERRTV
                     ARDQTPKSPPCPTKHTRETRRGPRTGPHPRHTLRRRACGAKRGQRESLLRVPVFDTPL
                     DGTDSNNPPRNRFVVS"
     gene            93241..94263
                     /locus_tag="MuHV1_gp062"
                     /db_xref="GeneID:3293822"
     CDS             93241..94263
                     /locus_tag="MuHV1_gp062"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214070.1"
                     /db_xref="GeneID:3293822"
                     /translation="MGSLGVQFEGCTLPPQLTPPQTPPSLPRPPSSSWPPRIPHALPP
                     HPPRNRAHFGQLTYASSWRIKARAGPPPARPARRSPPGSTPLRTAASDQRPAPHPDPR
                     TAGPAPRLPASAPRTPGPAPRTRLASRTSSPATGLGSPAFRLGSPASRLPTSAHRAPR
                     TSSPATDLGSPHPSRLLGSAPQLPGYPPRLTGPPGPAPRLDSSHPAWLPRPAPRSRFL
                     SGSSPRAPGPCPASLPELPVPVRLPSPSSRSLSGFPPRAPGPRFIAPCPGPDCRSPSG
                     SMLRSAPWPAFRGPGSGFVAPCPGPGSRIPLDAPLLLCLSPFARRCVFSLFLVPAAAK
                     CPFFVF"
     misc_feature    <93442..94071
                     /locus_tag="MuHV1_gp062"
                     /note="Atrophin-1 family; Region: Atrophin-1; cl26464"
                     /db_xref="CDD:331285"
     gene            complement(96193..98721)
                     /locus_tag="MuHV1_gp063"
                     /db_xref="GeneID:3293823"
     CDS             complement(96193..98721)
                     /locus_tag="MuHV1_gp063"
                     /note="UL69"
                     /codon_start=1
                     /product="Similar to HCMV transactivator"
                     /protein_id="YP_214071.1"
                     /db_xref="GeneID:3293823"
                     /translation="MLRTGVKRRLGPFAGYDEDDAATGGVSRRSKYSQQQSQHYYYGH
                     NQSSYRDSGASHPNWKRNAHLMPPPLSSPSSPPPQYDKNIAALTHLNKKLDCLGPDDL
                     ECLKAMIRIREARAQGRRPEPSSAPSILESSLVSSNNSNNNTTLSLGGGGGGDYHRQT
                     SPDIRDYTTGSLGLCMFPMDLPDPIKLLENRYTDNDRHAPAVVTHDELINTNYLLLFR
                     KHFDALPPEELRVLVQDRTFAINNAPSLDVVAAMADENLTYVKFHRVHNLPVNPKDLY
                     MSTLGLIKYATFNKLNLGELSCLLDSPGGGGSDREYHILRQIANKPASPCRKGGSSAA
                     AAASFDVLRRPPLSFKHPLQQALALIASFARIVGVIRRRSLRHSGPFFIRDFDDTGAT
                     DSYRCGMISELIFDYLRGHRCQNEICRVKLKKLLQPYTSTLFFCAYNNTRKHPNGTYR
                     REGRQKRRAPDATPNIPRLAYRRSATTSPEVEPAPPSRMTSSSPRVDSRGGGGDRRGD
                     SSSTSSNHHRHHTRRARTRSTHDSSSSGSRRRSSATDGRRSRRGSRRGEAQRESNGHH
                     SSKSPSTVSSTTVHGQNGARGDSAPSRKSQQSQQQPETTSKESSKTAAMPPPPSPCSP
                     SPASRERRPSKSPSSSPRPHDPPSGEPADAEKELATAGDEDEGVRSPGECSVATRRGS
                     SADESSDSSSSSSDSSSSSDEEESDVEDCRELDLQSKRLEEALEERCERDFEADDEEF
                     AEPIEEDDLHCSLDMEEDIEDEPLDPETESVWTASVTPLAAPPSIRILDHEPGDAEEE
                     EESDTDFYDETDQPLNKRIHLRSATPTDDVIMECDLSYSEMDSD"
     misc_feature    complement(97411..98112)
                     /locus_tag="MuHV1_gp063"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; cl27025"
                     /db_xref="CDD:331846"
     gene            98530..98889
                     /locus_tag="MuHV1_gp064"
                     /db_xref="GeneID:3293824"
     CDS             98530..98889
                     /locus_tag="MuHV1_gp064"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214072.1"
                     /db_xref="GeneID:3293824"
                     /translation="MSISFPVGMRGARIAVRRLVVAVVVVLRLLLRIFRTSGDAARRG
                     IVLVVSGERAQPSLDAGPQHGFAAFGALGRSYVRAVADGGDARAEMWLGVTLDMTATP
                     SAQETPRFFISREGKGR"
     misc_feature    <98677..>98859
                     /locus_tag="MuHV1_gp064"
                     /note="Periplasmic glucan biosynthesis protein, MdoG;
                     Region: MdoG; cl19308"
                     /db_xref="CDD:327537"
     gene            complement(99010..101904)
                     /locus_tag="MuHV1_gp065"
                     /db_xref="GeneID:3293825"
     CDS             complement(99010..101904)
                     /locus_tag="MuHV1_gp065"
                     /note="UL70 (HP) (34)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214073.1"
                     /db_xref="GeneID:3293825"
                     /translation="MTVVLFATEYDTPNIVVNMLSETPTEHHLFPLMIKYKPSNRIEF
                     VLQTQRCPDSTRVRPVFICDARRLSLSEYVSTNTPLPARVICAGIDADATRELYEHLF
                     DRKKDETGHDEENGSAGGDLFSDLTSTLKCLVHYNRSAILRYLNNTFLSPTSPSWFLS
                     TYGTHEGTLILTMSYYLFERQYSTIQTTRDYTKCFTADPGRNLFTYINMRDFMATMNG
                     SRFRKQTARFAAFAKARNARDRRELEYVDAKINAFREESRLAADSCVYYVYLAYRTAL
                     CREKFLQYCEHTAYDKNLPDDQQCAAEENYLGRSLDAELISIMNTYFSVEGYFGSYIH
                     VDRAKLSPPHSYRGYDWNTEADTMVGYSSTATNLAISLRKLNSTCESLFSPLPPTLMG
                     LLKLCASDRYVPRAEKSRKRTSGGREKEDETRVCRRNYLLNDTSRPIGPMPVFRVEMP
                     EKRHVFCAVSAENWTRRLLPKDLMKNLPSEYVSDECLTDAVWLREDIAASCEVGEQLY
                     RTRHEMFNENLPVFNFVGDVDLKLREDLQGLSRQEVFDLCRALRRTLIGAWRHLFPEV
                     DPDSHPVFFFKSACPQNAAGAADEAMLYGGGGYDEDDDPRPEHAAAVVDYGDAVRRPP
                     FCVCRRKLGLRVIIPFPPRTAAIGAQTLKRLAGILDHTLCLDRDLVCKLNAISHPGEC
                     FDTGIYSHGRSIRMPLMYKLDEASGLMLHSRLNPIFIVPAGYRDRPAEFVLQQLCPQN
                     LTHHGRPPRRDGSADQLTEVVLHITDRACADSDGNFLQSRARRAMSRRRLPLGPLLRA
                     HLSLESGQSAPSLPTLVGRGGGGEGGASSDYEEERAVGSDEEEDDDDVENLQAFARRI
                     AWPALLRHTRNHYREEVQQQLEAATVFTAVGRTCVAVKRGLYGRARDFSCLAREHYTR
                     QETVQVFLDIRGDQRRNVWATLWSRCFTRRCNSNAKQTHLSLKISLPSQY"
     misc_feature    complement(99037..101904)
                     /locus_tag="MuHV1_gp065"
                     /note="Herpesviridae UL52/UL70 DNA primase; Region:
                     Herpes_UL52; cl28059"
                     /db_xref="CDD:332880"
     gene            101903..102802
                     /locus_tag="MuHV1_gp066"
                     /db_xref="GeneID:3293826"
     CDS             101903..102802
                     /locus_tag="MuHV1_gp066"
                     /note="UL71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214074.1"
                     /db_xref="GeneID:3293826"
                     /translation="MMMTDFGGGGTGTSNARGGVGGAIAAADDDAGAAPPSCWRRMLD
                     FALCRRTIRDGSEYIVLRADEDVDMAELEGFLKDNFGNLGVSSADLSEIDRESEVTKH
                     LLRLLPVYKRCVRRQTRLDRLLANQCRPHLRNAAEIECQKSKRVMQALDIVILKLLVG
                     EFTLSDEDSVERLLEKFSVDQSTLCEVGRIVRLIDMDRENTQRLVDGREEPAPPLCDL
                     NGVPSSSSSSSYAATTTISSASDLLLRELDNAPAAPDHLPGEIDEILLRDEATSGTGR
                     LHNVGRRRDLEEQKQQHQQMAAL"
     misc_feature    102008..102781
                     /locus_tag="MuHV1_gp066"
                     /note="tegument protein; Provisional; Region: PHA03373"
                     /db_xref="CDD:223062"
     gene            complement(103031..104236)
                     /locus_tag="MuHV1_gp067"
                     /db_xref="GeneID:3293827"
     CDS             complement(103031..104236)
                     /locus_tag="MuHV1_gp067"
                     /note="UL72 (dUTPase) (118)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214075.1"
                     /db_xref="GeneID:3293827"
                     /translation="MAKHNRRKKLKRKTPTKPGMIKPNIPAPVRPNLPLSSPDSVLPQ
                     AMKDPFNIFDDDEPSEDTSSSEQSSRPPPREMMISSSCALREQTNSSFLNRFFPEDDD
                     SSENGAALAEINQLLRDGPEAPPREPTPKEARRPEKMQKIFFQTYGNDFKVEAHGDRL
                     LAQNQRVVRLFERGRILGLGVKMNIPMGYCAVTNCFHPPGCVCVMDMAGYGPSDIRAQ
                     IVNISSGPLELPPNMLQIHIHMLPMLLPEPWQTINLMAPHQGDTYFDLRLRRPLSLPP
                     RASKNLKFEAGHLCEEDASSCLVIPCRHLATKRVLLDPTVWRPNSLAVLRVLNASDEH
                     VDLEAGMAMAKIIFTTPGITPFKPSLTSVMMSFDVPRSDLKLVKGGRRDYYRAEERMR
                     SGRDSSNEG"
     misc_feature    complement(<103187..103867)
                     /locus_tag="MuHV1_gp067"
                     /note="dUTPase; Provisional; Region: PHA03128; cl28612"
                     /db_xref="CDD:333432"
     gene            104100..104519
                     /locus_tag="MuHV1_gp068"
                     /db_xref="GeneID:3293828"
     CDS             104100..104519
                     /locus_tag="MuHV1_gp068"
                     /note="UL73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214076.1"
                     /db_xref="GeneID:3293828"
                     /translation="MACGKTESGDDSGRFGRTGAGMFGFIMPGFVGVFRLSFFLLLCF
                     AMASGSSSSPSAAVSVAASVPDTTVSKIVISDGSEAHNINEFYDVKCHSHFYGLSVSS
                     FASIWMMVNAIVFICAFGVFMRHWCYKAFTSDTAKGY"
     misc_feature    104319..104507
                     /locus_tag="MuHV1_gp068"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            complement(104496..105812)
                     /locus_tag="MuHV1_gp069"
                     /db_xref="GeneID:3293829"
     CDS             complement(104496..105812)
                     /locus_tag="MuHV1_gp069"
                     /note="UL74 P"
                     /codon_start=1
                     /product="Putative glycoprotein"
                     /protein_id="YP_214077.1"
                     /db_xref="GeneID:3293829"
                     /translation="MNPLLLMSIVTAASAAKVNSSLRKSVAYNPAVTGYIEMSEDDYE
                     DGGYDTIDATEPPGEIHIGSSLVDNPPPPEKEPDVEEKENTQAKDYLSFTVNSVKFSK
                     TWIRRRNRRPDNVFPIWYLIEGTEVASIKAYAGYYVNATYTPIKDNNNKTSTIGTVIV
                     SGVPCGPSSSLSCHRSMGRDLITPKSNITAKYFKKCDTIFAAPILYDLPRWQVELRTP
                     DRRVLVTESFTITTLAVATLISRYSRAKNDHCAKAFVPLYAIQHSVFKVTASWPDIKT
                     FFDRFRHLKSQAPAAAVTLPPRRKRSAKPIVVTPPIPKNMHPIQFFYDFSAFMHAALY
                     QSSKCALKTQFNTATVLTNGTVETVVGPVNVTTLYKTERKKKPEIKDNKINLEDVETL
                     DDVLMDYLDTLTLTASPWRTISQKPQQHVPSLPHKRRTGSISFSRV"
     misc_feature    complement(<104883..105551)
                     /locus_tag="MuHV1_gp069"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            complement(106110..108287)
                     /locus_tag="MuHV1_gp070"
                     /db_xref="GeneID:3293830"
     CDS             complement(106110..108287)
                     /locus_tag="MuHV1_gp070"
                     /note="UL75 (gH)"
                     /codon_start=1
                     /product="Glycoprotein H"
                     /protein_id="YP_214078.1"
                     /db_xref="GeneID:3293830"
                     /translation="MKLSLILSIALCSTRVVYAAGAEAPRISRNTVKLHSYNESRVCR
                     HDESSNQTVSHAAMFTFNFQDGDGYRVYQVPRCLFNTHAAREVLSSVDMTETLESYRK
                     RFRVYFVVPIYGAYRLVARSPTAKYPGGVLNPPPASSVTMQDLIVDATNIHTVVPDKL
                     CVITEHPVIFSMKVPCSHQVITWTGYTVTVSLAQKFFVLTIKPTRDHTSENTLAMFFG
                     DVREVDLKAPYTVGAFLLRQTPDHDLLVVVKQTAFIQRYMFLTDVVFLQRTLSADYAD
                     TSVCLRVLSVLASVVARGKQCGLITRDTVEFFFTYSLCQLMANGTRYQSTAPVSTALW
                     RQSELELFGEFIVHCFKTTTPNPTPAFQTRMQLTEKHKPAHSSNAIDVRVLAATYSSG
                     MHAASMADLAFLLRSTRIPPNVNTDALLQKLLFTTDAYYRMSLKIPLSGSMRRILIRV
                     DLTVRTQLNESSVARRHFVLLTSMCSPREQISWGELLMNPQRGAPSEIYSPCVSGGRR
                     DYTGPSVRALMESAHRPERRAEQVMSVTEALRPKRSQMSDEANCVPDSTQGAVITANE
                     KTYLISSDFIVKGLAIPVSNTVVDRNLMITVLDRRSPCVLSRSYRERGSVIVMNNITF
                     TERCEFCASTLVEYDEVDGLTSIMHIPSIEVLKYLTDPENDILVATPRVHYLLLTANG
                     TVFEVTDILVNVRPSMPYSVVVALVIIAILMALGLYRLCRQKR"
     misc_feature    complement(106116..108287)
                     /locus_tag="MuHV1_gp070"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            108384..109148
                     /locus_tag="MuHV1_gp071"
                     /db_xref="GeneID:3293831"
     CDS             108384..109148
                     /locus_tag="MuHV1_gp071"
                     /note="UL76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214079.1"
                     /db_xref="GeneID:3293831"
                     /translation="MGTSADTDLLSYLPDARKRAGRRGHLQIYKKITAVFEDDDALNA
                     ILGGILPYRGVPGRRYVFYEIDFKKRIPDCIVVLVDDRDGSAECYVIEFKTTMRCADT
                     GTIRSNRTHRLQYLQGLRQLRDSTRIFSQFTVADGVCWKVFPVISFFRQKGARVALTR
                     VFKPREYRVLSSVVLDFLRLHQDESVKNLSRCAVYSGLRGASGKRPGLPPRKTRAPPR
                     RKRAAPAAVRRRPGARRQAPTKGGRRPRVSRKRAAK"
     misc_feature    108411..109007
                     /locus_tag="MuHV1_gp071"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; cl27526"
                     /db_xref="CDD:332347"
     gene            108931..110817
                     /locus_tag="MuHV1_gp072"
                     /db_xref="GeneID:3293832"
     CDS             108931..110817
                     /locus_tag="MuHV1_gp072"
                     /note="UL77"
                     /codon_start=1
                     /product="Pyruvoyl decarboxylase homolog"
                     /protein_id="YP_214080.1"
                     /db_xref="GeneID:3293832"
                     /translation="MSRLKTFHDVPCIVAFEAHRENVLVFPREKLARLRDESALRLRQ
                     YADDLGHDARLRRRAGEDLESLGKELRNECERFRGRIDQAEQLLSGPMSDILGGGEGT
                     EVAGTAGDGGSVDNASQKNKRKKAGGGASASSCSATGDGGGSGVGDDDDSRQQCLWVT
                     PNDPPISYSTDFRGELVETIFNVSQAWTFSFGSWYYRLKRWLYNQPRWRRVYRLTQIE
                     SLSVSQELLMGVLNAVEQVTVYPGHDTVVSDLEVAACLLAAYQAALDPRAAVPTTVEG
                     VLRDSGRVLRALSDDIAAEIARRPSGGNAFAYKDPPGLRFYAPVQQGRRYAAGTFDEN
                     ALVAVLLRRGAIAQVPGGATGVAAAASGGPGSSAAAAVASREVMSRLSGAVSDDVLAL
                     WTLRLFGKRLSGVVPNLLQEQHYLRSGLTAVLCLLFLWKLLNSESVFSGRAGKFSLRD
                     VFPDLCGGRDAPPPVEREEGFAGGCVKNFEFMMERYVVPWYSRDPAVTVSQLWPGLVL
                     LLYCESHRSGWDLSRRPFEHATADGVSSAAGVLHVQASRFNPLVDYMLLQQTAAPDKD
                     VDRLAAHDFALFHCENGIGRLLSITLPKHRVLTLGQQFFNLQNVYDSMYFFVLGFLPV
                     VSVT"
     misc_feature    108931..110814
                     /locus_tag="MuHV1_gp072"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            110989..112404
                     /locus_tag="MuHV1_gp073"
                     /db_xref="GeneID:3293833"
     CDS             110989..112404
                     /locus_tag="MuHV1_gp073"
                     /note="UL78"
                     /codon_start=1
                     /product="GCR homolog"
                     /protein_id="YP_214081.1"
                     /db_xref="GeneID:3293833"
                     /translation="MPTSSCAVDYSYPEVDAEHLSFIQTYNILVTSTFAVVSLISIVL
                     ILGSLILSMWRKVWHRRNGGARIYVFSLFLAEFMYVASFVAIWLVRVVCPSKVTEPYC
                     RLAIMVNGMSEGAVSFFYLYLTLDRLCLVGAVTEKKTIFNTSAGKDLVGVIWVTVVAW
                     ISAFIVGAPALTSQVMRDRAGFLPVCEMQGPDDMPYVLMHVTAVYVVPFLIIISRLFE
                     MRYSARDGTWHFVSGASIYYVMYMIIVVPIIICRVVISFGEIGHSLSQTTLQYVDLIS
                     TAGWQGRGIAVAFACDVVVKYVEAAGELHASVDGSDDRRSLCADLPSCIYPVGTTLVK
                     STFGFFFKGAKTMLRLCRRVSPFGIQKDALKSPAAMKALEGAAYDNKSFSPDEDDDDK
                     IPTVCEKTGPPPSLTEIAMTPVVDSQQKMTSLPMSVFYSDGGEKEGVQGDEGGHIIPI
                     PPSDGVTDDVSALLPTSSSVV"
     misc_feature    111076..>111627
                     /locus_tag="MuHV1_gp073"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    111076..111147
                     /locus_tag="MuHV1_gp073"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    111172..111252
                     /locus_tag="MuHV1_gp073"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    111295..111363
                     /locus_tag="MuHV1_gp073"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    111448..111498
                     /locus_tag="MuHV1_gp073"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    111568..111627
                     /locus_tag="MuHV1_gp073"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     gene            complement(112639..113415)
                     /locus_tag="MuHV1_gp074"
                     /db_xref="GeneID:3293834"
     CDS             complement(112639..113415)
                     /locus_tag="MuHV1_gp074"
                     /note="UL79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214082.1"
                     /db_xref="GeneID:3293834"
                     /translation="MVKTIRVGRFLHLSDDNHLILHITTKLLSGQPLSSMRLEELKII
                     RLACLLTLGRGIELLILRETVANNGVSDNTILNRKISPEFWRKMYEAMRAHVPTETLH
                     RAFSERSAAALSVEITGSRACRALVSHLIRTETGLALSLPDELLSDGNIFFSLGTVYG
                     HRLFRLLRFFNRHWGKEAHEPAIRTICQKVWFFYLIAWKKLTVSPEAFSVQRSDHELG
                     IFSFLIQDYLTFTGTLRRSTPPMDKKEEGVIADLLSGALE"
     misc_feature    complement(112645..113406)
                     /locus_tag="MuHV1_gp074"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03364"
                     /db_xref="CDD:223057"
     gene            113414..115507
                     /locus_tag="MuHV1_gp075"
                     /db_xref="GeneID:3293835"
     CDS             113414..115507
                     /locus_tag="MuHV1_gp075"
                     /note="UL80 (AP)"
                     /codon_start=1
                     /product="Assembly protein, protease"
                     /protein_id="YP_214083.1"
                     /db_xref="GeneID:3293835"
                     /translation="MTGDAARAPDAGSMIYVGGFLTLYDEDPQDERLRLPRDVVAREL
                     RRAAAGGPAVPLNINHDESSTVGTVRLFDAEAGLFCLGRLSSPAFLGIVEKAAGKSKL
                     VARGPAKGLEADPVVEYLSAGFPALSLSSFSPDAVAAAAADADTSENSGEEAEGQPRR
                     QTTDSGGFFRHVSLCGLGRRRGTLAVYGRDRDWIVGRFAALTPDERAEIARVDDAALG
                     GWDGDADPFGSDSYGLLASTVDDGYIAERLCRLRYDKRLLGLQSKETYVKASELPAEA
                     DDGPEPQSIRRDASRDSEERAAGREEMAQSSHGLTPAAVSVPGTANPAASAFPADCVY
                     LSRDALMSILAAAAKQNAVPGALTSPQQALPQVPSYYGMPPDGVQYHLPPPPPPPSHH
                     RGGGGTFDPPLPHGGYGPPYHHPDAYRGGYHHPDRDPRGGVPYEGWYRPRYDPAGDDH
                     PSYNNRRGDRYRADRPPQQQPLYRGERNRRRSPPDSDDDDDDDDEDLEAGERTGGKRT
                     RQRGSADSGRKRRRRGAAPDDDGGDLSLPGERGYPKRTAGDHHQSAPPASRTDEFGEV
                     RATLNEIRKDISQIRAAARAEGNGAREDAASVGSSDQKCAAPPPGATEMMASEPPAGG
                     TVVARMALDPAVAAATGHTAGLLTAGKLVNASCEPTPMEVGEPSGGGTSRKGGEASML
                     EVNKRMFVSLLNKME"
     misc_feature    113510..114523
                     /locus_tag="MuHV1_gp075"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            complement(115711..117507)
                     /locus_tag="MuHV1_gp076"
                     /db_xref="GeneID:3293836"
     CDS             complement(115711..117507)
                     /locus_tag="MuHV1_gp076"
                     /note="UL82 (pp71)"
                     /codon_start=1
                     /product="Upper matrix phosphoprotein"
                     /protein_id="YP_214084.1"
                     /db_xref="GeneID:3293836"
                     /translation="MAEEFNFLTADPDKPGSTFVHGWCTNLSLRVTKGPLFRGQETKY
                     LNTGLSLATSVPAITCLAQRLPQGRTPSALSVPFTVLSDPEDFINVVLPVRNMSTFTR
                     NSAETQDQIFVTAFAIPLPIVPINEYPLFRQHPNFKTDFEQEAHQTTAEELNDSHLIK
                     ITHRRMRWVHSKRIQFGTHCTTITATLPRSVPANTYVAAQPKAISDPMVRLDSSILIP
                     RPSETAHHKLRIQLVFDGHAENNGKKVNKPPTSLTVHILLHKDAITFALRHSPYKSLQ
                     RFDAFDNGYKVFCPRKIESRKGLTWTITIDNGYSCDGRYTALFFPKYSPQLDIHVCRW
                     IETRTLNICITAMANVTIPVGMELGRVHFFPNRLTQELVDLLTPVGIINKESMALSTS
                     QYECKLFVPVGSETYRPGPEPPQDADQLPPATTPRRMSSADEQLPEDQFAQLSLNTPR
                     PVGRELPPRRTSADERLFAQMDADNVPSDQEEDDSDEGEVFIDDQDFDEDRNWVYNAV
                     PDSYEEEAAAQRQLLTLQPHDLIRIRAGRLATLTFTMYTPFINEGVYFNEAMGVDKVA
                     VQLTTKGRYGARPMPSSLPRLKTAIIPPHLQP"
     misc_feature    complement(116413..117450)
                     /locus_tag="MuHV1_gp076"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(117614..120043)
                     /locus_tag="MuHV1_gp077"
                     /db_xref="GeneID:3293837"
     CDS             complement(117614..120043)
                     /locus_tag="MuHV1_gp077"
                     /note="UL83 (pp65)"
                     /codon_start=1
                     /product="Lower matrix phosphoprotein"
                     /protein_id="YP_214085.1"
                     /db_xref="GeneID:3293837"
                     /translation="MNAMNNRTEVINPLDSRTSSMVGSTKILLASFLQRVFFEPEELK
                     VFSTGIKILLKRPSVLCVCRDEGMMVPFQENKKRFLHTMFYAVNTQFGIGSLPVPAQN
                     SQPRKQTRMLRSNKYLGFCVFALALDHVPAPPMLIARVNSVKVDASAVRQASVSATTT
                     RTGMKTVRMTVHKVRWANDPDSKRFKKAIVSLELPRARAATLDPKTCSDPHVNFYQMT
                     AQRNSPTIYLTLRYAKANGTPPDSLTAILAVGNRAKKVNLKRSLDPFLKPLPVNGFRV
                     VMPRTVQLRTGQSVVLTSTAMYHASNHAALFIPYLIPGLDIHPSVWMPNSNLSFTITG
                     MKDMEVSVETAIGELRFVSRSWMTVETNSRHARHTCSQTEVINYGPEVFRKHKGTPSR
                     LRDLPDTTLPLPIQDLEQDNASSQDEASSSDAEEEEEDEEDDEDDDDDDDDDEDDGTE
                     NPNGMDDENESSNEDAEPERQAPPQQQRQLSPRANRPAEEDEDAAVFAGEIDPDAEDD
                     DAAVFAGEIDPDADADAMDVGGPAGDENADEDDDEEEDEDDDEDDDDDEDGSNNEEDD
                     DGMRQPRQPNGGSRDGRRRGLGDNPFYRNLVRAATRDAMGAAVAVDDYGVEDEDVYDE
                     QGRLILRREEDEEPEPRPNRPTEFGNRRDEDAEEERTPDPEAISLFLQREPVRISFQE
                     HYYSHGRQVNPLVSPSTALNMNCTKTGLSKREMVMQHKKDLQQFNLDKELKLILFPLS
                     VCLDETVLAPFLFIIPPAQFYPSKEPFNFTFLAKTRPTYRLSQLTGQEIPGAGFKHEE
                     KSDRVRRLLRS"
     misc_feature    complement(118970..119929)
                     /locus_tag="MuHV1_gp077"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(120082..121845)
                     /locus_tag="MuHV1_gp078"
                     /db_xref="GeneID:3293838"
     CDS             complement(120082..121845)
                     /locus_tag="MuHV1_gp078"
                     /note="UL84"
                     /codon_start=1
                     /product="Early nuclear nonstructural protein"
                     /protein_id="YP_214086.1"
                     /db_xref="GeneID:3293838"
                     /translation="MSVNVYLPSGTSSLFAGSLSYLLELHVPVTVDFGPYETKFLQTG
                     IRLSPQAPCVLCVGKMYRHPDNHPHLVNFATFTPADAPTDLVVEVSNPSAHPLKPPSG
                     GQLVLIVFCVPLAPVRMDLLCVQRRLDEPRVRGRCPVSILAMRTSKSTLDLEVAASNL
                     AWRPFSRGNRLTASVSLDVSSTNMRRFHIAHVLSCSHSDIYVDQVTVVQSSGVVYVSF
                     ATKYATIAAPSNIAFKILFREEDDAQLEDKRITFPRYPDPTVCTPHKYGLRVLSPRDA
                     ALTPGKPVRMYVSISYFSRAAYAGLFTPLYRPGLSCQIVPWKERQVLSMTVRSSFTTE
                     LKAGEPLGDMYFVSRDTLRVKKTSPSAAADATSYSILVHPAETGAGGPARSRRPPPAH
                     RRPSTSSSGAKRGSMNPGFSEFWSEFPPPDSKRARTRSESEKNAAKEQRPPDPPESER
                     QAPTYPEVERFSEHDEALEIVPTGAVFKLKQLIPILLHCKNRDSPITRGPPKKIGRAS
                     AASLPSPRWHSELCVGTLVGTAPASQAPYGHSPPFSNILALQAQRTKHYQSPPQLQLQ
                     PAPPAVFFHPLGALQRLQQNI"
     misc_feature    complement(120790..121788)
                     /locus_tag="MuHV1_gp078"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(122189..123124)
                     /locus_tag="MuHV1_gp079"
                     /db_xref="GeneID:3293839"
     CDS             complement(122189..123124)
                     /locus_tag="MuHV1_gp079"
                     /note="UL85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214087.1"
                     /db_xref="GeneID:3293839"
                     /translation="METTVLVTFEQRLTTGDVGKLSRLIGAVIPIPYRHHLLGSSQVG
                     LDAVVKDKTRDYSRMRARMREMTLTIMRRVEGNQMILGVPTHGQCYTIRNTGPVSWEK
                     GDVLTTLPPVFSGEVTGLVSVSDWDLVLPWIVPMALATEINQRMMMLALLSLDRSHEE
                     VRAATAQLRVVRYRDATLTLPEITIDDTVLIDMRNVCISLSMIANLSSEVTLAYVRKL
                     ALEDSNMLLMKCQEILGRRMPQVGVGAGSSGDRNDPPARSRTNYNITPTEELNKLTAL
                     FVMIRQITDVISEQPAFLVCDVSPDDKSALCIYKG"
     misc_feature    complement(122192..123124)
                     /locus_tag="MuHV1_gp079"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            127383..130163
                     /locus_tag="MuHV1_gp080"
                     /db_xref="GeneID:3293840"
     CDS             127383..130163
                     /locus_tag="MuHV1_gp080"
                     /note="UL87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214088.1"
                     /db_xref="GeneID:3293840"
                     /translation="MMSASDGSPASLSCLDPALIVKSPTARVKSAPVCVNSYNLTREI
                     SPFEDSRLSQAVTVDEEHISSIFRTLMAAGPDPGATDEDKARVVLCRLLMGPVAVPCY
                     CDEWDVDDYLAKCAYRCSGPALYVHRSRCRCGAEGGGTMFTLLHDHYTTHVFRGLLSL
                     SEWNVRLTDVFCACNAFRSDRYVMAVLPKHQSVFIEYYPYFLVCLARYLTVPEIDDCA
                     NSMTAHLGPAIAARVGVHYKMLFGANARPPRVTEVARRANYDLFLLELQKLWLNVSYR
                     NAVTRDFFETVFSAFHHETGKVMLALRSPGRQPLFPRWISMSRFKKQVLYFELEVRCT
                     KSRKDELKNALIFRKTSVLFADHDVIWRNLFYTYYAWCAHRGFGGESRLWGPSGSGGG
                     AATESERGGGVRGRDQATTASAAAAAASTDDDASAASTESGVAVSAPAAAATSAAKAH
                     PHAPAAPTVVGGGQGTAVSSTATQKYVKIVDRLALVRLRFRERRLAAEAAVGSGSGSV
                     EGAVAGGTSGVQTDVKADEPVAVPSFDFDPYRCLVRHRAAEGVRREGEGSVYGARKII
                     GGREFSEMTAVSLNRVAVNAFNTNRVINLKATIVQTPRLSAFYVPRNMTHSFVMYKHT
                     FKEPPYTVSTFVSNDAAHTNSLNVNIRGSYQEFLYALSVYKLYVNIENFFLPASVCNS
                     NSSLDVHGIEDQGVIRSERDKVYWTTNFPCMISNTDNINVGWFKAATAIIPKVSGVAL
                     ENVLLKELAYVTSIDQLCVDYTLHRVFTVLETRNCYQIPFLSKQFILFVRIMMLRICG
                     LEHRLAVDRLIFRAIRQGVFDYHKNTVAHTKIKHTCALVGTRLANNVPKVLVKNKKIK
                     LDYLGRNANLLTLCRHVDHACVDAHRLEALIGVLDCLEKLTSIDRTKEALTRARVRLC
                     GGYRPEAATSRR"
     misc_feature    127395..130160
                     /locus_tag="MuHV1_gp080"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     gene            130243..131523
                     /locus_tag="MuHV1_gp081"
                     /db_xref="GeneID:3293841"
     CDS             130243..131523
                     /locus_tag="MuHV1_gp081"
                     /note="UL88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214089.1"
                     /db_xref="GeneID:3293841"
                     /translation="MDEEDAGSINGERKDEAVAIRDPGAIWCDGAVLMSDGTIMEHEF
                     YSKPLVSLIRRKIRVEREEDDERGTAFVSSRELSLFVTGRCRRRAAGFSIYWHSHSDL
                     IFVLTGVTYCAQIYVECGRMAPDGTMEMLIEPRVLLVRARDPNGGISHVSWSKTPGIW
                     PKDVGIKLVKISSNAPAARQPTPVMPNVGMIGFPCVRLFGEPTNIDIGAYVPLVVGDR
                     EQYTDERLRLDCETSIFLERASAVYLRLLAIERELETSLGRRREVLMRCVELAARKRL
                     LLVDGTPIGNMFASEVCLCGLGEDSYANEIVGVLWRRRDTKSGAVFNLHNVALANGTQ
                     LALILRRIQEYSAYLPPVERRLDMTDPLTSAARDFYAAEVDVGVSVVSVAADVLRAFS
                     LRGLVSDGVKVVEKLGVPMTGPVDRDDVIRVLQL"
     misc_feature    130309..131520
                     /locus_tag="MuHV1_gp081"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:309600"
     gene            131649..132774
                     /gene="42.8 UL89 (CHS)"
                     /locus_tag="MuHV1_gpM89Ex2"
                     /note="Conserved herpesvirus spliced gene"
                     /db_xref="GeneID:3293842"
     gene            complement(132920..133876)
                     /locus_tag="MuHV1_gp082"
                     /db_xref="GeneID:3293843"
     CDS             complement(132920..133876)
                     /locus_tag="MuHV1_gp082"
                     /codon_start=1
                     /product="Potential MGP"
                     /protein_id="YP_214090.1"
                     /db_xref="GeneID:3293843"
                     /translation="MDSARRNTSSRVSCSMPAFLSSPRITFMLLGVLLCFALASGGTA
                     DLYTWIQATPSNITSPSDVFTMNVTISATDSDRSGRINASTFAYVTEAEQSQNEADAP
                     EYDTASKQIHTTFAPVLFNWFRVTGKNNTARFRTVLFILTCNETHSSLLMNSPPRFTA
                     MRIDLDNTNATQPLYLQMFSKRQCMQKIEPIITKRSHVGIRRILSKTCLTYRRAADPE
                     VQLAEGTVGREPQEAYTFLHVLIAFLFCIGTGLIVCLYAILRPYYQKKSANAFPKKKK
                     NRDDKATLWPRKPIFTEEYYDSPPGSIKKPYAVVNPGFMYKD"
     gene            133668..134072
                     /locus_tag="MuHV1_gp083"
                     /db_xref="GeneID:3293844"
     CDS             133668..134072
                     /locus_tag="MuHV1_gp083"
                     /note="UL91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214091.1"
                     /db_xref="GeneID:3293844"
                     /translation="MVTFMVNTSEGDVMLLGVACIQVYKSAVPPLASAKHSSTPSSMN
                     VILGELRKAGIEHETLEDVFRLAESIGEACDFFRQPGESRLRVLDLAVSLFDHVAAEC
                     IGDVVSLGFVESQDGAPGGTTGHPRGATASKD"
     gene            134075..134767
                     /locus_tag="MuHV1_gp084"
                     /db_xref="GeneID:3293845"
     CDS             134075..134767
                     /locus_tag="MuHV1_gp084"
                     /note="UL92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214092.1"
                     /db_xref="GeneID:3293845"
                     /translation="MFSHGRDPRTGKPISAAGARAHARGGGSGKCDGGGGCDMRNLCN
                     PLTQELNLRNMYVCVRCHRTHLCDLRHDCVVVHTQDGSVCIKTGLTYGSVFPGGCVSA
                     LEPVTEPHVDEINVVGVIMSYVYTYLTRNADHYADVIGSVIEGGWFNKPTENAIYFTF
                     NRVFKQHNALQKVPISVIGQLFVQLVIGVHARVTKYDSTVIKVSRRKREDGLLKRMRF
                     EYGNAPSFRTGR"
     misc_feature    134189..134743
                     /locus_tag="MuHV1_gp084"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            134733..136280
                     /locus_tag="MuHV1_gp085"
                     /db_xref="GeneID:3293846"
     CDS             134733..136280
                     /locus_tag="MuHV1_gp085"
                     /note="UL93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214093.1"
                     /db_xref="GeneID:3293846"
                     /translation="METHLRFEQAASEDDRDRLVPVHVVFAEDALSYREFEGLHTLCF
                     KIISRPDARWEHIPYFERLDREFVLKSLFHDKCRHLSASPGDGPWTLHGGGDENCRYG
                     LAFSVVLHLRDVEWWKDVIKFRLFIGDDETVDIDCTFVRLLREGLRFFGEVRRTRQPR
                     SGPRSASSRLLHHHPHHHRAGAAGDDDGDVDDDEGLPEGLLGAAADGPGFFDLGDNRK
                     MSEEMEDRLARFALKRVSAADFGPLEPPSKVRGREIKARRGEFFRDGDAPAAPDPVRS
                     RSDRWFGCDNAIRISYAQEVTGSRRFAVIWYSESIGSTVDVDVGRADDGEAAVTSFEH
                     TRRWETAVTRVYGATSRQLAAAVTRVGGLAQRFYVNLYAGLRAGDLVELLLLSRDAWL
                     VNGTGGGCIIKALSSDLHRRRRSGDLVDGCRVGWADVIWYAQARVASGIPIKLMRVGG
                     DGLWRSFLDSGKLTDWELNTDVCVLYAFEDRSLFWVLPGGFCATFQLQVDHGDVQTIR
                     EKFEKHQ"
     misc_feature    134733..136223
                     /locus_tag="MuHV1_gp085"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:309621"
     gene            136234..137271
                     /locus_tag="MuHV1_gp086"
                     /db_xref="GeneID:3293847"
     CDS             136234..137271
                     /locus_tag="MuHV1_gp086"
                     /note="UL94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214094.1"
                     /db_xref="GeneID:3293847"
                     /translation="MATSRLSVKSLRSISRFVQWECCWMLVNKSARYREFRAVTSQSP
                     GLGKVSSTDDGRCLAASMMLFRRDGNFVLCLVVNKEPVGQFGCSGMRREKMVIDGLQE
                     PVYVMRLLAPLIPVKLGFSPYMLPPKSIGGSGGLDPSVIYQNASVVTPEEAATVTMQG
                     SGIVTVGLSGVGSWVQIKDGGNMKLFVFALCFDVFTACCDRLAFPSLAKIYSETVSCE
                     ADKCGFCRDSGRHVDPTGRFVGCVPDSGVCLCYSPCRGTDAAVSVRSWLPYLELEDGA
                     NTHSLFVRRYDGRKGLPATISDYLGARNSEGDEIPLRTEPWQLLKIEPTLSAMIIMAC
                     PLLKKIVLEHM"
     misc_feature    136234..137259
                     /locus_tag="MuHV1_gp086"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03352"
                     /db_xref="CDD:223053"
     gene            complement(137390..138283)
                     /locus_tag="MuHV1_gp087"
                     /db_xref="GeneID:3293848"
     CDS             complement(137390..138283)
                     /locus_tag="MuHV1_gp087"
                     /exception="reasons given in citation"
                     /note="34.0 UL89 (CHS)"
                     /codon_start=1
                     /product="Conserved herpesvirus spliced gene"
                     /protein_id="YP_214095.1"
                     /db_xref="GeneID:3293848"
                     /translation="MLTDAIAVAVRRRYDEIANKRHKPTTVITTEFPDVGIFCRKRYQ
                     TVHPELGLTNACNETFTPLTKFCVQYRDYNESSPKTSALKITPTLSAAIDAVKFQPCT
                     PEQLEYRSKMNAFSDLYRDPEFVQIVNFLQDFENWIATGRDENCPSERRNKIYLEPFQ
                     RNLLAHVLFFLATTKNPTLANRVTEYLTHAFDLHFLSSQSIDLFKQKATVFLVPRRHG
                     KTWFTIPVICFLLKNIIGISIGYVAHQKHVSQYVLKEVEFRCKRMFSGRFMVENKDNV
                     ISVDHKIAKSTALFASCYNTNV"
     misc_feature    complement(137393..138160)
                     /locus_tag="MuHV1_gp087"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     gene            138282..139535
                     /locus_tag="MuHV1_gp088"
                     /db_xref="GeneID:3293849"
     CDS             138282..139535
                     /locus_tag="MuHV1_gp088"
                     /note="UL95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214096.1"
                     /db_xref="GeneID:3293849"
                     /translation="MATAAGGVYAGGEDQQQQRPRATDVSTALCDVEALAAVEEGRVS
                     EADVNRYREAVDAALIACEASSPRDRFRLIETAGGNFLLVTNALPKDRTEQQPPCVLE
                     GSGRASSNNNYEGIGTPSAGSGNAFDGLLALERGTSGGGLTATVPSAPGYVAKSVNTL
                     SYDGRLLSNSYVLYTKEQLRKSLSPDKRAIVERILRFVDTPGILDHNNVQDVEAVLWL
                     LFCGPQSVCQNPTCFGRDRECEVSYPVLLPPVFYDPITDYSAYINLAELYVYVWYRNY
                     DFDSEPTRCYELGTVAMDRVKKTLQSVRQRFSDRSVPVWPVSSRTCVFCALYNQNRVC
                     LDLAKSDVDVTSYSPIIIKDCRDAATNVTLSHVLPGQRVASLFPVYDIGTLLRALCDS
                     NDGEERRKRMRETIDSALSTTDDAV"
     misc_feature    138414..139448
                     /locus_tag="MuHV1_gp088"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            139535..139924
                     /locus_tag="MuHV1_gp089"
                     /db_xref="GeneID:3293850"
     CDS             139535..139924
                     /locus_tag="MuHV1_gp089"
                     /note="UL96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214097.1"
                     /db_xref="GeneID:3293850"
                     /translation="MGSRRPARSESALLKDAMRADLEKRQKRFFVEAFGPDHPLVRIQ
                     GIRTSDAKTRASIRECAQSTREVAAAIAVGKAQMRSGGVSTTGKDSSSWDRVHRDADE
                     FADALAEMRDVAEELRSVFTSSDSEEV"
     misc_feature    139586..139873
                     /locus_tag="MuHV1_gp089"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            140141..142072
                     /locus_tag="MuHV1_gp090"
                     /db_xref="GeneID:3293851"
     CDS             140141..142072
                     /locus_tag="MuHV1_gp090"
                     /note="UL97 (PK); HCMV UL97 phosphorylates GCV"
                     /codon_start=1
                     /product="Phosphotransferase"
                     /protein_id="YP_214098.1"
                     /db_xref="GeneID:3293851"
                     /translation="MSVELTPPRSDGSVGFAPVVVPPAPRKPLRRRAVSDLEKLYKVK
                     RRLVFGADDGAVDNDTSNNNSGSSSTTSRSRRKTAADVVSDSPKRTDDSSTAGEDGYT
                     HCVHSCACTPGERHLLCCELVSIGDSVSVARCPLCSLGISTTYLSRGCCRGRSKVTGG
                     DEDEEDEDEEENSQDEDRDEEEAASASSSGGLEWSDDSNSALSWSDENIIISPFPGLK
                     CYVTTFEDIRQPVLLETGSAYLPVYAPYDESFCRNRCLERGGDDDDERDATLIGKGSF
                     GQVWRLSDKKTALKAAASESINETLLTVWISGVVRSRAQDAGYRGELDDSVYCNILVA
                     TGSCLRHNLVSFASFDRDLYNYRGWHYAGLASYRRAFSGIADALRFLNLRCGVGHFDV
                     TPMNVLINYDRADDRQIARAVICDFSLSQCHTEGTTGHCVVVFQQTKTVRALPKSAYY
                     LTDIYHPAFKPLMLQKLCAIEPRKQFPKPSANRFCVSDLCALGHVAAFCLVRVLDERG
                     QLKVRSTSEDALFGVARKTCDALARHSVDEVANFCSLLITRQLAYTATLLGSDDMREP
                     MARLCDYFETVSDKDAPDRFRSVYKRARREIDGSYMVRLLLAASETEDGRYLLDNIRA
                     TCLMVDSEDLDVDPYKIFP"
     misc_feature    140951..141505
                     /locus_tag="MuHV1_gp090"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:270622"
     misc_feature    order(140951..140965,140975..140977,141002..141004,
                     141008..141010,141134..141136,141173..141181,
                     141194..141196,141200..141202,141311..141313,
                     141317..141319,141323..141328,141332..141334,
                     141386..141388,141395..141397)
                     /locus_tag="MuHV1_gp090"
                     /note="active site"
                     /db_xref="CDD:270622"
     misc_feature    order(140951..140965,140975..140977,141002..141004,
                     141008..141010,141134..141136,141173..141181,
                     141194..141196,141311..141313,141317..141319,
                     141323..141328,141332..141334,141386..141388)
                     /locus_tag="MuHV1_gp090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270622"
     misc_feature    order(140963..140965,141194..141196,141200..141202,
                     141311..141313,141317..141319,141323..141325,
                     141395..141397)
                     /locus_tag="MuHV1_gp090"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270622"
     misc_feature    141326..141823
                     /locus_tag="MuHV1_gp090"
                     /note="UL97; Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     misc_feature    141383..141403
                     /locus_tag="MuHV1_gp090"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270622"
     gene            142101..143786
                     /locus_tag="MuHV1_gp091"
                     /db_xref="GeneID:3293852"
     CDS             142101..143786
                     /locus_tag="MuHV1_gp091"
                     /note="UL98 (DNase)"
                     /codon_start=1
                     /product="Exonuclease"
                     /protein_id="YP_214099.1"
                     /db_xref="GeneID:3293852"
                     /translation="MATTVLPPEATAMTTIPRRIVDDVVVDDGGGFVTHNIDSAFGGS
                     ERNECLVFDQSEQCLARVFDGLSSESFDIYCLYNLLDIKERVSSVPVCALRLAYFRSV
                     FNKINLTHDGPGLATNFLSIVDREVSNAGGESTVRDAVGGVEGAQFALARAIFRLPAR
                     RLLRVMKAIERDSRGQAANPVWHALRVDTVSATRFHDVLATRKIAFRKDLDVRHSSEA
                     VRFGMQCESAIAQVLREFVAEGRGGVSDIGLLLDPASGVLGASLDFCSGLSRDDDGLL
                     VVAPGAAIFEIKCRFKYLRSRDDRAVQGLLDDPGLQSFADFILDHHTPAVEFRHQGQL
                     PTSRECLVSYDRVFRQSCKRRRTGVVSESLRLWIDGLIKENSEVLSTVFVFDARAAEG
                     ETGAATCVGDDDEDFILSAERPPLYLDLFLKAAFAAPVFANPRHPYYCQTLVQHYVLS
                     QYYINAHRDPERMSPDELPSVYLVSAILRKRDESERGRVIRINGHRSDCDEVPLCVVV
                     TPVRLDPHFARDAVSSVLDVWEGDIGKKTGLALWVQSAVNSYVAACIPTPRTP"
     misc_feature    142365..143741
                     /locus_tag="MuHV1_gp091"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:324346"
     gene            143723..144061
                     /locus_tag="MuHV1_gp092"
                     /db_xref="GeneID:3293853"
     CDS             143723..144061
                     /locus_tag="MuHV1_gp092"
                     /note="UL99 (pp28)"
                     /codon_start=1
                     /product="Phosphoprotein"
                     /protein_id="YP_214100.1"
                     /db_xref="GeneID:3293853"
                     /translation="MGAECCKQLCRSLHPYAADSLKDSSGRRVDLGTEFSVLTDTSDD
                     EDQVGAGERDDFVQKQLTTPLLSDKNSAIPLTVVTPIQLGANKGGGKRTSSLKSAKNG
                     AGVKKKVRAL"
     gene            complement(144296..145411)
                     /locus_tag="MuHV1_gp093"
                     /db_xref="GeneID:3293854"
     CDS             complement(144296..145411)
                     /locus_tag="MuHV1_gp093"
                     /note="UL100 (gM)"
                     /codon_start=1
                     /product="Glycoprotein M or integral membrane protein"
                     /protein_id="YP_214101.1"
                     /db_xref="GeneID:3293854"
                     /translation="MLSLFDPPRRPRTRDTCTMAKAGVMTLSHVDRMNLRTWTMAIAC
                     CLLSFVNIVVFSVAAHFPGIGFPCYYPRIIDFDNMNLTMYNAIHHLTPQLFLDPVQLI
                     VYVIFTELIFFCVLSYYIVCWVQIYFRSEHGTQVNQSTRDINFMGDSATCFTFVLTMD
                     TFQIFLLSLSFRLPSMVAFSKCMYFMCLTAFVVTLVTHYESRERSAFALSKIHPKLQG
                     TIRYRTAVVNLTQLILGFATMVLAMSLALGFGNSFFVKTAHVVFGAMVAFAIVACVYF
                     SIIESVLSRYMKVQFGYHIGTILGVCGAMYPIIRYEALNASSYARDINIGITVLLLLC
                     VAFSVIRTVRFLLRRNKRYRALALDNEEIRALRSDAE"
     misc_feature    complement(144338..145339)
                     /locus_tag="MuHV1_gp093"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     cl28128"
                     /db_xref="CDD:332949"
     gene            145596..148034
                     /locus_tag="MuHV1_gp094"
                     /db_xref="GeneID:3293855"
     CDS             145596..148034
                     /locus_tag="MuHV1_gp094"
                     /note="UL102 (HP)"
                     /codon_start=1
                     /product="Helicase-primase component"
                     /protein_id="YP_214102.1"
                     /db_xref="GeneID:3293855"
                     /translation="MERRWRRGLPVHLSIYAFLPEENQAILQCFFCEVADGDRVVTRL
                     FVFPVNIPAEGELRTYLLANYTSAIVSSSLDTIPDSTTAANGSGVGGEVGGGGGSGDE
                     CADRVARRSRALAQILMHVGPDFEPLTRFFTPVEIFSDGVEILGSRRWENVRGIYNSI
                     LQTLAALTVGRIRAIGSYHQMADAVSIETSTAIQSIIAEGATTEDAEDECRYRNTHAY
                     RKLRRGFVSRDITFSIRIGNKKFMLSEPSAVGAKFSVSDVFVIQDVKWRGKKLRLCFP
                     REFLAFVFSDDQCLVLLRDAMQRLFKEVYGGFSGLYPVFDFFGPNMLRSGGPRSVFFP
                     GFPAVAVYSVPWRYDMNTENGADAINEIRSLVGLPDIVGVAGKVPLVPEPGNAVDTLD
                     AVRMYDIDLHYADMRHFRINARLCVTHDMGDAALDDESSVAHIYVGVGGVCRISIVDL
                     RFAVLRMCLPGPEFPFVLSDVARRVDRMMIDAFLQRLAHSSPRIFRRVRSLENYICKR
                     VMDACEDEGYPWILVRDDCEIFVRRPVDCDQVNFDTIVRANLARVWAELFGLQYLCPV
                     CRITVAMSGVLFATGKYLLSGFPDEQKYFPTPGWVGATGRLLSEAVFCAFQSPDWGAK
                     DKIIRFMATHMLRLSARRHETRFWAQRFAPGRNRVQQHDGVMDANEFCGIHVCGRMVA
                     VQPLDGALHDNICYNDYVKKTFEVLRVTLEKVIIVLSQDQTNTAVVNNSTGEIDCVAI
                     KQEVTDDAIVSDTTGSDELDAALRALRETTANTVGMVVERTDTHNLIEEFNDVFQQTM
                     DFVVERYSAFFSMN"
     misc_feature    146361..146612
                     /locus_tag="MuHV1_gp094"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; pfam03324"
                     /db_xref="CDD:281336"
     gene            complement(148182..149135)
                     /locus_tag="MuHV1_gp095"
                     /db_xref="GeneID:3293856"
     CDS             complement(148182..149135)
                     /locus_tag="MuHV1_gp095"
                     /note="UL103 (85)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214103.1"
                     /db_xref="GeneID:3293856"
                     /translation="MSSTLMVRGAMEVHNDRDYVRLMAPEIVSITVSDRQIWFHTESG
                     ELIPNAQYRADSDCRSSFLGFCLFFILDAEDALSELRLSSIRTKHRIAVFRPKTNTDF
                     TLCMLLFAIESLPLSRQTLEHLVTFLTGTRPRTGLTRMICKSCIKLVCTSLYLFFDET
                     DPRITRHVPEICMLYKETQRAQATMLAETYFGVQDISSMSLVSLTLTDRVTKDGDTVG
                     DLAAEVLNTVCNVFYVPLGTNGSGVVTRWLSNDNNPKQRMYPDTTTTDTTITTPPTTK
                     KNMTTTTANSHIALLSTNNNTNTTTTTPGADTKKSASNNKK"
     misc_feature    complement(148437..149060)
                     /locus_tag="MuHV1_gp095"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7; cl28121"
                     /db_xref="CDD:332942"
     gene            complement(149113..151227)
                     /locus_tag="MuHV1_gp096"
                     /db_xref="GeneID:3293857"
     CDS             complement(149113..151227)
                     /locus_tag="MuHV1_gp096"
                     /note="UL104"
                     /codon_start=1
                     /product="Structural protein"
                     /protein_id="YP_214104.1"
                     /db_xref="GeneID:3293857"
                     /translation="MWRNQSLYRDSRENRFKASDLTRSTIRSIFEADDIFRTKMLSYL
                     DNPPEPPSDPLFPTDSSLDLFSMINGTEGACIGQTIHQILRDPSVFRKQIFYAMMRFL
                     LNGISVGELSTAWASHRRRFVRAEDEGGAALEQFEIWADALKHTIVDSIAALLEKLIY
                     TYAADDRYCRYVDWIVSVGVVPIAEVRTAEREKAVDAAQRRFLAEVAECHLLDRPDPL
                     RARTLRACVSALMTREVPNVPDIRIHRLKSNGHIECFSGKRRLKRFIYAEPTILEEER
                     LILTTPLARIRYERKRHNELRIHKKICQLLNTNPIKVVTTSRHEMNTKRIVELMEKRD
                     RQVDAKTSIVKFLLNVSDSKSKIGLEDSVESFLQDLTPSVDQARLLPSRAPLIQPAPS
                     GSGAQDIRELFRRQVIRCLEDQIQDHVEEIENLKLLNKTWESKTRELRDALDRYESEG
                     RRGRGPPAFDLQTLDTVNALRRVQGLPTAPVTVDDNRVVCNSFFSQFVPDERESDERL
                     SRLWEQEYFRCFKFRRNVTNQGAEDSISYSNYTIERVLLPFLTAVIEFPMLDAIPEEY
                     LFLSLSELANVIYETSKLQRYTDYIRYRETIRVQAFLEREQATAAAAAAAGAATAAAP
                     SERIGRAPGQVSGPPTKIRRLDETTPGTANYRPQQKTIVTTTPIGLPPPSSPAPEVSP
                     RFRSPQQKLETLRDRNVQHLNG"
     misc_feature    complement(149443..151029)
                     /locus_tag="MuHV1_gp096"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            151028..153874
                     /locus_tag="MuHV1_gp097"
                     /db_xref="GeneID:3293858"
     CDS             151028..153874
                     /locus_tag="MuHV1_gp097"
                     /note="UL105 (Hel)"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="YP_214105.1"
                     /db_xref="GeneID:3293858"
                     /translation="MEKRSSDESVGNKGSDGGSGGLSRYDNIFVLNMSSASKIERIVD
                     RVKSLALKRFSRESLYKDWFRHMLDPCAGLVAPELGDDGSSEGGGNAAMIVGDRELAR
                     RPPFLPFSCLLITGTAGAGKTSSVQVLAANLDCVITGSTVISSQALSSALNRSRSAQI
                     KTIFRTFGFNSRHVALADRVHLRRRDDVAFDGDVDPICQQQWRDLSTYWPVVSDIAIR
                     ALDGGKGRKDTDDLCRSNIIVIDECGVILRHMLHVVVFFYYFYNALNDSELYRQRAAP
                     CIVCVGSPTQSEALESRYDHRTQNRDVQRGMDVLSALISDPVLSEYCDVAHNWVMFIN
                     NKRCLDLEFGDLLKHIEFGLPLKSEHVEYLDRFVRPAGLIRDPAHAIDVTRLFISHAE
                     VKRYFTALHDRVRIYSQHLIFEVPVYCVLNNSAFHEYCASMCTGEPTPRPETWFRKNL
                     ARISNYSQFTDHNLSEDIQVEELAQSCGGGGAGGDDDGFDLEEEMINETLLTCRITFI
                     RDSAVGVTAKTKACVVGYTGTFDDFAEILQKDLFIERTPCEQAVYAYSLISGLLFSAM
                     YLFYSSPLTTPEILRDLSEIPLPDIPTLVIGANGGDGARDSDDNDEYEEDLEGGGCFD
                     GVSGGGSGNGGGEKYRRRLTSDDEDDFYDLSYVDRGRQPEPPQLQPPPQPQPQPRLTM
                     SAALPPRQIDEEISDVEMLCYSDIYTDKFFLKYSIPPPVSSISFEEIVHIYTIFRDIF
                     LARYRIMQKHTKGAFGKTRLVTYNRRNVWRRKNCEIESQTGSFVGMLTFVSPSNNYVL
                     EGFTNHNVFIMDAERNRIHRRILEKGLPRLIVRDACGFLLILDYNVSKFSDVIDGKSV
                     HICTMVDYGVTSRMAMTIAKSQGIGLESVAIDFGDNPKNLKMSQIYVGISRVVDPDRL
                     VLNTNPVRNTYENNTFITPFIRRALQNKDTTLVF"
     misc_feature    151097..153871
                     /locus_tag="MuHV1_gp097"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     gene            complement(153913..154356)
                     /locus_tag="MuHV1_gp098"
                     /db_xref="GeneID:3293859"
     CDS             complement(153913..154356)
                     /locus_tag="MuHV1_gp098"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214106.1"
                     /db_xref="GeneID:3293859"
                     /translation="MATASQQQPPPPPPPPPGAIVPCGHTIPMLRGGGHIELCAIQGH
                     GCLHPPLPLDDNVAAAAANTTETTTITTTATAQTSRRLRGNARIRLNPRPIPRPPAGP
                     HEHHRRRRDQRRSTQQISFMPLQSNDQQSTNTIPEIPRIVVEVVD"
     gene            161983..162678
                     /locus_tag="MuHV1_gp099"
                     /db_xref="GeneID:3293860"
     CDS             161983..162678
                     /locus_tag="MuHV1_gp099"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214107.1"
                     /db_xref="GeneID:3293860"
                     /translation="MDGRTGGRTGTGSEGVRREVLHRRPDRRSSTGHSSRVTVRSDSV
                     LASSDRSRRVISRFDRPLVATDRSLRLPARPCYLIAANATTARSKRTGARTTSACPMR
                     SSNRSGPENGEGPSALGGSEDRTTARHELPLETNGAPYAVYLHVRNEAEDPHFGRLLV
                     NERSLVTAIPTVLDPLIEPIGPGKPLFGHPLDATGISNAVRCDGRRAISSRGPCASAK
                     ASRGRPGRGAPLG"
     gene            complement(162210..162770)
                     /locus_tag="MuHV1_gp100"
                     /db_xref="GeneID:3293861"
     CDS             complement(162210..162770)
                     /locus_tag="MuHV1_gp100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214108.1"
                     /db_xref="GeneID:3293861"
                     /translation="MVYNLTADRRHARDRVSRARPRPGPAARADVQPSGAPRPGRPRE
                     AFAEAQGPRLEIARRPSHRTAFEMPVASSGCPKRGFPGPIGSMRGSSTVGIAVTSDRS
                     FTSNRPKCGSSASLRTCKYTAYGAPFVSNGSSCRAVVRSSDPPRADGPSPFSGPLRLL
                     DRIGHADVVRAPVRFDRAVVAFAAIK"
     gene            163097..164511
                     /gene="M112"
                     /locus_tag="MuHV1_gpM112"
                     /db_xref="GeneID:3293862"
     gene            163983..165079
                     /gene="38.3 UL113 P"
                     /locus_tag="MuHV1_gpM113"
                     /db_xref="GeneID:3293863"
     gene            complement(165596..166384)
                     /locus_tag="MuHV1_gp101"
                     /db_xref="GeneID:3293864"
     CDS             complement(165596..166384)
                     /locus_tag="MuHV1_gp101"
                     /note="UL114 (UNG)"
                     /codon_start=1
                     /product="Uracil DNA glycosylase homolog"
                     /protein_id="YP_214109.1"
                     /db_xref="GeneID:3293864"
                     /translation="MALRQWMLRHIAVHDVGAAAAGADVSADVIHQQAEALGIHEAWM
                     SFLKLSATQASQLVRITDRVDQERRMCTIYPEKSDVHRWSRLCFPYDVRVVILGQDPY
                     HDGSACGLAFGTVRDRPAPPSLVTVFKELRRSIPEFSMPKCGCLDAWCREGVLLINTV
                     FTVVKGQPGSHEALGWQILSDRVLQALSEQREGLVFLLWGLQAQKKEYLIDPRKHLIL
                     RSSHPSPRAQGARNPFVGNNHFVLANEYLSRRGERVDWNVLCSK"
     misc_feature    complement(165602..166384)
                     /locus_tag="MuHV1_gp101"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03200"
                     /db_xref="CDD:165467"
     misc_feature    complement(order(165719..165721,165911..165913,
                     166016..166018,166049..166054,166079..166093))
                     /locus_tag="MuHV1_gp101"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165698..165703,165710..165715,
                     165719..165724,165782..165787,166016..166024,
                     166076..166081,166085..166090))
                     /locus_tag="MuHV1_gp101"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165701..165703,165710..165715,
                     165719..165721,165782..165787,165881..165886,
                     166016..166024,166073..166081,166088..166090))
                     /locus_tag="MuHV1_gp101"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165719..165721,166085..166087))
                     /locus_tag="MuHV1_gp101"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(166384..167208)
                     /locus_tag="MuHV1_gp102"
                     /db_xref="GeneID:3293865"
     CDS             complement(166384..167208)
                     /locus_tag="MuHV1_gp102"
                     /note="UL115 (gL)"
                     /codon_start=1
                     /product="Glycoprotein L"
                     /protein_id="YP_214110.1"
                     /db_xref="GeneID:3293865"
                     /translation="MMPLLLLILLSTRNLLGAAQSQESPVAGERRALDLTTVYVLPRS
                     EPINATVEHKCREALASCYNGSEFQPLHDDGPIRPDPYRFSTMIRFKRSYGELPLPIE
                     LNDEFLEQLSLLHNNTDQLRVLLTLMRTSRASDWMSFLGGYTQCDAPKSVVFTCVESV
                     CYEHDLMRLNYTTDLFTENVLGLDVSPPVLSVLVLLRNNHTKAESVVRVPTSSMSLLD
                     GTYNLLRTILGHMSLDTDLIGVLRSYRDRFPAVFSVSDQIKITRQHYRPQYQRKRP"
     misc_feature    complement(166417..167049)
                     /locus_tag="MuHV1_gp102"
                     /note="Cytomegalovirus glycoprotein L; Region:
                     Cytomega_gL; pfam01801"
                     /db_xref="CDD:280049"
     gene            complement(167205..169142)
                     /locus_tag="MuHV1_gp103"
                     /db_xref="GeneID:3293866"
     CDS             complement(167205..169142)
                     /locus_tag="MuHV1_gp103"
                     /note="UL116"
                     /codon_start=1
                     /product="Serine-alanine-rich glycoprotein"
                     /protein_id="YP_214111.1"
                     /db_xref="GeneID:3293866"
                     /translation="MFRVGALLCVAYAVTAVYITPDVKHLQTHSPGGGRAQNSVTSKQ
                     PSIPKQPKLDRGLREVQSDPGTSQPAANANSSDAAPEKSTMSSPNPAQTAQAGKNGNE
                     TTVAAPAPPAAPAPAAASASAASTRAETPAVAAAAAATTAAKKRVSTILSRASDGTKI
                     LTPTDGTKILIYASSSSDSSDISSDDSDSETNSSSSEPSNSSLPPGSETEPSSSSSYS
                     SSSSSSSSPSSSDSEDEPSSSSSSSSTSSDGASSDSEAPSSDSGSESIGSTSPKSESE
                     SSDSEKDQEKNKKTSTPASTRASSPQPGAAPAAPANTEPARDASTELSSKMLSASIVD
                     KPTKLADAAKTTPQQVTNATGGDDALVVLTVGSITNSPLSDNRSTQSATTVQTESGHA
                     GLQKETPKKSTSLSTLKRAGRQTRELQQSSETATITDASRVPSTVTAVPPTSIPYLTT
                     LTTAPPAPTSDVDNNTNTIITAITTKDPATTAVPSRASLTVTPLLSSSSSTISFSSFP
                     SKPQTQLSVTQNATNKDNEWINSTESVSSPSAAFRTQVVTTTTTTNPTITTFPGDLCT
                     RRYCPAKYGPFVLSAFTRVTFSRAECASDVAIFNDSLIIDPGLGASVFLTIYKRLSLS
                     NRMIRLASELTEYTYTPADFI"
     gene            complement(169213..170910)
                     /locus_tag="MuHV1_gp104"
                     /db_xref="GeneID:3293867"
     CDS             complement(169213..170910)
                     /locus_tag="MuHV1_gp104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214112.1"
                     /db_xref="GeneID:3293867"
                     /translation="MMFWSGNRAAGGVRFPAPSAWSTITYAKVSRPLVTSLTPANVSD
                     DKVVVIRANETTFARIPPGESPWETRVRIIGSDVTDEELAERSAAAAKAPPAASFVDP
                     PQLHFLPLLQNPPPLPLPFMPTVDIPTTFAAAASMLPMFTDPAAMVPTAWPMVAAAAT
                     ATIPGQRPILPKLPMIEEPIPISSDPLTFPDPDAFPEPISIPDPGRFTEPIAFPEPIT
                     PPELIVFTDAPTKPTTTDPDTIELILEPVTVPESEPVGTSSPAEPVPEPVIIPQPVPE
                     PEPEPEPDSEPVTVPEPVAVPEPVKIPEPVKLPEPVPVPAPKPVADSELIILKRKELS
                     PVPQPTDARPAKVPKVPKLIIKKVPRAPIVVRPVPTRLSDVTAPANRPEPRQRQQRAE
                     TETAAASSCTTEPKKHKKIPKIVVPATITAKRKTAEGAPDEEFGNDLLKRLADLCSDR
                     HTDVSDIRIHFSCQKFRTARGTYNALAKIPNLKIVMGAQMLTEKCRCHEKPKFDEINY
                     QPRTAANTHIETGPYEVIVRSRASRELLAAARVCQDVAKKTGIKCEFSFSTIRYTCS"
     gene            169541..170956
                     /locus_tag="MuHV1_gp105"
                     /db_xref="GeneID:3293868"
     CDS             169541..170956
                     /locus_tag="MuHV1_gp105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214113.1"
                     /db_xref="GeneID:3293868"
                     /translation="MSETSVCLSLHRSASLFNKSFPNSSSGAPSAVFLFAVIVAGTTI
                     FGIFLCFFGSVVQEDAAAVSVSARCCRCRGSGRFAGAVTSLNLVGTGLTTIGARGTFL
                     MMSFGTLGTFAGLASVGCGTGESSFLFSMMSSESATGLGAGTGTGSGSLTGSGILTGS
                     GTATGSGTVTGSESGSGSGSGSGTGWGMITGSGTGSAGEEVPTGSDSGTVTGSRMSSM
                     VSGSVVVGLVGASVKTMSSGGVMGSGNAMGSVNLPGSGIEMGSGNASGSGNVRGSEEM
                     GIGSSIIGSLGSIGRCPGIVAVAAAATIGHAVGTIAAGSVNIGSIDAAAANVVGMSTV
                     GMKGRGSGGGFCNNGKKCSCGGSTKDAAGGAFAAAADRSASSSSVTSDPMIRTRVSQG
                     DSPGGILANVVSFARITTTLSSETLAGVRDVTRGRDTLAYVMVDHALGAGNRTPPAAR
                     LPLQNIIVRASKNAKQHDAAK"
     gene            complement(170980..171945)
                     /locus_tag="MuHV1_gp106"
                     /db_xref="GeneID:3293869"
     CDS             complement(join(170980..171633,171682..171945))
                     /locus_tag="MuHV1_gp106"
                     /exception="nonconsensus splice site"
                     /note="Possible splice to m119 as for HCMV UL118"
                     /codon_start=1
                     /product="putative glycoprotein"
                     /protein_id="YP_214114.2"
                     /db_xref="GeneID:3293869"
                     /translation="MLRLVLFAAAFHTAHGVSSVSCHDAETYWNYGANVNCSVTLYPK
                     NGGMFAVDCFWKAHEHKPWHKISRLDAYGWTHFESDRRSKYYNSPRTGFYPNRLSLSF
                     SPTASLKLSYDNKNHILNASHSAVAPGVTFFKCHFYHIARTRDGGPDWKEATWKVTAY
                     PLISLTTGFQVKDLFVRVTYKNRTDLKPKPKKSPNPMSISVYHEKNSPFTPTSNTSIQ
                     NENGTITYLMTFSVPWADSQGNATVDVMVDNHNYKKLFLFRRHSTRYYAALTVLLVLA
                     ALVIIAYIVHRHRGTLKARLAFRYTRDFE"
     gene            complement(172056..172991)
                     /locus_tag="MuHV1_gp107"
                     /db_xref="GeneID:3293871"
     CDS             complement(172056..172991)
                     /locus_tag="MuHV1_gp107"
                     /codon_start=1
                     /product="Putative glycoprotein"
                     /protein_id="YP_214116.1"
                     /db_xref="GeneID:3293871"
                     /translation="MVYSLLHCHDITTHYKPIKHPSYPPSSFAYASHHRINNTLVIYY
                     CTLCFFYFAPRTSSLKMSIDLLLHLVVCVSFLSVGGPIPCNVSLSYSYYEYDLRINCT
                     VRCEVPELSEIHFRDYGSTDLVDFDNPRLPRHKESSYTISATGSFWGEMIHCQVRAAL
                     ICTVVIQVNATVYFVCNGTSARWPPYEGPFVTGGPDGDDEISVPPETTDDGSPRLLKS
                     GRGKKCVEYGELHKLRRSRATSPARTAAATEDRDEDSERSNISLAIGMIFLSCVILAT
                     ICMWTCVRCNDISVRPRSYRSRWFLREGCRPVVRL"
     gene            complement(173022..173390)
                     /locus_tag="MuHV1_gp108"
                     /db_xref="GeneID:3293872"
     CDS             complement(173022..173390)
                     /locus_tag="MuHV1_gp108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214117.1"
                     /db_xref="GeneID:3293872"
                     /translation="MESSLKSNDTIRTPQPSSIAIFNLVMELTSTDLLTYGLISCILL
                     ALGFLSGILMAVAAMRAPHPNLFLHKLKKLLGLTSYQLYTICDHAPQTPEEKKKNKKS
                     NDHGDGTESAEDDFMYIPTK"
     gene            complement(173410..173721)
                     /locus_tag="MuHV1_gp109"
                     /db_xref="GeneID:3293873"
     CDS             complement(173410..173721)
                     /locus_tag="MuHV1_gp109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214118.1"
                     /db_xref="GeneID:3293873"
                     /translation="MRVAIPLVFCMVWLIYLLHPASVLASSAATGTSNVTPKPSPSST
                     SSSTASNQTINSHQSYSNSTTTKNSATSPSSPTDTSKKNLLFRLAFSSTAIAVLANRF
                     V"
     gene            complement(174054..174335)
                     /locus_tag="MuHV1_gp110"
                     /db_xref="GeneID:3293874"
     CDS             complement(174054..174335)
                     /locus_tag="MuHV1_gp110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214119.1"
                     /db_xref="GeneID:3293874"
                     /translation="MPEFPQDPAAPLRSNRTEPDFPTFLPHMVSGYIDSSLWSPIVRF
                     VVMLPELLFVIVAVAIIALAVIFRIVRMKIRAVYRIYRVLRRRRPTHTA"
     gene            174154..174489
                     /locus_tag="MuHV1_gp111"
                     /db_xref="GeneID:3293875"
     CDS             174154..174489
                     /locus_tag="MuHV1_gp111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214120.1"
                     /db_xref="GeneID:3293875"
                     /translation="MIATATMTNRSSGSMTTNRTMGDQRELSMYPETMCGRNVGKSGS
                     VRLLLSGAAGSCGNSGMIRRGDRCVPSRGTRGTMVCGRDGDHLPACVVTNSSWTIYTR
                     QRTLTRPVG"
     gene            complement(174299..174574)
                     /locus_tag="MuHV1_gp112"
                     /db_xref="GeneID:3293876"
     CDS             complement(174299..174574)
                     /locus_tag="MuHV1_gp112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214121.1"
                     /db_xref="GeneID:3293876"
                     /translation="MNDTVTTTTISSGGPDYVISLIAFAGTLIILLAALVFAVAYKWS
                     KRNSLPHKLVDDHRPFHRPSSRVFPSRGHIYPLAVSCQNFHKTPLPR"
     gene            complement(175679..177775)
                     /locus_tag="MuHV1_gp113"
                     /db_xref="GeneID:3293877"
     CDS             complement(175679..177775)
                     /locus_tag="MuHV1_gp113"
                     /note="UL121 P; Serine-alanine-rich glycoprotein with low
                     homology to HSV-1 ICP0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214122.1"
                     /db_xref="GeneID:3293877"
                     /translation="MRVPVDTVLLLAVGCWALLARGGGGAESAAQVTNTWCLFIEEGG
                     TTFVGEEGTGEYSRRDISVSVGNTGCTSDASNVTCETAENGDLIVNYENGTLFCEAGP
                     HVVNITVLRMLFPSQGEALFCDKNGTVSTLEWFNIDSGQDAPPIEAQFLPRIIFFLQT
                     DTEGATPCALCTSESDTLLCVYGVLDPEEFADTRDIYSALRSVAGRGTSREQRPTPRY
                     GAPTSGAERDDSLSLPRASTGAVRPTQEQEKVQKEQEFSLSSVWRTRLASNLGARGVS
                     RVTDSPQHRGPTHDDVLQPATRGTGEVSIPADLDLQTEIVRGGAGRPLSSSSASNSTL
                     PLSQRGNDGSPASVLGRSPDNLHAEPLPNNNNTSDPKVPGTPDLSQRHVLHPQNGTGR
                     GALSSVVRADGGASSARTPSLPVSSDFAREGRVHHQSSVPTRAAHARTQAGGSASPAG
                     LRGPPRAGEPSDSETAASAAVAIVSADGRSSVRRRRRREERPSGYRLRRLLEAAATTT
                     SNSTGPATVTSKEVRSQSVSEANGSPSTPTSVQERQSTSVRVVATGSVNSSAAGTNGT
                     GATTASGTVSSKETSRKSDAVGTSAKSSSPPRSHSATVQASHSNTPIGRPATRTQTIS
                     VVDLLPVVSGEPEIDTHDYPLSVTDGQVVTPQVGTWFVTHPLQVLLISLAGAVLLVWI
                     LTSLAALLFRRTRSVY"
     misc_feature    complement(175895..>177154)
                     /locus_tag="MuHV1_gp113"
                     /note="Atrophin-1 family; Region: Atrophin-1; cl26464"
                     /db_xref="CDD:331285"
     misc_feature    complement(<175985..>176266)
                     /locus_tag="MuHV1_gp113"
                     /note="Endomucin; Region: Endomucin; cl25495"
                     /db_xref="CDD:330316"
     gene            complement(177980..179517)
                     /locus_tag="MuHV1_gpM122Ex5"
                     /note="UL122 (IE2)"
                     /db_xref="GeneID:3293878"
     gene            complement(179760..181249)
                     /locus_tag="MuHV1_gpm123Ex4"
                     /db_xref="GeneID:3293879"
     gene            complement(181368..181562)
                     /locus_tag="MuHV1_gpm123Ex3"
                     /db_xref="GeneID:3293880"
     gene            complement(181656..181766)
                     /locus_tag="MuHV1_gp114"
                     /db_xref="GeneID:3293881"
     CDS             complement(181656..181766)
                     /locus_tag="MuHV1_gp114"
                     /note="ie1/ie3 exon 2; initiating ATG for ie1/ie3 at
                     nucleotides 181764 to 181766"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214123.1"
                     /db_xref="GeneID:3293881"
                     /translation="MEPAAPSCNMIMIADQASVNAHGRHLDENRVYPSDK"
     gene            181933..182280
                     /locus_tag="MuHV1_gp115"
                     /db_xref="GeneID:3293882"
     CDS             181933..182280
                     /locus_tag="MuHV1_gp115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214124.1"
                     /db_xref="GeneID:3293882"
                     /translation="MEAPLTQTESSVPSPNSPFFLSGPRFSGRGKRDLRSTSNNTQEL
                     TESSTGKEHHSRPPRWLQPLSTIFCILLIFGLIMAAVACNIWCVNTGDDLSSHGDSIL
                     DIELASSAGATDT"
     gene            complement(182011..182418)
                     /locus_tag="MuHV1_gp116"
                     /db_xref="GeneID:3293883"
     CDS             complement(182011..182418)
                     /locus_tag="MuHV1_gp116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214125.1"
                     /db_xref="GeneID:3293883"
                     /translation="MVASFSISYIYMLVMVPLPWPRCASVPGTVTWYRKRPDTYASLP
                     RMLCVCSTGGACELDVQDRVSMTAQIVSCVHTPDITSDGRHDKSKNEQNTEYCTQRLQ
                     PSWWPAVVLFSRGGLRQFLRVVARTAKISLAPS"
     gene            183436..183765
                     /locus_tag="MuHV1_gp117"
                     /db_xref="GeneID:3293884"
     CDS             183436..183765
                     /locus_tag="MuHV1_gp117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214126.1"
                     /db_xref="GeneID:3293884"
                     /translation="MYWAKPIGKSLLTQCTWLQWDFPVDSPPIDLMYWAKPNGKSLLS
                     QCTWLQWVFPIDSSPIDLMYWAKPNGKSLLTQCTWLQWDFPVDSPPIDLMYWAEYNGK
                     SLLTHPH"
     gene            184535..184810
                     /locus_tag="MuHV1_gp118"
                     /db_xref="GeneID:3293958"
     CDS             184535..184810
                     /locus_tag="MuHV1_gp118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214127.1"
                     /db_xref="GeneID:3293958"
                     /translation="MATAVFDRSRGSHFYSWKASDPHDLCLRPQGTCLDRWATPSGCL
                     YFYIRDRKSQPPVTAVRAIQDGDRYFRSLFLPSILLPKRNPPPGYVP"
     gene            complement(185190..185591)
                     /locus_tag="MuHV1_gp119"
                     /db_xref="GeneID:3293959"
     CDS             complement(185190..185591)
                     /locus_tag="MuHV1_gp119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214128.1"
                     /db_xref="GeneID:3293959"
                     /translation="MENKRDQSRKVRSCTRVIQRSGRLRSFAMSARQSTWIRKKEARA
                     RVVRGLGRTPSTMNKKVTFPPRQCTSVRNGVCGSVCPSKEDICYQLSSVSGRGSGRDE
                     QENVLELLFNRSVSWQSRTLGGSRTPSPGSL"
     gene            186085..187299
                     /locus_tag="MuHV1_gp120"
                     /db_xref="GeneID:3293960"
     CDS             186085..187299
                     /locus_tag="MuHV1_gp120"
                     /note="US22 (GF2); ie2 exon 3, with mRNA terminating at
                     base 187353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214129.1"
                     /db_xref="GeneID:3293960"
                     /translation="MERVRGASSSDSVATLHGDHNYHCMATFKLDCTSARTRGVVSIL
                     EHRDPATVDDIFMQRVCHDINDVLRPVECLTSFPEYRRTLRVAVEAATELHGVSALSG
                     QLTKFLEDHDGAMLPLAWPPNRYLRLTSGRKLGYLDVAEKLRKEYPMCNGPLEVLGVI
                     LGPGQSLYSDQHPVLLMGLTGTIFLHARGRPVWSPDYDPERDADRLFLAAESLQSFGR
                     EGLCRCDNVYTEDGGAPYATPEDPVLKNIVFTPHLGGKALHQQICKIKGHTWYLNGCP
                     GMLKDRVFVATPDIPPFVRHVNLELFGHRFLPIGRVTRSPEDPECEMFIMVDAGGAIY
                     GHMLDSGKVRRLADNFDQFMRMGTRRAYFNFQMVKGDSLNTEYEETSFGTKNHGFFLL
                     TRDLVTVRKKIQ"
     misc_feature    186394..186768
                     /locus_tag="MuHV1_gp120"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    <186997..187179
                     /locus_tag="MuHV1_gp120"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(187347..187847)
                     /locus_tag="MuHV1_gp121"
                     /db_xref="GeneID:3293961"
     CDS             complement(187347..187847)
                     /locus_tag="MuHV1_gp121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214130.1"
                     /db_xref="GeneID:3293961"
                     /translation="MMYVADVMTESPRITVGKYPYEVKDGENWIECVCEITWVGNGTN
                     WPLGIHPFKPTVWIQYTLQMTFSGKDNDPSSRCINSSHVSERRWTVDPPERLLDFNQY
                     VATLLSSASPPTGAAKTLLTPTAVECEFKNASETLRTPYYCMPLTSGEPPPGRVFYRL
                     QRLSDE"
     gene            187807..188280
                     /locus_tag="MuHV1_gp122"
                     /db_xref="GeneID:3293956"
     CDS             187807..188280
                     /locus_tag="MuHV1_gp122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214131.1"
                     /db_xref="GeneID:3293956"
                     /translation="MRGDSVITSATYIMSAGSTGTSLMVVLKAFSSAPKISRTRSLES
                     DRDLYTHRQTDQTPPIAPPADPSPFRSKHSPDQTQESVRPPGPLSAHPHPREGSENHL
                     SSARSVSVFGALYRVQRERVQLRPRATWLAEVRDGRHDQHDATDEAAHEERSHFR"
     gene            complement(188026..188376)
                     /locus_tag="MuHV1_gp123"
                     /db_xref="GeneID:3293957"
     CDS             complement(188026..188376)
                     /locus_tag="MuHV1_gp123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214132.1"
                     /db_xref="GeneID:3293957"
                     /translation="MKVSLLPMGSWRPHGLCIFMFLLNVSLIHNKISSEMGTLLVCCL
                     VCCVVLVVSTVADLREPCCARPQLHPLPLYAVQSAEYTNTSCGREVVFTTFSGMRVCA
                     KRAWWSDRLLCLVR"
     misc_feature    complement(<188071..188193)
                     /locus_tag="MuHV1_gp123"
                     /note="Chemokine: small cytokines, including a number of
                     secreted growth factors and interferons involved in
                     mitogenic, chemotactic, and inflammatory activity;
                     distinguished from other cytokines by their receptors,
                     which are G-protein coupled receptors; divided...; Region:
                     Chemokine; cl00134"
                     /db_xref="CDD:320775"
     misc_feature    complement(order(188152..188166,188179..188187))
                     /locus_tag="MuHV1_gp123"
                     /note="N-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(188083..188085,188089..188091,
                     188152..188160))
                     /locus_tag="MuHV1_gp123"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(188113..188115,188131..188133))
                     /locus_tag="MuHV1_gp123"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(188089..188091,188095..188097))
                     /locus_tag="MuHV1_gp123"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238098"
     gene            complement(188379..188601)
                     /locus_tag="MuHV1_gpm132Ex2"
                     /db_xref="GeneID:3293925"
     gene            complement(188878..189795)
                     /locus_tag="MuHV1_gp124"
                     /db_xref="GeneID:9887981"
     CDS             complement(188878..189795)
                     /locus_tag="MuHV1_gp124"
                     /exception="reasons given in citation"
                     /note="Exon 1 of M133(sgg1)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214133.1"
                     /db_xref="GeneID:9887981"
                     /translation="MSPPLLFTISLFFALGSRPLAGYSNLAVWYSDYENGTYSCEFVL
                     PRPNNMPLPFTNCYLPEKIKSSATVTPNGTILLHDNYLTTKLVEDSSTGKRHRRLSFR
                     DPEFEKRHPCLYCERPGDSMDMERCLMCKDTTMAVLLKDLHTPKRRDFSPMLVRATVE
                     TVNHRPYFTCRFRVTPDTQKIETAWLNDDCTFGAKTKDPIEACAKTASYKKSIREGRY
                     VTMSAKVKPGDPRTCRVCLLKTDNKYVLMARPCLTDKRHQEYIRNVRIVHALVISVWA
                     VAIALVGFAAVRLLLSLDSVARLVKKMFAV"
     gene            189868..190281
                     /locus_tag="MuHV1_gp125"
                     /db_xref="GeneID:3293926"
     CDS             189868..190281
                     /locus_tag="MuHV1_gp125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214134.1"
                     /db_xref="GeneID:3293926"
                     /translation="MAVDVTNSRSIDTLVNLVQREGVRAHVFVPGGAPQKPRGDVVVV
                     HPVVLYQIDATFDRDLLVAARGLLPSAASHERGDRHHQYSGRQQHRSQGGAGQHDGLS
                     GHGLRGRGTFCGVNSHASPRFSCPLSHREFCSVRQ"
     gene            complement(189895..190221)
                     /locus_tag="MuHV1_gp126"
                     /db_xref="GeneID:3293927"
     CDS             complement(189895..190221)
                     /locus_tag="MuHV1_gp126"
                     /note="39; coterminal with M133(sgg1) in MCMV strain K181
                     and shares splice acceptor sequence with exon 2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214135.1"
                     /db_xref="GeneID:3293927"
                     /translation="MAINTTECPSPSETVSAQTIVLTCAALTSVLLAAAILVVAISAL
                     VRRCRRQQTPRGDEQVPIECSVYLVQNNGVDDDDIPPGFLGRPAGYEDMSPHSFPLDE
                     IYESID"
     gene            complement(190310..191071)
                     /locus_tag="MuHV1_gp127"
                     /db_xref="GeneID:3293928"
     CDS             complement(190310..191071)
                     /locus_tag="MuHV1_gp127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214136.1"
                     /db_xref="GeneID:3293928"
                     /translation="MFLPTAAAWLFLAHGVASQITTTVSQTRGYTTARNKTYIEWCFR
                     TNERFASLNVTWNRTLYDTEILFETSWTTFTTERCVARKLVGAEDAMIQILRFDPDNK
                     KMEELRVKFEGTINHDSTGSFVSYINTQSGRWSVEKVMKVEISFVCELKVSEDAARYS
                     CEPEGYGWLTKGYLTATVRVNGSEHSIHLPEPGGAYIEYERGSFLSGYLGPGGPLVTV
                     TVLQPCPPREIDLIIELHPRYKLYQSFVIPERRGE"
     gene            complement(191088..192092)
                     /locus_tag="MuHV1_gp128"
                     /db_xref="GeneID:3293929"
     CDS             complement(191088..192092)
                     /locus_tag="MuHV1_gp128"
                     /codon_start=1
                     /product="Putative glycoprotein"
                     /protein_id="YP_214137.1"
                     /db_xref="GeneID:3293929"
                     /translation="MWRYWYRGAIAAIVAAVTTTALIAPGGWDPSGLSFEQPEFVRNM
                     YDTQPTVLNCSLTTRFSRGVVGWVKCSGGQPKKRCRSMWVEYVGDTDFAGEGVYDDGF
                     RAPITARVRKSEPPLLDVDLGIELEPRHENLGGHACVVVPHLGVEDSSVVTEHISRAT
                     FILTARVRRVFVVKDSILSAKFHMSSAMVSRAAGTILLRLREGPEVHFETRLDHIKSA
                     ISNPGLNFSKTTEKENVTTFALTAKIDPFDLGFSMEVDDGQGGFVGRSGVELERPARG
                     FWWKVTQMTTIVATVLLALLGEQYFVTPHTEKAFIAWCAMFIGWVLRGLIDREDLQEL
                     "
     gene            complement(192233..193942)
                     /locus_tag="MuHV1_gp129"
                     /db_xref="GeneID:3293930"
     CDS             complement(192233..193942)
                     /locus_tag="MuHV1_gp129"
                     /codon_start=1
                     /product="fcr1 Fc receptor glycoprotein"
                     /protein_id="YP_214138.1"
                     /db_xref="GeneID:3293930"
                     /translation="MAPSTLIALCLLAAVTAHQLPACQWRLPTETSVPFNISCDLVNG
                     STVKVWRDLCGEGNATEGWIGMARRGDKLHFSARWNYSTADIGVYYVNVTERNLTTPL
                     TQLITPPMTIWGMRQGGRSRDFVLCTVTGIFSKGEFTLEANGATVLSVNFTKPGRYAV
                     KKARVSLDLSHRNGTMRFLVSIRGGPMTHVKYQCIMTPLSCVPFAVSKPLMLEYRQTM
                     PSGVKRYTKDSTGTEVANRVCCKLDDYHNWDFAKRVTVTRTTVQCAEPQFLFAFDIPP
                     YMFYIAAVEKPLESVLMLYDVDTWNYAFTSSGVCIQTSKKTGVGLPPGEYQCIFERES
                     GSLYGRSLMVHGSITIEAKTTHDFVSRVEIQITCTFDAVSDGAFTLERVEDGQPVYQS
                     RVGTNESFVSDDSISINGSRLSEGKISVSVYLREDDGVIGRFRCRVRSGCLNLVSRAI
                     TVTKPTRMEYALVTEEPVTSPQTTTTTTTTTTTPSPPSPAKKLEEIRIKVDGTDDDDF
                     LLETQEPLKSYPYYPLFARVSAEGRLAAVACFFLAAILVLVHISFWISSPPCNLPGCV
                     RHT"
     gene            complement(194082..196016)
                     /locus_tag="MuHV1_gp130"
                     /db_xref="GeneID:3293931"
     CDS             complement(194082..196016)
                     /locus_tag="MuHV1_gp130"
                     /note="US22 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214139.1"
                     /db_xref="GeneID:3293931"
                     /translation="MWSLRGAQRRDLRFDGQDDEWCLAYEDCMDQKFGEYGGVDERSL
                     PPIRSPVYPPRSFINDQFSFGLPLDSTDRTAGGRESCGAMAESDLFIDRAALDGTGRS
                     DAGSRDSESDSDFDMESDSDLSDDGDAAGAYVYGSPWKTSAVTVSRKAVEKYEKKKLA
                     QRLYSLTMRDFKSFHLALSFPPGQIAAAVVHYLGKPLVLRYPENWYLIPQRRSEIRVL
                     RGVDLSKYLCCGDTAGELTPLGVCAARSPDLHFRETPCALVMDERGRFFLYDAESDGL
                     YYAARNIDQLARRGLSLCEPVYRDGGAVVSMPKPKTLVRKIVSAAVVGLENVAATATA
                     FRGSTIALRDPVSGRRETFQVFGASDLKRKPPFSRMDDTTYTLVREYITFRLAEAWTV
                     IGAVGEYRDDGFVFEVSTVVLVGARGTVYGFCLLSNDVFRIAEDISVFFKRGGVSGGA
                     AVPNRFDRGARGELRLERPPLCPHRDEDRPPIATSLASQEIARRDLEDWYRWRLGARS
                     RLQDGVALSNVSEAKRQLTHPAKGIPVSIVTAESYHPRGDPEEAFESLSGQTRPYRYP
                     RVCDASLSCSDRDFYRRYVRAMDMFDGGKEKSEREIMFIRAERVGSLQKTGTPLKLPP
                     LVRATQAGSTSNNMETGSDR"
     misc_feature    complement(194085..196016)
                     /locus_tag="MuHV1_gp130"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(196062..197516)
                     /locus_tag="MuHV1_gp131"
                     /db_xref="GeneID:3293932"
     CDS             complement(196062..197516)
                     /locus_tag="MuHV1_gp131"
                     /note="US23 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214140.1"
                     /db_xref="GeneID:3293932"
                     /translation="MDSTLWESLPVTDDPAPYRHATRSSFLRVMLAFRDFYRHQSNRG
                     ELASLVERRAGERLPLGIPHNWFVELTPASRYEELKGVDINGIVCCDEPLTVVGRIVI
                     RNNDGYEDAGAALCLGAWTRVFVYEIQEDAMILVAPDLDKLARFGLLHCETLYRRPHL
                     PQVTTTPHRLVVGLIMCQDDLDRVSDYCQENSGRDVALYTPGFKYQPMKLLGGVRDAA
                     RYWPLDIMNPSNLKACLDEITGRLCCFWHAFAAVGAYAPAGVFSIHHLLVIDTFGAIY
                     TLDMQREKFYRVADGITMLLRAGMAKAIAFGARFDRPARGEGRCEMRVICPHLPDHRK
                     SERSEVDYANEHEWLCRRDRFRPDMRTWDDADKLAINHAVRAMKRKAGEMYTNEEEDW
                     TDTNEWEQEDDDNRGFDGHAMDITGPDDGSRSCTWWPESVLTTRPDRNRDTRTLLRYM
                     SEKKVTFQEVATRRLLERQESHYSLSFPLRLCRP"
     misc_feature    complement(196065..197516)
                     /locus_tag="MuHV1_gp131"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     gene            complement(197705..199231)
                     /locus_tag="MuHV1_gp132"
                     /db_xref="GeneID:3293933"
     CDS             complement(197705..199231)
                     /locus_tag="MuHV1_gp132"
                     /note="US24 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214141.1"
                     /db_xref="GeneID:3293933"
                     /translation="MERPVTANAISAYKRVIDAFSRLVATGGDQNARRRAIERLDGKV
                     IPLGFPQDWYVVCGSGKSCWSVLTDRANALLCCEEALIPLGLCGRTSDPYDTRGLRGY
                     GVSLVLSGEYGRVYVYTASDDTLHLVARNLEELGRFGISRRSFAYKEDMQRSVPRADL
                     VRLRYIASCDVPRGYPGMELLVVFSDPNADAATSVGYTRFVDGKFVRLTTPGYGTSAL
                     FLAKDPGELRGIWPFRGMCDPEFKRCWNAVSDALHCSWSLIGVLGYRPGGLPDAEFRA
                     DHVIVADKFGAVYSLLVYSRAGLTRRVADSVAEFFQMGMLKRVFSSSFEFRQRERRKE
                     RLESMPRCPHWPEQKFKYIEENCRDRFDSPTDDEDYVPADCMAEHYAWLVQSTVKVHS
                     CRPWDLDDPNVAPRALVTNADTGDPMKTYWDRLESAIAKVKLTAAATASDVESSGGRY
                     GEGPYVYKLSPVPPTYFALTCHETESMTMEEVYACRRRQFFCDTIVPFYRARPGPSET
                     "
     misc_feature    complement(197711..199231)
                     /locus_tag="MuHV1_gp132"
                     /note="US22 family homolog; Provisional; Region: PHA03342"
                     /db_xref="CDD:165586"
     gene            complement(199441..200748)
                     /locus_tag="MuHV1_gp133"
                     /db_xref="GeneID:3293934"
     CDS             complement(199441..200748)
                     /locus_tag="MuHV1_gp133"
                     /note="US26 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214142.1"
                     /db_xref="GeneID:3293934"
                     /translation="MDALCAAIRSDHFRDQRPVGIRPRSRYLTAAAVTAVLQDFADIF
                     LAQNDHTSVENVVRKESGRLLSLGAPTGWYLCLRSADQVESFPGYPVWETYGGAPAGR
                     YTLLGQVVRRFRGVVPTEELRWFVYLGPQGQLLCHQERTDAVFVMSLSIDELARRGLV
                     NFEPLYAERHLPLTTAVPVKLVAEFSALDPRDGTAVAERALMCQGRTILLHTPGEGDR
                     PLVLCGTDECLRRWWPFCRMSDGEFAKFTDRVTRNLKTSHWKHFGVVGLRVGQDPFRV
                     ESVLSVIGNGAIFHTDPDMDVTWRIADNVDELFRMGLTKLYLPKRRLDRGTMGRARLE
                     APGCAHVAAAAWEETYVIFGCRIVRDFASQLGWLMREGRFDESSGTWDEMDDAMRKTF
                     DAESKELVRRDVEVADALNDVDATFRGCPRNPRSADADADDDD"
     misc_feature    complement(<199477..200673)
                     /locus_tag="MuHV1_gp133"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(200920..202593)
                     /locus_tag="MuHV1_gp134"
                     /db_xref="GeneID:3293935"
     CDS             complement(200920..202593)
                     /locus_tag="MuHV1_gp134"
                     /note="US23 (GF2)"
                     /codon_start=1
                     /product="US22 family homolog"
                     /protein_id="YP_214143.1"
                     /db_xref="GeneID:3293935"
                     /translation="MSWVTGDPAWRPEALIRPADREQILRDFKSFFLTQTSERSLKKT
                     VKRESGTKLCVGYPPGWWLAVVPRGELVEMDGRDLRPILPTGEWVVVLGEIRSPMVQH
                     TSLYLAMGKESRMFVYSAEEDAIALAANDLDEFSRIGLLTVEFIYRVPLSIPLKKDPV
                     WDAIGLCVTGYDLNRHLSTYRNSVIELRTPGKQETNPLILLDRLELCCKYWPLVAMDK
                     SRIDGLIRYASRKMSSRWYTLGLVGVYRDTGVFHGAQLLVFDDSGSIFYLSLISGELW
                     RLADSAAELRRMGLLKIFTAGRRVDRDLAGSVRLEPPPDQELWFHSRPAATHLCVDVA
                     PPGEAQLAQQFAWISRPGRAEILSEEETAVADAFLRLSRLKVTVTEENSSRVLCTHVA
                     APPEPGRAAWCRRCCVTRTAGAPSRRTRRTSCLGSRRSRRLRRRRRGATTRISLRRRW
                     RGAARTRPRVRPASRPVTTHRSWSRRAPCAPRRREIVTNASESGSTATRPTIRHRPRP
                     RRRRTPPGRPRRPVRSPRRDAVARHRRATRERPTREPPRRGPRRGGFPL"
     misc_feature    complement(<201535..202587)
                     /locus_tag="MuHV1_gp134"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     misc_feature    complement(202153..202473)
                     /locus_tag="MuHV1_gp134"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(201703..>201891)
                     /locus_tag="MuHV1_gp134"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(202742..203893)
                     /locus_tag="MuHV1_gp135"
                     /db_xref="GeneID:3293936"
     CDS             complement(202742..203893)
                     /locus_tag="MuHV1_gp135"
                     /codon_start=1
                     /product="MHC class I homolog"
                     /protein_id="YP_214144.1"
                     /db_xref="GeneID:3293936"
                     /translation="MRALALICVVWVCWRESCARHGTEDSSESGLRYAYTLVVDGTAN
                     TRRCFGTGHVDGEAFVGYSNNKTHGIGRWVNASHVEEENKEFVRQCKELQAELDKMQN
                     NSKVIGVKTVQLDVGCTSKIEKHYAYDGNETEDDTATSASERDRDCQKKLTEYRKLVL
                     ASAVSPQLEVERRSSGREGGMRLRCFARDYYPADLEIRWWKDDGGGGALPQTSKQHHD
                     PLPSGNGLYQKHIDVYVDGGLEHVYSCRVKGIATGLELQIVRWKGYARGAGNSVVLLA
                     LFIPASVMAAVVVGSVLIRKKSKEQRKTRRRFGRRSGHEPKRPSYQVKRRAEPPCDLP
                     MTIWFRGDNVMSTQVEACPAYAVTMSARELSDAWSNGDGPIVTVPDPSI"
     misc_feature    complement(203150..203404)
                     /locus_tag="MuHV1_gp135"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:325142"
     gene            complement(204029..205492)
                     /locus_tag="MuHV1_gp136"
                     /db_xref="GeneID:3293937"
     CDS             complement(204029..205492)
                     /locus_tag="MuHV1_gp136"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214145.1"
                     /db_xref="GeneID:3293937"
                     /translation="MDRRVVSYLMCALAVSFASYDQRTPGDVDPECARGFEEMHHDRV
                     NLTLVLSMLSFDVYPHFLATIALDDTTSFLTVKWNNTPRWDHTDEGTVTDSYGWANDS
                     DIPTEYDFFKNQREFLKTVRAVLMELRSRCGVRYECTFNATFWYGCVVTIVLNETVLL
                     KYNPAFVNGTEHTLIYNKTAEKLKNYAEGRDTDLLKNKVTSLYPRWLKVYKAAAKLGG
                     PNSLKTRFRTSNNTTICEVWTYAPLYFSIEIEVAGLPPVKGEVSKSWFTIYMRVQNQT
                     SDSDLSKSICKIRSSVRGACKDVRHPRYVPPPITTSPTTTALSTTTLFTDTTPFHTTP
                     ETPFSSMNTTLLTVSTLGPTRPTIIPTVSSTALDMISSVRSTATKTATVEVSTNIEVS
                     ETTSSSDDISLMIDVLTGIVTGEQGKYYSGYSVDTPTLVAMFVAVTALCICAMVFCYY
                     CYYASRTKLRSGELDIEKARAKNRLSTVVSWYKTIEA"
     gene            complement(205642..206775)
                     /locus_tag="MuHV1_gp137"
                     /db_xref="GeneID:3293938"
     CDS             complement(205642..206775)
                     /locus_tag="MuHV1_gp137"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214146.1"
                     /db_xref="GeneID:3293938"
                     /translation="MTTPSPIRVRAIAVWCVVSLWVGYVTNAQDVSFVVRSRLLSNSY
                     TFESDISFPYSFPIASLNSRSGKDTTDYVRNITDTNAFDPVLRLHREDLTSIRERLYT
                     QASVSAQHECIGTPDTLECVSSFAKDNKVMISVISIAGVTDGRLISERFEKNPENGDG
                     QSLIDVINVLTGVLRISDYSTVYSRLSSIHRNILNNCVVGILDTKFSAYKRDEMIHLT
                     CTVKISCPLTLNVCFTVNGGSDARADNRAQPTSSGEDVVQSLDDRVFVAYATQQIPKF
                     GHNPVWLSCDVESKVGWKAEYTFSFNRTDIADDNAKQHEMRPTLLRVSQIATRSYYHR
                     SRRSKPFDPRAVIVGIIAGLLFILTVLALIYMQRKSPMPCVCV"
     gene            complement(206862..207299)
                     /locus_tag="MuHV1_gp138"
                     /db_xref="GeneID:3293939"
     CDS             complement(206862..207299)
                     /locus_tag="MuHV1_gp138"
                     /codon_start=1
                     /product="Possible multiple membrane spanning protein"
                     /protein_id="YP_214147.1"
                     /db_xref="GeneID:3293939"
                     /translation="MFANLYVNFHIQTDLWNKMQRRPGSETKSYLKGHYLTFRVKDRR
                     DADREEDEVPKRPDWSTAIVLKWIPPICILIYFVIAFRLVYLTVQAHGLWTRHERHQR
                     GTDAVRLAPVAAAFVIGVLTVHAYSLRGIANRYVAEPCGPDDE"
     gene            206928..207287
                     /locus_tag="MuHV1_gp139"
                     /db_xref="GeneID:3293940"
     CDS             206928..207287
                     /locus_tag="MuHV1_gp139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214148.1"
                     /db_xref="GeneID:3293940"
                     /translation="MHGQHADNEGRGYGRQSYRVGPPLMPLVSRPESVRLHGQIHQPK
                     GDHKVDEDADGRNPFQDYRGGPVRPFRYLVLLSVRVSPILHSERQVVSLQITFCFRSR
                     SSLHLIPQISLYVKINI"
     gene            207326..208015
                     /locus_tag="MuHV1_gp140"
                     /db_xref="GeneID:3293941"
     CDS             207326..208015
                     /locus_tag="MuHV1_gp140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214149.1"
                     /db_xref="GeneID:3293941"
                     /translation="MTVSFFRDLRILLAEFTATFDTVPDSVVGDVHERKCPTTPTEPH
                     GTHHQEDASSGVITHEPSERSEVESLPKTALYTKSKRSGCHAASGDASSCQSTGRSHV
                     RARLARRSAEDIACADLSVPRRSQLVQTRGAIAVVGPPRRALRVVAPEKHIGTQDPLQ
                     HRKRRYDRHDGDQGQLHAARGRLPLCRRCRSQDLGLVVRRGRQRHRPPHRRSNDTDQI
                     RGLEARGREIV"
     gene            complement(207623..208789)
                     /locus_tag="MuHV1_gp141"
                     /db_xref="GeneID:3293942"
     CDS             complement(207623..208789)
                     /locus_tag="MuHV1_gp141"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214150.1"
                     /db_xref="GeneID:3293942"
                     /translation="MCIVAVLSHSLSTSVVMAVVRVRTWGVILVCYFIVRNASAVALV
                     FSASIFSDSFVAGTISLNDSFPLVRIDGRGQIRDRDPSVSDLKVDDPEVHFLWDQRFH
                     LTAFRRLLGQSAAVHNVTYECDFAPQLVGCLVVHTADGTNVRSAIVTVRDKKKVVIAD
                     HSSDNLTKFTTDLDLSVLRRNEVSIHGRWSSTRLKIMKLAAPEHLEVSFHVSVGRHGF
                     FCCSVWSPAPLPFDVTVRGGGLRSVSLNASRRFFSDTVALLNDFTTSSFEPSDLVCVI
                     RSSVGWTVTLTTPSHDEAKILRTATTTEREPAACGMELSLVTVVAIVSTFTVLKGVLC
                     AYVFLRRDDAERAARRTDDRYRAASLDELTPTRHRQISARYVFGRPPGESSTDV"
     misc_feature    complement(207899..208648)
                     /locus_tag="MuHV1_gp141"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:288476"
     gene            complement(208814..209983)
                     /locus_tag="MuHV1_gp142"
                     /db_xref="GeneID:3293943"
     CDS             complement(208814..209983)
                     /locus_tag="MuHV1_gp142"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214151.1"
                     /db_xref="GeneID:3293943"
                     /translation="MIGVIRALVWWTLVKTTAASVCESPVLVLTASTAGLHDAVTKTV
                     GLKQTVPLLTVYDNGTVCGTGWVMLTKDDPEFIFMQGQKQHLSQVRGLLSEAGEISVV
                     YECHLSVNFYCSVKHSLNATDVLYYNVGRANLISSPFDSDDGDGITSLVNAFRSMASG
                     YGVFDLTTHSGDIRRRWQSICTLIMEKATKERSVSSFSSMTNGVVCEATVSSPVILWM
                     TIVGSDVQLNASSVFDNTNNISSVRAFSSVSPNNSPRCEIICSAGWNVTIRQPNSSAA
                     TTERRVALSAAPGELSPSPRTVLSVSNGSELDDLPIYTNRSIVVSYAEEATSHVGRKR
                     SCSLLYLLAVPAVLLVVLSSVVIFRHKIRLLLMDRTVTRFRKRTQSTSHSELSFR"
     misc_feature    complement(209150..209779)
                     /locus_tag="MuHV1_gp142"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:288476"
     gene            complement(210241..211377)
                     /locus_tag="MuHV1_gp143"
                     /db_xref="GeneID:3293944"
     CDS             complement(210241..211377)
                     /locus_tag="MuHV1_gp143"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214152.1"
                     /db_xref="GeneID:3293944"
                     /translation="MLGAITYLLLSVLINRGETAGSSYMDVRIFEDERVDICQDLTAT
                     FISYREGPEMFRHSINLEQSSDIFRIEASGEVKHFPWMNVSELAQESAFFVEQERFVY
                     EYIMNVFKAGRPVVFEYRCKFVPFECTVLQMMDGNTLTRYTVDKGVETLGSPPYSPDV
                     SEDDIARYGQGSGISILRDNAALLQKRWTSFCRKIVAMDNPRHNEYSLYSNRGNGYVS
                     CTMRTQVPLAYNISLANGVDIYKYMRMYSGGRLKVEAWLDLRDLNGSTDFAFVISSPT
                     GWYATVKYSEYPQQSPGMLLSSIDGQFESSAVVSWHRGHGLKHAPPVSAEYSIFFMDV
                     WSLIAIGVVFVIVFMYLVKLRVVWINRVWPRMRYRLVYINCRVW"
     misc_feature    complement(<210634..211131)
                     /locus_tag="MuHV1_gp143"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:314492"
     gene            complement(211587..212804)
                     /locus_tag="MuHV1_gp144"
                     /db_xref="GeneID:3293945"
     CDS             complement(211587..212804)
                     /locus_tag="MuHV1_gp144"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214153.1"
                     /db_xref="GeneID:3293945"
                     /translation="MIPLLLLPLVLISGGFWACGSAEVVRPEVNRTGTVDICQGPMEL
                     IFSVSRTSSGATGERISLKNTLSIVSMENGGKPGTYEWSFPANESWPEIQFLLQNREF
                     VSKYYADVVQTPGELVVEYRCPVPQFNCTITHRWKGETIMSFDGAIQTIRSVTSEYTT
                     KNEDTLVKYIRGLNVTLLTDNAKSIEHRWTEICKKLKDADRPDDNQYTLEDDILEDDI
                     EMDIVQCQMTTQVPLKYHMTVWSAGRDSRAIALSADYYTDIEVASYLPVNRSQILNTT
                     CEITSSSGWTVRLRFSEEMVAASKARQAQKRPLLPVEPHGFMSDEHGPAFVQRTINDS
                     RLTTVTIAITVAAFVALFVVVGLLVHGIVTGRLARMAERLRYSIRYTREDETVSMLGL
                     QENECSDTEENVV"
     gene            complement(212942..214048)
                     /locus_tag="MuHV1_gp145"
                     /db_xref="GeneID:3293946"
     CDS             complement(212942..214048)
                     /locus_tag="MuHV1_gp145"
                     /note="some similarity with EHV1 g(X)"
                     /codon_start=1
                     /product="Threonine-serine-rich glycoprotein of MGP family
                     m145"
                     /protein_id="YP_214154.1"
                     /db_xref="GeneID:3293946"
                     /translation="MRAMLRIYALSSLVCCLFHPVVALGRLELLALVSSVGMELSVGA
                     TSTTVSLDATSETTLEMTGSGDLMTSEDPTTPEPTSEPGTTFATTELLTTLVSSEIST
                     LDVSTFVASTVAATAPTTPQPETTEPDTSTAADAISSAATPSAGAVVTTPSPVTTKGQ
                     NTTTTATTTALPTTEPSSTVTTTTTTTTTTSTVLPTTEPSSTAAVVHTSSKPSTTPMI
                     TSSMSSSPNATTVTTQGYTTSMKLASSIATTMPMNSTTAVSRRSTGSTPSKTSIPTTT
                     LSTTRLRTGTTASPTATSDEGDTITTLTTLIDRDEDTENQIGPNRLDTILAILITVVI
                     LSGIAAGVLLITHRWEDDKGGEVALGEGYDESYV"
     misc_feature    complement(213596..>213898)
                     /locus_tag="MuHV1_gp145"
                     /note="Predicted periplasmic protein [Function unknown];
                     Region: COG3889"
                     /db_xref="CDD:226406"
     gene            complement(214434..215567)
                     /locus_tag="MuHV1_gp146"
                     /db_xref="GeneID:3293947"
     CDS             complement(214434..215567)
                     /locus_tag="MuHV1_gp146"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214155.1"
                     /db_xref="GeneID:3293947"
                     /translation="MSVRVCALLLLIACAYAYIDLQDYDDDNDDYCDGLTVLTIYLNS
                     ENSTDYVARIRSIMTFDLMTIQDGQITMSCNGCPNATDLGSELALIANQSTYLQTVRE
                     LVGDGPLELEYTFRLRPNNMSDYYIGLWSDTCRLYYNSIKNRTITYGEPKPNNCSLND
                     TLWDADNARRLREFLEHADDVRERWNATCLWNVRSAKFSRLEIDFWYEVEDGRNLTKC
                     GVKSEGRRRMHVAITDECGNIGYAGGRLNYTGGGFYLEAVTESAPGLVCTVRTTWLGS
                     VRNATSGRVRRKSVQGYPRCPLNRRVRSEPSSVKVTSTPKNHTKVVPYLNDAELIINV
                     TYTLLVVLCVLLVVMCWMLRRNIRSCFAASCEGEKKSVPPVYK"
     misc_feature    complement(214671..215438)
                     /locus_tag="MuHV1_gp146"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:288476"
     gene            complement(215534..215977)
                     /locus_tag="MuHV1_gp147"
                     /db_xref="GeneID:3293948"
     CDS             complement(215534..215977)
                     /locus_tag="MuHV1_gp147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214156.1"
                     /db_xref="GeneID:3293948"
                     /translation="MSTVLPLLIYRTYRYSSYVWYLCVWSFDDSSDDGNYGGNYLGDN
                     GHDLTDGRDFGVSAFVYHVLREMSYPNSIPTDVVPGMTCIVTSHILNFNDPSGPFSAR
                     KIFGTQPPHCPTTYHRQLASRATKIYFCLTDFRRKCLYEYVLSCS"
     gene            complement(215895..216884)
                     /locus_tag="MuHV1_gp148"
                     /db_xref="GeneID:3293949"
     CDS             complement(215895..216884)
                     /locus_tag="MuHV1_gp148"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214157.1"
                     /db_xref="GeneID:3293949"
                     /translation="MVIVPLVKLLLIVFISERAVTIFNPDPDDTYIVNMDDFQFTFTM
                     EFEVTVTRGGVHKRTISVDNGRPVVVWDVGDRDPKICKICPDVSSTDIEYVFLDIQKM
                     RLNNLLTQSLWDTQRICVRYACLFLGFDVICDVYHTTDTVRVAYTGQTGKINIQGSGK
                     FSTSDAKEIGTYMIKSNVREIKNRWRSTVQKLKQLAYMNATEVEFWYNTTGLTTCVVT
                     SRSNVPFTVELSLNTNSSAIVTDESTVDCQILTVKAPGSHAQRCYVTSSLGWKGVVTP
                     PSQYRTKRVPVNISSSKWTGIVNWKGNVNRSTASHLPNLPILILCVVFMRLVV"
     misc_feature    complement(215994..216740)
                     /locus_tag="MuHV1_gp148"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:314492"
     gene            complement(216932..218002)
                     /locus_tag="MuHV1_gp149"
                     /db_xref="GeneID:3293950"
     CDS             complement(216932..218002)
                     /locus_tag="MuHV1_gp149"
                     /codon_start=1
                     /product="Member of MGP family m145"
                     /protein_id="YP_214158.1"
                     /db_xref="GeneID:3293950"
                     /translation="MLSRWGTLGCLLVSAALFSAQEFILSKLPLSIQIIGYLDRNVQF
                     AASLSINGSYRLLEWQRGDLVPLTWVVPNDTDELSTEILFFETEGLYLANLRDLERGA
                     QVIDVSYTCTFGDDVRCDVSRTGDDRPLLSPLLADASDPDIRLDHTKPGYDVLLQNSE
                     RIKRVWSPVLDKLIQFGKPPHTEVEFCNVTGGFRCTAISRSFLRLTVILYVDRTNFLV
                     DTIPVLHYAKASVTAAGNFSATPVCKIYSATGWLASVKYEGDLQHGCIRRPLTYEDVV
                     PGVASEDEVLEHLLLFSHLAPPRTTVKPVRNRTAASVSVEDNDTTLRTPWLDVLVVSL
                     LLVPVSVGAYFFWRWRVKRRRI"
     misc_feature    complement(217238..217855)
                     /locus_tag="MuHV1_gp149"
                     /note="MHC class I-like protein M157; Region: M157;
                     pfam11624"
                     /db_xref="CDD:314492"
     gene            complement(218170..219366)
                     /locus_tag="MuHV1_gp150"
                     /db_xref="GeneID:3293951"
     CDS             complement(218170..219366)
                     /locus_tag="MuHV1_gp150"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214159.1"
                     /db_xref="GeneID:3293951"
                     /translation="MWTTSYFLIGLGTLVLSTFSQECLYMPQINLYIIGEYTNCSFST
                     AAPTVASVMSTAAISTPLVTTPGSANVSTTASIHNSTLQNLTTLPSTTPELITAVPSC
                     RTFYNFSWGASINERDALLLSVNDNSTTTWTYGYDVGNTSQEVTFLQQHRDFMRDTAQ
                     NRSSNYLDETGMISVQITYDCCRMLGNGTVCWVRQRINGNLTDDFKFNNTYVSVSDDN
                     GTFSVWINNTAMTSLWPHMNTIGGRWSSFVNYIRRLNTLGRAVGYTKVINATERNSTV
                     KCFVRTSSPFDIQMSWLLDGYEIKPRGFYWMPDGVGGGVGRIKITLPTDDVHRLSCLV
                     SSPGKWASFMVVPYPYGPLPMGSEVPVMLVAAIVAVLVVFLMIGCIGFCSFVCERRLK
                     TMCSDL"
     gene            complement(219598..220524)
                     /locus_tag="MuHV1_gp151"
                     /db_xref="GeneID:3293952"
     CDS             complement(219598..220524)
                     /locus_tag="MuHV1_gp151"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214160.1"
                     /db_xref="GeneID:3293952"
                     /translation="MRLITKLCLLLGYLIQINNADYQVHLTAKDPDVNSLEYTCTSSG
                     SDGFENVQGFWKILCTGNKTETILATFGGYSGGFQRKHPYVLSGSSTTTMDIHLPSRS
                     ANRDSESSEEDEEEEDEDDTTSKSGPSSTLKMKPLCDGLISCKLGYNSTDVTGRSSAL
                     PVLGPLITTHTRNRTRTGQTLGVQMSCRPQRMCGTYNVTWYHSSNTITTIGRATYWNE
                     SYSDGCNTTWGSEKLKWDHDGSVQVNRSLWTDEFEYAYCVSCKVETCGAAVWSMVCDS
                     GYTAYYSSGHRIQPSSWQQMLLVFLGVFLITR"
     gene            complement(220472..221149)
                     /locus_tag="MuHV1_gp152"
                     /db_xref="GeneID:3293915"
     CDS             complement(220472..221149)
                     /locus_tag="MuHV1_gp152"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214161.1"
                     /db_xref="GeneID:3293915"
                     /translation="MGLSYHLTMIHIIAFMLFMHTQSRHVCSRSDDMSLRCIEQSPSG
                     SEPGFSLTARVIIASSQNLSDLVVACHCPFGNRLDHTISWYVDSEHVATVDGRPDGIV
                     QDTVEISGTWRNTSRWRGDRLYFSRGLRISGRRTHCTCRSLHKIAVSPEIRFDDPVFD
                     VYVPADPRDWKISSTVVLFVISLYFFSYIYLLGTLASAPITSNDDRFDHASHNEALFA
                     SRIPDTN"
     gene            complement(221186..221665)
                     /locus_tag="MuHV1_gp153"
                     /db_xref="GeneID:3293916"
     CDS             complement(221186..221665)
                     /locus_tag="MuHV1_gp153"
                     /codon_start=1
                     /product="Putative membrane glycoprotein anchor"
                     /protein_id="YP_214162.1"
                     /db_xref="GeneID:3293916"
                     /translation="MYLYNNTTYVPADNYSDHTVLATTSQILTSTVVASSALGGPVIE
                     NVTTGGRGGGGRVHILAYPSNGLGGPPITTTNGLGSVIYTSGSYTALAVALSLVILCL
                     AASLLFALIYAHGTFDLRRSQSETLNRDSGEFDPGTPLQLRAVLRTIPESEMVESNE"
     gene            complement(221875..222414)
                     /locus_tag="MuHV1_gp154"
                     /db_xref="GeneID:3293917"
     CDS             complement(221875..222414)
                     /locus_tag="MuHV1_gp154"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214163.1"
                     /db_xref="GeneID:3293917"
                     /translation="MEGRNERFVARRTFVMILTLLLVDRATSSVSGTPSYPTEGAGDG
                     PTISEQPDVQEALQSHAVSSSGPDVAYLTEMIDILGREEETQQVAPEPGAVEVDAEGH
                     LKNDSHQHHPPDAPTSLLINDDLNTSIGKGPFVAAVTFLLIGLIGAAVLAVVYLRRPN
                     GSRSGGDKERLGPVPYNRV"
     gene            complement(222366..223649)
                     /locus_tag="MuHV1_gp155"
                     /db_xref="GeneID:3293918"
     CDS             complement(222366..223649)
                     /locus_tag="MuHV1_gp155"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214164.1"
                     /db_xref="GeneID:3293918"
                     /translation="MFLRGCRRGRRAATVSLAGCGEPELPMCRRRVACSHFDRGSRGG
                     TRVGPRGPRCVPTSSRRPRRRYRRRLPFCIPWTEEDRRSRRLFKAGMLALIYAAASAA
                     GTASASAVGSCVDGVLSDNCMNKIYPDQDKAAVICHVKPGSVKKFVGSWSFALPEGRD
                     FQTTTIATFDAESFHIHVAGFTGMADALSMTTELWPPSGFSGLVVCDIDHVSQAMCLI
                     PPPLLRWVPGEELLTIEPVVPDAAEPFGKDYCRTWGADAGPPRYSRIFWAVNNQAIVA
                     AGEETLGTTDFLWMSNRLEGFTVNASDLALSFPIRSDLPVCVSCVVGSGGNLLSLPTI
                     ECRPVHVARSSTGSKSCDCQLERFLAAFVVMLCITIVTIVVYIYLVSDVRPSLFPTFE
                     IRYFTGGVPVNGVVSRNHQPWRAATNASSRVGRSS"
     gene            complement(223280..224278)
                     /locus_tag="MuHV1_gp156"
                     /db_xref="GeneID:3293919"
     CDS             complement(223280..224278)
                     /locus_tag="MuHV1_gp156"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214165.1"
                     /db_xref="GeneID:3293919"
                     /translation="MALGPTMLTLLLTWLLMSPTRAGRPSVLVTLPLTRPGLLLGCRW
                     SRPSRADYISIRPRWPGRAAEYELSLASSDRVVFYLPHRLEVVLSCGGDEREPTKYSV
                     VAGPRLRRLANRGSDFSRVRCEQYLGDGGSVGGVEGIYTVRWWIDTGLVGSVQRVREG
                     LARVVANRTVGSRPALDPLTGDLLVPRRSRDRCFSCQILGPRVATHVGRRCFSAAVGG
                     GDAQLPSPWQDAGNPSCRCADDALRVAISIGVAAAALGSVLVVLAVYRPLPEDRVAAT
                     ADDSRSVSPGPRRTVDPDDSSRPGCSPSSTRRLQLRARPRRPPSEAASTESSQITA"
     gene            complement(224413..225561)
                     /locus_tag="MuHV1_gp157"
                     /db_xref="GeneID:3293920"
     CDS             complement(224413..225561)
                     /locus_tag="MuHV1_gp157"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214166.1"
                     /db_xref="GeneID:3293920"
                     /translation="MALPAIPQQLSPVARLRAASFSVLLCLWCLAWLVSRPALVDCSK
                     PKKTTTTAALGSVTQEERPRPEPIKIFLYDTQDQNVIQFSWSGRHHDVRSGFNVSYRN
                     HDDQTVYLGQLDWRGFVRYRDNSDLYVGDALIFHGPPLTDDTVDVYASGWLKLPPQTV
                     GEIVIKGYGQTAVVTVLPPAQVALLQSTDRDTLAPFLFRCLANIRGSTPLQPTLMRWW
                     HGPYPLVSIEWSENNPVEGRVRWEQLPDGDRTYYVNAYTGDIHVFARSTIQRLACLQC
                     TMQADKVATSSRLSCPARAKTIALPFDFGQDTTVTPTERRHMDILHTVLIVITWFVAG
                     LGILALGIVLIGNALALLRSCCFPSRSPGAGGKKGGPAYEILVNEETA"
     gene            complement(225779..227089)
                     /locus_tag="MuHV1_gp158"
                     /db_xref="GeneID:3293921"
     CDS             complement(225779..227089)
                     /locus_tag="MuHV1_gp158"
                     /codon_start=1
                     /product="Putative membrane glycoprotein"
                     /protein_id="YP_214167.1"
                     /db_xref="GeneID:3293921"
                     /translation="MLTWQSVETLTADVATRRGLWWLVLRVTILGWCCDSSNGDWSVD
                     SVPPWVETKVPYITTSFRGGRTVAECVWHGSAPRINGTWWQIEGSTRTEIAKFNGSWF
                     QWITLLRDGGAFAWESETSKESQRRWQKASPVSIGEDSPGDGRPDSSSRPPRSPSGSR
                     RGVSNSRRSGGNPQKQTQTPKPPRKTKEYWVHSWIELTENFAGSLACAVFNSSSEVSV
                     EPAPSLSWEEASPESWAVRCQPPRGDPRLLSNRSAPYGLAWWLNGSVAATVSYPPESS
                     GPQTLSIYRTAMETSGPGSSSFSYEQHPPRETTGSGNSRTTTVPQTRRPSPDLRPWFE
                     IETVSDRMVLQDQAWAAGTLCVSCTVIQPRLLGVATTACRSHPPSRRLPVVSKRSTPN
                     GCAWSATAAAGAGVLFGAVATAGLTLTLGPRARRGSVRFRNSRH"
     misc_feature    complement(225944..>226441)
                     /locus_tag="MuHV1_gp158"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta2; cl26247"
                     /db_xref="CDD:331068"
     gene            227920..228465
                     /locus_tag="MuHV1_gp159"
                     /db_xref="GeneID:3293922"
     CDS             227920..228465
                     /locus_tag="MuHV1_gp159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214168.1"
                     /db_xref="GeneID:3293922"
                     /translation="MRGRTHEGRMYVRERTRSRKKQKAYCIQVASPDEETVLRQTSEG
                     TSFHSLLFRRSSSGGDHGRGETADEDRSEDSVSTPKETGSRSDVSGRRGRRIHVEDRE
                     PAGEVVTCQTKTTLIIIIRARSSVGPPSSRGAPTSFGGPPLLRIQDLGERLITTSPTA
                     LGEQRTLADRTDVRVVHGDAT"
     gene            complement(228310..228708)
                     /locus_tag="MuHV1_gp160"
                     /db_xref="GeneID:3293923"
     CDS             complement(228310..228708)
                     /locus_tag="MuHV1_gp160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214169.1"
                     /db_xref="GeneID:3293923"
                     /translation="MSNAVPFVPYAGIGHNLRRWELQCRPTDTELATFSATSSFMSPK
                     VFGDDSRCRLFCCCPYDPREPYGPHPLGVAFYLPDLDSRRIAVYYTNVRPISERPLFA
                     QRGWRRRYQTFAKILDTQERRATERGRCPP"
     gene            complement(229339..230046)
                     /locus_tag="MuHV1_gp161"
                     /db_xref="GeneID:3293924"
     CDS             complement(229339..230046)
                     /locus_tag="MuHV1_gp161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_214170.1"
                     /db_xref="GeneID:3293924"
                     /translation="MCSVNELAFVRLSGTTTAGVYWELCARPRDVYGVGDLDRRADAR
                     PDAHLPLPPAGMAHETVFFRARGVNPLEPPSRRNVRGPWASFYTRTVDSRFLGVYYAV
                     ARPLCERPLFAQRGWRQRHPVVADQLRAQARQAADVGECVRPRVASTRSLVERPPGFR
                     DARRNATPVTQRDQRAASRVRARPSSVPPLFECCHVPRSGERRSRRCYAERMTAGRGR
                     PAGMLQALRVDRRAGTR"
ORIGIN      
        1 cccccccggc cgtctgagtg cgcgcgggcc cccggggggg tattttgatg ggggggctat
       61 atttttgtcc tctagagggc gctgttgcat cgatggtcgt gagggtgctc ctgagagtgc
      121 gatgaggtgg ctgcgcgcac gtcaccgagg gcgtggcacc gtgccaagaa gatgttcgtg
      181 ccaaagcgtt ccgagaagtt ccccttttct gggaagattc tggcgggaac ttcccctttt
      241 tggagcgcgt tctgctagtt aggtttcgtt ttcccgtaag cgccgggcgc gcgacgcgaa
      301 aacgtgttcg aaaacgcagt ttttgtgtcg tttcgggtgc gtttttgccg tagaacgctc
      361 gttttctgag tcgtttttgc gctagaacgc ataggttcta atgctaccac gcggcgcgag
      421 agacatgtag tgtcacgcgc acgtgttagc ataggaatcc agacgcgcgc tcgcctgagt
      481 cagcctccgg gccgcgcgcc gcgtccgcgg gaaggcgggg tgaggcgccc cgccagcgtg
      541 tgaagcttcc gcgacgagcg gcgcccggcc cggagagccg tgaagcgagc gttcctcgag
      601 cgccgccgta tgtttcgagg caacagtcgc ttcaccgctc ttcggacccc ggggtggggg
      661 ggcgggtata atacccgggg agtattggcg gggcaccccc ccccgcgggg ttttgggtcg
      721 ggggtaaaga atgtcgagcg tctctcagcg gtgagtctgg gtagcgcagt cgaaggaaac
      781 cgtgtcgaac ggtagctcgt acttaagaaa caccgttcca acccgattct cttcatccgc
      841 aacgtacccg caagtcgatc tcgagcgtgt gagctatcct ccccgaggat cccacccaag
      901 taggctgttg tcactcgtaa ttccctccct ccgtccggtc tgaccttacc gcttgattcc
      961 ccctagctga cagaggtgat aaattacacc acggtgccat ggcagccgct gtcgggagac
     1021 gagcgtgccc cgcaggcagg cgcagcgacg cagtcataag ggtcgctcga tctgagcgtc
     1081 tcgagatgag gcacaggtcg agttggtacg cgtctcgtcc ccgtggtgtc tgtcggctgc
     1141 gagtgttgtt gctcgtgtgc gccgcggtgg tccccattgt gtcgtcggcg ccgctgccgg
     1201 ggtactactg ctacgcgaag aacgcgacgg agcgcaggac gcctaacatc gatcgcgatt
     1261 actggaggcc gggcgtgtcg gtgttcggtt gtcgcatgcc caaaggagtg tgtatcgagg
     1321 gcgaatggac gatcgagtgg tacatcccca gcctacaggc gtccgtgatc aaccaggtct
     1381 tctttaagtc acagacgtgg ctgggaccgt cgatgcagta catcataccg tcgtacgagc
     1441 gtggtaagga agtgacctgt aggcaaggtt tctgcgtcga cagagcagaa ggcaacctca
     1501 tcatcaccga caacaacaca cggaaagaag agtgggcacg caagcctaca cgcgacgtgg
     1561 tgtgtaagct gacggcgtgc ctgcgagcga cctccgtctc gccgtattct cgcacaacat
     1621 acgaggaatg taacgggact ctggaggatt atctaagttt accggacttc gagaacatat
     1681 acgacatctc gaaggtcgtt ccgtacgtcc caccgcccaa agcacccgcc gtcccaccca
     1741 aagtacctgg aaaggccgag gacgctccgc cagacgagtc gtgtatcgga tgcgacaatc
     1801 ccggtctgaa cgcggcggcg atcgcggttc ccgtggtgac ggtgatcgtg ttggtgtccg
     1861 gaattgggta tctgtgccgt tccacggagt ctcggcagcg gacgttggag ttgtatcgag
     1921 atctctggtc cagtctgcgg cgtcgtctcc accgcggaga ctacgctcga gacggttgaa
     1981 gggtggtaag cgcctgagcc tacctcgaga gaagagaata aagtctgaca gaactatgat
     2041 taatcaccgt tcgacgttat tctcctcttg cgaggcagct cctgttcgtt tcacgcgctg
     2101 cgcgcgtatg ccgagcgtgg gaagatgatg tcggccttta tagggactca tcgctccaaa
     2161 tgatactact cattcactca tcgcacggtg attgacaatc atcagctctc agtgctccgg
     2221 tcatagagaa gaaacatgac gatcggtcgt gtaagttatc cgtccgcaca tgtacgtctc
     2281 cgtttgacac ggttgctttt gttgttcgtc ttctgtgtcg tgatatcata cgctcaagaa
     2341 tgtcccaatt acggtggaaa aaagacagat gacagcgttt ggaagtaccg taaagacctc
     2401 ggttgtctgt ttagacgcat cattaacatc accttgtacg aaaataaggg tattaagacg
     2461 gcatatttca ttcttcccgg tcccgcagca gtctatgtca acgcttcatg gacctttgaa
     2521 tggttcatca aaccgctctt cgcctcggta gacgcagcct cttattttac ctcgacgacc
     2581 acttcggcag ctaaatctgc cacagatacc gtacccatct tttcttacta tgatatgcat
     2641 tcgggtagac tgaagaagac cgtgggatta aaagacggtt tcaaagccga tcattcaggc
     2701 aagctttaca tctttcagaa cgcgagcgtg gcaggaaaca tcacggtgaa cgataccata
     2761 tgtgtactaa ggctgtgtct ctggacgact aaggacagca cgataagcat agatgatgcc
     2821 ggactcaaga ataatttgag ttcgatcctt tcgcttccaa catacgacga gattcgtggc
     2881 gtgttgtata tgtatcctca gtacaactac agtatcccaa tcaaacgtat cgtccagaga
     2941 tcgaatgacg ctggtctggt cgcggcaata ttgttcttta tcgcatcggt cttcgtcgcc
     3001 gcgctcttgt tgggttactc ttacaaaccc acactgttcc gtcgtctctc cactctcatt
     3061 aacggtcaac aactccggca gtctgatcgt cagccgctct gatcgtaatt tgtagatgaa
     3121 taaatgtgtg ataagttaac gaccgtgtct cttgttattc gtccattaat tgcgcgtccc
     3181 attcacccca cccattatcc ttacgtatat aatgatctag acggcaattt ctgtctcatt
     3241 cgttgttcca gagcgacgga tggtacaaga tgtctctcgt atgtcggctg gtgttggtga
     3301 cggttgtact gtcgagcctc ttcacgttcg ctatttctcg taatgacaat gaatgtgaaa
     3361 agatgcagaa agaatataaa gaaaaaatga agtatcgaca ctccctcggt tgctatttca
     3421 aaggcatcaa cccgactaag gtcccgtcat cggatccgcg tacgatattg aagtgcacgc
     3481 ttcctgatgt caaagtaaat gcttcatgga ctttagaatg ggtcgtcgtc aatctccata
     3541 cttcggtaga tgtaacgagt tattatgaat cttcaccaaa ttccgaaccg agattcctac
     3601 gtgctatttt gaatttcact cccatgcacg gattacgtac gaagaacctg ttgaaagtca
     3661 aggacggatt ccaagtcgat aacagcactg ataacggcaa cggtggtaat ctttatgtct
     3721 atccgaacgc caccacaggc agcgctgata gtgtcagatg tcgtttgcgg atgtgtccgt
     3781 ggacatctaa cagcaaaatg acagctccgg atgaggagat gctgcggaag atgagcgagg
     3841 tactcaacct cccaaactac ggtgttccag atctgacccc tccaagacgg gatgaatttt
     3901 acaccaagaa tgagtcacca aacacgatcg tgaccacgct caccgtgata gtgactcttc
     3961 tttttgtcgg actccttctc gtactgattt acttgtacgg accctcatta taccgtcgtt
     4021 tcttcagtaa tgattgttgc tcgaacttca aaccgcttaa gagtaactaa ccccctaaat
     4081 aaaaatcccc ttgagtaaac cattttccgg tgttctgagt atttctttcc gtccgtcaaa
     4141 cgtagatatc ctcatacatg gtctagaatc aggagttatc agtcatgtgg cttagcgtgt
     4201 gtccatgtac cgtcatgtgg cgctcggttc tagtgttttt actgttctca tcgtggctaa
     4261 cgacgtccgg agattcatcg cacagatcca gacgaccacc actacaatca cccaagtccg
     4321 gaataacaac atggatagga ggatcatcca gaacacggtt tccatctgca tcattcgata
     4381 aatataaaac catagcttta ggtggcgaca aattttcacc ctggaagtct ataagcaagt
     4441 gcttcaactc aaaggacgcc acgccgtttc ttaagaagtc tgtgaatcaa aagactggcg
     4501 ataagacgtt cacgtgcatg cctgcggaga acgtctacgc aaacgcttca tggcgcatag
     4561 aatgggtcct gggaaatggg acaacttggt taacaccggc cattcgattc gtgtcgaccg
     4621 accgttcgcc accaacattc aacggcacgt tatccgtcgc ttactcgact agattgctgt
     4681 atactgatga aaaagataat cagaacgcaa ataacacagg attgtacgtc gataagtccg
     4741 gtcttcatat ttcttcagcc gtacgagccg atctcgtgaa ggacgtgcac gacgtgaaat
     4801 gtacattgtc agtatgcttg tggacagaca agatttcttt atataacacc tccgacggtt
     4861 atgtcgaaac tcatgttgaa gtagatccca tagccgttgc caatctaagc atcatagcga
     4921 cactcgatga cttcgtctat ccactcggat atccaatgga atacacaaag aagagcgcgt
     4981 atagttggcc gtctgaaaca tcacagccac aaatgtcgat gagtgtattt tttggaatat
     5041 tgagtgtata tatcgtgcta atcatcggtg aagtctatat ttgtctgaag tgccattaca
     5101 atcacaaaca cgagtccgcc gctgacgttg ctgtcgaata cagagggact gaatctgatc
     5161 catctgtagt tgtttcttcc gatctggaga gcatcgagat cttagactaa gcggctcata
     5221 aatcgcggcg accggtgatg atgaagataa cacgcccaaa atcacgcaat catatataaa
     5281 tggacaatga agccaatcta tgcccagttg gagcgatacg ttgacaatgg acacaactgc
     5341 gagaggatct acccggtcgc gtccggtaca gctcttggcg ctcgtaactg tgctagcctc
     5401 gatgactttc cagatgggag aatcgctaat accaataata ccagatttta gcagtttcat
     5461 gatgaatccg ctccctatgc ctcagattat gcctccgtcg actaacgaaa cgaaagagtc
     5521 ttacgttaag acagaggaac ctatcgtggg gtgcaacgtt tcgcgtaccg agataaaccg
     5581 actgaaaaac caaatgaaga agataccgaa cacattcaaa tgtttcaaga aggacggtgt
     5641 tcgaacgtca ctcgatatgc agacgaccgg tgagaagaga ttcgcctgtg agatacccaa
     5701 caacgtttac gtgaatgcca cgtggtacgt acactgggtc gtcgggaaga tcgcagcctc
     5761 ggtatcgccg atcgtctact ttacctcgac aacgagctca ccgcctacgt tggatggtaa
     5821 catgcaccct ttttatcgac ggaaaatcgt aaccgccgcg aacggtttca aagtcgacga
     5881 gaagactgga gatatcacag tcgcccgatc taacgcgagc ctcgcagaca gcgtccggtg
     5941 tcgcctgata gtgtgtctat ggacgaaaaa tgacagcatc agcgacctgc cggacgacga
     6001 cccgcagatg aagaacatga gcggtgtgat caaactccca gattacagcg gtccggacac
     6061 gttgctcaca gacggtgtac cattcgacta cgccgcgtgg cgtcagagaa tgcggacgga
     6121 gatggaggaa ccatcacgcc gccgccgcca gctcctactc gtcatctccg tgatcgcctc
     6181 gctactctgg ctcgctgtcg gtgctatgtt gttctacacc tacggccgcg agccgctagc
     6241 tagactgctc aagcgatacg gcaagcagct cgcggccgtc cgcatccccg cggacggtaa
     6301 agatcaatca ctcacttccc ccttgcttac caaataaaaa tggaaactgt tttagtacct
     6361 acaccaaacg gtctgtcgtg tctgttctgt ctgcgtcgtc cgtggtcctc ttgacactct
     6421 tgtctgagtc ttttggcgtc gtcgggtcta tcgagtgaga gaatgagggg atatacgggc
     6481 gatacgatgg tgttaatggt gttctgcgta tggctcgcgt acgtgttctc ggtggaatct
     6541 aaggctaacg gatgcgaccc gtcactcgct actaactaca gtaacttaac acaaggtcaa
     6601 tgtgtgacaa gaaagggtgt caagaacgat acggaagaag gatcgtacag ttgtctaacg
     6661 gatgccatct gtattcccgc atcgtgggaa ggtacgtggc tggtggacgg gtggccgtta
     6721 ccgttcggag tctatttcaa gtcctcgaac agcagtccgc ctttgtttag catgactttt
     6781 aaccaaacgc agccgactac cacaccgcct accatcaacg ctacagatta tacactagat
     6841 cccacgtcag ggcgccttat cgtctcttcc aacctaacta gatcagtgtc cgtcacgtgt
     6901 aaactgacga tttgtcgaca gaccgacggc tacggaccta aacctccacc aagacggccc
     6961 aagaaacgca cgacgacggt tctccctaca accacgagtt atacaacctt atctgtaact
     7021 catacttcta ccatcagaaa actcatcacc acacgccggg cgaccgaatc cccaaccgtc
     7081 aaccacacat cgccgatacc gacgtccagc cgcgttaacg tttctgtcga ttccaacacc
     7141 gacgacgaga cgaccgggtc tatggaacgg cagaagagat cgaacatgat cgcgatcgtc
     7201 atgctcgtct gcttctcgtt cggtgcgtgc gtgctgctag taggcttggc gtattattac
     7261 ggcttctttg acgacacgca gtcacacgct cccggtcacg gatccgaacc acgttccggt
     7321 gaatctgaac ctctacgtcc gccggctgat gtatctgcca acaattctac gtacctgtca
     7381 ccgcccacac ctgcggtgag tatgtaaagg gccgaccgcc gcaggtgcga cggtacgtat
     7441 cagatacacc tggacacgat gcgtctctat cttgatctat cacagtttct gcttttagca
     7501 gtcatcgtaa cagattccgt ggttttatcg atgatctgcg atacgaatgc acattccaat
     7561 ctaccacaag gaagttgtac gattctgagt aaaactcccg tacgtaacga cagtaaccta
     7621 ggtgtggacg gttggggata cgaatgtcca ctcggtgata tctgcattcc ggcatcgtgg
     7681 caggttaaat ggtatatcgg gctttaccaa atggatacgg gcggtttttt cagatcatcc
     7741 ctgacaaaac cacctacgtt tcaaggactc agtatgtacg tgaaagataa aaacaacgca
     7801 cggccagatg ggttcgatat aaaacacgaa gacggtcgtc tcatcgttac tgtggatgca
     7861 ggtcggccat tcactgtggg ctgtaaggtg actgtatgta agagagaacc cgattatggt
     7921 ccagcgactg aggaacctac gacgaaagaa cgtagtacca cgaaacccgt gccgattccc
     7981 accacacaac ggagaaccac acgatccgaa ccccagacca cagtccgtcc tactaccaga
     8041 cccacgacca cggtccgccc gactaccaga ccaacgacca cggtcagtcc tactaccaga
     8101 ccaacgacca cggtccgccc gactacaaaa cccatacccc atcctaccca gaaaccagtc
     8161 ccaccggcgc gacccaagcc catcacccga aaacatacct cgatcaccca ggcgctcgtt
     8221 aagttttcta catctagccc cacaactctt tttcccggcc ccgacaacgc agacgatacc
     8281 gtcgccgcaa ccgcagagat gcagacttcg catacggtta cgatcaccgt gtcggtagcg
     8341 gtgacgatct ttatagtgac tctgatcgcg ttagctgtgt tgtatcacta cggctttctg
     8401 gggagatcgg ctatcctcga tttgtacgcc gaacgtctcc gtgctcgttt cagttctcgc
     8461 gatccagaga cttttagacc aaccgatgaa tccgagcctc tccgtacaac atcctctcct
     8521 gcgtcttaat ctgcttacgt acacctggaa ccgcccacac ctgtcctgag tatgtaaata
     8581 ccggcgcacc tgttgcgccg gtatccattt gttcacatta aatgatacat aatgaaactc
     8641 tttttctcga gtcgtctgtt gttacatttt ctgatcttcg cagtgatcgc agcgaaatcg
     8701 ctgatcactt ctgcggcgac gtgcaattca gttcgggatc tggctttttc tggcaccgtc
     8761 acaccagggc aatgtagaac tataagtgtc actctcaaag atatgtatgg atttgggact
     8821 agttccgttt gggtctatac atgtgagttt cctgcatttt gtattaatgc aacatggagg
     8881 ttagaatggt tgctgaacaa gagcccgatt aacgtgagcg tgttgtacga atcaacgagc
     8941 tcatcaccgc ctacgtttaa aaaactcatc acgaacaacg cgactaccag accacctccg
     9001 acgggtttcg aattaaattc cggtaacggt tacctctaca tctatcctag cgccggtaac
     9061 agtttcgatc tatcatgtac ggggtttgta tgtgtaccgc cgaaacctat aaccacgaca
     9121 ccttcgacca caagatcgcg atcgagcacc gagacacgga ccacacgaag cggtacaaaa
     9181 tttattacac ataagataac tccatcacga tcccagtccg tcaccccgca ggtcgatgat
     9241 actacccaac tcgaaatcga taacgctatc atcgtcgcga gtgcagagat gcagacgtcg
     9301 cacacgccga ccgcgatcgc cgtgtcgcta gtggtcatcg tagtagttac cgtgatagtg
     9361 ctgggtttat tgtatcacta cggctttttg gggaaatggg ctctcctcga ttcatacgta
     9421 gaccgtttcc gcgtccgttt catgggcaac agtccagaca gaccaaccgt tgaaaccgag
     9481 cctctccgtt caacggcatc tcgtgcgtct taatttgccc acattttcta cgtacacctg
     9541 gaaccgccca cacctgtccg agtctgtaaa tatcatcgtg acaaagacga cgcgacgtat
     9601 tcactaacac cgggtgatac atcatgaaag tctctccaga tcgtctgttg caactctctc
     9661 tggtcttagc cgttttcgca ccccacttag tgatcttcgc gtcgcgaaaa tgtgatccgg
     9721 ttatctcgaa atcttactcc tccaggacac cgccaggtac ctgtacaggc gcatctgtat
     9781 atcttgaaat tatatctaaa agtcacagta ctcaaacttg gaaatacgaa tgtcagttgc
     9841 ctgaggcctg tattgaagca acatggcagg taaaatggac cgttaatcgg atcccaatga
     9901 atgcgaccgc tttatacaat tcgacagact cgtcgttacc aaagtttgat aaaattctag
     9961 taatcaacgc gacgacgaaa ccacctccaa aggggttcac ggtgaatccg catgacggtt
    10021 acctgtatct cgtttcgtcc ccagaggaaa ctgtttctgt acatctacag tgtgaggggt
    10081 ttgtatgtct accgaataaa accatacatg taactacaaa tcctccgacc acgatctcac
    10141 gaactaaacg agacactaca aagtttatat ccctatcatc acgatcccag cccgtcaccc
    10201 gacaggccac cgataccacc gtttcgaaca ccgcgtcaag caccgataac gctgttatcg
    10261 tcgcgaacgc agaaatgcag acctcgaata cgacggtcgc gatcgtcgtg ccgttaatgg
    10321 tcatcttagt agcgactgtg atcgtactgg gtttcttgta tcactacggt ttcctgagaa
    10381 aatgggctct cctcgactcg tacctcgcgc gtgtgcgcgg tcattttacc accagcgatc
    10441 ccgagagttc cagacctgaa tccgatccgc tgaattcccc accaaccagt gtgttgtgat
    10501 atgactcaac agtgaataaa acgctgtttc ggacaaaata atttgtttag tacgtgtttt
    10561 atttttccgc ctccgtttac ctaggtgatt tccccgtcac ctgagttccc gtagatcccg
    10621 cccacgtacc tggcgtatat gtagctgcgg aaaacacacc tgtacggtag atcacactct
    10681 gctcaaggca ggtaagatcc cgtacagcac cgagatggct caccgctacc tggggagatc
    10741 gcttttcatc cttgtaatct acttcgtagc tctgtcgata tcgcgagtta caccggcggc
    10801 gcgtgctcca gctccgaaaa ccaataactg tacgaagttt tcatatccgg gcgtcagtcc
    10861 gggatactgt acagaaagac gggacatgaa gttgatcact aagtttaaaa acggcacgaa
    10921 ggtattctcg tgccctttac ttacagacat atgtgtcaac gcgcgaatgt ccggtgtctg
    10981 gtgcgtaaat aatagcgcca tcggtagtct gttctttact tcgacaagtc atactcctcc
    11041 tatgtttcat ggtttcaccc ctacacatca ccgccgatta tctggtttat gggtcgatta
    11101 tcaaaccggc tatctttacg tctaccctaa cgccacgaag aaaccggaga aagaaatcta
    11161 ttgtactctg actatttgta tcaccgcgat tacgacacga cgaccgacta ctacacgatc
    11221 gtcgagagga gtatcgacgg ggatttcgac gacaggacta tggacagacg aaacaagtgt
    11281 cgtctttcct tttgtatccg cgggtgaaaa cttcggggta tcagcgtcgc cacagacagc
    11341 aagtagcggc acgatagccg cgatcgtgat cgtaatagtc atctgcgtcg gattagtcgt
    11401 tctggcggtg ttgtattatc gcggttacat cggtcactcc agacgactga atctgtatag
    11461 agagcgcctc cgcgcccgtt ttctagtgtc ccatagcagt tatccaacca gctattcgac
    11521 cagatatccg agcacatata tcgatagaca ccacgaccct tccgatccta cgtattttct
    11581 tccaccgtta cacatatcaa ccagtgctgc ataagcagta tttgtatccc cggttcaaca
    11641 aataaaaatt gtacgctcat tttatcgcgt ctctgtcatg tgttcatgtc cacttttaga
    11701 tggtcgtcgt acaaatttat ttacattcgc atcatcctca cattacactc aactcggata
    11761 gaagacatta tacgcgccga aatgttccgt caccacctga cgtcgtttat caccgtcaca
    11821 ttctcgctcg catcgatatc gataacgtta ccgctagcac aggcaacgaa tgttcttgct
    11881 gcaccaaaaa atacgtcgtg tgttaagaag tttaccgtct ccgaaagacg tcctcctccc
    11941 gaaccaggaa aatgcatgtc gctgttagga tcgacactcg tgaataaaca agccgcgaat
    12001 aaacaagtgg ataaaccagt tactatcctc aaaatattta gatgtcccgt cgaagaatac
    12061 ctttgcatga acgcaacttg gtccggtcga ttgtttgtac gcacacagga caacagagaa
    12121 ataatattcg gaaatatttc gtttacatca acagattctt ctcctaccac gttaaccgga
    12181 atatctacct taaaaccatg gcctttatca tcagacttgt ggatccattc aggtactggt
    12241 gatatataca tgttttctaa cgctagcttt tccgacccaa aatgttatat tacgctttgt
    12301 gtcctcagaa aaaatgcgca tatcccggtt caacgtgcta actttgcttt cggagtcacg
    12361 gacgaaaatc tcgtaacacc aacatcgaca cgaacagtag ataacggcac gatagccgcg
    12421 atcgtgctcg tatctgctat cgtcgtaggt ttgatcatac tcgcagcgtt gtatcgccgc
    12481 agaggtttcg accgcttcaa atgattgggt tcgtacatct gtatcgcccg cccgtatccc
    12541 cttttactta gaacaatatg taaaccatct ctcattcagc tacatacaga caagggacat
    12601 gcggacgatg tctttgtcga agtcaacggc gcagagcgcg tcgagacgtc gcggttcgac
    12661 acggcgaacc gcaccagccg gagatatgaa caaatcactc tctgcatcga cgacgaacgt
    12721 cggcaagaga tgcggcgata aacggccacg taagagcacg gacacgaaaa gaatcaagag
    12781 agatccaaac agcgatacgc caacgaccat ttatttgaat ggtgacggtg tacgttctcc
    12841 aattgtcgcg cctaacgatc gcccaaccac ctcgacgaga gcacacacga gaacgagcgc
    12901 ggagactacc tctatcatcg tcctgacgat agggctcctg ctgggtctgc tgttcgccgc
    12961 gacgatctat tctttcggtg ccgcaatccg caaccgctag agtttatcgt gttctagaac
    13021 gtgtccccca ttaaagtata attcttatca attataccag agtttggtat ttttttaatc
    13081 tgagatgcgt cgtctgggta tagttattgt catcgcgtct ctcctgagcg ctgttgaatc
    13141 tacagagaca gagtgtgata cgtataatgt cacaatcaaa ccagaaacgt gtgatttttt
    13201 cgataatctt tacgaggtcc gcgtacgtgt cgacgagaaa gataccaaca gggtccacta
    13261 ctcatgtcaa ttcaaatgga acatctgtac ccaggcaacg tggtacggga cgtggatacg
    13321 aatgtcattc gatgaggaga tgaacccgtc acctcgagta ctcgcccacg ttcagttgat
    13381 gtctacacct acatctccac caacattagt cggcttctgg aatgactcat cgtctgataa
    13441 gcagtacgtc ctttcacata acagttctgc ggagatatgg catgatcccg ttaccgacaa
    13501 catctatatc tcatcacaag tatcatcaaa ccaattggga ctaatctgtc aactgaccgg
    13561 ctgtctaaac tcgaagatgg acgaaaccta tccagcgttc gcccgcgaga aaatcgagac
    13621 ccagacggca attgcgatcg gtaaacccgc ggataaacaa agtgagttgg cgagtcaaag
    13681 tctgtccaaa ccgacgtcga gtcgtcgtat cgatataccg tcaccgacgc cgaaaagtct
    13741 acagatgatc agacctacaa caagaggaac atcggtttcg aggaagcccg agatcaccgt
    13801 gtcgtcggct cagaatccta ctagtagcgc cgcgccttta cgtcacgcgg cacaagcgta
    13861 cgtaacggtc gtcttagggg taatcgcggg tctcttcttg tggaccttga cagattttcg
    13921 ctatgtgatc gccgatcccc gtcaggatca gcgcacgatc gaccggaaaa tgtgtcagca
    13981 ttcgtcataa gctgtggagc acgaatgaaa agacgcgcca gtttccccat ttcacactcg
    14041 ctatccttcg accacacttt cgagtctttt accgtatcaa gaagatgtac cgtcacgtcg
    14101 gatatatctt actatctgcg ttcacagtct cgctgaataa aaatgcattc gcgacgaact
    14161 gccaaagccc gtcttccggt atggatttta ctccaggtat gtgtgtacgg gtaccattcg
    14221 ccagcgttgc aagcgcatca cgcaacggtg tacaattatt aacttgtcaa ctgcttcctg
    14281 tatgtattcc tgccatatgg tacgcaacat ggaccgtaag aacttctaca tctgttccgg
    14341 acatcacttc gatttctgat acggaggatg agtattcggg atcgggcgca ccaccaaaac
    14401 atcggcaacc aagatcgtat ggcgcatatt tggatacatc caatatcatg attatagatt
    14461 ttattacatt caattctacg agcacctcaa taccgtatta cactggcact tggaataacg
    14521 attcggatac gagagtccat gtgaatcaga gcctcctagg gatacacttc aatcaacaaa
    14581 atggaagtat cacacttccc cacaattcgt tactcaaata tcataatttt gaatgtgagg
    14641 tcattgcttg tattgatccc acaacaacga catcgtcaca gacacacgtt ccgtcgactc
    14701 caccacccaa cggatccaca ccgccaccca tcagatccac gccgtcaccc agcaaatcca
    14761 cagaatcgca aacgacatca aaggtcacaa cgcgcaaaga cgtcatgatt tccaagatat
    14821 attcgaatac aacggcagct tcgattatat caagcatcac aagctcccat gttgtcacat
    14881 cgcgcactac gaatcgcgcc attgctccat ctactacaag ccacacagaa gacgaaatta
    14941 tacacactgc gatagacgaa gaagaattcg tttttttaca ttctggacat atatcgataa
    15001 attcagattc aaatgttctg ctcatcgtcg caatgagcct cctatggatc tatatattca
    15061 tctaaaaata atgactatcc ctcgacctta caagatgaca gtgaatattc tgtttttcgc
    15121 tttgttttta cagagatttt tatgtacggc agcgaaatgt agagaatacg accttgatat
    15181 cgcactggac gcttgtaaag aacaggatgg aggtacttta caaaaacaag acaccgataa
    15241 gtgtatattc agctgtaaca ttgacacagc tgtttgcgca tctgcatcgt ggtacgcaac
    15301 gtgggttgca tcttcatctg gcacacaata cgttatcggt tttgtttcgt atacttcttc
    15361 gtcaacatcc ggcgcgacat tcaccgacct gtggacaaat tcttcggaca caagaccgcg
    15421 tctaaccatc gataaactca aactcgacaa caaaaccgga gaagtccatg tatctccttc
    15481 atgttcgagc agtggatatg ttatcgaatg tcacgtgact gcctgtcgat cctcaacaac
    15541 accgtttcca ccgaccgtcc cgcacccgcc tacgctatta agatcgagtg ccacgattcc
    15601 gaagttatct aatccgataa tatccctctt aatcatgaca attataagtg tcttatacgc
    15661 aatactttta tcataattta ataaattatc acacaatcca tactttttgt ctgaaatctt
    15721 tattgtacgc catcgaaata aggggagctc agacttgggg cagacgctga aatcggtggt
    15781 gagttattcc tattcctctg taacgtgagc gggatatccc ttccttgtga tacatcaatc
    15841 tgtcacagat agcgcgtctg ttgcctatgc ataagttcag gatcaaacag atagcaaaaa
    15901 tgggtaagaa tatcagcgcg aggtttagaa tttgtccgag gtgcacacac aactgtccgc
    15961 tcgcgcagcg ttttgttttt gacttcgtgt cgaagaacct tcggacgtcg atctcgacgt
    16021 gcttgaactc gcagccacgc acatggccgg gtgttggcag ttcatagctc cagcggccga
    16081 acagggtctg aaaatcgcag gtcgagttcg tttcgttggt ctcttccacg ttgaccgtgc
    16141 tcgacacgcc ggtggtgtag ttgtatctgg tatacattcc gtaaggggta ttcatacccg
    16201 ccatgaatct agcgggtgat ggtgactcaa tccgacatct gacggtaccg ttcgatctct
    16261 cgtatgagaa gttagcatat ctccgcatcg aggcgtgcgc caccctcaca cagacctcct
    16321 tccaccgttg gtatatgtgg ctgttatcat tatctagata ctgaacgcct accccacggg
    16381 ccacggactc gaacagtttt ccaacgtctc ccaccgggta cgtatggttt ctgtaattac
    16441 ggttatattg caccaactga agaaagtttc gctcgtgttt aacacgacat ctgaccgtca
    16501 cgtggctcac gcggcagttg tatctgactc cgatgtgagt aaaatcttgc ggtcgagtaa
    16561 cgttacccgc ccgtttccac acctcatgaa acttctttac atgttccgtc tgggacatca
    16621 aaaatttata ttccccgtca cgctccgtga tattcaccca tctaacgtcg ttgttgatgg
    16681 taccgttcgg caagacttcg aacagagcgg cggtggtatc gaagcctccc atcatccaaa
    16741 cctcgctcgt gttgagaacc atgccggcgt agaactctat gttgataatc gttccgcact
    16801 cgctccgcac cgtggcggtg agatattcat cagctaacag atcatcgggt ccgaaactga
    16861 cgccgcagtt ctgcgcacgc acggcgaggg cgagccagaa cagcagatag aaacccgaga
    16921 acgtaccgtc cgcctttcct cccgtcccca ttctcgaagg cggacgttct gatcggtcgt
    16981 ccgatttcaa agaaagcaga caggagagtg taatttcttt ttgaatacga ttgtttttat
    17041 tggcagcact gagcacacgt cccccccacc tcaatcatcc caccagagag gtccaccgat
    17101 ctcgtcgtta agtatttctg caaagcattc gacgtcgtaa tcgctaacga cctcgacgac
    17161 cctggcaact cccgtcatgc catcaggtac gacggcatcc cccaaaggat cgtcctcgtc
    17221 cccaggtccc ttgagcagcg ccaaagcgtc cgaaagggcc tcagctgcct cgatctcgtc
    17281 gacctcctct tcttcaccgc cggaggtggt gtcgggtgcg gcggagacaa cggcctcgga
    17341 gccgccttcg agtccggtgt cctcggtctg atgccgcgag agactgttgt tggggttgac
    17401 gagctgttgc tgtggtgtcg agggtcggag aggcgaagga ggcaagagcg gtcgtttggc
    17461 ggcctctctg gcgacacgtg aagccaccct cctcaagttt ctctgcacaa aaccgggtcc
    17521 gcgagtatct ttgggttcgt cttcggccgt catcgcagcg ggcgatttgg cgcgctcgtt
    17581 ccccttgctc gggctccgag tcttatgttt cttctgagtc ccctcatcga ccgatatttt
    17641 gtggtcgcgg cgcgtcttgc gaggaagatc ggcaccggag tcggatgacg accgacggtc
    17701 gtccgtcgcg ccatcgccgt ggccgtcgtc gtcgctttgt tgttgcgcct caggcgatct
    17761 gggaggcttt ttcttcctcg gaggagtgtg cagcggctta gacagcgggt ggccgtcgcg
    17821 tttggcgcga tcccgcgtga tcaccccgtt ttccacaggt ctgggattgc cgccgagtcg
    17881 agcagccgag ctttcaggaa aagtagcggc ggacggacgc ccgtcgagag actgtcgcct
    17941 cctggatatc ggggcaggta cgatggggtc gcaggtcgcc gtgacggtcg tccgtctgcc
    18001 gcgcgacctc ttgggtgtcg gggagctgga gggtgtcgta gtcgtagagg tctggttcgt
    18061 cgggctgcgc gaggtcgagt ctgatctcga cgatggcggc agcgaccgcc gcagcctcgt
    18121 ggccggcatc tctgtcgcgg aagaacctcc gggcccgccg cgggacggga tgttggcggt
    18181 atcgtccgcg gggcgttctc gggacgaatc tgagctggac ggctcgcgac tgtcgacaag
    18241 tcggctcttc ctcccgcgcc tctccggagt cgtctcccga ctggaggcgt cgctcggagt
    18301 agcgccgata ggacgaaagc cgacacgagc cggactcgcc ctctcgattc cagatctctt
    18361 ctgatcgttc gacggctccc cctcgaacga tccgcacgaa cgaagcgccc atttcgactc
    18421 cgagtccgtg gtggtggaat ctgaagcgat ggtagacgag cgagacctcg gacagccgcc
    18481 ggattcctcg aacgggccag aagaaggtac caacgacggg gcgtcgtcgc caccgacgac
    18541 cctcagagcc gaacccgacg gttcggactc gacgccgacg acctctccgg cgactcctcc
    18601 gaggagcgga ggggcctcgt tggtgttgtc gtcaccgccc aggcccacgt ttcccccgcc
    18661 tccgccacct ctgccgtctc ttgtagcatc ttcgccagcg gtcccggatt cgcccaccac
    18721 cgagtcgtcg aaggtgccgc tgtcgatcac agagtccagc agcagtgaca gtagcgggga
    18781 cgacgaaaac gagacgttcg tcttggcgtc cgaggagatt ggcgaaccta agaaaagatt
    18841 atcgcaggat ccgtcttccc ctcctccccc accgactgac gagtgcgaca tcccggcacg
    18901 cccgctcccc cccgaacggc cagaccctgt tactcgatgt cgcgtgtgct gctggtactg
    18961 ttggtcatgc atctgttgct gctgcacctg ggtgtggtgg ctgtgctgct gctgtccctg
    19021 ctgtcccggc gcaaactgat cgacgactcc gaagggttgg acgacggcgg cggtggccca
    19081 catctgtgac gacgaggagg agaccgcgcc caggttcggg tcactgaccg agatgatccg
    19141 gccacgagac ggtccggaag aagatgccga ggacgacgac gatgctgccg atgccgcttt
    19201 ctgccgaggc gggacacctc cggccgctct gcgcgagccg gtggtcgtct ccacaggccc
    19261 tccgttcaat aaattgttgt tactagccgc ctttttcttt cctcgcgcga cgggggatct
    19321 ggaccgtccg gcgacgggcg tcatcctacc cggaggacgc acgctacatc gcggaggtct
    19381 ctcgggaggc gtctcggtct cgcgctcggg cctgggtagt atggggacgt tacccgccgg
    19441 cgtcggcgga ggtgccggag gcaccgcgct gctggcgatg agcgtggtgg ggacgggagt
    19501 cggtggagcg cccatcgtcg cgatggggac ggcggaaccg ctgccgaacg gcgatacgat
    19561 tccgaacggc aggatgaact gcgtgggtgt cggtggcggc ggtagcgtcg gctgcgaaaa
    19621 atcgtagacg gacgtatcga ggggtaaagg attgatcgtg ggataggctg cgggcagcca
    19681 agggaagggt tggaaggtgg cgtatgccgg gccgggtaac ggctgaaacg cggaggcgtg
    19741 cggccatccg agatggggcg cgtatcccag gaagacgggg gcgtgcgggg gtgtgggcga
    19801 cggagccgga gtcaaaagag tcgtccacga ggtaggagca ggtgattgta tctgtgggag
    19861 cggcggtgtc gggacgaagc tgccgaatgg cgtgctagag accctgatcc accccgtcgc
    19921 cgccgaggaa tcgaagacgg tagcggtggt ggcggtggtt acgacggaca ccgtcggcac
    19981 ttgttgctgc tcttgctgct gttgctgttg ctgctgcgtg tgcgtccgcg actgctgttg
    20041 ctgacgctgt tgcctttgag atcgggcggt tgaattattc ccacctaccg gctctgccgc
    20101 ggcactgccg tctgacggca tatcgacggg aacgacgggc gctctgacga ccctcgaacc
    20161 tctcgttcgg gtaccgtgcc cagtgtcagc catgcggcgg acgtctcgga ctaccaaaat
    20221 cgctcgaacc gtaccaaccc ctcgtgtatg tcgctctgaa actcaggacc gacagcagtg
    20281 gtgcttgcca agacgctcgt cttataacac cgactgacgt ttactccgac tcaggatatg
    20341 agtatcatcg ccacacccat cccctaccat tatgtttccc cggttcatct cgagatcctc
    20401 aaagaaacca gaagtgagac acggacatcg gactcgaatg gtatgatttt ttattacaaa
    20461 aggctgatcc tgaccgcacg cccgccagcc agccggccgg gcctccttca gtcccgcggt
    20521 cgggatgttc tagttagagg agaaagggaa gagaaagcaa gcagaaaggg aggaagggtc
    20581 agtcgcgtaa ctcttgttgg tccttgggcg actgctcctc gacggccatc tgttcctctt
    20641 ccaggacgag ttccgcgacc gtatcgccgt ctccgtcgca ggcctcggag tacgcgtctt
    20701 ccaccacgcc gctggcaccg ggcagtcccc agtagcacac gacggcaccg acggcgacga
    20761 cggcgatcac ggcgagggtg aagagggtga tggcgatcgc cctagcgtac agctccgaag
    20821 actcgcctcg agttccaaca tcgtccttct cgagggtcgt cgaggaaagc gccggtccgc
    20881 gagcggtagg tagagaggcg agcgacacgg ccgcggcgct ggggaatccg ctcgctttcg
    20941 cctcgttgtc cgctttggag gcgggcgcac tggtcctcga ccactgtgaa gacgcaggag
    21001 tagcggcgaa ccccgtcgat ggtgaggaga cctcggtata cgccggcctt tctaaccacg
    21061 aatctgaagg tgaggttgcc tcccccgtct cgccacaccg tgtccgtagg ggacatgacg
    21121 tacgctcgat cggcaccctc cgttccgtgt atgaggtcgt acatgtccct gttaaacaac
    21181 acagccccgg cgaggatccg caacggctct ccattatctc ccgtgcgatc gggggaatcg
    21241 aaggtccagt tgaaaatccc gatgcggtaa tagaccagag gaatgtcgat gatggactcg
    21301 gtgtacggcg tcatggtcga ttccgaacat ccgtgcacga ccgcctcggc gtgcgcggcg
    21361 gtcaacatct tttctttggt attgctgtag tcgaccaaca cctggcctat actcacgttg
    21421 ccgttgtgca ggtccgagaa catggcggtg aagtagacgg cgcagcgata cattccggcc
    21481 agatcgttgg cccattttcc gaagttccac acgcaggtgc cgctgttgcc gcacatgatc
    21541 ctcttgtcgc gctgtccgta ggggttgatg tagtgttcga tctcgcacac cctgcgtatg
    21601 ttgcaacgct ggtcgttcca ttccctgtgc aggtcctgca actcgtagcc gctctgggag
    21661 gcccagccga taatcacgtc caagacctgt ccgcgggtct tgaaacggca ggtagcgacg
    21721 cagtcgccgt ccggacaatc gaaggtcagg aaggtttcgc tgccgctatc ttggtacgtc
    21781 gtcagcgcct cctcggcgtc gtagaaagaa gcgttgggtt catccggcgt ggtcgacgtg
    21841 cacctcttga atcctcgccc gcccggggga taccgcggct tatcgaactc ggaagggacg
    21901 tgacccattc ccccactcca ccacttggag gtttcgtgcg aatagccgct gtgctgatgc
    21961 tgatgctgat gctgatgcgc ggccagggcc gtcgtcggca ggacggtgag ggccgccacg
    22021 gccacgccga cggtcatcgc cgccggcact aacccggcca cggccccggg caggccgcgg
    22081 tatccctccg gtcggtcgcg gcggcccaac ccgcgcgctc cgaagatcat atgcgcgtcg
    22141 acggggtttt cgaaccgttg aaaatgccgg ttcgaatcag aaccgtaccg cgattcccac
    22201 agggtcgtca cgatcttgaa aatgacggcg aacagaattc cgacggtcgc gatgaccgtc
    22261 atcgtgccgg cgcccaacat ggtcccgacg agaaaccgga acccgggaga gctctcgaat
    22321 ctcggatcct ttccgttttt cccagcgaca tcagcggggt gaaaagacgc cgtccagtga
    22381 tgtagtccca cccgagagat gcggttcgac aagatgtcca tgggaaagat gccgagcgcc
    22441 acggctttgt ctccagtcgc gtgctctctc actgtcaaac ggcaagacag gtcctggaat
    22501 ttcttgtagt cgacgtcctt tggagggcgt gcgactttaa gccccacccg gacaacggta
    22561 ttccccgttc cggatcccac ctcaacccca gcgcacggct caccccaact cgtggtgtaa
    22621 ttcgtgcccg gtaaaggggt tttcatgaca ggtatccgat acggacccag gagcattctg
    22681 ctgtacgacc tgccggtcgc ggtatcgtta tattccacct cccagatcaa atccagggtc
    22741 caccgtcccg aaaccgtctg gctcacgaat tgctccgtca cccccaagac cagagccaaa
    22801 aatataccat cgtcgtcctc acgaccggcc accgtcgcta tcttagtgcc tttcaacata
    22861 cccacgctca aaacgtgcgc gaggttcacg gccgaagcgt ttcgcagcac gctgctgtcg
    22921 cagcctccca acgcggtcag tggcggcggt cggcggttcc gtctcgtcgt cagatttgtc
    22981 gccggcatcg aggcggaaac ccccgagatc gccccgatcg cgaacagaaa ccacactcga
    23041 gccatagcga acggttcgag acgagatacg gaggggtccg gagacctcaa aattctggtg
    23101 acatgtttgt cttgggcgcc gcttttattc cgtttgagcg ttgtcagtca tcgatcgtca
    23161 cggtcccggg agaatcccac tcaccggcga ctcgtaacca gcgattctcg agcaggtcgg
    23221 ccccgccgat cccgcccgaa ttcgcagcag gcgacagaga agagtcccga caccctccct
    23281 ccgccaacgg cggttgacaa acgagcgaaa ctcaggcaga tggtatcgat ttaacagagg
    23341 tcacacgacc tcatctttta ataaccgtcc atttacatga cagcgggtca agcgacacca
    23401 cccctctccg gacagacaaa cagacagata gacagacagg ctcagtctca taccgtcggc
    23461 catccccccg cttgaccgag gcccccatcg tgcacacgca gtaaactacc accgataggg
    23521 gacacgttca agccggggta gcgcctcgat cgacgagcgt cggacaaaga aaccgggaga
    23581 agaagatgcg ggcgggcggg caggcaggcg ggctggtgaa caggaaggca ggcggtgagg
    23641 cgggcaggcg ggtggacggg cggctggcct cgggccgacg caggagcccg ttcacaatac
    23701 acacggttcc ccgtccgtac cgaggccaga cacccgcccg acaagcagtc gcggtccgtc
    23761 cggtccgtcc gatccgatca cctccttttg atggagcgca tcagtctgtt gactgccttt
    23821 ctcatgctgt tcctcccggt tttcttctcc caggttggtt cgctaccatg cggcacccca
    23881 ttggtcgccc tggagtgtaa gaagttgttg ggacactcgg tcttcttggt gagcatggcc
    23941 tcgagcggat cgatgatgaa gtacctgttc ttgtgatagc ggctgatccc tcgctcgacg
    24001 aactcaaagt agtcctcggc gatgagacag agcgacgaga cgccctgaac cacgtagacg
    24061 cgacagaggt cgtcggtgag gatggtgagc ggcggcagca tgagcggctc gatgatgatg
    24121 ccgaggacgt ccatggcgcc gacgtcggcc tcggcggccc atccgtcaag ggcgacgacg
    24181 tcgtatccca cgaagaactc gtcacaggcg ctgagttcgg atttatcccc caagaagacg
    24241 cggttggcga ggtttcgctc gcgccaggac aggatgtcgt tgttggtgcg gcactcggtg
    24301 agctcacggc tcgcggcccc gcgacagatg atggggcgac gcaccggcag gtagatattc
    24361 ttgatgccat ccttgacgat ctcgcgcatg ctgtcggcga cgtgggcaaa ggcctcgctg
    24421 cgcgtgagaa gcaggtagat gtagatcttg ccgctgctgc cgacgtagac ctcgggaggc
    24481 tggcggtagt ggggcagctc ggacatgggc gcgtagatgg caccgccgcc ggccctgagc
    24541 gccggcccca agatggcggc ggcagcgacg acggcagcgg agacgagccc ctcgtcggga
    24601 tcgcgcggtc cgcgcgtgtc gtcgccgcca ccgccgccgc cggtgttgcg aaagcgccag
    24661 ttgaggaggc gcgatctggt gttctggcga ccctcgaggt tagaatcgga ggcgacgacg
    24721 ctgccgatga acttgatgtt ctcgtgacag cagagaagag cggcgagtct ggcgcactcg
    24781 ttgggcggcc ccccgttggc cggcgcgggt atctcgcgcc agcgcatgcc gatgcagagc
    24841 gagagccctt tcgggtggtg gagacgcacg cggcgcccga tgttggcggc gacggcggcc
    24901 tcgacggtgg caaagtcgct gaagatgctc tcgagagctt ccggaggcgc catatcgagc
    24961 gatcgacagc gtttttcgag ctcgagacga tgggtcggtc gtgggtgggc gtccctcggc
    25021 cttttgtgtg tgggcgtccg tgggcgcggc aaggggccgt gtcccgaccc tccgacgtgt
    25081 gtcccacgta gccgtctgac gatcgaccga tcgacagaga aaggaggaaa agtgggtcac
    25141 ggaaagacta gaactcgctg aggcgcgggg gaggcctctc acagttcctc ccggagtccc
    25201 gctcgctgat gaggccgaaa cgtcgattct caaagtacct ggtggcgccg atgccgacga
    25261 agcccgggat cgagtcggct atgagatagt aagagctgtc cccggcctgt cgggcgtaca
    25321 ccctaccgga gggcaagccc acgaacacag cgatcccagg gtcctgcggc agtccctttt
    25381 tgactcgacc aagcggaacg gtgctatatt ctcccagtgg gggcggacag ggcgcatatc
    25441 catgcagacg ccccgaagag tccctcttgc gccagcgact acaacccaga gagcagacgc
    25501 gcagcacctc ccgccgcccg acgaggcgtc tggcgaccac gacggtctcg ccgtgcgcgc
    25561 gcacgacaaa gcgacagacg gcgtcggcgt cggccccgcg cctgatcatc atccagaggc
    25621 ggctgagcag caggccgatc tcgatggggc ctgccgtgca gtgaatcgga taaaaatatc
    25681 tgaacccgat gacggagaac tgctccggcg aggcggcgag gtagtagatg gcgtcgtccg
    25741 ggggcccgcg ataacagtag aaacggccga agacgtcgac gaggaccagg gtgtcgtcgg
    25801 cgaccttgag tccgctggca tagccgatgg gatacacgaa gacgtcgcag caaaagtatc
    25861 tgagtacgcg gttgcgacgt ccagactgcg gctcccaacc ctggatatcg gggacgaagg
    25921 ttatcacggc cccggcgggc caggccatgc gcaggttccc gccggcgaag aggaagagtt
    25981 tctctctgag ctctagggat ccccggccgg cggcatgagc cagttcgtac agcacgtcgc
    26041 tgaccgtggc ctcggcgtcg tccaccagcg gctcgcacgc ggcgtcgaac cgcgagccga
    26101 ttttccccgt cgaatccatc tccgcatccg aaccctgccc agagatggag acgtgcaact
    26161 atataaaatc acgagagccg gggtctgcgt gccagccgtc ctattccccg tgccggcgcg
    26221 tccctttcga cctcgaacgc ctgtccgaga acccccactc acccgaacga tgaaccgtcg
    26281 atcctccaag gaccgtcgta tgttcgtcac cgacgactcg tcggatgatg acgacgacga
    26341 tgtgatgatc atggaccccc cggagacgac gtcgtcgtcg tcatcggcgc tggcgacggc
    26401 ggcggggata cggggcgttc cccatgcccc cgcctccaac tccgccacgg cggcggcggc
    26461 ctccgagagc acatacaagc cattgagcat cccgtctgag gaactaaacg gcgaagagga
    26521 ggagagagac gaagaagaca tgtcacgcga cggaccccgc cggcacagcc aggacgacga
    26581 ctttacttat gcggacccgg ccgatgtgag actgcgggcg atgatgggca ataggtacgg
    26641 cggacagagt cggagtgcgg cgacagcggg agcagcgtcc cggaatgata gtggaagcgt
    26701 gtcgcccgtg accctttttg atgaggacgg atacgcgata atccccgacc cacctacttc
    26761 gcgcgacgat tcgcgacacg tcgtcgtgga cgacgacgac gacggagatt atgattcaca
    26821 ctacggcgtg atgacagtcg ctccgagccc acccaaactg ccacgcaaga gtcgaccttc
    26881 gaccaaaaaa tcggcggagg aaaagcaatc ttccaccgcc ggccggtcca gaggccgctc
    26941 gaccgcacgc cggaccccga agaaggctca agagaccgct ccggcggccg cggcgggctc
    27001 cggagctcgc caaaaacaac gccagcagca gcaacaacag cctccacgcc gccaatctta
    27061 ccaccctcca cccgattatc ctcccccacc tccgcccgta caggcgactg tgtcgcgtcc
    27121 tctccccagg accccgaacg ccaacgacga cgatgacgac gatgacaacg acgagccggg
    27181 tccgagcaac acacgccgcg gcaaaacgcc ctgccgtcgt gtcgatcaca cggagaataa
    27241 tcatctatac gagaccccga tatccgccac cgccatggtg atcgatatcg aagatgacga
    27301 ggacgaagag accggcggcg ccgccgacga cgcgtctatc gtcgtcgaag atgatgatga
    27361 agaagaggag aacgattgcg aggagatctg cgacggggaa gaagagccgg cagcagcagc
    27421 agcagcagcg gcggcatcgt cgtcgactcc tcatcgcacc cagcctctgc ccgtcccacc
    27481 gtcgtctccg cgcatcacgc gcgagctcgg gttcctgccc ggtgtagtga gcggtcagga
    27541 cgccagattc atcgcggcgt gcctccacca ctcgcacgcg ccgcaggtcg acatcataaa
    27601 cacctgctat ccgatgccgc cgtacaccct agacgcgcta tctgagccgg tcctgaccaa
    27661 gaaggcgctg cgctgcgcgg gggtgctgcg gcccgtcatc aagctagcca tcctggtgaa
    27721 ttactactgc gtagggatcg ggcgtctggc ccgtgctcgc gcgctgtcca aagatctgat
    27781 gaccccgccg cgcatcgaga cgctgcgccg ccgtctggag ggcctcctgc cccagcagac
    27841 gtcgcccagc cctccgatgt gcctgcgggt gctcggccgc ctgaacatca ccgcggcgca
    27901 gcacaaggcc agctgcgata cgatcgacca actgatgaaa ccgatgcagg aacgcgagcg
    27961 ccgccgacag aagacgcagt gcgcacagtt gttccgcagc aagaacctgc tgttcagtcc
    28021 cccgcgtttc acccgcgagg gggcgaagac cctgtacatg cggaacatca agatcctgaa
    28081 cagcgacgag gaggatacga cgctgaacct agtgatgacc ctgaatccgc atcccacacg
    28141 ggaagatgtg ctgaacgacg cgatcttttg cctgtcgctg ggaaactttg tgtacaactt
    28201 ctcgcgcgcg ctcgaagaac tgcgcggaat gatcagatgc cagttcgagg acctgaccga
    28261 gaccctgtac gcggcctact atcagtgtcc cataatgaga gacgactacc gcgtgctgtg
    28321 ctccgaggtg gcgaacgaga tcacgtcgcc ccgtgaagac ggacagggcc tgtccgcgtt
    28381 gtgccgccgc agcctcgctt tcgcgcgccg ctgctacaac gaaggcgtgt ttttctcacc
    28441 gtcgtacgtc aagtatctga tcaagtgcgc ggccatggaa gaggcaggct tcgaaggcta
    28501 ctcgctcgag tcggccgcga gatctctggc gaacccagac atcttccgcc cgctgcctga
    28561 cgagagtagc gcccgccgca tgctgcgccg cacgatacac ttcgtgcgcg tcgacgggac
    28621 accctcgtct tccagacaga tccccacgac ccacatccca acacacgcca actacgagct
    28681 gttcctgcaa gcgtctcgca tgatcgttcc gcagcaacag cagtcacgca gaagcagcac
    28741 cccgccacca tcatcctctc ctcctccccc ggccgccgga gggccaaagt actccaagcg
    28801 tacctttctg taatcttaga ttaatcagca gaataaccaa ccccaaaagc acttagcact
    28861 tagccacacg aatcgagtaa gtaagttacc aatctcatac acccccccca tgtacttctt
    28921 tcttccataa tttcactgaa taaataaaga tcacagacaa aaaaagacaa gagacatcgt
    28981 gtgttgtgta attcgattta gtgtctgact ttattgatat cggcattgtt gtcgtcgttt
    29041 tcggaacctc ccttagccag cagattgaag gaccgaccga ggcaacgtaa ggtgctgttc
    29101 tccccacaga gatcttgtcc tgtgaagaac accggactga cgtggggaca cttgggaggc
    29161 cggtcgccca gcgcgacggg cagccgagcc ctgaatcgat agttcttttt gattccccgg
    29221 agtcccagag tgaatagctg catgacgccc tcgcagatct tggtgatctc gtcgtcccag
    29281 gggttgtagg aaaagatggc acctttctcg ttgacggcca agaggacctc gcggaagacg
    29341 gggtccaagt aacgtccgat gacggccgcg aagtagacca tggtgtcaga accgcgtccc
    29401 gtgacgaact tgcgtcgtct gggtgggatg gttttgatgt aggcgccggt gggccagggc
    29461 agggagaaga cggtgccggg gtaggtggcg gagaacttgg cgatcgagag cgcggtgctc
    29521 ttggtcaggc gttccaggta ctcggtgacg ccggcgctgc agccgtccgt ctctatctcc
    29581 cgatagatgg ggtagaagcg cctgagtccc ctcttgatga agccctccgg ggagtccccg
    29641 accagataga tggcgtcgtc gacgtcgggc gcgtagatgt agacgcgtcc ctcctcgccg
    29701 gcgaagagga cgcccaggtc ctcgttcttg tcatcgccgg tcgagcggcg gacgccgccc
    29761 aggacgatga gatcctccgg acagcagagg tactcctgcg agagccgact gatctccccg
    29821 acgggcatgc ggagttcggc ctcggtctcc aaccagagtg tgtaattctt gggccaggtc
    29881 agcggcatcc gccatccctt gcggatcttg acgaactccc ggcagagatc gggattgttg
    29941 acggcccgcg cgaagtcctc gggctcgatg atccgctgag gaggagactt ttcggggacc
    30001 ggtgctggcg gcggcggcgg cggcagtggt atcgccagag gctgcgcgac cgtcaccggc
    30061 gcggtggtga cgggcacgaa cgaggacagc ggcagcgtta tcgttgatgg cggcggtgga
    30121 agcgaggcca gcggtagcga gagctgcagc cccggcggcc tggggagggc gggtggcgga
    30181 gcgaccggac ccagccgcgg gatgtagcgg ctgttaccaa catccccgaa gccgtcgtag
    30241 cgcctcagac cgctttcaaa aagaacctgt cgtccccaca tctgctcggt accacgcgat
    30301 agttgtgaaa aaacctcctg atgcctatct tgtagaacat atccagagat tctgcgagtc
    30361 tgagcagctt tgacacggcg tgatgaatgg catagaccgc gtgatcggcc ccaatgaaaa
    30421 cggccgtacg cggtctggta gagtttaagc ctgccgccgt gccaaaatgt ccaaatgtag
    30481 acagtcgtaa agcgtcgatg caggggcttt gctctttgtt taaggatgag gcgacggcgt
    30541 tggatgattc cgggggcgtt ccgaaaacga agtcgtaatc ttctggccac tgtagggtac
    30601 ataccagccc ccgttccgcc gcggcgagcg cctcgtccgc gttccgaggc agcgacgcgt
    30661 gtccgtcctt cacccggatt gcatcctcga cacagcaggg atcacgatat atgctgtcga
    30721 acctgcgcag accccgtctc acgaagccga tcatagtgtt ggcaagccta tatagtcccc
    30781 cgtagggcgc cgggtcgtag atgaagaccg cgctcgacgg attgacgaga acaatgcacc
    30841 tgtcgtcacc gtcgcggtgc gcgtcctcgc gaccctcgac gaagccgacg acgaccagcc
    30901 tgtcgacggc gggttcgagc gcccgcaggg cgtcggggtc gcactcgtgt ccgtcgacat
    30961 cgccgggagc gcagaggatg agatacttgg cgcacttttc ggggaagacg agtgggatgc
    31021 gctcgccgcg tcgggcgctg agccactgtt cgagcttgcc ctcggccgcg gccctgccga
    31081 gcgccaggag tctgttgacg gcgtacgcct tcctcatggc ggcggccttg gccgccaggg
    31141 tggagcgggc aggcaccacc gtcaccgtct ccgtctccga ctcgggcatc gacaccgccg
    31201 cggccggagc tagcatggtc tggtcccctt tcgccccgtt cctaattcta gttctagtcc
    31261 tactcctcgt cctcttcctc gcgaccgtgt ccgatcgtct ctgcggtcgc cacggacgga
    31321 gaggaggacg tcggcggcgt cgtcgttcac atgtgggaca gagccagggc cgccttaaac
    31381 accccgtccg gaaaatccgc gggacggagt ctgatcggcc ggcggatcct ctcggccggg
    31441 accctggcgc agagtacgcc tccgagctcg acgggcagcc actggctgaa ggacggcggt
    31501 agccagggag accgcggctc gttacactgg cagatctcga cgatctgcgg taggacgccc
    31561 tcacgcaggt cgcgctgtac ctggatgtac cttctagaga cgccgtccga gatgagctgc
    31621 gtgaggttgt ccgagacgta catgatgaag caggcatcgt tgatctcgta ggtgaagacc
    31681 tggcccacgg cgttgacgcc gaccacccgg cggtcccaag cgaaggtgcg tcggtgcccg
    31741 agcgtgccga tgacggtgag ctccccgcac atgagcgggt gcatccgcca gaaatggaga
    31801 tcgcacgagg tgagtatggt gtcctcctcg cccccgatgt aaaagatgta ccccgtgggg
    31861 aaagggagcg cgacctctat tcccctgagt ctctgtacac atcccctcag gcattcgcca
    31921 cccatggcgg cggcgatgac cagctcgcag acctcgttct gggacgcgcc gtaggcgaat
    31981 ccgcctcgat cagatccaga cgcaactgcg tccgcaactc catccccttg gaaccgccgg
    32041 cgaccgcgac cgcctccgag gccatcgcgc agtgtcccgt cctgcccact ctggaaaaat
    32101 gaccgacaca gacagaccct cacggaagtt atcgccaaaa ccgaaacttt ataataataa
    32161 ccggactacg tgacttaaca ccgcccactc ggagcgaaca gaaccagcca tattcctcct
    32221 gtcttccgtg tgtcgctcgt gtcctgtcac acccgctcca ccacaaactc ggagccgtcg
    32281 gactcgccgc catcatcgga cggctccgag tgcccgctgt ccgcgtcctc ggtctcctcg
    32341 tcggagcccg acgaatcctt gtccgagatg acgagctcga cgagctcccg cttggggacg
    32401 tataacctat ccagctccat catgagcgtc tgtttattga cgctgatgtt cctcagcatg
    32461 tcgacgtact cgaaggtgtc gtagtagcgc agccgcatgc ccaccaggtc gtcggcgcgc
    32521 cagtgtccct tgacgatctc ggtgtcactg agggtgacgg cgcccatcct gatgacggcc
    32581 ccgtcgcgcc ggcggtatcc gccgacaaac atgtagtagg ggatgagcct gtcgccgtag
    32641 aagccggcca gcgggcgctc gtcgtacatc ctcttgatga agaaggtgtg caggaggagt
    32701 tcctcgcggg cgcggttctc gcgcagcgcc ttcgggacgc ggaacgcatc caagaggtcc
    32761 atgaacttgg cggcgtcgcg cgagaagccg cccatgcgct cgtagcgctg ctcgaggaac
    32821 atgcgctcga gggcctcgtt gtcgtcgtcc tcgtagccgt cgggccgctc gtccgagaag
    32881 gtgagccggt ccagcgcgtt ggcgatggac aggtcgcgct cctcgtccga gatgccgtcc
    32941 tgtcgggggt cggaggcgac gaagacgggc cggtcggctc ccgcgcggat gcgggcgtcg
    33001 acgtcgcggc ggagcatgac ggaggcctcg cggaccaggc cggtgacgag gtcgacgtac
    33061 tccctctgct cgctacgcac tacgtcgcgg acgcagcgga tgagaaagag catgaagtag
    33121 acgttgttgg ccatgtagag cgcgtagccc agatcgatgt ccatgcagtc gacggccgtg
    33181 aagggcaggg ggatgccgtt gacgcgcgcg agcggactgg aggaaccgaa gtgcacgtcg
    33241 tacatgaggt cgcgggcgag gtgtccgcag acgagggtct ggtgttcgtc gctgaggtgg
    33301 cggatcttgg gcaggcgcag cacgccgatg ttggggtagg cggcgacgcg aacgtaattc
    33361 tcctcgaaga ggcggatccc gtcggggttc cgacgccggt acttcgtgcc gatcttctgc
    33421 gcgcggagcc tctcgaggcg ctcgccccgg cgcatccgac actcgcgaca gtaacagagt
    33481 tgatcgtaga tgacctccat ggtcatctcg acgtactcgt agtagctgtc gagcagacag
    33541 ctctcgaagg agaaggggat accgagttgc tggcagatgc gctcgggcag gagacgctgc
    33601 acgatctcga ggtcgtgtcc cgggatgcgg aggctggaca tgaggctcat gttgcgcatc
    33661 ctgtcgtgca ggtcgatgag ctcgttgacg agccggcgga gatagcggga catggaggcc
    33721 gagcgatcgt agccgtacag cagcgagatg gcgtactgta tggcgacggt ggctcggccc
    33781 agcgccttgc aggagtcgga ggcctcgggc ctccattcga gatcgaacag gatcttggcg
    33841 atcccgtcgc acgaggggaa ggagaagggg ttggcgaagg ggacgaactc gatctccctg
    33901 aggagccccc agatggcgga gtcccaggcg agggtgagac cgcggatgcc gtacccgccg
    33961 ttggcggtgg cgagccgcgc gttcttcagg tagctgtact tgagttcgat gtgattaaag
    34021 ggcttattga ggcggatgaa actgcggatc tcggtggcct tgcccgactc cctggaccag
    34081 gcgtccatga cgaagccgaa gcgcgaggcc tgctcgtagt tcctgagctg gaccaggtga
    34141 tcggcgataa agcgccggca gaacgagtcc gccgtctcgt cgacgaccag ttcaaagacg
    34201 aactgcgtgt cgtcgacctc ggaagactcg gacgggctcg agcgccgtct caccgtccca
    34261 cccgaccctt cagcgcaggg cccgcggtcc gccatggtca gcgcgacacg gcgccgtcga
    34321 taaatgacac cgtcgtcttt ttcctcacac gactttattg aaaataatcg ccccgcccct
    34381 tacctacaca gcaagcacgc caccctccgc cgctcggctg ccgggaggcg aggcgaaact
    34441 ggcgggataa ctgcaagaga ggggaaaagc ggtcgatccc agccgtcacc cgagcgtggg
    34501 cacgcaggtc tcggctatcc cggacggagc ccgcaacgcc aaccacttgg cgaagtcggc
    34561 accgccgggc acgacgtagt cgatctcgca gtagaaattc acgacctgtc cgacgcagac
    34621 cgtgcgctcc gcgacgccgt tcctggcgaa caccctccgg tagggctgca ggttgatcct
    34681 gagccggtcc cggaggaatc ccgctatcgt gttggccacc ttcaagacgc gggcgccgcc
    34741 caggagcacg aagacctcga gcttctcgtt acacagcacg atgaactgca tctcggagcg
    34801 tccgatgacg cgatagcccg cccggcgaag atagaagaac acccgtccgg gcaccacctg
    34861 gcccaatctc aaactctctt catcaccgac catgaaatag ccgaagaact cgcccataaa
    34921 cctgaggtta ctggcctggc ggaaagtaga cagcccggtg cggtcgcgga cgaagcattc
    34981 tatcgattcg agatcccgga gctcggtcag gggcagtaaa caggaaggca cctcgacgtc
    35041 gtcgcccgtc gttggcggcg cgtcgaacat ctcatatatg tgccggtgtc cctctctcga
    35101 cagaagatcc accagacccc gttcggagac gatatagagc agatcggtgt cctggctgtg
    35161 cacgtagcaa cgatctccgc cggtgtacac cgcgatcaga tcgccgtgac tcctggcacc
    35221 gaaaacgatc cgaccgacga cggtcatctc ggaggaccgc tcgctacagc ggtagccaag
    35281 cagcttttct acgtcgaacg tgggacagat gttatcggca tctccgatcc gcaacgtgat
    35341 atccgccatg tggtccagcc cgaaacgccg tccggtgttt ctcttgacga aagccttcac
    35401 ctcgtcgaag gagctgccat tgcacgccct ggcgcagcgc aacagctccc ccctcgcgtg
    35461 gaagttgtcg acgctggtac cgcgactgcc ggaatccaag tcgacgcgct gcgcggtgcc
    35521 cgtgacgacg ttcacgggca cgaccggcgt cttggaggcg acggaggtgg ggacgggcac
    35581 ggtcggttgg ataaccatct ccgagaaggc ggccacaggc ggaatcggtg gcgtcggcgg
    35641 tgtcggtgcg ggatccacgg cggcggcggc ggcggggatg tcatcggcga cagggtcccc
    35701 ctgttcatcg tcgcgaagga acacctcatc gaggtcgtcg tcgctgatga tccgcatacc
    35761 gacagcttcc aggctcatat cgactgattt ttatctggga tcggcagaaa agacaaaaga
    35821 gatagaaatg cacacggaaa aaaagctttt acccgaatgg ctttatgcca ttgcccgaaa
    35881 tagaaacgcc cactactcat acgatcgcac gacgaacctc ctctacgatc tgagctggca
    35941 aatggcgaaa cctcccgcat ggcgaccgtt cggtgctctg tcgcggccgc aggtcgtcgg
    36001 actcgcgccg ctgctcctgc ctcacttact agatggtggt gtttctcctg ctcgattttc
    36061 tgatcgggac aggaggtggt tgtctcttct cgccgatagg gacactcctc acgaacagag
    36121 gagcggcgtt agtggaaaca accgtggcgg caacggggcc gctgccggcg gcggttgtgg
    36181 tggttgtgtt ggtggatcgg cgggagtcgc cgcggacgaa gcgacggcag caggaatggt
    36241 ggcggttaca gccgcaccgt ggtcgccctt tcttttgcgc ttggccttcc gctcggagcg
    36301 gcgcttttcg ctggagcacg cgagcatttt attcataagg aggttcatcc tctcgatatc
    36361 ttcgaaggtt gcgacgaagt cattcatgtc cgagccacga caggcgagtg cgtcgctatc
    36421 gtcgctctcg ctgccgccgc cactttcgct ttcatcctct tcactagacg ctagtatgga
    36481 atggtatcta gcgtgcacct cgtccgcgac ctccttatcg aagcgagcct cttcttcctt
    36541 agtcaacatc gtagccagcc gcgacacgac cttcatgtcg ctaacgggca tccgtccggc
    36601 gcccgcgaag ttgaccatga gatcaaaggc tttaccccac aactcttctt tagtttccat
    36661 aaccgtacgc gaaacacgcc ccccagatca acgtcggcga tcgcgcatat atagacacaa
    36721 gccccggtga gaagatacct gtcgcagagt ctgaagcgca actctcgcag agacctattt
    36781 tatacgcgag cgtggaggac ggcgcaggag ataagcctga catcaccaca acacacctct
    36841 acttccgaga gactctctga attctcctaa cgagaacaga gggatggaag cgccagaaac
    36901 agaacgcgca tcgccgccca gcagcaggcg tcctgacgcg gacaacatca gcagactgag
    36961 cacgacatcc tcgagggaga gatccaggtc ccgatccgtg tctcgagacc atcatcgaga
    37021 caaatcgcga agcgtttcgg tcccgaagcc ttataaagac cgctaccgcc cgccagagag
    37081 tcgaccgtcg tcctcttcgt ctcacaagaa tgcagaaacc ccccgagagc gcagatcggt
    37141 cagcgccatc aaagagccgg cccccgctcc gcagatccgc agttgcagtg tcaacatcgg
    37201 cggcagcagt gtcagcaact ccgccgccgt caccgagagc ggctgcctca agcgcagcgc
    37261 ccagacgccg ccgtctccat gcaggcgaag cagcgaaaac cggacacgac gaccacccca
    37321 gagaagagcg ccagtttcgg cggcctcaag agcccccggt cggcaccagc ttccgtcatc
    37381 cggagcagcc caccgcagag gaagaacccc gacgcgacgc attaccgtgc cactatcgaa
    37441 gacctgcgtc gtctccagaa catcctcgat ccgcatcatg cggtcgacga gcgtgacacc
    37501 accgccttct ccgaagctca tcccgcaggg ctgtgcggac ccctggcggc tctccgccaa
    37561 gcggtggacc tcagcgtgca acagccctcc atcatcgtcg gggcacccag ttcgtcggtg
    37621 gcgctcaatg ccggagattt ccatgctcag gtcgtcatgc tgtacggctc acaggccacc
    37681 gtcctggaca cggccgcaga gtctatgcgc gatacctgca acagcatgat cgcgtacacc
    37741 aactcgatcg acgcgtcgtg cccggacacg cgcgtgaagc tggatcgcac cgagagacgg
    37801 cacgtttcca actaccgcta ccgactggca ctcagcgcca gccagtacaa cgaggtggtg
    37861 ccgtcggagc tgcgcgctcg ctactacaaa ggcgccattc acttcgcgac ggcggtgatc
    37921 ggcacgatgt tccgcacctc ggacgagctg acgtacacct ggaccacgct gctggtccct
    37981 cgcgtctcga acatcccggg cggacagttc ctgctgtgct ccctgaaggg aaacgcagcg
    38041 gtgtgtcaac cgaccgtgac cacgggtggc ccgcacacca tcctgctggc ccacgacccg
    38101 tccaacgtgc cgccggacaa caggcccgtg aggctggagc tgtcggcgtt cttcttcgtg
    38161 ccgtacgtcg cgccggactt cggcgtgcgc atgctgacgc tggaagacgc ggcgatccgc
    38221 gccagcggca tcagcttcgg catcatgacc cccgtgcgga ggacgggcgg ggtgtgtatc
    38281 ggactgttct cggccctgag ctggactccg cgcaccatca tgaacgaaaa cggcgtatcg
    38341 accacgagct acgtagcctg gttcgagtgc acccaggaga acagctactc cctatgcaag
    38401 tactggcgac cgtacaggaa ggtgacctac gagtgcggcg atttcgaggc cggtatcaac
    38461 gtcgagagca tgtacgtcgt ggacggcggc aggaggctca tcggcacact ggtggtgggc
    38521 agcgacacca ctacgaacac gccgtcgctg tcaccggagt tgatgcccag catgatcgtg
    38581 ctgcgctttg aactgtgtaa cagtcgacac cgagaaccga ccatcgtgtt ctcgaccaac
    38641 cccaccctgc acctcacctg gccgagcgaa agccccgacg atcccatcac gatgtacgcg
    38701 ccctacgatc tctgcttcag agagggtaag tgcgccgtct tcatggacat cagatacgcg
    38761 aaggcggcag ataaccgctg ctttttcatc tccggcgtgc ccgcgagtac cgtttccaca
    38821 ccgggctgac ggtctggcgc ccgcagagcc ccatccgcct ctcgctgatc tccccgaccc
    38881 ccagcctcca catctgccgc gggacgccca tcgccagact cttcttcatg cactccacag
    38941 agggcaacat ctaccaacac aacgaacgca cggcgacccg agtgatcaag acgggagacc
    39001 gaatcaacct tcacttggga gacctgagac tcccttatca gaactttaca acctcggacg
    39061 agttgtgatt atattgttat catttctttc tttctttctt tctttctgct gctgttgctg
    39121 tgtatatgcc tgtagtgtaa ttaataccca ctgccaaacc ctcaataaat caagaaaaac
    39181 acaaaacgag agagtgtgtg aacagtgtct ttctttttac tgtgatgata ataaaaaaat
    39241 aataaaaacc aaccaggagc gagcgatcat cgatcttgtt cagtgagacg acgacgattt
    39301 ttttaccagg ccgccaccgt ccccatcaga accggcgaat ggggagccgg cgaactgttg
    39361 ggagagtggt ggctgtaggc taccaccgcc accggttttg agatctatac cctccagacc
    39421 tttacggagg tcttctagaa caccacctcc atcctccccg acgggcatat tatccccagt
    39481 ctcgtcccag taatactcgt cgtctttatt atggggtggt ggtctctgtt tataattctc
    39541 aggaaaagtg gggtgcttct tggtcctgct ctttggaatc ttgccgtatc tgctgtcctg
    39601 gacgtcttcg tccgcgagaa ccccggagag atccggcaga tcggggggga gagtcaaagt
    39661 gctaccgggc cctccgaggg gaggaggaag gagcacggac gcgccttggg tcgtgaaagg
    39721 cccgtcgtcg aatcccttcg acgaggaggt ggtcctcacc gtatctccga acgccgcgac
    39781 cggatcgccg acgaaggcga ctttccgcag cggctcggtc cggggaagga ttgtgctcag
    39841 atccgagtcg gccgtgcttt ctctcgcttt ttgtaacgcc atctttaatt ctctgtccgc
    39901 gcgatcgtcg atcgtgccat ctttcttcat cttccgcacc tcatcatcgt ccgtactcct
    39961 gcttctcaac aagtagccgc ccccaccttc ctttttcttc cctgtacgtt tccccgacgc
    40021 cgttgacggt gtctgtacac cgccgccaac gctattactt cccgagacgg gtggcgtgac
    40081 attcttctta ggcggagggt tcttcttatt accaccgtcg tcggagcttg cctttcggag
    40141 ttccttgggc ggtggtttgt ccatcaccct gccgtgttcg tcgatccaga cggcggcctc
    40201 gttgtccacc attatcccgg tcggattcca ccacctcaga gccctgccgt tcaccatctt
    40261 gaccccaaga caccgctcgc tatcgggatc gaattccaaa cagcgtccac tgccgccacc
    40321 gcaatcctca tcgtctcccc ctatgagaca cgtgtttgcg atgccggtgt cgtcgtggag
    40381 ggacatcccc ggatcgggcg tccgattccc tcccgactcg tcgtcatgtc ctccgggtcc
    40441 tccgccgtca tcgtcgtctt cttcatcttc gaggtccagg tccgagccgg cgtcactatt
    40501 atctccctcg ctctcgagct cggactctaa cccccagtcg ggatcacccc acctaagcgc
    40561 gtttctgaag aggaggaagt cctcctcgag ccgccgcagt agattatacg cggtcgtacc
    40621 gtcgacgggt ctctcgagcg cgtttcgagc gtagactcga gcgaaggccg gtctatcgtg
    40681 aaacgctagt atcagacgcc gtcgcagcga gttgatgcga tccagacaca tgtgggagag
    40741 cgtctgccaa gacttactga tggcgtaggc gaggcggcag aggtagacga gacgattgtg
    40801 cacgaggacg gacggatctt cgttgagagg gtccctcacg tccaagactt cgtagacgag
    40861 gacgcgttcg gccgcgtccc tgacgttgtc catcaggcga ttgacctcct ccgctctcat
    40921 gttgatgaag cccatgatca ccgcacgcgc cggcttgtcc gggccctgag cacagagaca
    40981 ccgggcgagg tcctcgagcc cccgcaggaa gacgtccacg cgaggcacat aatcgtcgcc
    41041 gtagacggcg tcgtcgaaca cgttgacctc cgtgagtccg tcgaagccgc agagctcggg
    41101 ccgcgcggcg acgaagccga agagcttgtc gtaatcttgt ctgatcctag tgaggagcgg
    41161 caggtgtccg ggtcgtcggg ccgtgagctt ctcgtggtac ctgagccaga ggaccatctc
    41221 gttgtagagc tgcgtctccc tggaaaggtc ggtgccgcga cattccgcaa tcacacgtgg
    41281 gtggcgacag agattaatgg acttcagatc atagagattg ttcagaaact tcttaacctt
    41341 tccaacggag ctcttggaga gcctgacgaa cccgagggtg gccatcagtt cggcctgacg
    41401 accgtcgtct cccgccgcgc gccctcgagc ggacatcgtt aaatacagcg actcgcggaa
    41461 gttctccggc gacgaccggc tcgagatgga cgtccttttg ggccgggacg agactatggt
    41521 aagcagcgtg cgccggggcg tcgggacggg gagcgcgcgg gcggtcccgc cagagtcgcg
    41581 gcctatctgt caagagaaag gcaggtaaat gattgatatc cgtctatctt cggtgtccgg
    41641 tgtctatccc cacaacatat ctcgccctct cgcccgcagg acgagagcga ctacctgcac
    41701 gtgaacaaca cgtgcgcccc ctcgctgggg ctgagcatcg cgagggacgc ggagacggcc
    41761 atcaacacgg tgatcatcct gatcggcggg ccgatgaact tcgtggtgct gacgacgcag
    41821 ctgctgtcga accgcatcta tcgcagctcg gccccgaccc tgtacatgac caacctgtac
    41881 tttgcgaacc tgttgacggt gacgatgctg ccgttcctga tcctgagcaa tcggggtcag
    41941 atcagcagct ccccggaggg gtgcaagctg gtggcggtga cctactacgc gtcgtgcacg
    42001 gccgggttct cgacgctggc gctgatctcg gtgaacaggt atcgagtgat ccaccagagc
    42061 acgaacaaga acgcggcggg gtcgaagaag aagacttacg gcgtgctggc gctggtgtgg
    42121 ctgacctcgc tgatgtgcgc gtcgccggcg ccgacgtacg tgaccgtttt ggcgcacgac
    42181 ggggacacgc cggacagcgt gcacgagacc tgcatcatct tcttcaacta cgatcaggtc
    42241 aaaaccgtgc tggcgacctt taagatcctc atttgcatag tatggggcgt catgccagtg
    42301 gtgatgatga catggttcta cctttttttc tacaaacgcc tgaaactgac ctcgtaccgc
    42361 aggcgcagcc acacgctggc cttcgtgtcg accctcatcc tgtcattctt agtgctgcag
    42421 accccgttcg tgggcatcat gatcttcgat agttacgccg tgatcgagtg ggacgtgacg
    42481 tgcgagtcga tcaacagccg agacgcggtc gccatgctgg cgcgagtggt tcccaacttc
    42541 cactgcatgc tgaatcccgt gctgtacgcc ttcctcgggc gggacttcaa caaacgcttc
    42601 atgcaatgca taactggcaa gctcttcagt cggcgccgca tgcttcagga gcgcgctggg
    42661 gtgcgctcgc cctcgacgcc acaccgcgcc gcgcgccagc tggcaaagat cgggacgctg
    42721 acgcgaagct gctcgcgttc ggagctgcag aggtcggcga gcgctcctcc gccccagtga
    42781 tcgcagcgcg gcggccgctc tctcttctct ttcgcttctc tcctctcgtc gtcgtccctt
    42841 cgtcatcctc ttctccttct cttcctcatc ctcccccgtg cggagggtcg gtcgagaccc
    42901 ctcggagagc gcgagggacg ccacgcacct gtcgaaagag acacatcacc gcgcacaaca
    42961 tcatctagac caatcaatct ttcgcagaat accgtgtagg agtggcggcc cggctaaaag
    43021 cgcagcggtg ctacgcatca cctcagacgc cgcgccgccg ccactaacag tttgctcgct
    43081 cgatggaaac cgcgtcggct tctcgaggcg tcggcgcgac agaccgcacg ttcggacggt
    43141 ccgggcatcc gcgacccggc gccgatccgc gctcgcgaag accgccggcc gcggaagaca
    43201 cgcgcacgga cggcgggaac ggcagacacc gacacagacg acgcaagagg agccgttctg
    43261 acaacaataa caacgagggg gtccggggag ctttcatcaa gcgcccgcgc agcttctcca
    43321 agtcgtcgtc gtcgacccgc gaccagacga cgacaaaaac gacgtcgtca tctggcccgg
    43381 cggggacgcc ccacgcgccg cgtccccgac actcgtccga gtcgacgacg tatcggcggc
    43441 ccgaccaccc gttcgatcgt caccatcctc ctcaccatcg acactcctca tcgtcgtcgt
    43501 cgcagccaca tcatccgccg cagcacgtgt cctcggcgcc gccgatacat cacttggaga
    43561 gacggagatc cgacccggtc cgcgcgcaga gacgctactc tgatcgcgaa cagcagcacc
    43621 agcaacaaca acagggcggc ggcggcaacg gtaggaaaga gagcggcggc ggttccagac
    43681 acgaaccacc aacgcagcct ccgccgtcgc atcaccgcga aacgacaatg ccgtcgtccg
    43741 cgccgtcgaa gatcgtgagg tacgaagcgg cgcacaggta cacgatggcc gagggtttca
    43801 tccgctccgt gtccgggacc tacaagatga tgaatcgagc ggaggatcgc aagaggatgc
    43861 tgtccaacca gctgccttcg tgcatcaagt ccaagtcgat cgccaactcg ttcatcttct
    43921 gcacgtcgtc ggacggagac atcctggagt cggagatcgc gtcgatgcgc cgccaccaga
    43981 aacacatcac ggatttcagc aagctggacc gcgcgatcca cggggtgagc tgcaggatca
    44041 gaaaacaccc gatctccccg aacctgagcg aacagcaggt ggcgatgatc cgcgccatcc
    44101 gcatcatcgc catctccttc aaccgcatca cgtacgtggc gcgcgtcaaa cattactgcg
    44161 acaaggattc caggttctcc aactacctcc gcgaccagct caccaaacgg tgcagcgaag
    44221 gctcgcgcct caacctcggg atacgtcgtt tcatcagctc ggtgaacgtg gagaagaacc
    44281 gagacctctg catgatcctg gtggggatgc tgtgccagac gccccacatg tgggcccggt
    44341 cgatccgcct gctgtgccgc ctcaagatct tctaccagaa cgtcctgatc aagatgttcg
    44401 ccgacgagaa gatcgacctc agggacgtct tcgagctgca gtaccactcg acgggataca
    44461 agatccagtc gcagatccgc cagtacacca gctccgcgtt cgtcttgaac gacgcggtgg
    44521 gcacagtggt gaacatgatc agacaacgtc aatcgtcttc gtccggcggc gcgatgttac
    44581 cggggacggt ggcggcgctg cctcccgacc cgcaccacca ccaccttcat catcactcct
    44641 cgtcctcctc ctcccaccat caccaccatc atccccacca ccatcactcg cctcatcgct
    44701 tcgaagacga cggcgtcgtc ggcgacgaag cgatggtcgt cgaccagagc ggtttcccct
    44761 cgttctctcc gcccaagact ccgatcatcc gagaagacat cctcgacgag tacatcttct
    44821 acccgcgccc gggaacgttg tccgacgtgt cctccgatac ggattctccg cgccaccacc
    44881 gcgacacgga cagcgacacg ggccggagca gcgtcgcctc tcgctcgagc aggacgcctc
    44941 cgttcgcgga ggcagcagaa gagacctcgg atctagagga ggaagacggg gaagagacgg
    45001 cgaagagcac accgaccttc gacagcgacc cgttctcccc cggccgagga ggagtagtag
    45061 gaggagaaga ggaggaggaa gaggaagaga acaacaaacg ggcgtcctcg tcgaaatcga
    45121 gttcgcgtgg aggtagttcg acgtgcagct cggggtcctc cagcggcggc gaaggcgact
    45181 cgtcggactc gtccacgggt ggttctcggt cccacaccgg ttcaccgacg ttatccgaca
    45241 ggggcaacac gccgccgctg ccgccaccgc caccgttgcg tcaccgtcct cctccgcccg
    45301 tcgcgtcgtc tccttctcct cctcctcctc cacttcatca tcttcctcct ccgatcgaca
    45361 gcatcggcag ccacgacatg atgacaatgg ggggagaaga agagggaatg atgatgatcg
    45421 tcgacgatct cgacgcgttt caccaccaag cgcagcagtt tcatcacccc tatcaccatt
    45481 actcgccaag cccacacgaa ctcgggtact tttcaccgaa cgagataaac ggaagccctc
    45541 cgaaaaactt catctccgtc cacgtcggac ggtctacgcc acccggcgcc gcggcggcgg
    45601 cggcagccgc ccagaaacat tctgagtgca tcaacatcct gctctaaggg gggcgcggga
    45661 cgaggggaac ggtcgagaca cggcgtccgc gacaccgtct ccctcaccag taccgtgtcg
    45721 ttttgtagca taggggaaac gggtattttt tcgtgtgtgt gtttacatct aataaaaaca
    45781 tctcggtacg gcctctgggc ccaaaagcta attggaatcg tgtcaacatt atttaaccca
    45841 tccatcgggg gctggcgcca cacgccgcgt gcgggtgggc atgtatcgga ccggccgcac
    45901 gggacgcgat ggccgctccg acggaggaag accccagacg cgacacgagt ctgatgataa
    45961 acgagagatg caatttcccc cacaatatgc tgtcggagga aaatatcaat ttcatacagg
    46021 acgccgtgtg taacggcgac ctgggcgccg tggcggcgtt gaactcgggt ctgccgatgg
    46081 ccccgtacat gctagaggcc ctcctggcgg tccgcgtcaa acacaggctg acgaaggtca
    46141 gacagacact cgagcccgtc atctgttaca ccatcagcgt ggcgcacctc atcaacggta
    46201 cgcgcatctt gcgttcggcc acggccaaac acgcgacggc gtgggggccg aacgacaaac
    46261 accgcgcgga gtccgggctc cgaaggatct accgcgccct gaacctggaa gataacccgt
    46321 tcgacctggt cgaggccgtg ggcgacctgg acctgtctca gggcgcctac gagggctacg
    46381 tgcgccacat ctactcgctc atgaagtccc tgggacacga tgtgggccac ctcagccggt
    46441 ccctggacta ctccacgatg acggtgttca actacctcta cgaatccccc ctgttcacga
    46501 gccaggaggc cgtgacgatg tactccagga acctcgccgg catcaccaag atgtcgcgcg
    46561 agccgttcga gaccctgtcg gtcgtgcacc ggagcaaaga acctcccgag atcctgaacg
    46621 acatgctgtt cctcctgtcg gtcggccgca tgatcgtgct ccaccaggaa tcgctgagag
    46681 ccctgcgcaa gaacctgatc ttgacggcga gcgcgctctg ctcgatactc tacaccgcct
    46741 acactcaggt accggagacg aaatccctgt tccgcgaggt cgcgcacgag gcgcacgcgc
    46801 tgctctcctc caggtccccc gacaccccga acttcagacc gttcgtcgcc tgcatgttgc
    46861 agttcatcaa gcagatcatc gcggccgacg tgtacacctg ccccaggtac ctgaccaacc
    46921 agatcctggc cgtgacggcg aggatgcacg gcctggaggg ggccgcgatg ggtcacgacg
    46981 acgacctgga catcgaggtg gacccgggaa acccttacag cgccaagtac cgcatgaaca
    47041 acccgtacaa cgaccagaac atcttcaagt gccccaggag cctggtgcat tacgtgggcg
    47101 atgcgctgtt caagaagacc atgacccagg agctgctagt gagctgcacg gaccaagagg
    47161 cgacgtacca gacctacgag ctgccgtcgg tctccgagct cgtgggcgaa ggcgtggcga
    47221 aacgggcgca cctcacccca gaccagctgt cgcactacct gtccgtggta agcaccccgg
    47281 tcgaagtcgt cacagacgac atcgaagacg gcgaacagga ggaggatctg ttcgccgacg
    47341 tgtcggtggc cccggcgtcg cccgtgaggc cgatccgcgg cggggggcaa cggatggcca
    47401 acatgagagg tgccagaccg tactccacag tccagcgcgg ccgccgtcgg cacgagagcg
    47461 aagtgtgagg gaaagaaata gtaataaaag agagagagaa ataaaaaata tctttgcgaa
    47521 aactccgtgt gttatgtgtc gctttttatt aacctccgtt ttgtttattt ttttttctcc
    47581 cctcaccctc tccgtccctt tcttatccgt tttccctcta tcgatatccc cgtgtcatct
    47641 taaagagctt gaccctcctc ctctcgatac atcgccgaca cggtggatcg ttgatcccga
    47701 tggtggtcag gctggtgtcg cagtcgtcgt cggaatcgtc gtccaccgac ctcatgacgc
    47761 tgcgcatccc ctcgagcgtg gccttgatca cggggtcaga ggccatggcc gggcaggagg
    47821 ggtggccgac gaggagcccc tcgatctcct cgggccagag gagatcggtg atctgcttga
    47881 agccgaagta agcggccctc atgatgttgg cggcgtcgta gtgggagaag acgtcggcca
    47941 cgaagccctc gacgcactga tttctgttga tgcgatcagc gtgaaagaac ttgttcttcc
    48001 tcccgaggaa gagattgtgg ccgatctgct ccccgaaact ggtcatccgc gacatgcaga
    48061 aggagctgtc ggggtccctg acgacgtact gcgggtcctc atcccccacg gacaccctgc
    48121 gctgaagaac cacttcaccc tcgcggacct gtggcggcgg cggtggcggc ggcggtggga
    48181 cctcgcgcac gttgccgacg tgcggacagt agggaacctt ctcgaggcgt ccgataccgc
    48241 ggaagccctt gtcgtgtctg aagttgagga ggctctttcg gctgccgatg cggatgaaca
    48301 tattaaagtt gtcggccagg cgagtgactc tgttgagaca gttgtcgtat ccgaagatgg
    48361 cgccgaaggg atcgatgatg aggatgagcc ggggtcggaa gaccgaggtc gcggccttgt
    48421 atccgaccac ggcgaagatg tcaaaggtgc tggagaacct ccggacgacg gagcacatga
    48481 cggaggtgag gttgatgacc gtacccaggc tgcaggaggt gacggtgccg tagtcgccgc
    48541 gatagagcat catctgggcg tcgatgccgg cgatgttgcc gaccatctgg tagacggcac
    48601 cctgattctc cgcgacgatg gagatgaaag cgggcacgga gtcggcctcc aggaggctgg
    48661 cgatgacacc gtcgacgaga agtatgggcg cgaccagcga cgtggcgaag atgggatcga
    48721 gccgacgcag gccgtcctgg aagaaggaca ctagactgtc ccccagatgg aagacgacgt
    48781 cctcgtgtcc gtcgtagcag tagatgccgc cggtggcgcc gaagagcatc acgaacctcg
    48841 tggtgtccag gtcccgtcca cgcagccggc cgaacggcac catcctctca ccgcagcaga
    48901 cgtactttcc ttttagggag gacgtcgtgc gcggttgtta ccctacgttt tctctccccg
    48961 ccgccgccac cccgtcatgc atccatccat ccatccatcc tcccctccgt gggtccgtcc
    49021 gcacgtagca ctcaccttca tcacacagac caccgtatct cttcaagaaa tacgtatatc
    49081 tggtcatgtc gacgagccgg accgaaaccc cgtccggcca gctgaccggc aaggaggtac
    49141 cggcgcgctc ggagacatag ctatagatgg cctccggatt gaagccgatg ttggcgagcc
    49201 agcgataagc ctccccgatg tcctggtaag ggacgatctc gggttgttgt tcctcttgct
    49261 catacatcct ttcactgtca aacgaccctc ctccacccct ttcccgaaag aatgagctcc
    49321 gtccaaagaa tgtgacctcc ttatagcgtg tatgacgcac gcgaaaaaca agaccgcatt
    49381 cgagcatttt gacgcaagca gcaactttat tgagaactgg gacttagtga catcatctat
    49441 tcacacgttt tccgcggcga aatcctcgtt ccggagacgg agggacgact gtcccctcat
    49501 atctttgaac agcgactcgc gttgtcggat ggtcatgaag cagaagagga tcaacagggc
    49561 caggccgccg aacacgaaga agaacatgcc gaccatcttg ggcaggggat cgccggccac
    49621 gtagccgtgc atcgcgacga gaaagcccgg gtccctgacg aaccgctcgt tcatctcgca
    49681 gtacttcgtc cagttgcccc agacggtgga ccagtttccc gtggcggtgc cgccggagca
    49741 ggcgtccctc ctgatgacgg cggtcctctc catgatgccc ggcgagagtt cggaccggtg
    49801 tccgacactg acggcgcgca gcaggtcggg acaggcacgg aagacgtaca cgtccagact
    49861 aatgtttttc atcaggaatt gcaccgtctc ggtgtgattt ccgtcgtccg aaacccagtt
    49921 cgtgtcgctg ctcttgctcg aatcgacctc cagacggaac ccgccgtcca tcgtcgtctt
    49981 gagctctacc gaaccgcgac cgtccggatg acatctgccc ttgccggaga acgacgaagt
    50041 ccttccatcc gcacggtgcg agacgagtcc gggacacgag ctcaggggcc tgaggatgta
    50101 accggtgaag tagtaagcga tgccgatgtc aaccagctgg atatcccgaa acgaccagcg
    50161 ccggttaacc ttgccgaacc aggtactgac caacgtgaag gcatcttgac agctgccgga
    50221 gaagacgagt tcggatccgt acttgcagtc gacgatacag cccacactgg tgcggttgtc
    50281 cttgcgctgc acgagacaga cgtcgtagga gcactcgaag acgcccgatt cgggccccga
    50341 gaccgccgtc cgcgcggcga tcgcgaggca acaacagaga gtggtggcac gcgtggccac
    50401 cgccgcgatc ccgagccccc ccgctgtcat cctgacgaga gaatccgccc gagattcgga
    50461 cttatgtgtc aggaccatcg ctcgaggcgc ggtcgcacac gcgtggcgcc ccttcagcgc
    50521 ccagcacgat gctcgtcgtc atcaccgcag gtccccacag ttgggcgtcc cctcgttcct
    50581 tctgctcgaa gcattcttcc gtcttggtga tcttggcccc cacgctccca tcctcgagca
    50641 ccctactgtc ttcgggcgcc ggcctcttcc tcgggacgga ggccacctgg atacagccgt
    50701 tgtacgacag ggccacagga ggagagccgt tcacggtgag gtccatgggc tgctcctgct
    50761 gatcttccga agagtccagg gtgaggtcta tgcacggcgg ctccgtgtgg tcgcgtggag
    50821 gagacacggc gaatcgcacc gagttgaagg cgttgtcatc gttttcatct tcctcgtcca
    50881 cgggcccgaa gagaacgtga acgccgggcg cggggcctct gacggagaga tcgacgggca
    50941 cgggcgagga cggtactcca ccgccaccag gcacggggtt cacgggcacg cgaaacatgg
    51001 gcggcgagga gatgagggtc acggtcatgg gcatcggcgg tccctcgata gccctccgag
    51061 cgatgggagg agacgccgcg gcgagatcga tgcacggggt gctctggatg gactgcgaac
    51121 cccgaggagt agattcgagg atgatggtac cgttcctacg cacgacgccg ttctgcgccg
    51181 attgctgcgg cacgtagcgg cgcgacttcc agtacatctc gaggaagccc atgtccacgt
    51241 tttggtggag ggtggcgcgg tcagagaaga gcggcggtat ggatccctgc tggatggcgc
    51301 tggccgcgga aatgaggatg cgcatgaggc gattgcactt gagaggcagg acggtcccag
    51361 acttctgcct cttctccttg gattcgatga tgacgcgctg cagacgcagc ttgttgtaga
    51421 agcccatgag atccttgagg tcgatattga gctgcttgac gtacctccgc aggggcgaag
    51481 gaaagatgga gttgtcgtgt tcgaagacga tgtcggctgt ccagaagtct tgcaggctgg
    51541 gacagatgta gaacatgact cccctgtcgt aggccatgac gacgccgtcg cgtccgatga
    51601 tgaagatgac ctgtctcgag ggtcgattgg aggcgaaccg ccactcttcg gcgaccccga
    51661 agatgatcat gagcggtccg gacagggggc agaagtcgcg tcggatccag gagagcgcgg
    51721 gttccttgat ggtcaggtgt tcgtaggagc tatcgcagac ggagatgacg agaccgctag
    51781 aatgtgtaat ctccatcttc tgaatcgtac actccctcaa agtcctcaca aacgtatagg
    51841 tgctcgtctc caaagcctgt accagtttcg ccgcccggat ggcggactcc cgatccatcg
    51901 cgttggcgaa catcctctcg gtgttcggca cgattgtcgt tgtcgacacc gccatcgccg
    51961 gcttcctgac gctgagactg cggacgagac tgaggttggg gctgttgctg ttgttgcttc
    52021 tcctgctgct gttgttcctg ctgttgttgt agctgctgct gacaatctct cctgatgtcc
    52081 cgcaagacgc gtatgagctc gttggcagtc tcctcggcga agcggcgttc gcgagaaccc
    52141 caggagaagc ggcggcgccg aagaccgacg tagaccgctg aaccgtcgtc cgtaacgtct
    52201 ccagcgggcc gatcacagct gcttcccgag cagttctgac tgtcccgccg cctggttaac
    52261 caattagaga gaatccaacc ggctacgaaa ccaagcgccc cagaggcgaa gagcagcgct
    52321 ggtcgttcgc ttacaaaccc aaagaagggt cggcgcacac tctccatcgc tgtcccctcc
    52381 acaactacaa cccgcggcac cgtccgcgca acttttatat gtgtcccccg tccgtctccg
    52441 gttccacttc ctgtccaatc aatccgagcc gccacggtca gggtcagaag ttgtgcacgg
    52501 tcacgttctc gtagcagcca tcatcgaccc catcgtagtc gtcatcttca tcggactgct
    52561 gtagttgaaa ccgaggcaag ggatactgac ccccggcggc cccgccgtgc gcccccgccg
    52621 agcgcatcat ctgcatctcc agagcatcgg cgatggcgac agcttgtctc gccttcgatt
    52681 ttttactcag gtcgccaccg acgaacacct tggccgccgc tggcggtggc ggtggcggat
    52741 gcgactgttg aggtagaccc atctctggat ccagatccgt gcagaccact tgcacggtgg
    52801 gagaaagtgc ctcgtccgag taccatttct tcctgagaaa ggggaaagca gaggcgagca
    52861 gagcgcgccc gccctcggca aaagtgaccg gtaggggaga gccgacgatc ctgtcgacga
    52921 gaaaggcgaa gaagacgccc gcggtaaagc ctccgatgac acacaacacc gcatactctg
    52981 gggccaatcc ttgtctcaca atggtattgt gtccgataag gtcacacgct ccacaacaga
    53041 tggatgaccc gttagggaaa tcgggcatct tgtctattcc gtaccgataa gttttgatca
    53101 ctcgttcctg gccgcggacg aagatacgaa cggcgtcttc gccgcggact aaaagatgag
    53161 tagcaccgaa caatatcccc aaaaactgag tacacagcat ctttttatat gtctttgtag
    53221 ctatcacttt cgaaacgcat aaacgacgct atgtcccact catctcaccg actctcttcc
    53281 ctcaacctgg tccaacgcgc tccgccggcg cgatcgtgtc gaacgaattc acgtctaacg
    53341 gcgtagatgt tgtacgcgaa ccaggcccca cacagcagca ccacggacaa aaccacggcg
    53401 atcatgaagt agaagacgct ctccgtcctc caccacgcca gatgcaagag tgaggcgtcc
    53461 ccggacccgt cacggatagt ccccacgtcg ttctcgcccc gaccgacggt ggtcgtgccc
    53521 gagaggttca agaccgccga gctctccggg aagatggtga cctcttcatc ggagaggatc
    53581 gtccgagaca ggacacccac cgtcccggtg cctccgcctc tgcccgacat ccctccccga
    53641 cacccagatc gacagagaag acgcgagtcg aggggatggt gtgagaagac ccgattgatt
    53701 tttattgaag atcagagaga taatttgggt ttaatagtca tccgatgatc gtgtcgccgc
    53761 ccgaccgccc tcctccccca attcatctgt caatgatcac gacgatcagg atgacgatgc
    53821 agatcactgc gaggacggag gcgtaaacca cgtcgggagt gattttttta cgtacgccgt
    53881 tacagagttt ggcgaccgtg ccaactcttc gcggcggtcg cgccgggatg gccactccgt
    53941 tggcgtcgac gggaaacagt tcgagtcggg catgatctcc gacgaagatg acgccttccg
    54001 aggaaacgtt gtctcctaac gacggcgtag agcccccgag ctcacggtaa ggcatagtaa
    54061 agaggccgcc aaggcgacgg agattaggtc ttcgcggagg gcgcgacgaa aggttcgcgg
    54121 gagcggcaat cttctcaccg tcggcagagc cagagccata tacgccgccg tcatcgccgc
    54181 gacgatcatc gtctcccatc aaaggttcgg aggaacctgc gcacgacaac ggaatgtgag
    54241 gaaacggcgt ttaaaatagt tttgtaaggt ttgtttagta gtagtgtagt tttgtatcaa
    54301 tcagcacaca tcgtcatctc ccgtccggcg accggtcgtt cctcctcaag tctaatcgtc
    54361 tccgccacct ccccgaccag tgaccacggc cgtgatgacg agaacgagta tgaccaagag
    54421 ggacacacag actccgaccg tgatggcggt ccactgaaac tctttatcca tgcgttcgag
    54481 agacagggtt cgcctcagcc tctcgctcgc tgttcgcgcg cggtctgccg cgagcgcacg
    54541 cgcagccacc tccgtcgagg acgaggtggt ggaggcggtt gacgaggata cggagatgga
    54601 gatggagttc tctccgcgta acgcggcgcg gagactgctg ttgtctcgcg ctctccgctc
    54661 gtcgttgtta ccaaagagac tctcgtagga cggtggggga tcgtcgtccg cctgctgccg
    54721 cagattcgtg accaccagtc gcgtggtggc agtgtcgttg agaaacacag tttcatagcg
    54781 agcgttctca ccgaccgctt ccagataagt aggcaaacgg tgctccggtt cggaagaagt
    54841 catgtcctcc caaccgcgtc cgttcacaaa agtagcataa ccacgtcctc tatcagcata
    54901 tatagtatca aggccaagcc tacaatgaga gccacgatct tcaggagatc gtaccacggg
    54961 ttgtggccct gcctgacccg cctaggcata ctccgtctat cccgaaaggc aatcggatct
    55021 gcaaccaacc acccgttccg acccacaacc accctacctc ttgaccttcc gaagcgttca
    55081 gagaggaaga aaacgagcaa acaccagagt ctcggttccc gtacctatcg gagttgtgct
    55141 tcgcgacagc gttaaataat aatcctggcg cccgcggcgg cgccgagaca gttatctacg
    55201 gaagggaacc gccgttcccg gccctcttct ccccgggaga gaggaaggag agcgctagtc
    55261 agcgacgcga acgagcgaga gcgaacaaag taagagactc tcagacacag cgagatctga
    55321 aagtgaacta gacaccgcag cgtcccgttt ttattgatgt cggcaacaca ccgtcacata
    55381 gccccacgtg ccccagagcc agtgccagaa acgactgatg atcgagaccc ttctcttgcg
    55441 tcggcacctc tgcccgagcg gacagaagac cggcctgatg ggctgtccgg ggcgcgggtc
    55501 ttcgagtcgg cgctggggga aggtgttggg gagaaagcag ttgctgttgc ggaatcgcat
    55561 gacgccgagc acgaggaagg tgaagaggtc tgcggcgagg aacttgatgt taccgtgccc
    55621 cgggtcgacg tagtagacgg tcccgccgtc ggacacgagg atgggcgcgt tcacccagac
    55681 cccggacacg cacgccttga ccatgaagac gggctcgagt cggcactggc cggtctcgtg
    55741 cttccagcac tcgtagtcga agctgtcgta gccggtgtcg cacaggttgc tgacggtgag
    55801 cagggtccac atgctatccg agtggaagat ggcggtctcg gcgccgagca ggcgatcgcg
    55861 gctgacgacc aggtcgtcta tcgagctcct ggattcgagg atggacttga gcggatcctc
    55921 cgtatagtcg atcggcgtcg atccggcgtc caggccgatg ccgcacctct cacggagtcc
    55981 gcgccggcag aagtcggaga agccgcactt ggtgagcagg tgcagcacgg ggacgacacc
    56041 gccatcgtcg tacatgtaca cgaagccatc gaggttgacg aggatgaccg ggtactcggc
    56101 ctcggagggt tcgcgcccca ggtcgtggac caccccgatg gcgatgaggt tctgctcgca
    56161 gcagacgtga ccgtcccgga cgacggcggc gctcgccttc tgcagcctcg gcgagcgagt
    56221 cgcatcgatc acggtgaaga cccagccggg gggccaggtc aacagcacgt gatggagatg
    56281 aaacctgtag atgaggcagt tgagtcgccg gatgtccctg gcggcgatca attcgtggat
    56341 gtagagcgtc tcgtccgtgc agagaatcat cttagagtcg acctgagaga gtctggcagc
    56401 caacttctcg acgaaatctt tactgagctg gacggggtcc ggcagggtcg gaggcgctcc
    56461 gatcagcgag tggcgatcga gagtaaaggt caggcggtcc gtactcttcc tcttgttgct
    56521 agtagtgtga tgttcatcgt tgtcaaagat gtcgttccta gtactgctgc ggcgacggac
    56581 gcgagatttc ttcagagtgg cggcgacacc gcaggcgctg atgatacttt tcctcttgtc
    56641 tttgttacta cttctgccgt cgtcgagcga gcaggcggcc gcggatgtgg atgcggtggc
    56701 agcggccgcg gcacccttca ccgtcggttc gacgttctcg taaatctctt cttcctcacg
    56761 actcttctcc gccgcagcgg cggcggcggc ggcagcagct gtctctcctc ctctcccctt
    56821 ctttcgaaaa gatctctctc tcggtgtgag cttatcgatg agcgccgtga gatcgtcgga
    56881 cggagaccaa tctcgtccac gaggtgccga aaatcgcacg acggccctcc cacgggcctc
    56941 cgacctggta tccagcgtgc ggatgatcct cggctgcggt cggaaccgcg cgtcggccag
    57001 tcgttcggga tacatagaga acggcgcggg gacgctggtg atgttccgtc gccacctagc
    57061 ggtaacagcc aacgtgtacc cgagctctcg agccatggct cgtcgtcggc acgacgggca
    57121 aggccccgtc aacgtcgttg tcatagacca acgaacgtgg cgaggtctac tggttaataa
    57181 cagttatcac agagtagtag tgtaaaacgg gacgccgtca cgccggaaac gagcgtagac
    57241 gacaattata ggtaggattt tctaatatac gtacgtgctt tatttatatt ttcacagcga
    57301 aaaccccctc gaagacgccg gtctctagct aacggatcgg acgccgtgaa gacggattct
    57361 cgatgctgtc agttatctgt tgtatacgat tgccggcgac gaccgcggct ctggaaaaag
    57421 atacgatcgg agcgacagtt tccttctccg gagctcgcgg tcgtcacggc ggcatataac
    57481 acagacgtac gtcgatcggc gttttcgctt cttcgacgcc gtcgtggcga tggcgcggcg
    57541 gtggtggtga gcttttctca aacggtgatg atacaggtag gagattacaa taataaaatg
    57601 atctaactat tatggattct aaatcacgga gtggttgtga ttcttttcgg ggatccggca
    57661 cctgaggggg gttcagatcc tcctcggact gaaagaaaga ccgcacgctc ggggaattta
    57721 tctcgattag gttaagacag acacacatac caagtcatgc gtcgagacgt tcgttcgttc
    57781 gtgcgattca ccgcgggcga gaggagggga ggagagagat cgtcgtcgcc gccgccgtcg
    57841 ctctcggtgg tcagtcggtc gatccccggg ccagaataag gcattcaggc cgcgcacttt
    57901 tgttttttag tgttgggagt gtattcgaag gtcaccgagt cttcactgtc gctctcttcc
    57961 ttggtgtcgt tgaagtagcc accgcggtca gagccgcctc ccccggcccc tccacccaca
    58021 gcccccttgg agaccatgaa actggtgatc ttgtgctgat catacttgtt atctttgccg
    58081 cttccgccgc caccttgatg gtcgtcgttc acgacgaccc ctccgccgcc gccgccgcca
    58141 ccgcccgcct tgcgcgagac cctctcgtgt ttcttggtac agttgtcgat gacttgatcg
    58201 acgcaggcgg cgaaatcgtc gccggcggag ctgctggagt tctggtagtt gttgctgttg
    58261 gcgacgggca tgcggtcaaa gcccacgtcg ccgcgcacga agggctcctc gctgaggaag
    58321 ttctcgatgg tgaagttagc gttcttgctg gcgacgtaga gcatggtctc gtggtccgtc
    58381 atgacgcgca gcgtgcaggc cagcttagtg accacacagt tacagagcgc ctggtgcagg
    58441 ttcttggcct gcaccgtgat gcgcaggttc ttgacctcgt gaaaggcgat gcggttgctg
    58501 gcggtgaact cgagctcgct gttacaaccg agcgagaact tgaccgtggg cggattagcg
    58561 tgcagcgtga tctgtaccgt gctgctggag gtggattgct tcttggagtt tcgcttgggg
    58621 cggatgttcg gcgcgatcca gcggatgagc tcgccgacga cggcggagtc gagatcgacg
    58681 cgcgcggcgg agtcgccggt ctcgcggatg atgtcctggt tgtgcacgca ggcggagctg
    58741 aactccatgt tgtagtcggg cgccgacatg cagaccttgg cgctgaggtc cgaggtgtcc
    58801 tgcacggtga atttggtcag atcgcggctc gaggtcatgt acatgaggtt tcccagcagg
    58861 gggatggagt tgttgatggt cttggccgag aaagacttgt cggtgatgta cagacaggag
    58921 ctgttgaaga cgatcttggc gatgaactgg ttcttgacgg tctggacgat gagcgcgggg
    58981 gtgggcagga agctgaccgt ggtattctcc ttcaacgagc gtacgacgca acgcaactgc
    59041 tggatggcgg tcttgtacga cttgaggcga aaggccaggg tcggcggttc gtgctcgcga
    59101 actttcctac caccctccat tcccgcggag atgtatgtga gcgagatcgc ggcgcgccgg
    59161 cgaaagaagg acacgagaca gaccgaccga ccgagcgagc gagcgcgagg cgacgacggc
    59221 gagagtccga tcgggcgcgc ggcgaacaga gcgaaaacga accacgggat gcgtcagaaa
    59281 aaaaagtcgg cttttatttc aagacgagag cagagagacc ctgcaccgcg gatctcctcg
    59341 aaggggaatg aagcgctcgc gatcagacag tctcgctttt atagctcaga ccgctgtcac
    59401 gaaaaccaat cgtctggccg cacgctaagc acaaaaacaa acacacacac aacgcattca
    59461 agcccactcg agcgccagag caatagaact cgttttttgg cgacgagttc gccgtcagcg
    59521 ataattcacg gaagggggca tactacattt atatactccg acggacagtc ccagagcgtt
    59581 ccctcgtctc agatgacgcg ccaattccac cgaagacccc ccgaagccga tggcgacggg
    59641 cagcgactgc gcatggtcga cgaacggctg tctgtcgacg cacatcttga tgaccgcgtc
    59701 ggtcgacacg gtccagccgg tctcggagca cgccacctcg tcctcgtcgt ccgagtcgtc
    59761 gtagaagggc gccgagcggc cgcggcgcac ggcgaccgtc gcggactctt tcgagatctg
    59821 cctgaggcgg ctgttgagca cgggcagctc gacgggccgg ttctcgccga gacaggagag
    59881 atcctcctcg tgcaggcgat ggggctcgat cttgacggag cgcacgcact catcgagcat
    59941 ctgatccttc gtcggggtca tcatgagcgg cgtctgctcg agaaagacgt tgtcgcggcg
    60001 cggccagaag cccggagtgg tgcccgccag gttggcggct tcgtcggccg agcagccggt
    60061 gatgaaggag gcgttcctga tgccgtgttt caccacgtct tcacgtagtt tctcgaggaa
    60121 ctccttggtc atgcgacgcg ggccgcgctc gtcgtcgtcg aagaggtcgg ggtagaagcg
    60181 gccggccgcg tacaggctct tagggaactt ggggaacgga tcggcgcccg ccatgcacag
    60241 gtcgacgctg gcccgcacgg cggtgtagta gataaactcc gcgatacgct ggttgaggtc
    60301 gtaagactcc atgtcggcga acttctgccc gaggcgattc atcacagcgt ggaagccgac
    60361 gaccccgatg tgcaggtcgc gatagagcgt caggagcttg ccggcgccgt acgcgttggt
    60421 gcgcacggtc atgtcgatga gcaggttacc cagcaccacc gcgtcgcgga ccagggactc
    60481 cagggccttg aagctgaagc ggcaaccgag accgaggacc acgtcgacgg agctctcgac
    60541 tgccgcgccc tccaggacgc agttctccag gttgatgcac agctcgtgga tgggggtaca
    60601 gccgacgaag ccgccggaga cgacggagac gccgggtccg cacacggcgg ggcgcccgat
    60661 gttctcgggg atcatactct tgacgttgtg agggaagacc acggccgtgt tgccccgcgc
    60721 cacgcacgcg tcgagctgac agacggccca ccagggcgag acggtgatgg cgctgcgccc
    60781 gtcacgctcc atcttctcgt agacgttacg gaaggacttg aggtcgaggc cgcacagggc
    60841 cgcggcctcc cgcctcgcga acatgagcca catcttgtcg ccggagctgt ctaggtagcg
    60901 atcccagaag atcctcggcg tgttgaccgc gaaggccatc aggccctcgt attcccgccc
    60961 gacgtcgagg atgaaagaga agatcttgag agcgtcgacg gaccagatgt cgaagtagat
    61021 cctcaagacg gtcttgaatc gcgcgtacgg ccgcagcgcc ttgcactgct gtccgaggat
    61081 gtgcagagag gccacgatgt cgcctccgag gtccgccgcg ctgacggaca ccgagaggcc
    61141 gttggtcacc atgtcgcaga tgtcgtgcag ggtgccgttg atcgtgctct cggccgagta
    61201 gaactgagcg cggtaagaaa cggcgtcgaa gatcgggttg gaaccgccga acccggcgta
    61261 ggccaggacc cgcggcgagg ggatgatggc gaaggagcag agggcggaga ggaaggcgtc
    61321 gaaggcctgc gcggcgtcga cgggcttgga gctgaggatc ttgtacgaga cgcccccgtc
    61381 gacctcgcac tcgacggcga gagccgcggc gacccgggcg aagacggaga tgggggtctc
    61441 ctcgcgtccc tggaagctgt ttccgcagcg atccatcatg acgacggtcg agtagaggcc
    61501 cctacccagg gccggcccga cccgctccgt gatgcgctgc gccatggcgt ccaccaccat
    61561 gccgtaggtc ttgaagaacg cggcgacagc atcccgcagg cgatcgcagt cgcggtagaa
    61621 ggccgagagg gggacggcgt tcctcttgga cgccgtctcg acgtaacatt cggcgagatc
    61681 caggtcgcac gacgggtcgg tctggatgag acggttggcg ctggagacga tggcggtgta
    61741 gagcgcgagg ggtccgcagc gcgtcacgtc cgcggcgtag cggcggatgc gagccatgcg
    61801 ctccttggcg ggttcggagc acttctcgtt gacgagggcg cagaatcggc tgttgccgag
    61861 gatgccgtgg cagtagcagc gcacggactc gacggcgtcg tcaaacaagg cgtcgcgccg
    61921 ctgtcgcgcc ccgcgcggaa gggcctgctg acgggaatga ccgtcatcgt cggggtcggg
    61981 gggcgcatct cgtccctgac ggggagcccg gcgatgcgca gatcttcgaa ttctccgagg
    62041 acgtcgtcgc tcacgaacga gaaagacgac tgatcttcgt cgtctccccc ggtcgccatc
    62101 gctgctgctg ctggtggtgc cgaagcggca ggtgaggatt cggattcagg ggcgacggca
    62161 gcggcagcgg cggtcgttac gctcgcggga ggcggcatcg tcgccgcgta caggagggga
    62221 tcagctttag cgggcttaag cttcttggct tgaggttgct gttgttgttg gcctgtgctg
    62281 caccggggag cgggaatcgg gataggagtc gacggagtcg cctgagtgcc gacactaacg
    62341 tgactaggac gatggtggcg aggagaagat ccctcgtcac agggcgcagt cgaggctgta
    62401 gaggggctcg ggctgggtcg tcggttttcg acggcggtgg cggcgggggt ggtggcggcg
    62461 ggggtggcgg ccgcggatcc agcaccagag gtggcgttag cgtgattgtt gtcactcttg
    62521 gcgttggaag caccggcgac ggcaggagcg gccgcggcgg tagcgttggt cttcggcatt
    62581 cgggtgggag ggagggaatg ccccccattt cctccgcagc aacctcgctg atttgcacaa
    62641 gtgacagcag cagccagtag gttagcgccg ccgcccccgc cggcggcagc agccgcggca
    62701 gcagcattga cagcagcatt ggcggcggag acggcagcgg cgaccctgtc tgccgccgcg
    62761 ttggtcgcgg tcttggggta gctcctgcgg cgtcggtcag tgtaggaggg actccagcaa
    62821 gaggcgatgc tcatagcatt atggtttccg atctgtattc cagagactcc attcatgatc
    62881 ctgacgtagg gcacgctgtg ccccccaccc accccgaagg ctcccccggc agcggtggtg
    62941 gcggtctgct ggcctccctg cccgtcgtca ggcatgggga catccaaaaa gaagaatccg
    63001 ttgtccgggt cggagtagac tttgggctgg cgatccatgt cacgcgaact cgacgagggg
    63061 cccgacgtcg acgtagaact tctctagctt aaccacggag agctgtccgg cgcgcgaggc
    63121 gacgatcccg gacctgctgt cgcgcgagca gaaccagccc agtcgctgta gcgtgccgag
    63181 acagccggtg gacggcccgt agcccgaaat actgttattt aagaagtgaa atctggagac
    63241 cctgaaccta tagcgcagga cgttgatcaa cgtatgcctg tgtgtgatcc tggagaccac
    63301 cacaaaggcg gacggtcgac cctgccgatc gctattatag tcatacgtga tgacgaaata
    63361 aacgaatctg atctcatcgg tgctttcccc atcgaggtcg aggtagatct ccttgggaac
    63421 gagcagggga tagatctcgg tcttgagcat attgtacgag tgtccgcgca tcgagcaggt
    63481 gatcaggcac gtcgctccgg gcgtgatcga gttggtgcat ccgagcgggt ggacgacccg
    63541 gtgcagccgc caggcgccgt cgcgcagcca ggtgcggatg gcctcgccct cgcggccgta
    63601 gatcgccgcg agcgtgttct tggtggcggc ggagacgttc tcggccacca tcgagaggaa
    63661 gaagaggctg acgagcacgg tgctgggcat ctcgatcccc gtgtcgagcc tgaacatcag
    63721 gacccccagg ttcttctgct cgacctcgcc gagactctcc cgcacgaaga agcgggccgt
    63781 gatcgcctgg tggtcggcgc cgtagacata gcccttggct atcgacctct caagtttcct
    63841 catcttagac accttgtagg ggtcctcggg gtcgaactcc atcacctccc gcttcatcgg
    63901 gccgaagctg ctgacgttcg ccatggccgc gttcgcgaag gaccaccacc cgcacgtcac
    63961 ccgagccctc aacctggaac agacgctgga agatctgcgg atgaaaacgg cgtgtgacga
    64021 ggatctactt aatattctgg ccaagataga aatctccgcc gtgcaactgc agacggtgac
    64081 ggcctcccgc gtccgtcgtt tcctgcagca cgtccccgag acgggctacc acttcgagtt
    64141 catccgcaga cacccggtgt tctactttct gaaccacggc accttcgggc cggcgcagaa
    64201 agggcttctc ctcccgctgg ccgccgacct ggtctcggag ttacgcaagt ataccgagaa
    64261 gtcgcaggcg gcgggcggag gcagtgtcgg cggcgaggac aagacctcga aactctccaa
    64321 cgagcgggtg ctacagacgc tgtccgagtt cctggaaggc gcggcgcgcg tctcggacat
    64381 ccaacagggt ctgctggact cggaccagtg tctaatagac gaagaaaccg accgtcctca
    64441 gggccgcggc cggagggaat tcaccgacgc cgacctaaag acggtcgaga agctggtcgc
    64501 ggccacgcag acgctgagga actgtcgcgc cgtggccgag ctgctggagg agctgcacca
    64561 cacgctcttc gaattctttc gtctctcgct caccacgcag cagctgcggc gcgacggcga
    64621 cacacagctg gacgcggtca tcaagatcat ccactgccac gataaccacg cggcgacgcc
    64681 cgccctagag acggacttcc agaaggccat cgaccgcgcg tccgccgtgc tggccgagat
    64741 ctgcaccacc gacatccacc agatccagca gctcggctcg gagtacacgc gagacgcaag
    64801 cttcaagatc tcctcgcgct cgctgtcggc caaggagcgc tccgacctgc gtttccccat
    64861 cctgacccca tccgtgagcg tgctgcgcca catctcgccc gccaacgtgc tcttctaccc
    64921 cggcgtggtg ttcgccatcc tgcggaccgc ggcgcgcgtc ggagaagagc ggcgccagtc
    64981 gccgggcggg acgccgcctc agagacgacg gcgcctactg acccaccgcc tgtcctcttt
    65041 tttcgacgcg caagagaaag agagcagaaa gatagcagag aacgacgaaa aggaggatga
    65101 agaggaggaa gaagacgacg acgaggagga gggcggcgag gggggatcgc gacagataca
    65161 cgcgttcaac gacttctgtg tgaccatcgc ggacatttta ttcacccaga cccaggaatc
    65221 gtcccgctcg cggctcgtca gcgtcaaaga cgtgatcgag aagacgcggg cgttctaccg
    65281 cctcgggttg accccgaaga gcacggcgac ctacatccgc atgatctccc tgcacgccac
    65341 gtaccgcacg gccgcggcgt ccagaagcat cgacgagttc agcgaggcgg cggaccacat
    65401 cacctttctg gtgtacaacg cgcacctgca ctttctctgt ctgtccagat acagcaacac
    65461 gttcctgttt taccacgcga agcggctgat cctggaacaa cagcgctccc tgttgacggg
    65521 caaccggtcc ctgcaggacg tgtgggccaa cgtggcgttc aacatcaacc ggctgttcgc
    65581 gctgcgctac gacgaagaag agttcacgca gctgacgctg ggcgcgtcgc cggcgggtcg
    65641 cgagtacctg taccgcgacg cggcgaacaa gtgggacgac atcgcgttca cgctggacca
    65701 ggaggacctg acggacccgc tgccgctgcc gccgcaggaa gatccgacgc ccgaggacat
    65761 cgcgcgggcg tgcgagctgg tggacgcgca ggacgcacac tcgtacaact cgctgctgcc
    65821 gctgagcacc taccccgact tcgacaagac gctgacggag aagatcatca tcccgcggat
    65881 cgaggcgatc gtgaacgcga tgccggcgga gatccgcgcg cacgacgaca tgcggctgct
    65941 gaagctgatc cacatctgcc gcctgctgat gccgcggcgc ctggaactgt accgcaacct
    66001 ggtgtcgctg tacaacctgc tgcactacgt gagccagacg gacctcgggc tggtgaaggt
    66061 gctgtacggc gtgatccgca acgtggtcct gcacctcggc gacatcaccg gggactcgta
    66121 ctcgttcaac tcggagctgc tcgaggacct ggcgatcgag tcgttcctgc acgcgctggg
    66181 gggcgacatc accgaggcgc tggcgcgctg ggccgcggac cggcgccagc tggccgagcg
    66241 gttcgcggaa cactgcgcga cgtgctactc gctgacgaag agcgtggcgt cgctgtacac
    66301 gaacacgcac tcggtggtgc tgacgggcaa gaacgagatc gtgacgatgg tggccctgcc
    66361 cgagttcacg gacacgctgc ggaagatcgc ggcggacaac gcggagctgg aggagcggct
    66421 gcgtttcctg agcaacaccg gcgcgctgat cgtcgagcgg ctgcgctcgc tgaccgagga
    66481 gacgcgcagc atcccgacct tcaccgacct gactttctcg acgcggtcga tcacgaagct
    66541 gtacgcgcgg ctgtcggaga cgctgcagac gaaccaggcg acgctggaat cgctgtgcgt
    66601 ggagcgcctg cgcttcaacc gcgcggcgtg cgagtcgttc tcgtcgctgg cgagcgcctg
    66661 ccgcacgatg gacgcggaca ggatccggag ccgcgggctg cggcgctgcg tggcggacgc
    66721 gctgacgctg atggagagcc accgggcccc ccacagcccc cccaagagac aggagctcga
    66781 ccgggaatcg ataggcgtat taaagaagct cttcgatccg taccggaatc gcgaggaggc
    66841 gccggcgccg ccgctgcgcc gacgaaacat gagcggacgt ccgagggacg cgtccgttga
    66901 tttccggtac gaggcggaga ggtacgtgcc ggtgaaatcg ccgaacgacc tgcgcgagtg
    66961 gtacgtggag acgaaggaga aggtacaaca agacctgacg aacccgctac gcctggccag
    67021 aaacgtacag aaggcgacag catgaagatc gtccgcgcaa gccgtgacca gtcggcgccc
    67081 gtgtacgggc cccgcgcggg cagccagtgc atgtcgaact gctttacctt cctacacacc
    67141 tgttacctga tgggcatcga tccggtgctg gacacgacgt cgctggacgc cgtgctggac
    67201 agcggcgcgc gcctggacgc gatcgcggac gagaaggtga agaggcaggc gctgacggac
    67261 cacccgtacc gtctggggac ggagatcccc acggtgatcg agacgcccgc gggtatcacg
    67321 gggcacgcgt tatcgcggcc gttcaacggc acggcggaga cgcaggacct ggggggctac
    67381 aagtgcctgg gcatcctgga cttcctgacg tacgcgagag ggaagccgct gccggtgtac
    67441 atcatcgtga cggtcggcgt gcacacgaga ggggtgatcg tggcgcgggg ggcgacctac
    67501 gtgttcgacc cgcacacgac ggacctgtcg gccgaggcgg cggtgtacgt gtgcgacgac
    67561 ttcaccgagg cgatctcggc gctgtcgttc ttcggggcca tgatcggaga cttctactac
    67621 gacgcggtcc tggtgtactt cacgcgctgc cgcacgacgc tgatctcgcc gtcggagctg
    67681 ctggtgcaga tcatggacca gtacaaggac ccggacatcg acgcgtcggt gatgtcgggg
    67741 agcggcggcg gcggcggcgg gccctccatc tcttcttccg ccgcctctgc ctctgcttct
    67801 gtttctcctt tgccgagcgg cgccgcgtcc gacggcgtga cgaacggcgc gggcgcccag
    67861 acttcgtcca agtcgggcaa gaagagacgg gcgccggacg tgccgccgca gcagaagggc
    67921 acggcgaaga cgctgcgccg cagccggcgg ccgatcaggt tgcccgagcg tctgtccgag
    67981 gtgatcgtgg aagacgtgca gacgatcgag catttccgca ccgccacgca gtcgctgccg
    68041 gtgaaacccc cgcaggaatg gaccatgtac tgcggggagg agccgttcta ccggcagtac
    68101 ttcgtggacg tgggccgcca gctgctggcg cacgcgatcg atacttacgt gagtctggac
    68161 aagacgacgg acgagtcggc ggtgcagcgg ttcgagagcc tgatgggtct gtcggacgag
    68221 ctggacgcgg tgatcgcggc ggcgcgcgcg acggagctgt cggccccgcc gctgtacaag
    68281 acttacctgt ctcagcgggt gagcgcgtcg gcggtgacga ggacggaccg gctgctggcg
    68341 tcgaagatcc tggcgctgtt cgaggagggc tcggcgacgg acttcgagac ggtgtcgtcg
    68401 tggctgcggg agctgctgca gcagctgccc gtggagaaca cgacgacgac cgaggcgaag
    68461 atcgccgcgt tcgtggcgca gcaccccatc cccggggagc gcgcgttcgt gtgcctgcgc
    68521 aactcgcagg tgaagagcct gggcgagctg ctgtcggtga agagggagac cctgaaggtg
    68581 aaatacatgg agaacgacgc gacttaccgc aagatcctgg acgcgatctc gaagctgggc
    68641 ctggcgagca acgcggcggc ggcgatccag agcgccgaca cgtcgcacct ggacagcgag
    68701 cagctggcgt cgctggcaca ggcggccgag gcgtacgcgc agtcggcgta cgagtcgtgc
    68761 caggcgaaga tgacggagct gctgtcgacg aaccacaacc gcatcctgac ggggtcgctg
    68821 ccggactcgg acatcgcggc ggtgctggcg gccttcaagg ccgtgtcgga gaacgtgcgg
    68881 gcgctgcgcg aggtcgagct gctgaagtcg caggtgcacg tgcaactcgc tcagctgacc
    68941 gaggacctgc tgtacctgca gacggccgag gtgaagctgg aggtgacgcc gagcgcggag
    69001 atcaagaagt tgcgcgcgga gtacgagacg gcgcgcaagc agatctcgga cgaggagatg
    69061 cggatcaagg aactgatcga gaacatggag gacatgatca cggatagcag cagcagcccg
    69121 ccgccgccgg agatgctgga tatgttacgc acgcagatcg aggaggtgga gagcatgacg
    69181 gtggacgagc aggacgcgcg gcgcgccgac aaggtgctgg ggaagctgtc gacgctggac
    69241 gaggcggagg cgaaggcgac ggagttcgca cagtcgctgt cgacggtgaa catcccgtcg
    69301 ctgaacgaga tcaagggcgt gaagatgctg aagagcgtgc tggagacgaa cgcggatctg
    69361 aggcgcgcgt acgtgcaggc ggtgacgggc atgctggaga acgcgctgaa gcagctggcg
    69421 gagggcaacc tgccctcgga cgacatgatg tcgaggatca cggcgctggc ggaacagctg
    69481 ccgacggggc gccaggtgcg cgccgacctg ctggactcga cggacatcgt gtcgcagatg
    69541 tcgcgccggc tgcggtacgc ggccaaccag aagaactcga cgcagtcgct ggaggacgtg
    69601 ttgaacttct tctccgagaa cgacgacatg atcaggaagc tgctgaagac gagctggggt
    69661 aagcccgtgg cgacggtgta ccgccgggtg caggtggaat acgaccgcaa gatggaggag
    69721 ctgcgcgaat ccgagtggct gaagcgcgtg aaggagacgg acatcgactc cccgcagacg
    69781 ctggagaggc tgctgaagac ggcgccgaac gaaacgatcc tggcgaagca cgcgccggac
    69841 atgcacgcgc gactgaagaa gaggatgcag agcgaggcgg agaagaggac ggcggacatg
    69901 aagcgactgt acgaggagat gcgcaagaag gtggacaccg acctgaaggt ggtgtcggac
    69961 tcgttctcct cgcagacgcc gtcggtgttc tcctcgatcg acctgaaaag ctgcggcacc
    70021 tcgctcgtga ggctgaccaa ggaggacagg aaagccgcga tcgcgacctt caacgccaac
    70081 ctgaccaaat ccctgaactc cctgctggcg tcgctcgtca cggtggagac ggccacgatc
    70141 gccgcgatcc tcaaaggcgc ggaccccgag gcgacgagca gcaccggcag cggcggcggc
    70201 ggcgccgatc gacagaaaca cacgagcacg ctagagaaca acatctcgac gttgctgggc
    70261 tggcagcaga aggtgctgct gccggagacg gaacgagacc tgctgacgat cgcgcacctc
    70321 ctgaccgccc tgacgcacat gcgaaagaac tggcgcaacc ccgcggcggc cttcagcagc
    70381 accccccaca cggccgcgta caggaacttc gccgaactgg cgaacgagat cgagagccgc
    70441 aggacggaga cgctggcgcg atacaagagc aagtacgcgg agctgaacgc gagcatccac
    70501 gacaacacga aagcgaacga cgtgacgatc aaacccgagg acaccttcac ggcggcgttc
    70561 agggacaccg tgaaggcgat ggcggcgccc ttctcgacgg agctgcaggc gcgcctgcag
    70621 gcgcgagaga acgagctcaa ggacgagctg tcggacctga acgtgaagct caagacgaag
    70681 ctggagcgct acctggctaa gcgcagctct caggacgcta ggtggcgcga tctgatcacc
    70741 cagcaccgca tcaggctgcc cgagggcctg gacgtggaca ccaaccgcct gcgcacggac
    70801 acggtggtga cgctgaacgg catcatccgc tcggcggcca ccaccctgcc ctacatcacg
    70861 gccaagaggg gcctggagtg gacgacggaa ttcatcctgg cggcgatcga agagaagaaa
    70921 gacgcggacc ccgggatgtt cgcccagctg gcgaccctgc tggacaactc gcaggcgatc
    70981 gccaggaaga tcgaggagaa gatcgtgtac aacacgaagg tggaggcgga gatgttggag
    71041 acggcgccgg agcacacgag ggaatcgctg tcgaacctgc agctgatgct gggtcagctg
    71101 gaggccaaga gagtggtcgg cggggaggca cgatacaaga tcctgagcga cgcgatcctg
    71161 accaaacaga acaaactggc cttcgccgaa gatctggaga agctgtcggc gcggtacttc
    71221 gaactggcgc gcgacatccg cagctcgaag tacgggctgg attttgacgc gcagctgctg
    71281 aagacgagcc tcctgaagtc ggagatcggg cagcacaaga aagatccccc ctcgacgggg
    71341 gaggaggtgg gcttacctga agagagcacg acggcggcca agatctcgat ctcctcgctc
    71401 ctgttgggca tcgcggcgct ggagaagtac atcgtggcgc accgcaccct gctggataac
    71461 ttcgtgtcct cgcagccgtt gatcagtcag gcggaaaaca tcccggctct ggtgggtggc
    71521 cccggcgagg acgataagcc agggcaggag ccgttcgact ggacccgtat cgacctgtcc
    71581 agactgtcag catgcgacgt cagtaccgcc ttatatcgcg ggacggacgt gttcggggag
    71641 aggcgcgtga tgacggcacg gggcatccag ctgtacctgt acgcgacgca cgggaacttc
    71701 gtgttcgagg cgttctcaca cgtccgcggg acgaagggcc tcctcagcag cagcagcggc
    71761 ggcggcaacg ggagcggcgc gtcctctcga cagaaagacc agcagaatgc gacggtgacg
    71821 cggcgctacc ggtcggtgac cgtgttggcg tcgatcgccg ccactctgca gacgttctgg
    71881 tcggagatct cgaggtacga catacgcgag ctgctggtgg agagcggcag ggatccggaa
    71941 agcgcggccg accagcgcga cagacggctg aacacggtga tgaacctgaa actgttcgtg
    72001 tatgtgatga cggtggcctg gtcggaggcg acgccgccgg tggagccggg cagcccggag
    72061 gcgacgcatg ccctggaggt gagcctgctg gacttctcga cgctgatggc ggcgctgcac
    72121 ccggagtacg tgtacgccat cacgacccag ccggtggacg ccaccctgcg cggcctgatc
    72181 gccagactgg acaggaggac ggtggacgcg gcgatgaaca cgcaggagaa cccaccgccc
    72241 tacgatatgc gcgaattgaa agcgttctgc ttggatacga agcagtggac gcaggaggac
    72301 atccgcccgc agatgtggat gtcggacctg gtgaagcaga tctgcacgtc gcacccgagg
    72361 aaccgcgacg cgagcacttc gaccaagctg tttctataca tgttagccac aaaagtgctg
    72421 cccagggaca tccttcggtg tctctgggtg cagttcaggc cggcctacgc ctcctcgata
    72481 gcgtccttag aagagctggt gagcgctctc tgcgactcct tcttcaggat ctacggtacg
    72541 acgagcgaga cggtgtcggc gcggctgaag accggggaga aggtggaacg gcaggtggtg
    72601 ctgcgacaca agccgacgat gtcgctgctg gacgagttct cgcagcaaga agcggtgctg
    72661 gactacatcc tggggtcgta cgtgttcgcg atcccgatga cggtgggcat ccatgtcacg
    72721 aacatcgtaa acggccgata ccggctgatc gtgcggcacc tggagaacct gccgagcgac
    72781 ccggacttcg tcaaggtggt gcgttcgcgc gacctgagct tcgaccgctt cggatggtca
    72841 tacaccgtcc aaaaccccgt cgaacgctcc tggttctcgc tgcaagagga tcggttgcgc
    72901 cacctgctga ctaacccccc acaacaggac agaacgccgt tggtggtgta cgactccaac
    72961 accaactacg cggtgaacgc gatgatgccc ccgctgaagg cgcccccggc ggcgagtcgg
    73021 gtccacctaa cggtcaagaa cccgttctcg acgatgcgga tgatccccca cgaggacgag
    73081 ggcgacgatg ccgccacgag cgagacgccc ttcacctcgt tgccgatcaa catcgacttt
    73141 ctgcgtcgag accctccccg actgaagaga gcgtcgggag actcttcctc gtcggtgccg
    73201 gcggaggatc gggaccccga cgcgcgaccc caggattcgg tccccgacca gtccctcagc
    73261 gaacccctgt tctcgcagac caaggtgtcc agcatcgtgc cgaaggacgc ggtgacgacc
    73321 ctgtctaacg aatctatctc gcagacgttc cagatccacc cgttccgagc cctgtctagc
    73381 gcgatcatgg cggcgatcga gatcctgcaa gagacccgac tgcagctgga cactttcgag
    73441 agcgacatgt gcgaggccat caggaggatc aagatcctct acctgcactg acacacaaac
    73501 aaaaaaccca caccacacac agaggtttat ttttttatga ataaaagttt tatttttctg
    73561 tatgtgtgtc ttattgtatg acggtggctt ttttagcgat cgagagcatc cgcagaaggt
    73621 ccagctggta ggcgagtttg tcctcgtgtc ctcccatctt catatatttc ggaatcatgg
    73681 tcgagatgac gggttgtgca accatcgcag gcgccaggtt gagtacgttg gcgccgaatt
    73741 gcttcctcct ttcctcttct ttcttgctgc tgccgccgct tcctcctcct ccgccgccgc
    73801 tgctggcgcc actgctgccg ccgctactcc cgcctcccga ggccgcgcta ctaacgttgg
    73861 tcgacatgag taaagtagag agagctagct agctcgctag ttagtgagtt ttgtcagttc
    73921 agtttagttc agtgataata gtgttgatcg gaccggcagc gccggtgttg ttgttgttat
    73981 agttcctacg cctgatctcc agacaggaac agcgagagtg gatctggcag ccgagacagg
    74041 cgtcggcgag gtcgaggtcg tcgcggtcca ggcaggtctc cctgtagacg ttctgacagg
    74101 actggcagaa gaactcgccg gagtgcgaga cgaggcggag gagcttctcg acggatgact
    74161 cgcgcagcac gacggtgccg aaacaggtcc tagaggagca gggcacgagg acgtcgaggc
    74221 gggtgcccgg gccgagaacc ccgcaggcgg cgttcgagcc gatgaccgcc ctccagcgca
    74281 ccgtcgcgaa cctgagcccg tgatggtaat cggcgcgagt gacctcgtag atccgctctc
    74341 ggcttaaata ctggttccca cacagggaac agtgagcggt gtcgttgtgg gtactgtaga
    74401 tgacactctt ctcctggcgg tccctgtaat aaaagataca gttgagcgcg aaagtgtgat
    74461 tgccctccaa cttgtccttg cccatgttga gacagtgtcc gcagttgtca cagaggatgg
    74521 cctcgagcac gccgtcctcg gcgtagcgct gacacttggt cttgcagaag caccacacgg
    74581 ggaggtcgat gaggctggag atgaggccgt ttctgagcac gaccgaggtg gcgaaggtgg
    74641 agagcttgga gaggggccag ggacagttgg tgccgtcggt ggcggtggcg gccgagttcc
    74701 cggaaccgcc gccaccgcta cccgggtctg aggtccggac cgcggcgcgt ccgccgtagc
    74761 gcagggtccg attgccgatg gggatgagga agcgcgggcg cctgcgacag tagcgttcga
    74821 cgaaaacttt agccatgacg tagaaggggt ttccgcaggg agtctcgcgg cagcgctcgc
    74881 gcaagatgct gacgagcgtg gagacgcccg ggtcgggacc gaggcggcgc aggttgaggc
    74941 ggcggtggta gacgggcagg tcgcagccga cctcgtactc gcgggcgcgg aggaaggcga
    75001 cgcaggggga gctggcctgg ttgggaatgg ggatgccgaa ggggaagtgg aagacgaact
    75061 ggtgcaggtc ggtgaggccc tggtagctgg cgttgtcgac cagggcgtcg accttggagc
    75121 ggctgtacct cttgaagacg tgctcgaggc ggctgctcat gccgctcctg aggtagaggc
    75181 aggagacgtt gcgcgagacg cgctccatgc agcgcacggc gtaaaagtag gcgagcagga
    75241 cgaagacgtg tcgcgtcatg acctctttct gcgagatctc gcggacgatg gacttgacga
    75301 gggccgagca ggaggaccag cgttcgagga agcgacagta gagctcgtcg acgacgtcct
    75361 tgcagagaaa gcgcttgccg ttcatgaaca tgttgaggac gcagtagacg cggcgtccgt
    75421 cgcgttcgtc ctcgacggtg cccgagagga gcagctggag gtgatacttg tcgcggtgct
    75481 ggcagacgcc cccgaagagc tcacggatga cccgccgaac gggccgcatg ccagtagagg
    75541 agccagagca ggacgagggc gatggcggcg gcgaggatca gggcgcagtg aatagcgttg
    75601 gcgtgcctgg tcaaaaagga aatagttctt tcggagtacg tggtctcggc ggccgtgacg
    75661 ttcgtgtcgc cggcgggggg aggccgctgg gtctggtcct gatcccgcga gggagccgcc
    75721 ggggaggagg tggaagtgga ggtcggcgag gcggccgcgg gctgattctt ggccgcgccc
    75781 ccacctcctg cgtatcttcg cgtgagaacc gggccgtgtt tgcgcaggct gccccagcgc
    75841 tgacccgggg gaggcggagg cggcggtcgg cgagggggag cggcggcgag gcacctggca
    75901 cgacgacaga tgagggaccc gcagtcggtg ggaacggaag tcatcctccg cgcgtagatg
    75961 tcgcgcagga gggcctggta ctcggcctcg ttatcgggtc cgaaggcgac gacctcgatg
    76021 ttgtaggaca tgccgctgtt ggacttcctg acgacgcagt tggtgagcac ccccttgtcg
    76081 cagggcttga tcctctcgat gtcggccaac gtgaccacga gggcttcgtt gacgctcagg
    76141 aagttaaaat cgcagaccct cttgaggtcc ttgaggcgct cgggaaagcc tatatagcag
    76201 gagagggaga cccgacagcc ggtgtttttg aacacgaagc aagcggtcct gccgctccta
    76261 cactcccaat agctgaggag atactcgacc ggatagacga tatcggtggt caacatcgcg
    76321 tcgcagagcg aatagttggg gtttttgcat attaaagcgg tgtcggtgat cctgagctcg
    76381 ttctcgtcga gccggaggat ccgccgcgtg ttggaaatca ggtcggcgcc cacattcttg
    76441 tcgatctcca tcgcgccggc gccgccgcgg atgagctcgc cgccgtccga gtggcgccgc
    76501 ccgagccgac ccgatcagtc ggtcgtttcc ctgcgttcta atattccatt cacgtctaat
    76561 aatttagtga tcacggccgt aaagagcttc atcttctcgt tgaggacggc ggcgtgttcg
    76621 cacctgtcgc accccccgta cacatgccgc agaaaagcgg cgtgacgtct gccgacgttg
    76681 ataaaattta acctcgagtc gatagacggc aacgtcagtt cgtagaccct aggcagcatc
    76741 ggctcgaaac ggatcgcgtc ggcgccgccg tccccgaaga agcgttcgaa gagcgcgtcg
    76801 aggttgcact cctcggcggg gacgggcgcg gcgccggcgg cctcgtcatc gtccggcgca
    76861 tcgccgccgc gacggcgaac gctatcaccg ttcatcgccg tcgcggcgct cgcgatgtac
    76921 agggcctggg atccctcgct gacgacgatc gactcgttcc tcgtcaacga gctgttgctg
    76981 cacgcgcacc cgaccaaaac ccctccagaa gtgacggagg gccagacgcc gtcctcctcc
    77041 tcatcctcgt cgaccgactc cgggcgggag acgatgctgg aggaggagga ggcggcgtgc
    77101 tgcgacctcg actcggagct ggcgcggatc ggcgacgaga acacggccga gatccgcgag
    77161 ctgtgcctgc cgctggagat cgactcgcgc tgcaacctgt gcgcgatcgt cagcatctgc
    77221 ctgcggcgcg acccgcagca gaaatggctg ctggactact gcttcctgtg ccacaagtgc
    77281 gcggcggcgc cccgcacggc gatggccacg ctgatcgtgg ccaccgagtt cctgcacctg
    77341 atgaagctgc actttcgcga catcgccttc gacaacatct tcaaggagcg gatcgtgacc
    77401 atcttcgact tccacgcgca cttcttcatc aaccggtgct acacgcagcg cgacgagcac
    77461 ccggtgatgg tggagaacat cacgctggcg cacatggcgg tgacccgggc gctgctgacg
    77521 gacgacgacg cggtgccgta caccaagcgg cgcaagatcc agtacaagct gccgaagaag
    77581 ccggcgccgg cggagcccga ggagctgcgg ctgctggaca agtaccggcg cgcgaccgag
    77641 ggctcgttcg cgcgggtgct cttctacatc tggtcgggca cgaacgtgat gttcaacacg
    77701 acgctgacgg acctggcgat caagaagagc aaggcgctga aggcgctcaa gacgcggcag
    77761 tcggagatcg agccgagcgt gggccccgtg ttcctgtcgc cgatcccgac gttccgcctg
    77821 cgcaacgcca cgaccacggt gtgcctgctg tgcgagctga tggcgtgctc gtaccgcgac
    77881 aacgtgttcc tgcagcagct gcgggagcgc atcaccaact actcgcgcaa caacctgaag
    77941 atcatcgacc ggacgcagct gaccatggcg gagatcctgt cgcacggacg caactcggag
    78001 ttcccgcagc agctcaagaa caaggacgtg tcgatctacg tgacgtcgag ccccgagacg
    78061 ctggccgcgg cgagccgccc cgggacggag gagccgttcg agctgagcgc gctgacctac
    78121 ctggtcctgc gtcaggtcgg cgtgatcggg gtgtacaaac acctgttcgc ggacccgctg
    78181 tgcgcggcta acatgcgatc gacggatccg aacatcctct ttttcgacgt gcccaacgag
    78241 tatttaaacg aagcgaagct ggccatctgc tcgacgaacg cgtacccgtc gcgcgtcgag
    78301 cgcgatttct ggctgtacgc gcacatgttc aaagcgtttc agatcatcaa acgtaacttc
    78361 aagacgaaga cgcaactcag cgactttctg cgggacttct cgcaggtgct ggaatcgcac
    78421 gatttcagcc tcgtggaccc cagcttcacc gtcgagaagt atgtttagga gcccggaggg
    78481 agaggaacgg gacgccgccg accgagaaga ggaggaagga ggagaggctc gacgacggtc
    78541 gaggatgatg atgtctccgc gccgcgtcaa gcgcgcccga caccgcccgg ccggcagcgg
    78601 cctcagaaca ccgctgagga gcccgtccgc gtgccgctgc tcctctccct ctccggagcg
    78661 acagtggcaa cagcgacggc gggcagaaaa gaggtcgacc accccgaccg acccgcctcc
    78721 gccacccaag agatcggccg ccagcgcagc ggccggcgcc gcggcgcccg agagcgagta
    78781 tctgaacgtg aagctctctg agcttcacga cgtgtttcag agacatcccg acctcgaaca
    78841 gaagtacctc aagatcatga agctaccgat cacgggcaag gagtcgatcc gactcccgtt
    78901 cgacttcaag tcgcaccggc agcacacgtg cctggacctc tccccctacg ggaacgacca
    78961 ggtgtcgcgg agcgcgtgca ccacctgcaa ggagacgacg agactgccga cggcgtcgga
    79021 cagcatggtg gcgttcatca accagacgtc taacgtgatg aagcaccgca agttctactt
    79081 cgggttccgt aagaacatgg aactgctgaa gatggccgct aaccagccgc agctgttcca
    79141 gatctactac atcgtgcagt cgtgcgtgca agagatcgtg ccgctgatct actacgaccg
    79201 agagatggcg cacatgcaac tgattttcga gaaggagacg gtgcacatcc cgtcccagtg
    79261 catcgagcag atcctaacgg tggcgaagga cgcgtacggg gtgagcctgg acatcgcgca
    79321 ccagcggatc acgctgacgg cgcgatgtct gcggctagag tcgagctccc tgcgcatcga
    79381 cgtgctgatg ctgcagagga aggtggacga gctcgagatc cccaacgaga cgaacgagaa
    79441 gttcgagagt tactcgttgt gacgaggcac acagtgtgag actgtcgttc aacgttgtat
    79501 tttattgata attattattt ataaaagcgt tacaaaaaca aaagaacaaa agagtacgag
    79561 ttctttttaa ttaccgcgac attgttgtcg gtcacacaat aggggagaat aataggatca
    79621 aagggaatcg ggttacaata tttattattg ttatcggtcg tacacgatat caatcgagat
    79681 aagggagggc gcccccggga tcacgtctcc atcgcctcgt gcgaggacga ccgctccgtg
    79741 tccatgtttt ctttctcact atcccccccg tcgctgtcgt cccctcccct cgcgagttcg
    79801 ttcacgtttc cacagaggtg taggaactgg tcggggatgt agatcctctg gggcaccacg
    79861 agggagaaga acttctccct cttgggcatg tcccggggga agacgggcat gagcgtgttg
    79921 gtgacggcct tgacgacctg ctcgtagtac ttttcggcgt tgatactgag tttggcctcg
    79981 acgacgtgtc gcggatcctc ggcgatctcg tagttgggaa cgttcttttt gcagccgtcg
    80041 ggcagggtga ggacgtactc gacacggtcg ccgaccgcgg gcagttcctc cttccgagcc
    80101 gccagacgtc ggatgacggc caggtgaggc aggtttttct gtttatagca ggagagctct
    80161 tgggagagga cggaggagag ggtgagttcg ggcacgggca ccttcttcag gtgcaggtcg
    80221 tccctggcgc ggcagaggcg gctgacgacg ggcccgaact cacatgggat accgttcttc
    80281 ttgaggtcgt cgaaagtcat ccgggaaagc ttcatagtcc cctccgaaac ggtctcgtcg
    80341 ttgaaaacca tatggaggac gtcgctcacc accgccttga cgaaaccgca tgcggtgcgg
    80401 cgaacgagat cgacgccttt catactgagg ttctgggaac cgtggacctt gccgatatac
    80461 ctcttcttgc atatcatcat aagggaaacg aacatcttct cgaactcgag gcgaacgggc
    80521 tctttgaaaa gggcgttcgt aacgttcgcg gcgagggctc caacggcctt caaaagggct
    80581 tccttgtcga tgccgtagaa agccgcaaac acactgtcgg tgtcgccgta gatgatcttg
    80641 acccggaggg cttcggggtc gatagcctcg ggggggagtc cgaggacggt acggagaaaa
    80701 tcggggcggt tgcaccggtc ctcgatatgg ccggcggtcg cgagcaacat atccctgccg
    80761 atcttggtga tagaagcggc gatggggaga cacgggagca tcccggccgc tacccccgtg
    80821 aaaccgtaga aagcgttgca cgttactttg agggccagct gctgcttgtc catgatcatc
    80881 cgttgcatct cgttggtgca ctgcttcatc gcctcccgga ccagcttgcg ttgggttagc
    80941 catcgtacca gcagctcggc cagcagagag cgatgtacgt tctcccgcac aaaccggtga
    81001 cactgatcac cgatttctac cctcaggacg tccttttcag gcacctcggg ggagccctcc
    81061 accaagaggg tggagtagca cagattgttg gacatgatga tggacggata cagactggcg
    81121 aaatcgaaca cgcagacggg aacgtggtgg aacccgcact ccggttcgag caccgtagct
    81181 ccctggtacc ccaccgtccg cgagttgttc gagttctcgc cctccgaggt ttcgtccccc
    81241 tcgccccccg ccgccgcctc ctcgatcgcg gcggccgcct cgtggccgag cgagggcatg
    81301 ttgggcaaga tcatgtcccg acccgaacac tcctcgagca gacaggtgta gatcctgatc
    81361 tgctgtccgt cgaagatgac cttcctgagg gggatcctcg ccaacctggc gatggccgcg
    81421 gcctcgaagt gaaaagcgag catctcgaag agttcgcgca cgagcacggc gtcctgcagg
    81481 cagtacttgc ccacccgggc ccgtccctcg tccccggcgg agaactggac ggggatctct
    81541 ttgtagctca ggtcgtcttt cttcttcttg aggtagatct cggccatggt gtcgagcttg
    81601 tagttgggcg agctggcctt ggcggtacag acggggtaca tgtcgaggac gatgctaccg
    81661 ctccagaaga ccttgaccgt gttggaggtg ccgaagccgg ccttgccctt ctcggggctg
    81721 aagacgaaca ttcggccccc cctccgcagc ttggtgaact ggcccacatc catcttgtag
    81781 agtttctcgg cgcgggtcag gatgtacttg atgtcgaagc cgttgatgtt gtagccggtg
    81841 atgaactcgg gcgagtacca gctcaggaag atgaagaaac cccgcaacat ctcgtactcg
    81901 gaggggaagg tgtagatctt gacgtcgggg atcggggcgc acggcccgat ggtgaagaga
    81961 tggttctcgg gcacggcggg cgtgctgagg tcggcgtgga cgtcgtaggc gtggtgcacc
    82021 atctctccga cgccgaaaca gacgcaggag atctggatga tgatgtcgtc gacgttttcg
    82081 gcggcgggga aggcgcccgt gccgctcata cactcgatat cgaaggacag gcaacggtag
    82141 aacggccagt tgctctgctc ttcgatcggt aggatgtcgg cgacgtcgca gtcgatctcc
    82201 agctgcgccc ggctgacgta tccggcggcg cggacgctgt acctcctggc gaggcaccag
    82261 ccgaagctgg ggatcttcct gtcgatcagg aagcgcgcca aggggtccac tcccaactcg
    82321 tacaccttcc tcccctcctc cagcatccgc ttgccgatct tgcggcacat gttccagttg
    82381 ttgaaggaga gccggtacag gttggggatg tgcccgaggc cgtagccgta gaaggaggat
    82441 ttggtgacgg gagagatgga cacgctgaag ggggagcagg gctcggggac cttatcggcg
    82501 atatcgtaga cggtgttctt gaggtcctcg gactgcatcc tctcgcagta gaagtaggcc
    82561 ttctggccga acacgttgac gcagaccgag accccctcat cggtggcccc gaacatgcgg
    82621 atgacgttcc ccgccggcac cacatggtgc ttccagcggg gcgagatctg ctcgtcagag
    82681 tcggcgagca ccaggttgac gacctggtcg taggtgtgga agcgcagctc gtcggagtag
    82741 ggtccccggc accaacctct ggtgcgcagg gtcggccacg gcttgtcggg gttgagcacg
    82801 tactctttct cggcgtagaa catcctgggt tccatgccgg actgtacctt tattaacccc
    82861 gtcgcaccat catacaacac gccacgcgga acgacttgta aaaagttttt attattatcc
    82921 tcgcagcgtc tccaatcgcg acggggtttc cgtcgcaggt aggggttgaa gaaagtctcc
    82981 acgcaagtgt ccatgtcggc cgtcagtact cgaaatcgga gtcctccgcc ggtaatcgct
    83041 ggtagccact ggtgtcgtta cctttgagac ggtccaagat gcccgtcggc agtctagtcg
    83101 ctttctgctg cgctttctcg gtgcgttggc tgtcgtctag ctgttttaac gcgcggagta
    83161 tcaatagagc atcttgctcg gtgtaggtcc tctccaagcc ctttttatcg ctagtccacg
    83221 ccttacccga atcgtcactg ccgcccgcgt tcacgcgccg atgcagacca ggcgctcccg
    83281 gcggcccgct ctcgagtccc ccgtgcgcgc cgccgggagg agcatactgc acggcggtct
    83341 gggtggcgta ggggaagaag tactcgaccg gcctcgcggc ggccgaccgc tgcctcgtga
    83401 agatgagata cacgacggct agcacgccga tcaccaggag gatggtggtg aaacctccaa
    83461 acgggttcgt caggaagccc gtgacggcgt tcaccaccga agacacggcc ccgccgacgg
    83521 ccccgatggc caccccgatc cccttacccg cgacccctag cccctgcatg aaagtatcca
    83581 accccaagag ataagagggc gtgttgtcgt tgactttggc gctcagggtg cggatgtgct
    83641 gcttctgcga gttgtactcc cgcatgatct cgtccaggct gaacacgttc gaggcgcgca
    83701 gctctccctt cgagtacagc tcgagcacct tgaagtcggt gttctccagg ggctcgatgt
    83761 ccagcccgat cagggtgtcg acgagttgga tgtgttccaa actggtcacg ttcctgaaac
    83821 ggtagtcccg atactcgtag cccacagtcc ccacgacgaa gatcttcctg ctgttcgtgt
    83881 cacagttctc cgtccgaaag gttcccagca taatctcgtt gttttcgccc agctggcccg
    83941 actcgagctt cgtcgagttg atgaactgaa agacgaccag cggtctcgaa taacagttga
    84001 cgaccttccc gtcctggaag atccgcatgt ccttcaggac cttcacacta ctctgatcga
    84061 ccttgacaca ctcggacatc gcgatgacgt cgcccgccag cttggcggtg accggtctct
    84121 cgtagatggc cgacaagatg ttggacggat tgatcttact gagctccttg agcatctccg
    84181 ccgtccgttt ctggtcgcga caccaagcgt ccatgatgtt tcggagcgca tcgttgatgt
    84241 agtccttgag cacgtcgtag gtaaattgca gttgagcata ggtgatatca gtcacgacat
    84301 catctatatg atccaagctg cgtttccgac gagcagcaac agaagcagca gtggtaccat
    84361 tttcagtagc agaagttaca ggagggctaa cagtccctac agaaacgtta tttaaagcgg
    84421 cgaatttttc cagattatgc agtgatttcg ctttcaatcc ctgccacaat acaataagac
    84481 ctcccgttgt tctatacatt tcaagctccc cgtctttcac atgcgtctca ttgtactcat
    84541 cttcaaacac acgattcact tcttctacaa attcatcata aacacatcgg aaggtgttat
    84601 aatttttacc ttcggtagta gtattataat ctattttgtg tttactggcc acaaaagtag
    84661 cagttaaact cttggaaaca aaatgatagc tagtattggt gtcagtacgt atcgcccttg
    84721 aaaccgtctg ccatttcttc cagtcgcacg tgacattctg tttgggaaag atctcccacc
    84781 cgatggtcat gtcctccctc tctagaaaag ccatcagagg tactactttt ttgggtgccg
    84841 cgagttcacc gaagtacgtc ttcatggtgt agttcttacg aatccagaaa ttcctcgtgt
    84901 cctcttcgaa gggctcggag ttttcaccgt cgtaaaacgg tgatatctcg acgacttccc
    84961 cggagctgag cacgaagaat tcgtaggggg tgttggacct agctttcgtg acgacgacga
    85021 cgcagttcat gttacaggat tcggtgtatc tccacgtcca agcgccctta tgatacctac
    85081 tcttggtggt cacgtatcgc ttactgttct tactcctgta atcatcctcc acaagcacca
    85141 tagtatagtt cctatagcta tcctcgtggt aagcgacata cacttctcca ttgagtatcc
    85201 tactcgcggc agagtaacac ctgttgttcc tgttcacctc atccagctcc cagacgggga
    85261 aggccatctt agtcacacta gtccccaaga aataattagt agtcgtgtca gcgtaacttc
    85321 tctgaaagat cgcatctttg tgataagtga tcacctcgaa cgtgtgagcc acgatattct
    85381 gtttgtacac tatcatgatc ccctcttgta cgggcgtctt cggggtatga ttgatacaat
    85441 ctatactttt cccgaaccga acgagatcag tagacacaga catgcacact ctgtaaggat
    85501 atttatctat gtcaacagaa accatgttct ccgtctcgtt cacgaaggga acgatggtgg
    85561 tccccgttat cttcgaggcc tgagtcggcg tggcttcctt ctttccggtc gccgcgcccg
    85621 aagtcgccgt ctctgtttct gcggacgcgg tttctgacga agtgtcagtt tttgctttcg
    85681 gagtagtacc tggtgtactc gccgccgcga ttacctcact tgtacaggca aggaggcacc
    85741 agatcgtcac cgccagcgcc gtcgacatcg cgtaccagct cgaggagcga catcctcttt
    85801 cgtttcttct tgacattctg cgtcgacgag cgttgttcag cgatcggccc gggtctctcg
    85861 acctgacata agtcggcgac cgaggcgcga gaaccggcgt cggcgagagt ctcggagtcg
    85921 accgagagat gcttgtagag cagcaagtac agatccctgg atctgtaact tcgatctccg
    85981 cgacgcagga tcaacggaga ttctggattg tacgttaata ttatcccgtc gccgatctca
    86041 tcgccgtcct cgacgcgcca caaggccaac tgcttgccga acgtctcgtt atatagtgcg
    86101 acggacagga cgagctctcg aatgtgcgcc cagaccatct tctgcaggtc gttgagctcg
    86161 cggatgtcgg cgaacctgaa gaagcccatg tatccgactg tcatccagtc gctgggcacc
    86221 accgtcccgt ccgcgcacct gacgagatcc tctttgacgt gcggcaggat gccggcgtta
    86281 tcgcaggcgt aggccatgtt aacgttatag ggcagggggt gtctgtcgag atagtgggtg
    86341 aacatgggac cgttgatgaa acggtagatc tgctgcccga gctggggcag cagctcggag
    86401 gggagcctct tgtgcacgag attattgatg acatagaggt gttcgtcgta gccgaggctc
    86461 tcggccacgt cggggtaggt ctcggcctca gttatagacc gctgtcggga gagaaaaccg
    86521 ttcataattt tggaaaccgc ctccaaacac accgttccca ccaggttgac attcaccagt
    86581 ttcgtaacca gatgctcctg gtttcgaata caggccataa ccttgttgta gcccatttcg
    86641 gaaacctttt ttaagtatgc cctttttcgg acattcacct ccttgttcac atcgtgcacc
    86701 ctcagcagcg gatctccaca ctccaacgcg gaactcattg ccgttgttgt tcccgcgccc
    86761 tcgtcccccc cagtgttccc tcgccctgcc gccgcccccg ccccctcttc ccctcctgcc
    86821 ccggcccccg acgccgcctc ggcccttgaa gctgccgccc ccgccgcggg tccatctccc
    86881 accccccgga tttcctcgat cagcgacttg atcttggcat agatctcgtt gctctcgtgc
    86941 aagcgattga aaaggggatt gttctcgaag gattttatgc tcatcgaagt gatcatgtcg
    87001 acgacctttc ccggcgccgc gaagatggac cccacgtaga ttcgctcgtc gcccccgaag
    87061 cgcccctcgc ccagagtgaa aacgtcctcg aggtcttccc cgtagtgata gcgactcaat
    87121 tccgtccgca aggttttcca gaggctgtgg gagacgttga gctgcctcat cgtaatcccc
    87181 acgtggcgga cgatcgcctc cgacgttttc gaccagtatg tgtagtccga cagtgagtag
    87241 atccgatccg ggatctcgct gaacaagttg taccccctca acgcctcctc cgcgtcgttg
    87301 atgtacgcat acgacgccgg tgagaacgac gcgagactct ttatcgcccg gatgatacct
    87361 ttcacagagg gcgccctgat cgcaatatcc cccatatcct gctccaccgt ctgggcatcc
    87421 atatccagct gcaccaagac ctttttgata gtgatatggt cgcagagcag gccctgcatc
    87481 cgccggttga tcgagcggcc ttggttcggc accgccatca gctcctcgta gcactgaaaa
    87541 caggtgaccg tctcccgata gatctccgga cccgccaccg ggcagatatc gcacaacctc
    87601 gccagcaggg acaagagccg tcgacagacc gccaccccct ggctcgcgtc caccgcccca
    87661 tacacacagt tgattttgca caggagacgc tccacgtcgt tcagcgtcgc caggtcgatc
    87721 gtcagcgcca gctcgggcgc aaaagttatc gtgatcgact cgtgtcgatt gcacgaatcg
    87781 agtttcagca cccgccggta gtatcgctgc cggtcccgat gcgtcccaaa gtccgtcaaa
    87841 gccatgtcga tctccctcat cgtatcgtac aagccctgca gcagcatctc catgtagagg
    87901 gtcagcaccg aggtctgcac cgcgttctgc gagaccagcg ccggatagag ggtccgatac
    87961 aaatgtatca ccatgacccc gttcctcctg aaggccgtcg aatccatcga cacaatattc
    88021 ggatcgcagt acttcagaca ttccacatcc atcgcgcact cgttgcattt ggaacacacg
    88081 acgcacagtt tttgtaacgt attcattgcc atccttgccg acgttgcgcg cgagcaggtc
    88141 gactccccta cccctccgct tatacatacc gcgcacagac aaccccgaac ggcgatacag
    88201 acaccgctac gttacaccgt gatttcaacg agctttaata gaaaggggcg cccgctcgcc
    88261 ggacgagcgg cggacgggaa aggagaagga gtcgaggggg cggggaggtc ccgaatactc
    88321 acaaccgaga ccgtttgctg ggaagttcga actcgtcgtc cccccgcacg tcgtcgccgt
    88381 tgatgaggcc ggcgttcacg tcctcggcct cgtcgcgcct cgaaaacaga gcggagaaat
    88441 cgtacatggg accgctctcg tccgcggccg cggcaccgcc accgccctcc gtcgccgagc
    88501 cgccaccgcc ggcagcggag cccgccgccg tcgcgttggt ggcggtcgcc tcgcgcagag
    88561 aggccagcga aaagtccgtc acccccctct cggccagact gcgcatcttg cgatacatgg
    88621 acctggcgat gtactcctgc tggtccacgt agaagaggat gtcgtcgatc tcggggatgt
    88681 cgccctcgtc gcggccctcc atgagctcgg cgatggccgc cagctcggga tccacgtcga
    88741 gccccgtcga gtcgagcgcc gccagcaccc gcgagcggac gacgtccgcg tcgtacatga
    88801 cgttctcgcg gcgcgagcgg cggatgagca cgtccaccag cttggtggcg atgatgtacc
    88861 tgtagcgcat gaagcggtag tcctgcgtgc ccatggagcc cgtgttgagg ctgcggtcca
    88921 cccccgaccc cacgtagtac ccgatctgtc cgaactgaaa cacgtcccgg gtgcccatgg
    88981 agctggagta cttctcgacg gcgaagctga cggagacgag cgagcggccg tcgaagacgt
    89041 tcttgagcac gggctcgcgc gtgatggtgg ccacctgggg cgccttgacg ccgtccagct
    89101 tcatcttctt gaagtgcagc acgtactcgg cgatggagac gaacttgggc gcgtccttga
    89161 ggagacaggg gaactgcgag tggttctgcg gcgtcaggcg cgtgctcatg ccctggatgg
    89221 tgctcatgta gtccctgaag ccgaacatgt agaggaactt gttgtggaag cggttctcca
    89281 cgtagctgag caggcagtcc ggctggatgt ccaccacgtc gctctcgtcg tagtcgtcgg
    89341 tgacggtgag gaggaagcgc accaggttgt cgaagtcctc caccttgccc acgttgaccg
    89401 agcgcggcag cgagttctgc aggacgcgct gccagaactc gaggcacgac aggccgcagg
    89461 ccgggaagag cttctcgtgg cagcggaaga gcaggaagga gaggcagccc ttgatgggat
    89521 tcttcctctg cagggcgccc ttcttgaaga agacgctgct ctgcggcgtc ttggagatgg
    89581 gccgattctt gatgcggcag ctcttgagcg actgcaccga catcttacac gacttgatct
    89641 cggtggagat cttgcggtag cggcccgtct cctggaagga cctgaagtcc atgatgcgct
    89701 cgaactcgac ggatttgagg ttcttggtgt ccttgacgtt caggaacccc ttcttgaggg
    89761 gcgtcgtccc gaacgcgccg cagatggact ggaagtgcag cgccacccac ttggagatct
    89821 gcgccgtcgt cagggggttg tcgaccacgt acgacgcggc gttgatgagg gccaggttct
    89881 ggatgatgga gaacatggtc cggtaatact ggaacgacag gacgggggag aaggccgtgg
    89941 cgtaggggct gaggtccagg ttgaaggact gcgtgctccc gctgatctcg tccctcccgt
    90001 gcccggacct ccgcacgtcc atggcgaacc tgcacacggc atcgtcgatc gtctggttca
    90061 gcgccgtgac cgtcgcgacg aagtctctct tgctgcgcac gttgatgata tcctcgccgg
    90121 tgatcgcgtc gatcagcgaa ttcttcttac agtagtccag gacctgcccg agatacttca
    90181 tcctgtcgac ggagacgaag ttcaacccgc tggcgccgcc ggccggaggc cccgcggcca
    90241 cctcgtccgt cctgccgccg gctccgccgc ctccgccgtc gcccgcctcc cgggactcca
    90301 ggccgtatct cttaccatag tttcccaaga ggtcggcgtc ggcgaaggcc cgcgagagca
    90361 gagtgaccac gacgggctcc ttcttgatct gcttggggat gcccggcagc cgcgtgttca
    90421 ccctgatgaa ggaggtggcg tagcacgtgt gacagcagcg gccgccgcac gcgccgcaca
    90481 gcttggagcc ggcgttcacg atgtgactga acaccgtgtc gccgctcgtg accccggtcg
    90541 agtagatgga catgcggttg aagaaccaca tgagggtgga gaagagctgc ggcgaggtgc
    90601 cgcagaagta ggccaggtgg tgcggggagt acttctcgtc ccgcccgacg gccccctcga
    90661 acctgatggt cttcttggcg tcgttcagga tgtcatcgta catgcccgtg aggccgttga
    90721 agaagcggat ggacttgagc agggagtcct gcgccgacgg gttgctgttg gcccccttgc
    90781 cggcgctggg cacgaacacg atccgcgtct ggtagaggat cgagttcgag ctgaagatga
    90841 gcgcggcgat gtgtttagcg aggtgcaact ggaaatcccg caggttgtcc agcagatcgg
    90901 cgtgggtctt ggcgttcttg acgagcggcc attcgagaaa gttggaggcc gtgctgaatt
    90961 cgtagacgga atcaagatag atagacgcgt agctgaacgc gagctcggag cagaccgcgt
    91021 cgaccgtcat gagctggtcc ctctcgacgg cggtgagctt ctggctggtg tagccgtggt
    91081 acttcttgaa cggcgtgagt ttcaccgtct gctgcgtgtc ctcgacgaac tgctgcagac
    91141 cggcctcgat gaggcgactg gtctcgcaga cgcgcagcga ctggccccag gaggtgaaca
    91201 tgaagtagaa gagcgcctcg ctgagcgcgg ggtcgtagaa cccgtgctcg aggacccacg
    91261 gatcgtcgca ggcgacggcc gcggaagcgc cgtcggcgtg cgcggcatcg gcgccgccgg
    91321 agaagagagt gtagggatag agcgggacct tgacgccatc gaccgcgccg acctgcacct
    91381 tcacggcctc ttcgggacag gggatgagct gccccgcgta gaggagctcc ttgaggccgt
    91441 ttccgcacac gacgtgcccc gtgtactcgg cgggggcgat acctagctcg tcgcagagga
    91501 cgtctacgtc cgtgcgatct cgattagcga gcggactgaa ggcctggacg ccgaagcggc
    91561 gcctggcatc gtcacagagg tgcacgacgt cgccgtgatc ctcgacgacg tcgaggatct
    91621 cgtcggtgtt gtggaaaaag aaggcgaagg gacagaaaga ggtgactttg gtgaggacgc
    91681 ccccctcgta tgtgctcatc ggcgtcctga ccgcgccgca gaagtcgcgg tcgacggtca
    91741 ggtctatcaa cagcggcgcg atgacgacgg gggtcgcctt gtcgcagagc gacatcgcgg
    91801 ccacgatgtc cgcgagctcc cgcgtctttt tgaggaagaa catccagacg gcgggagcga
    91861 cgggggcgag gctggagaga tcgtcgtccg ccatggcgac ctccccggca tcgaaattat
    91921 acaggagcgg gggtcgttct ggtcgcccgc ggcaccagaa cctttatata cgtgaagccc
    91981 ccggcgggtt ctcctcgacg aaaacgtcac aatcctcacg caagcgccct cgaagccttt
    92041 gtcacaacgt actggacatg gtttgcgcgg caacgtgcac gaatctgaac cgccccgaag
    92101 ggctccgtgc gccgcaatcg cagaggaccg cgggctcttg gcgcgctcga ggcatctcac
    92161 gcgcgctcgg agggccgcgc gttgcgccag cagctccgag cccggcgcgt cagacggcat
    92221 tgacggaaag acgtacggtc gcacgcgacc aaacaccgaa atccccaccg tgtcccacaa
    92281 aacacacacg cgaaacgaga cgcgggccgc gaacaggccc acatccccga cacacactac
    92341 gcagacgagc atgcggtgcg aagcgtggtc agcgggagag tttgttacgt gtgccggtgt
    92401 ttgacacacc gttagacggt actgactcaa ataacccgcc ccgcaaccga tttgtggtct
    92461 cgtagcaccc cctagcggaa gacgcagcac atgctgtcgt catggcaaca tccaacgctt
    92521 atcgggcggg cagggcgttg ccatggttac atgtcccgcc ttccgcggcg atgtgccggg
    92581 ccagaggctg accggaagtc ccgccttttg gcccggtgcc tcgcgcgcgc gtacgggcgg
    92641 gcgggcgcgc gcacgcgcgc gcattatata caatagcgtt atacccgaag cgcaaccccc
    92701 ggaaccacgc cccctaaact aggtacgccc acctaaacaa tgggcgtaac ctcctgaatt
    92761 atgctaatta gcagaaagag ataaagttag ctacgcaaaa atatgtaaat tagtctccgt
    92821 taattaactt atgctaatta acccctgtac aactaattat ggaccagtcg actggttcac
    92881 cggcctacgg ccggtgaacc atcgaaacct aggtaaccac gcccattcat agcccctccc
    92941 ccgtaaccag cacctaggtg acgtaatgct cattagggta gtacacgccc cctaacgtat
    93001 attattgatt actaattttg attatcgata aattttcgac atccggttga ccgaaggtca
    93061 accggatgtt gaaaggttat cgatccctat acattaagcc atgtatacgt tggataacga
    93121 atgacgtcac tccctgtgga atagtatacg tctggatatt gcgcaatggg aacctatata
    93181 catagggtct actatatgta accctatcct atggatccta cttaagggat aaaataatat
    93241 atgggttcac taggggtgca attcgaaggg tgtacccttc caccccaact cacccccccc
    93301 caaacccccc cctcccttcc ccgccctccc agctcgagct ggcccccccg catcccccac
    93361 gctctccccc cgcatccccc gcgaaaccgc gcccattttg gtcagctgac ctatgcgtca
    93421 tcgtggcgga taaaagctcg agccggcccg ccgccggcca gacccgcccg tcgctcgcca
    93481 ccaggatcca cgccgctccg gaccgccgcc tcggaccagc gccccgcacc ccacccggat
    93541 ccccggaccg caggaccagc tccccggcta ccggcctcgg ctccccggac cccaggacca
    93601 gcaccccgga cccgcctggc ttcccggacc agctccccgg ctaccggcct cggctccccg
    93661 gctttccggc tcggctcccc agcttcccgc ctaccgacct cggctcaccg ggcccccagg
    93721 accagctccc cggctaccga cctcggatcc ccgcaccctt cccggcttct cggctcggct
    93781 ccccagcttc ccggctaccc tcctcggctc accggacctc caggaccagc tccccggctc
    93841 gattcctcgc accccgcttg gctccccaga ccagcgcccc gctcccggtt cctgtccggc
    93901 tcctctcccc gagctcccgg tccctgtccg gcttccctcc ccgagctccc ggtccctgtc
    93961 cggcttccct ccccgagctc ccggtccctg tccggcttcc ctccccgagc tcccggtccc
    94021 cgcttcattg caccctgccc aggtcccgat tgccgttctc cgagcggctc gatgctccgt
    94081 tcggcaccct ggccggcttt tcggggtccc ggttccggct tcgttgctcc ctgcccaggt
    94141 cccggttccc gaatcccgct cgacgctccg cttttgctct gcctctcgcc tttcgctcgg
    94201 cgctgcgttt tctcgctttt ccttgtccca gccgctgcaa aatgcccctt ttttgtgttt
    94261 tagcttgccg ttggcggcca ttttgtcgag ttttcgttta ggcgggaaaa ttggcgccat
    94321 ttggtcccga cgccattttg gtggcctccg ccatttaacg ttcgcacaag cgctggtccc
    94381 tgacacacaa accctcgtca cgttcactaa gcacgaacac gctatccgag atctccataa
    94441 atctcgcttt cctctttcaa agggggtccg cagagggtct aggtcgctgt cggccgaggc
    94501 actgctcctt ttgagcggta gtgcaaaatt tagcagtgcc tcgaccgtca gttgaaaaag
    94561 atgacgtact ctccctgtgg ctttgaagag atcaggcggt tatctccgtt cggtcttcct
    94621 cgagcaaaca acttttttta gctaaccaga cctagaaaaa gacttaaaaa tgactctttt
    94681 gagaagcata tgggtggacg tgcccgttga tgataggaat ctctgaaacg agtctgttga
    94741 gatagagtct aaagcaaaca ttggaattat tagttttttg tgaaaatgtg cctgccatgt
    94801 gctttatcta agatggcgga cataaaacat ggccgtttgc ggtttcttct tggtttgttt
    94861 tctgggtgcg gtcttcttgg aagtatgact cattaacggt cgctgctgtg tcatgcatcc
    94921 ggttacatgc ccgccccttc cgcttagggg ctgtcaatca tcttaggtcc cgaagagccc
    94981 tcacagagcc taagtgtcca tcggacttag ccgctgtcgg cctcggaaag gcgttcctat
    95041 gaccgtatat ggggtgtcac atggtaataa tgggcgtggt tatggactta ggctctgcga
    95101 aggttcttcg aagactcgag acttagattc tggggactcg gggtgggctg gggtgggggt
    95161 tgggaatgat gtcattacca agaaatcgct tgaataatct ccttataagg acacaaggtg
    95221 gtcctagatc tccctctcga ccaccaccta gcggacgacc tcgttgagtg gggggtaata
    95281 aggaatagtg tgtggtgggg ggatggtact gattaaccct gatcacgtga tttagactta
    95341 gacgaaaaac tcatgttgat ggggggtaat aagaaagcat gcattggggg ttgggtgtgg
    95401 agtgggggta ataaggattc atggggtgac acttagctag atttcagacc cgagggggtg
    95461 tgtcggtgta ggacttagaa cgagaatcga acgcaaaagt ccactgcgca tgcgtttgat
    95521 gagtcagttc ccaatataga accgatcgtt catctatagc atgatcggca catgcgcagt
    95581 ggggtttcta ctcaaaccct agttgctgag tcactgtcga tgcgcatgcg ccgatagcga
    95641 tcagatgcat gtgcaaaatg gcctccataa ttaatatgcg tgtatgcaaa ttgacatata
    95701 ctgactcaac gtcccgggaa gtgtgccagt gggcctatgt gtatcggtcg ctaggatacg
    95761 gatctgctag catctgtcca tcatgtgtat gcgcatgcgc gtaacttcaa cccagaactc
    95821 cgatattcgg atggtagcca gcttatcgtt gatggacagt tgtgtccacc aatcgaaagc
    95881 tcgtacggtc cccgtgcacg ttgagtgaca ggtcgaaccc ggcaagattt ctaacggttc
    95941 aatagcgcca tctagtcatc gacggtgcac atcggcccgt ctctgagtcg cagacccaca
    96001 gaatgacgct cgtttgacgg gcgcggacgc gatctgaggc taggaacgga caacagacgc
    96061 tacagcggaa cgaaaatcgt acgaaaaaca acggtttttt attaacgacg gcggctgcgc
    96121 agcgtaccaa cgtctgagag gataggggat cggggagtca cagatatcga cggcgcgttc
    96181 gggccgattt catcagtcag agtccatctc gctgtaggag aggtcgcact ccatgatcac
    96241 gtcgtccgtg ggggtcgcgc tcctcaagtg gatgcgtttg ttgagcggct ggtccgtctc
    96301 gtcgtagaag tccgtgtcgg actcctcttc ttcctccgcg tctcccggct cgtggtcgag
    96361 gatgcggatg gacggcgggg cggccagggg cgtcacggac gccgtccaca cggactccgt
    96421 ctcggggtcc aagggctcgt cctcgatgtc ttcttccatg tctagcgagc agtgtaggtc
    96481 gtcttcctcg atcggctcgg cgaactcctc gtcgtccgcc tcgaaatcgc gctcgcaacg
    96541 ctcctcgagc gcctcttcga gtcgtttcga ctgcagatcg agctctcgac agtcctcgac
    96601 gtcagattcc tcctcgtcgg aggacgacga cgagtccgag gagctggacg aggagtcgct
    96661 ggactcgtcc gccgacgagc cgcgacgcgt ggcgacgctg cactccccgg gagatctgac
    96721 cccttcgtcc tcgtcgccgg cggtcgcgag ctctttctcg gcgtcggcgg gctcgcccga
    96781 cggaggatcg tgcgggcgag gggacgaaga cggcgatttc gacggtctcc tctctctgga
    96841 cgcgggcgag ggcgagcagg gcgacggcgg aggcggcatc gcggccgtct tcgacgactc
    96901 tttggacgtg gtctcgggct gctgttgaga ctgttgagat tttcgagacg gcgcgctgtc
    96961 gccgcgggcg ccgttctggc cgtggaccgt ggtggagctc acggtcgaag gcgatttgct
    97021 gctgtggtga ccgttagact cgcgctgcgc ctctccccgt ctgctgccgc gcctgctgcg
    97081 ccggccgtcc gtcgcgctgc tgcgacgtct gctgccgctg ctgctactgt cgtgggtgct
    97141 gcgcgtgcga gctctcctgg tgtggtggcg atggtgattg ctgctggtgc tgctgctgtc
    97201 tccgcgacgg tctcctcctc ctcctctgct gtccacacga ggactgctgc tggtcatccg
    97261 actcggaggg gcgggttcca cttcggggct cgtcgtcgcg ctgcgcctgt aggccagcct
    97321 ggggatgttc ggggtcgcgt ccggcgcacg gcgcttctgg cgaccttcgc gccggtaggt
    97381 gccgttgggg tgcttcctcg tgttgttgta cgcgcagaag aacagggtgg aggtgtaggg
    97441 ttgtagcagt ttcttgagtt ttacgcgaca gatctcgttc tgacagcggt ggccgcgcag
    97501 gtagtcgaag atcagctcgg agatcatgcc gcagcggtag gaatccgtgg cgcccgtgtc
    97561 gtcgaagtcg cggatgaaga acggcccgga gtgccgcagc gatctgcggc ggatcacccc
    97621 gacgatgcgc gcgaacgacg cgatcagcgc cagcgcctgc tgcagcgggt gcttgaaaga
    97681 caggggcgga cggcgcaaca cgtcgaagga ggccgccgcc gctgccgaag agccgccctt
    97741 gcggcacgga gacgccggtt tgttcgcgat ctggcgcagg atgtgatact cgcggtcgct
    97801 gccgccgccg cccgggctgt ccaggaggca cgacagctcg ccgaggttca gtttgttgaa
    97861 cgtggcgtac tttatcaggc ccagggtgct catgtacagg tctttgggat tcaccggcag
    97921 gttgtgtacg cggtggaact tgacgtacgt caggttctcg tccgccatcg ccgccaccac
    97981 gtccaggctc ggcgcgttgt tgatggcgaa cgtgcgatct tgtaccagga cccgcagttc
    98041 ctccggcggc agcgcgtcga agtgcttgcg gaagagcagc agatagttag tgttgatcag
    98101 ttcgtcgtgg gtcaccaccg ccggcgcgtg gcggtcgttg tcggtgtacc tgttctctag
    98161 cagcttgatg gggtcgggca ggtccatggg gaacatgcac aggcccaagg aacccgtcgt
    98221 gtagtcgcgg atgtccggag aggtctggcg gtgatagtcg ccgccgccac cgccgcctag
    98281 gctcagcgtg gtattgttgt tactgttgtt ggaggacacg agcgaggact cgaggatcga
    98341 gggtgccgac gacggctcgg gacggcggcc ctgggcgcgc gcctcgcgga tccggatcat
    98401 ggctttcaag cattccaggt cgtcgggtcc cagacagtct agttttttat tcaagtgagt
    98461 gagggccgcg atgtttttgt catactgggg tggtggcgag gagggcgatg agagtggcgg
    98521 cggcatgaga tgagcatttc gtttccagtt gggatgagag gcgcccgaat cgcggtaaga
    98581 cgactggttg tggccgtagt agtagtgctg agactgctgt tgcgaatatt tcgaacgtcg
    98641 ggagacgccg cccgtcgcgg catcgtcctc gtcgtatccg gcgaacgggc ccagccgtct
    98701 cttgacgccg gtccgcagca tggtttcgcc gccttcggtg cgctcggtcg ctcgtacgta
    98761 cgcgcggttg ctgacggggg ggacgcccgc gcggaaatgt ggctaggtgt tactctcgat
    98821 atgactgcga ctccttccgc gcaggaaacc ccccgctttt ttatatcgcg ggaggggaag
    98881 ggtcgatgat acgttagtta gggccgggtg ccagcgtggg ccggacggat ttattccttg
    98941 acgcaagcag gatgcgtggg tgcgctgccg gaacgggggt cgtcgtcgcc cacgcgctcg
    99001 tcgacgcgtc taatactgcg agggcaggga gatcttcagc gagaggtggg tctgtttcgc
    99061 gttagaattg catcgccggg tgaaacacct gctccacagg gtcgcccaca cgttccgccg
    99121 ctggtctccg cggatgtcca ggaatacctg caccgtctcc tggcgagtgt agtgctcgcg
    99181 cgctagacac gagaagtctc gggcgcggcc gtataaaccc cgtttgacgg caacgcaggt
    99241 gcggccgacg gcggtaaaca ccgtggccgc ctccagctgc tgctgcacct cctcgcggta
    99301 gtggttacgc gtgtgtctca acagcgccgg ccaggcgatc cgcctcgcga acgcctgcag
    99361 gttctcgacg tcgtcgtcgt cctcctcctc gtccgatccc accgccctct cctcctcgta
    99421 atcgctcgac gcgcctcctt ctcctccgcc tcctcgcccg acgagcgttg gcagcgacgg
    99481 cgccgactgt cccgactcga gcgacaggtg cgctcgcagc aggggcccga gcggcagacg
    99541 ccgcctcgac atcgcgcgcc tcgcccgcga ttgcagaaag ttgccgtcgc tgtcggcgca
    99601 tgcgcggtcg gtgatgtgca acaccacctc cgtcagctgg tcggcgctcc cgtctcgccg
    99661 cggcggacgg ccgtggtgcg tcaggttctg ggggcacagc tgctgcagca cgaattccgc
    99721 cggacggtcg cgatacccgg cggggacgat gaagatgggg tttaatcggc tgtgcagcat
    99781 cagcccgctg gcctcgtcca gcttgtacat cagcggcatg cggatcgagc gcccgtggct
    99841 gtagatcccc gtgtcgaaac actcgccggg gtgcgagatg gcgttgagtt tgcacaccag
    99901 gtctcgatcg aggcacagag tgtgatcgag gatgccggcc aggcgtttca gcgtctgcgc
    99961 cccgatcgcc gccgtgcgag gggggaaagg gatgatcacc ctcaggccca gcttgcgccg
   100021 acagacacag aagggcgggc gccgaacggc atcgccgtag tcgaccaccg ccgcggcgtg
   100081 ctcgggccgc gggtcgtcgt cttcgtcgta gccgccgccg ccgtacagca tcgcctcgtc
   100141 cgccgccccc gcggcgttct gcggacacgc gctcttgaag aagaagacgg ggtgggagtc
   100201 cgggtctacc tcgggaaaca ggtgccgcca ggccccgatc agggtccgcc gcagcgcgcg
   100261 gcacaggtcg aacacctcct gacggctcag accctgcagg tcctcgcgca gcttgaggtc
   100321 cacgtcgccc acgaagttga acacgggcag gttctcgttg aacatctcgt gacgcgtgcg
   100381 gtacagctgc tcgcccacct cgcacgaggc cgcgatgtct tcgcgcagcc acaccgcgtc
   100441 cgtcagacac tcgtccgaga cgtactcgga cggcaggttt ttcatcaggt ccttgggcag
   100501 cagccggcgg gtccagttct ccgcgctgac cgcgcagaac acgtgccgct tctccggcat
   100561 ctccacccgg aacaccggca tcggcccgat cggacggctc gtgtcgttca gcaggtagtt
   100621 gcgccggcac acgcgcgtct cgtcttcttt ttctctgccg ccgctggtgc gcttgcggct
   100681 tttttccgcc cgcggcacgt accggtccga ggcgcacagc ttcagcagcc ccatcagcgt
   100741 cggcggcagc ggcgagaaca gggactcgca cgtcgagttc agcttgcgca gcgagatggc
   100801 caggttcgtc gcggtggaag agtagcccac catcgtgtcg gcttccgtgt tccagtcgta
   100861 gccgcggtag ctgtggggcg ggctcagctt cgcgcggtcg acgtggatgt agctgccaaa
   100921 atagccctcc accgaaaagt aggtattcat gatggagatc agttcggcgt ccaggctgcg
   100981 ccccaggtag ttctcctccg ccgcgcactg ctgatcgtcc ggcaggttct tgtcgtacgc
   101041 cgtgtgctcg cagtactgca ggaacttctc ccggcacagc gccgtccggt aggccaggta
   101101 cacgtagtac acgcacgagt cggccgccag gcgcgattcc tcgcggaacg cgttgatctt
   101161 ggcgtccacg tattccagct cgcgccggtc tcgggcgttt ctcgccttgg cgaacgccgc
   101221 gaaccgcgcg gtctgcttgc ggaaccgcga gccgttcatg gtcgccatga aatcgcgcat
   101281 gttgatgtac gtgaacaggt tgcggccggg gtcggcggtg aaacatttcg tgtaatcgcg
   101341 ggtggtctga atcgtactat actgcctctc gaacagatag taggacatgg tcaggatcag
   101401 ggtaccctcg tgggtcccgt acgtgctcag gaaccaggag ggggacgtgg gggacaggaa
   101461 ggtgttgttg agatagcgta agatcgcgct gcgattgtaa tggaccaggc atttgagggt
   101521 gctggtgagg tcggagaaga ggtcgccgcc ggcggacccg ttctcctcgt catgacccgt
   101581 ctcgtctttt ttacgatcga acaggtgttc gtacaactcg cgagtagcgt cggcgtctat
   101641 gccggcgcag ataacgcgcg cgggtagcgg tgtgttggtg gacacgtatt cggacaggga
   101701 gaggcggcgc gcgtcgcata tgaaaacggg gcggacccgg gtcgaatccg ggcacctctg
   101761 ggtctgaagt acgaattcta tacggttcga cggtttgtat ttaatcatca gggggaacag
   101821 gtggtgctcc gtcggtgtct ccgacagcat attgactacg atatttgggg tgtcgtattc
   101881 ggtggcgaac agcacgacgg tcatgatgat gaccgacttc ggcggtggcg ggactggcac
   101941 tagtaatgct cgcgggggcg tcgggggcgc tatcgccgcc gcagacgacg acgccggggc
   102001 ggctcctccg agctgctgga ggaggatgct cgatttcgcc ctgtgtcgac gcacgattcg
   102061 ggacggatcc gaatatatcg tcctcagggc cgacgaggac gtcgatatgg ccgaattaga
   102121 agggttcctc aaagataatt ttgggaatct cggggtctcg tcggcggacc tgtctgaaat
   102181 agatagggag tcggaagtca ccaaacacct gctcaggctc cttccggtct ataagcgctg
   102241 cgtgcggagg cagacccggc tcgaccgtct tctggctaac caatgtcgac cgcacctccg
   102301 caacgccgcc gagatcgagt gtcagaaatc caaacgtgtc atgcaggcgc tcgacatcgt
   102361 catcctcaag ctcctcgtcg gggagttcac cctctcggac gaggacagcg tcgagaggct
   102421 gctcgagaag ttctccgtcg atcagagcac cctctgcgag gtcggcagga tcgtgcgcct
   102481 catagacatg gaccgcgaga acactcagcg cctcgtcgac ggacgggagg agccggcgcc
   102541 tcccctctgc gacctgaacg gcgtgccgtc gtcgtcttct tcctcctcct acgcggccac
   102601 tactaccatc tcctctgcct ccgacctctt actcagggag ctggacaacg ctcccgccgc
   102661 gcccgaccac ctccccgggg agatcgacga gattttgctc cgcgacgaag cgacgtctgg
   102721 gacgggacgc ctgcacaacg tcggaaggcg tcgcgacctc gaggaacaaa agcagcagca
   102781 ccagcagatg gccgctctgt gatcgaggct tttctcgatc gggggacgtg taagtgtgtg
   102841 gattgttgtt atttaccggg gcgtgtttat tggttaacaa aaatcgctat ttccacttta
   102901 ccgtttttag aaaaatataa tgtttatttt gtttgattcg caaaaaaaaa aatatacata
   102961 catctctgag ggtaggtagc ggtaaacgta gttttcctga gtacactaga caagaggtaa
   103021 tctctctagg tcagccctcg ttcgacgagt ctcgaccgct tcgcattctc tcttccgcgc
   103081 ggtagtagtc gcggcgcccg cccttgacga gctttaggtc cgagcgcggc acgtcgaaag
   103141 acatcatgac gctcgtcagt gacggtttga acggcgtgat gcccggcgtc gtgaagatga
   103201 tcttggccat cgccatcccg gcctccagat cgacgtgctc gtccgaggcg ttcagcacgc
   103261 gtagcaccgc cagtgagttg gggcgccaca cggtcgggtc caggagcacg cgctttgtcg
   103321 ctaggtggcg acacgggatg accaggcagc tgctcgcgtc ctcttcacac aggtgtccgg
   103381 cctcgaactt caggttcttc gaggcccgcg gcggcaggct cagcggtcgc cgcaggcgta
   103441 ggtcgaagta cgtgtcgccc tggtgcggcg ccatcaggtt gatggtctgc cacggctccg
   103501 gcagcagcat cggcaacatg tggatgtgaa tctgcagcat gttcggcggc agctccagcg
   103561 gacccgagct gatgttcacg atctgcgcgc ggatgtcgct gggaccgtaa cccgccatgt
   103621 ccatcacgca gacgcacccc ggtgggtgga aacagttcgt gacggcgcaa taacccatcg
   103681 ggatgttcat cttcaccccc agaccgagga tgcggccccg ctcgaacagt cgtaccacgc
   103741 gctgattctg cgcgagcagg cggtcgccgt gcgcttccac cttgaaatca ttgccgtacg
   103801 tctggaagaa gatcttctgc atcttctcgg gacgacgcgc ctccttcggc gtcggttcgc
   103861 gcggcggggc ctccggaccg tcgcgcagca gctggttgat ctccgcgagc gccgcgccgt
   103921 tctcgctgga atcgtcgtcc tccggaaaga acctatttaa gaacgacgag ttcgtctgtt
   103981 ctctcagcgc gcagctgctg gagatcatca tctcgcgagg cggaggtcgc gacgactgct
   104041 ctgacgagga ggtatcttcg gaaggttcgt cgtcgtcgaa gatattaaag ggatccttca
   104101 tggcctgcgg caagactgag tctggcgacg acagtgggag attcgggcgg accggagccg
   104161 gtatgtttgg ttttatcatg ccaggctttg taggggtttt ccgtttgagc tttttccttc
   104221 tgttgtgctt cgccatggcg agcggatcct cgtcgtcgcc ttccgcggcg gtgtcggtcg
   104281 ccgcttcggt gccggatacg accgtcagca agatcgtgat cagcgacgga tccgaggcgc
   104341 acaatatcaa cgagttctac gacgtgaagt gtcactcgca cttctacggt ctgtccgtct
   104401 cgtcgttcgc ctccatctgg atgatggtga acgccatcgt ctttatttgt gcgttcggtg
   104461 ttttcatgag gcactggtgt tacaaggcct tcacctcaga cacggctaaa ggatattgag
   104521 ccggtgcgcc ttttgtgggg cagagacggt acgtgttgtt gtggtttctg ggaaatggtc
   104581 ctccaagggc ttgcggtcaa cgtcagggtg tccagataat ccatgagtac gtcgtctaga
   104641 gtttcgacgt cctccaggtt gatcttatta tctttgattt cgggtttctt tttacgttcc
   104701 gttttgtata gcgttgtgac gtttactggt cctactaccg tctccaccgt accgttggtt
   104761 agtacggttg cggtgttaaa ctgggttttg agtgcgcatt tactgctttg atatagagcc
   104821 gcgtgcatga aggcggaaaa atcgtagaaa aattgtatcg ggtgcatgtt tttcggtatg
   104881 gggggcgtca cgacgatcgg cttcgcactt cgttttctcc tcgggggtaa ggtgaccgcg
   104941 gctgcgggtg cttgagattt tagatgacga aacctatcga aaaacgtttt gatgtccggc
   105001 caggaggctg tgactttgaa aacgctgtgt tgaatagcgt acagtggaac gaaagcttta
   105061 gcacaatggt cgtttttagc tctcgagtaa cggctgatga gagtcgcaac ggctaacgtg
   105121 gtgatagtga acgattcggt caccaacacg cgtctgtccg gggtcctcag ttccacttgc
   105181 cagcggggca ggtcgtacag gataggcgcg gcgaagatcg tatcgcattt tttaaaatat
   105241 ttggcggtga tgttactttt cggggtgatg aggtctctcc ccatggatcg gtgacacgaa
   105301 agcgacgaac ttggtccgca aggtactccg ctcacgatta cggtcccgat tgtgctagtt
   105361 ttattattgt tatctttgat tggggtgtaa gtagcgttca cgtaatagcc cgcgtaggct
   105421 ttgatgctcg ccacctctgt tccctcgatg agataccaga tgggaaagac gttgtccgga
   105481 cgtcgatttc tccttcggat ccatgttttt gaaaatttga ctgagttgac cgtgaatgag
   105541 agatagtctt tggcttgcgt gttctctttt tcttcgacgt cgggttcttt ttctggaggt
   105601 ggtggattgt caaccagaga cgaacctatg tgtatttcgc cgggaggttc ggtcgcatcg
   105661 attgtatcat aacctccgtc ttcataatca tcttcgctca tctcgatata gccggtaacg
   105721 gccgggttgt atgctacact tttccgtagt gagctgttca ctttcgcggc ggatgccgcg
   105781 gtgacgatcg acatgagtaa taaggggttc atcgggaggg ctgatctccg cgttgaatac
   105841 agcggacatt aatcgcggct ctctttgtgt tttaataggc agtctctgcg gagcgcgatg
   105901 ctgttacgcc gcgatagtca acaccgtgat catggtggcg atgatgttgg tgttgtaccg
   105961 agccatcgtc ggattccaag atgacatcgt cctgagaagc acggaggctt tcagacggat
   106021 gtgggccgga aagagcaacg ccaccgcgtg cggggggtgc tcgacgcaat aaagaatctt
   106081 ttctttcttc attcacctcg cgtgtgtcct tatctttttt gccggcacag ccggtacagc
   106141 cctagcgcca tgaggatcgc tatgatcacc aaagcgacga ccacggagta gggcatcgac
   106201 ggtcggacgt tcacgaggat gtcggtcacc tcgaacaccg tcccgttcgc ggttagtaat
   106261 aggtagtgga ccctaggcgt cgccaccagg atgtcgtttt cggggtccgt caggtacttc
   106321 aggacctcta tgctcgggat gtgcatgatg gaggtcagtc cgtccacctc gtcgtactcg
   106381 accagggtgc tggcgcagaa ctcgcaccgt tcggtgaacg tgatgttatt catcacgatc
   106441 accgatccgc gttcgcggta gctcctcgac aggacacagg gactcctgcg gtccaggacc
   106501 gtgatcatca ggttcctgtc caccacggtg ttgctcacgg ggatcgccag gcccttgacg
   106561 atgaaatcgg acgagatcag gtaagtcttt tcgttagccg ttatcaccgc gccctgagtc
   106621 gaatccggca cgcagttagc ctcgtccgac atctgcgaac gcttcggacg cagggcttcc
   106681 gtcaccgaca tcacctgttc ggcccgtctc tccggacggt gcgccgactc catcagggcc
   106741 ctgaccgatg gacccgtata gtcgcgcctg cctcccgata cgcacgggct gtagatctcc
   106801 gacggtgcgc ctcgttgtgg gttcatgagc agttcccccc atgagatctg ttctcgcgga
   106861 gaacacatgg aggttagtag cacgaaatgc cgtctcgcca cgctgctctc gttcagttgc
   106921 gtacggaccg ttaggtcgac gcggatcaag atgcgtctca tcgatccgga tagcgggatc
   106981 ttcaagctca tacggtagta cgcgtccgtg gtgaacagta acttctgtag cagggcgtcc
   107041 gtgttgacat tcggcgggat gcgagtcgaa cggagcaaaa aagcgaggtc ggccatgctc
   107101 gccgcgtgca tccctgacga gtacgtggcc gccaataccc ggacgtcgat cgcgttgctg
   107161 gaatgtgcgg gtttgtgttt ttcggtgagc tgcatcctcg tctggaacgc cggcgtcggg
   107221 ttcggtgtcg tggttttgaa acagtggacg atgaattcgc cgaacagctc caactcgctc
   107281 tgccgccaga gggcggtcga gacgggagcc gtcgactgat acctcgtccc gttcgccatg
   107341 agctgacaca gagaataggt gaagaagaac tcgaccgtgt cgcgcgtgat gaggccgcac
   107401 tgcttgcctc tggccactac cgacgccaga acgctcagca cccgcagaca cacgctcgtg
   107461 tccgcgtagt cggccgacag cgtgcgttgc aggaacacca catcggtgag gaacatgtag
   107521 cgttggatga acgctgtctg tttgaccacc accaggaggt cgtggtcggg cgtctgccgc
   107581 aggaggaagg ctccgacggt gtacggcgcc ttcagatcca cctctctcac gtctccgaag
   107641 aacatggcca acgtgttctc cgaggtgtgg tcgcgggtag gtttgatggt gaggacgaag
   107701 aacttctgcg cgaggctcac cgtcacggta tatcccgtcc aggtgatgac ctgatggctg
   107761 cacggtacct tcatggagaa gatcaccggg tgctcggtga tgacgcagag tttatccgga
   107821 acgaccgtgt ggatgttcgt cgcgtcgacg atcaggtcct gcatggtcac tgagctggcc
   107881 ggcggggggt tcaggacgcc gcccggatac ttggccgtgg gcgagcgggc caccagcctg
   107941 taggcgccgt agatgggcac gacgaagtac acccgaaacc gtttgcgata cgactctagc
   108001 gtctcggtca tgtcgacgct cgacaggacc tctctcgccg cgtgcgtgtt gaagagacag
   108061 cggggcacct ggtagacgcg gtagccgtcc ccgtcctgga agttgaacgt gaacatggcc
   108121 gcgtgagaca ccgtctggtt agaggattcg tcgtgccggc acacccggct ctcgttgtac
   108181 gagtgcaact tgacggtgtt tctggagatc cgcggtgcct cggccccagc cgcgtaaacg
   108241 acgcgcgtcg aacatagcgc gatggagagt attaatgaca acttcatgtc gcgggtcggg
   108301 gtgcggacgt cgcagggccc tatctcgtcg atcctgttta aatatcttaa ttacgctcgt
   108361 cggcgctttc cgtccgaccc gtcatgggga cgtccgcgga cacggatttg ttatcgtatt
   108421 tacctgacgc ccgcaagcgt gcggggcgac gggggcatct gcagatctac aagaaaatca
   108481 ctgccgtgtt cgaggacgac gacgcgctca acgccatcct cgggggcatc ctgccctacc
   108541 ggggggtccc gggccgtcga tacgtcttct acgagatcga cttcaagaag cgcatccccg
   108601 actgcatcgt ggtcctcgtc gacgaccgcg acggctcggc cgagtgctat gtgatcgagt
   108661 tcaagaccac tatgcgctgc gccgacaccg gcaccatccg ctccaaccgc acgcatcgcc
   108721 tccagtacct gcagggtctg cgccagctgc gcgactccac gcgcatcttc tcgcagttca
   108781 cggtcgccga cggtgtctgt tggaaggtct ttcccgtcat ctctttcttt cgccagaagg
   108841 gggcgcgcgt cgccctcacg cgggtcttca agcccaggga gtatcgcgtc ctctcctccg
   108901 tcgtcttgga tttcctgcgc ctgcaccagg atgagtcggt taaaaacctt tcacgatgtg
   108961 ccgtgtatag tggccttcga ggcgcatcgg gaaaacgtcc tggtcttccc ccgagaaaaa
   109021 ctcgcgcgcc tccgcgacga aagcgcgctg cgcctgcggc agtacgccga cgacctgggg
   109081 cacgacgcca ggctccgacg aagggcgggc gaagacctag agtctctcgg aaaagagctg
   109141 cgaaatgagt gcgagcgctt ccgcggcagg atcgatcagg cggaacagct gctgtccggg
   109201 cccatgtcgg acattctggg cggaggagag gggacggagg tggcggggac ggcgggtgac
   109261 ggcggttccg tcgacaacgc tagccagaag aacaagagaa agaaggccgg cggcggcgcc
   109321 tcggcctctt cctgctcggc gacgggagac ggcggcggta gcggcgtcgg tgacgatgac
   109381 gactcgcggc agcagtgtct ctgggtcacg ccgaacgatc cccccatctc ctactccacc
   109441 gatttccgcg gggagctggt cgagaccatc ttcaacgtga gtcaggcctg gactttctcc
   109501 ttcggctcct ggtactaccg cctcaagagg tggctctaca accagccgcg ctggcggcgc
   109561 gtgtatcgcc tcacgcagat cgagagcctg tccgtctcgc aggagctcct catgggcgtc
   109621 ctcaacgccg tggagcaggt caccgtctac cccgggcacg acaccgtcgt cagcgacctc
   109681 gaggtggccg cctgtctcct ggcggcgtat caggccgcgc tcgacccccg ggccgcggtg
   109741 cccaccaccg tcgagggcgt cctgcgcgac tccggcaggg tcctccgggc gctctccgac
   109801 gacatcgccg ccgagatcgc gcggcgaccc tcggggggca acgctttcgc ctacaaggac
   109861 ccgccgggct tgcgtttcta cgcgccggtc cagcagggca ggcgctacgc cgcgggcacg
   109921 ttcgacgaga acgccctcgt cgccgtcctg ctgcggcggg gggccatcgc gcaggtgccg
   109981 ggcggtgcca ccggcgtcgc cgcggccgcg tcggggggtc ccggctcgtc cgccgcggcc
   110041 gccgtcgcgt cccgggaggt catgagtcgc ctctccggcg cggtctccga cgacgtcctg
   110101 gcgctctgga cgctgcgcct cttcggcaag cgcctcagcg gcgtcgtccc caacctcctc
   110161 caggagcagc actacctcag gtcggggctc acggccgtcc tctgcctgct gttcctctgg
   110221 aaactcctca actccgagag cgtcttctcc ggccgcgccg gcaagttctc gctcagggac
   110281 gtcttccccg acctctgcgg cggccgcgac gcgccgccgc ccgtcgagag ggaagagggc
   110341 ttcgccggcg gctgcgtcaa gaacttcgag ttcatgatgg agcgctacgt cgtcccgtgg
   110401 tactcgcgcg acccggccgt cacggtctcg cagctctggc cggggctcgt gctcctcctc
   110461 tactgcgaga gccaccgcag cggctgggac ctctcgcgca ggccgttcga acacgccacg
   110521 gccgacggcg tctcctccgc cgccggcgtc ctgcacgtcc aggccagccg tttcaacccc
   110581 ctcgtcgact acatgctgct gcagcagacg gccgccccgg acaaggatgt cgacaggctc
   110641 gccgcgcacg acttcgctct cttccactgc gagaacggga tcggcaggct gttgtccatc
   110701 acgctgccca agcacagggt cctgaccctc ggtcagcagt ttttcaacct gcagaacgtg
   110761 tacgattcca tgtatttttt tgtgctcggt ttcttgcctg tggtgagtgt gacgtgagcc
   110821 gccgccgcga ctcggccgag tattttatgg attggcggac gtccccttct ggcgccgcct
   110881 gacatataag gcgcgcggcc cgtttcggag cgcacagtct catactggtc cttcacacag
   110941 tgccaggcac cagtgcgggg cgcgggccgc ccgcgtcgaa ccgtcgccat gccgacttca
   111001 tcgtgcgccg tcgattactc ctacccggag gtcgacgccg agcatctcag cttcatccag
   111061 acctacaaca tcctcgtcac ctccaccttc gccgtcgtca gcctgatctc gatcgttctc
   111121 atcctaggga gcctcatcct ctcgatgtgg aggaaggtct ggcaccgccg taacggaggc
   111181 gcgcgtatct acgttttcag cctcttcttg gccgagttca tgtacgtcgc cagcttcgtc
   111241 gccatctggc tcgtgcgcgt cgtctgcccc tctaaggtca ccgaacccta ctgccgcctg
   111301 gccatcatgg tcaacggcat gtccgaaggc gccgtctcct tcttctacct gtacctcacg
   111361 ctcgatcgcc tctgcctcgt cggcgccgtg accgagaaga agaccatctt caacacctcc
   111421 gccggcaagg atctcgtcgg cgtcatctgg gtcaccgtgg tcgcctggat ctccgccttc
   111481 atcgtcggcg ctcccgctct caccagccag gtcatgcgcg accgggccgg attcctcccc
   111541 gtctgtgaga tgcagggccc cgacgatatg ccctacgtgc tcatgcatgt caccgccgtc
   111601 tacgtcgtgc ctttcctcat catcatctcc aggctcttcg agatgcggta ctcggcccgg
   111661 gacggcacct ggcacttcgt gagcggcgcc tccatctact acgtcatgta catgatcatc
   111721 gtcgtgccca tcatcatctg tcgggtcgtc atctccttcg gggagatcgg acactcgctg
   111781 agccagacca cgctgcagta cgtcgatctc atctctaccg ccggctggca gggaaggggc
   111841 atcgccgtcg ccttcgcctg cgacgtggtc gtcaagtacg tcgaggccgc cggcgagctc
   111901 cacgcgtccg tcgacggctc cgatgaccgc cggtctttgt gcgcggatct cccctcctgc
   111961 atctacccgg tcggaaccac cctcgtcaag agcactttcg gtttcttctt caagggcgcc
   112021 aagacgatgc tgaggctgtg tcggagggtc tcgcctttcg ggatccagaa ggacgccctc
   112081 aagtcaccgg ccgcgatgaa ggcgctcgag ggggccgcct acgacaacaa gagtttctcg
   112141 cccgacgagg acgacgacga caagatcccc accgtctgtg agaagaccgg accccctcca
   112201 tccctcaccg agatcgccat gacccctgtg gtggacagcc agcagaagat gacgtcccta
   112261 cccatgtctg ttttttactc ggacggcggg gagaaggagg gtgtgcaggg cgatgaagga
   112321 ggacatatca taccgatacc gccgtccgac ggggtgaccg atgatgtctc ggccctactg
   112381 cctacctcct cctctgttgt ctgaaataaa aacggtgcgc gcgcgagaga cgcgagggtg
   112441 acgggtgtag ctactactga atctctctct caatcgataa agcatgcaag gtgttgttgt
   112501 cggtccgtcg taacgacggt ggatgatgaa taacacacgc acacaactct cgataaatca
   112561 acatttcagt aataaaaaga aaacggaaaa cgagatatac cgtgtgtggg tcgttttttt
   112621 ttttattcat aaaatcaatc attcgagcgc tccgctcagc aggtcggcga tcacaccttc
   112681 ctccttcttg tccatgggcg gcgtgctgcg tcgcaacgtg cccgtgaagg tcaggtagtc
   112741 ctggatcagg aaggaaaaga tccccagctc gtggtcagag cgctgcacgc tgaacgcctc
   112801 gggcgacacc gtcagctttt tccaggcgat caggtagaag aaccacacct tctgacagat
   112861 cgtcctgatc gccggctcgt gcgcctcctt gccccagtgc cggttgaaga agcgcagcag
   112921 ccggaacaga cggtgcccgt acaccgttcc cagcgagaag aagatgttgc cgtcggacag
   112981 cagctcgtcc ggcagactca gggccaggcc cgtctccgtc cggatcaggt gcgacaccag
   113041 ggcgcggcac gctcgcgaac ccgttatctc caccgacagc gccgcggccg aacgttcgct
   113101 gaaggcgcgg tgcagcgtct cggtcggcac gtgagcgcgc atcgcctcgt acatcttgcg
   113161 ccagaactcg ggcgagatct tgcggttcag gatcgtgttg tccgacaccc cgttgttcgc
   113221 caccgtctcc ctcaggatca gcagctcgat cccgcgcccc agcgtcagca ggcacgccag
   113281 cctgatgatc ttcaactcct ccaggcgcat ggacgacagc ggctgccccg acagcagctt
   113341 cgtcgtgatg tgtaatatta gatgattgtc gtccgacagg tgcagaaacc gcccgacgcg
   113401 gatcgtcttc accatgacgg gcgacgccgc tcgcgcgccg gacgcgggat cgatgatcta
   113461 cgtcgggggc ttcctcactc tgtatgacga ggaccctcag gacgaacgcc tgcggctccc
   113521 tcgcgacgtc gtggccaggg agctgcgcag agcggcggcc ggggggcccg ccgtgcccct
   113581 caatatcaat cacgacgaat cctccacggt cggcaccgta cgtctctttg acgccgaggc
   113641 cggactcttc tgtctgggcc ggctcagctc gcccgccttt ctggggatcg tcgagaaggc
   113701 cgcgggcaaa tccaaactcg tcgcccgcgg tcccgccaag gggctggaag cggaccccgt
   113761 cgtcgagtat ctcagcgccg ggttccccgc cctctcgctc tccagcttct ctcccgacgc
   113821 cgtcgccgct gccgccgccg acgccgacac ctcggagaac tccggcgagg aggccgaggg
   113881 acagccgcgg cggcagacga ccgactcggg cggcttcttc agacacgttt cgctctgcgg
   113941 gttggggagg cggaggggta ccttggcggt ctacggacga gatcgcgact ggatagtggg
   114001 gaggttcgcg gctcttacgc cggacgagag ggcggagatc gcgcgtgtcg acgacgcggc
   114061 gctcgggggc tgggacggag acgccgatcc cttcggttcg gactcatacg gcctcctcgc
   114121 cagcacggtc gacgacggtt acatcgcgga gcgcctctgt cgcctcagat acgacaagcg
   114181 gctgctgggt ttgcagtcca aggagaccta cgtcaaagcc agcgagctgc cggccgaggc
   114241 cgacgacggc cccgagccgc agagtattag acgcgacgct tcccgggact ctgaggagcg
   114301 cgccgccggc cgcgaggaga tggctcagtc gtctcacggt ctgacaccgg ccgcagtttc
   114361 cgtgcccggg accgccaacc ctgccgcctc cgctttcccg gccgactgcg tctacctcag
   114421 tcgggatgcg ctgatgtcca tcctggcggc cgccgcgaaa cagaacgccg tacccggcgc
   114481 tttaacgtcg ccgcagcagg ccttgcctca ggtgccctct tattacggaa tgccgccgga
   114541 cggtgttcag tatcatctcc cgccgccacc accaccgccg tctcaccatc gcggcggtgg
   114601 cggtactttc gatccccctc tcccacacgg gggatacggt cctccctatc atcacccgga
   114661 cgcctatcgg gggggatacc atcatccgga tcgcgacccg cgcggcggag tgccctacga
   114721 gggctggtat cgccctcgct acgaccccgc cggggacgat catccctcct acaacaacag
   114781 gcggggagac cgctatcggg ccgatcgccc gcctcagcag cagcccctct acaggggaga
   114841 gaggaatagg cggcggagcc ctcccgattc ggacgacgac gatgacgatg acgacgagga
   114901 tctcgaagcc ggcgagcgta cggggggcaa gagaacgcgg cagagaggga gcgccgactc
   114961 cggcaggaag aggagacgtc ggggcgcggc gcccgacgac gatggcggtg acctctccct
   115021 acccggagag cggggatatc ccaagcgcac cgccggtgat catcatcagt cggcgccgcc
   115081 ggcctccaga accgatgagt tcggagaggt gagggcgact ctcaacgaga tccgcaaaga
   115141 catctcgcag atccgcgcgg ccgccagggc cgagggcaac ggcgcgcgcg aggacgcggc
   115201 ctcggtcggc tcttctgacc agaaatgtgc cgccccaccc cccggagcca ccgagatgat
   115261 ggcctcggaa ccgccggccg gcggcaccgt cgtcgccagg atggccctgg atccggccgt
   115321 ggccgccgcg acggggcata ccgccgggct gcttaccgcc gggaaattgg tgaatgcttc
   115381 gtgcgaaccg actcccatgg aagtgggaga accctcggga ggaggaacct cgaggaaggg
   115441 gggtgaggcc agcatgttgg aggtgaacaa acggatgttc gtgtccctcc tcaataaaat
   115501 ggaatgagtg attcagacac cggactaacg gagtgaacgt gtgatttatt tattctttca
   115561 ttctttcatt ctttatacag agatttttca tattgattca cagaatatac acactaacca
   115621 gtaaaataag aataaaaaaa cctgtctgtc accgtgatgc gggcgggcga gcgtctgtct
   115681 ctgtctgtct gtttgtctca gtcggggaaa tcagggttgt agatgtgggg ggatgatggc
   115741 tgtcttcagg cggggtaggc tggacggcat gggtctcgcg ccgtatctac ctttcgtggt
   115801 caactgcacg gcgaccttgt cgactcccat ggcttcgttg aaatacacgc cttcgttgat
   115861 gaacggagtg tacatggtga acgtcagggt ggccagtctc ccggcccgga tccgtatcag
   115921 atcgtggggc tgcagcgtca ggagctgtct ctgagcggcc gcctcctcct cgtacgagtc
   115981 ggggacggcg ttgtagaccc agtttcggtc ttcgtcgaaa tcttggtcgt cgatgaacac
   116041 ctctccttcg tcgctatcat cctcttcctg gtccgacggc acgttgtcgg cgtccatctg
   116101 ggcgaagagg cgctcgtccg ccgacgtgcg ccgcgggggc agctctctgc cgacgggtct
   116161 cggtgtgttc aaggagagtt gagcgaattg gtcctcgggt agctgctcgt cggccgagct
   116221 catccggcga ggggtggtcg ccggaggtag ctggtcggcg tcctgcggcg gctcggggcc
   116281 gggtcggtag gtctcggatc caacggggac gaagagtttg cattcgtact gtgaggtgga
   116341 gagtgccata gactctttat tgatgatgcc gacgggggtc agcaggtcga cgagctcttg
   116401 tgtcagtcgg ttggggaaga agtgcactcg gccgagctcc attcctacgg gaatggtcac
   116461 gttggccatg gccgtgatgc agatgttgag cgtcctggtt tcgatccatc ggcatacgtg
   116521 gatgtcgagc tgaggggagt acttggggaa gaacagggcg gtgtagcgcc cgtcgcacga
   116581 atagccgttg tcgatggtga tcgtccaggt caggcctttc ctgctctcga tctttctcgg
   116641 gcagaagacc ttgtagccgt tgtcgaacgc gtcgaagcgc tgcaacgact tgtaggggga
   116701 atgtcgcagg gcgaacgtga tcgcgtcttt gtggaggagg atgtgcaccg tcagcgaggt
   116761 cggcggcttg ttgactttct tgccgttgtt ctccgcgtgc ccgtcgaaca ccagctggat
   116821 cctcagcttg tggtgcgccg tctcgctggg tcgcgggatg aggatggagg aatcgaggcg
   116881 taccatcggg tccgagatcg ccttcggttg cgcggccacg tacgtgttgg ccggtaccga
   116941 ccggggcagc gtggccgtga tggtggtgca gtgggtgccg aactggatcc tcttgctatg
   117001 cacccaccgc atgcggcggt gggtgatctt aatcaggtgg ctgtcgttca gttcttcggc
   117061 ggtggtctgg tgggcctcct gctcgaaatc cgttttgaag ttggggtgct ggcggaacag
   117121 cggatattcg ttgatcggca cgatcggcag ggggatcgcg aacgccgtca cgaagatctg
   117181 atcttgcgtc tcggccgagt ttctcgtgaa ggttgacatg tttctcacag gcagaaccac
   117241 gttgatgaag tcctcgggat cgctcaggac ggtgaacggc accgacagcg ccgacggggt
   117301 ccgcccctgg ggcaggcgtt gcgccaggca ggtgatggcg gggacggacg tcgcgagcga
   117361 cagaccggtg ttcaggtact tcgtctcctg tcctctgaag agcgggccct tggtcacccg
   117421 gagactcagg ttcgtgcacc atccgtgaac gaacgtggac cccggcttgt cggggtccgc
   117481 cgtcaggaag ttaaattcct cggccatatc gacgctcggc cgcgcgcgct gggctcgcgg
   117541 cgcggagtgg cagccgatcg cgagtcaaat actgcgtcgt ccggctccgc ggccgctcgc
   117601 cgccaccggt gtttcatgaa cgcagcagtc tccggacgcg atccgatttt tcttcgtgtt
   117661 tgaatcccgc tcctgggatc tcctgtcccg tcagctggct caggcggtaa gtcgggcgcg
   117721 ttttcgccag gaacgtgaag ttgaacggtt ctttggacgg gtagaattgg gccgggggga
   117781 tgatgaacag gaacggagcc aggaccgttt cgtccaggca caccgacagg ggaaagagga
   117841 tcagtttcag ttctttgtcc agattgaact gctgcaggtc tttcttgtgt tgcatgacca
   117901 tctctcgttt cgacagtcct gttttcgtgc agttcatgtt tagcgccgtc gagggcgaca
   117961 ccagcgggtt cacctgtcgt ccgtggctgt agtaatgttc ctgaaaagag atcctgaccg
   118021 gttcccgctg cagaaagagg gatatcgcct cgggatccgg tgtgcgctct tcttccgcgt
   118081 cttcgtctct gcggttaccg aactccgtcg gccgattcgg ccgcggttcg ggctcctcgt
   118141 cctcctcccg acggaggatc aggcggccct gctcgtcgta cacgtcttcg tcctccaccc
   118201 cgtaatcgtc caccgcgacg gcggcgccca tggcgtctct cgtcgccgcg cggacgaggt
   118261 tgcggtagaa tggattgtca ccgagaccgc ggcggcggcc gtcacggctg ccgccgttcg
   118321 gttggcgcgg ctgacgcatt ccgtcgtcgt cttcttcatt gttactgccg tcttcgtcgt
   118381 catcatcatc ctcgtcgtcg tcctcgtcct cctcttcatc atcgtcctca tcggcgttct
   118441 cgtcgccagc gggaccgccg acgtccatgg cgtcggcgtc ggcgtctgga tcgatttcac
   118501 ctgcgaatac agcggcgtca tcatcttcgg cgtcgggatc gatctcgccg gcgaacacgg
   118561 cggcgtcctc gtcttcctcg gccgggcggt tggctctcgg tgatagttgc cgctgttgct
   118621 gcggtggggc ctgtcgctcg ggttcggcat cttcgttcga ggactcgttc tcatcgtcca
   118681 tcccgtttgg gttttctgtc ccgtcgtcct cgtcgtcatc atcgtcgtca tcatcatcct
   118741 cgtcgtcctc ctcgtcttct tcctcctcct cggcgtcgga cgacgacgcc tcgtcctggg
   118801 acgacgcgtt gtcctgctct aggtcctgta tggggagggg gagcgtcgtg tccggcaggt
   118861 ctcgcagtcg gctcggggtg cctttgtgtt ttctgaagac ctccggcccg tagttgatca
   118921 cctcggtctg cgaacacgtg tggcgagcgt gtcgactgtt ggtttccacc gtcatccacg
   118981 accgcgacac gaagcgcagc tctccgatgg cggtctccac cgagacctcc atgtccttca
   119041 tgccggtgat cgtgaacgac aggttgctgt tcggcatcca cacgctcggg tggatgtcca
   119101 gacccgggat caggtaaggg atgaagaggg ccgcgtggtt ggacgcgtgg tacatggccg
   119161 tgctcgtcaa cacgacgctc tgacccgtcc tcagctgcac ggtgcgcggc atgaccacgc
   119221 ggaacccgtt caccgggagc ggtttcagaa aagggtccag gctacgcttc aggttcacct
   119281 tcttcgcgcg gttacccacc gccaggatgg ccgtgagcga gtctggaggc gtgccgttgg
   119341 ccttcgcgta ccgcagcgtc aggtagatcg tcggcgagtt tctctgcgcc gtcatctggt
   119401 agaaattgac gtgtggatcc gagcaggtct tcgggtcgag ggtggcggct ctcgccctgg
   119461 gcagctccag agacacgatg gccttcttga agcgtttgga gtccggatcg ttggcccagc
   119521 gcaccttgtg gaccgtcatc ctgacggtct tcatccccgt gcgcgtggtg gtcgccgaga
   119581 ccgacgcctg gcggaccgcc gaagcgtcca ccttcaccga gttcaccctg gcgatcagca
   119641 tgggcggcgc ggggacgtgg tcgagggcca gggcgaacac gcagaaaccc aggtacttgt
   119701 tggatctcag catccgagtc tgtttccgcg gctgggagtt ctgtgccggg acggggagcg
   119761 agccgatacc gaactgggtg ttcacggcgt aaaacatcgt gtgcaggaat cgcttcttgt
   119821 tctcctggaa gggtaccatc atgccctcgt cgcgacacac gcacaggacg gagggtcgtt
   119881 tcaggaggat cttgataccc gtcgagaaca ctttcagctc ctcgggctcg aagaagaccc
   119941 gctggaggaa actcgccagc aggatcttcg tcgagcccac catcgacgag gtgcgggagt
   120001 ccaagggatt gatcacttcg gtcctgttgt tcatggcgtt catcttgatt ccgatcgggc
   120061 tctgtctgtt tgtctatgtc ctcagatgtt ctgctgcagc ctctggagcg cgccgagcgg
   120121 gtggaagaac acggcgggcg gtgccggctg aagctggagc tgaggaggcg attggtaatg
   120181 cttggtgcgc tgtgcctgca acgccaggat gttggagaac ggaggcgaat gtccgtacgg
   120241 cgcttgactc gccggcgccg tccctaccag cgttccgacg cacaattccg agtgccacct
   120301 gggtgagggg agcgacgccg cgctcgccct gccgatcttc ttgggcggac cgcgcgtgat
   120361 cggcgagtct cggttcttgc agtggagcag gatcgggatc aactgtttca gcttaaatac
   120421 agctcccgtc ggcacgatct ctagggcctc gtcgtgctcc gagaatctct ccacctcggg
   120481 gtacgtcggc gcctgacgtt cgctctccgg cggatcgggc ggacgctgct ccttcgccgc
   120541 gttcttctcg ctctccgacc tcgtccgggc cctcttgctg tcgggcggcg ggaactcaga
   120601 ccagaactcg ctaaatccgg ggttcatcga ccccctcttg gcgccgctcg acgatgtcga
   120661 gggtctccgg tgtgccggcg gcggtcggcg cgagcgggcg ggacctccgg cgccggtctc
   120721 ggccgggtgc acgaggatcg agtagctcgt ggcgtccgcc gcggccgacg ggcttgtctt
   120781 cttcacgcgc agcgtgtcgc gcgagacgaa gtacatgtct cccagcggct cgcccgcttt
   120841 cagctccgtc gtaaacgacg accgcaccgt catgctcagc acctgccgct ccttccacgg
   120901 tacgatctgg cagctcaacc ccggacggta cagcggcgtg aacaggcccg cgtacgcggc
   120961 cctcgagaag tagctgattg acacgtacat gcgcaccggc ttgcccgggg tcagggcggc
   121021 gtctcgcggc gacagcaccc gcagtccgta cttgtgcggc gtgcacacgg tcgggtccgg
   121081 gtagcggggg aacgtgatcc gcttgtcttc tagctgcgcg tcgtcctcct cgcggaacag
   121141 gatcttgaag gcgatgttgc tcggggccgc gatcgtcgcg tacttggtcg cgaacgacac
   121201 gtacaccact cccgagctct ggaccaccgt cacctggtcc acgtagatgt ccgagtgcga
   121261 gcaggagagg acgtgcgcta tgtggaaacg ccgcatgttc gtcgacgaca cgtccaggct
   121321 caccgaggcc gtcagcctgt tgccgcggct gaacggccgc cacgccaggt tcgacgccgc
   121381 cacctctagg tccagcgtgc tcttgctcgt ccgcatcgcc aggatgctca ccgggcagcg
   121441 gccccgcact cggggctcgt ctagtctcct ctgcacgcac agcaggtcca tccgcacggg
   121501 cgccagcggc acgcagaaca cgatcagcac cagctgcccg ccggacggcg gcttcagcgg
   121561 atgggcgctc gggttcgaca cttcgacgac caggtcggtc ggcgcgtccg cgggcgtgaa
   121621 ggtggcgaag ttcaccaggt gtgggtggtt gtccgggtgc cggtacatct tccccacaca
   121681 caggacgcag ggcgcctgcg gactcagccg gatcccggtc tggaggaatt tggtctcgta
   121741 ggggccgaaa tctacagtca cggggacgtg tagctccagc aggtaagaca gactccccgc
   121801 gaacaaggag ctcgtgccgc tcggcaagta aacgttgacc gacatgtcga acgaaggaag
   121861 aaggaaggac ggacggcgcc gtgaaagtgt gtcaaaaaaa aatttattag ctgctatctt
   121921 tttcaccctc tatccctctc tccttctgcg gacggaggtg gcggggatgt ctggggtttc
   121981 ggtcgtgccg cgcactttct cttataagtg gttagcgcta cgctgggcgg gagttgtgtc
   122041 tcagacatac atagatatag gtgcatgagg aaaacgtaga cggtccgctc gggggttggg
   122101 atacgacgtc gtttttcctc gcggtgttgt cgaaggtcgg gaggtcggga gggggcgctc
   122161 ttctctgtct gtccgtccgc tgccggtctc aacccttgta gatgcacagg gccgatttgt
   122221 cgtcggggga cacgtcgcag accaggaacg cgggctgctc ggagatcacg tccgtgatct
   122281 gccggatcat gacgaacagg gcggtgagtt tgttgagctc ctcggtgggg gtgatgttgt
   122341 agttggtcct cgagcgggcc ggcgggtcgt tcctgtcgcc gctgctgccc gcgccgacac
   122401 cgacctgggg catccgccgg ccgaggatct cctgacattt catgaggagc atgttgctgt
   122461 cctccagggc cagcttccgc acgtaggcca gcgtcacctc ggaggagagg ttggcgatca
   122521 tggagagcga gatgcagacg ttgcgcatgt cgatcagcac cgtgtcgtcg atcgtgatct
   122581 cgggcagggt cagggtggcg tcccggtagc gcacgacccg cagctgggcg gtcgccgcgc
   122641 gcacctcctc gtgcgagcgg tcgagcgaca gcagggccag catcatcatg cgctggttga
   122701 tctcggtcgc cagcgccatg ggcacgatcc agggcagcac gaggtcccag tccgagacgg
   122761 agacgaggcc cgtcacctct cccgagaaga cgggcggcag ggtggtgagc acgtctccct
   122821 tctcccagct cacgggaccc gtgttgcgga tggtgtagca ctggccgtgc gtcgggacgc
   122881 ccaggatcat ctggttaccc tcgacgcgcc gcatgatggt gagagtcatc tcgcgcatcc
   122941 gcgctcgcat gcgcgagtag tcgcgcgtct tgtccttgac gaccgcgtcc agccccacct
   123001 gcgagctgcc cagcagatgg tggcggtagg ggatggggat caccgcgccg atcagccgcg
   123061 acagcttccc cacgtccccg gtcgtgaggc gctgctcgaa cgtgaccaaa accgtcgttt
   123121 ccatggtcgt gggtgtcggt ctccggcgag cgtgacgtcc gacggcgctg cgccttccgc
   123181 tcgggaggac ccgctcgatc acgagttaaa taagatgctt tgctggaggg gaatggtctc
   123241 gccgatgctg tagttgccgt agtgggtttc gtccagtccc agtttgctcg tgcccttcag
   123301 ctggctctcc atcagggcct gcgtcgtgcc cgtgtgttgc gtgagggctt cctggaggaa
   123361 gcgacagggc ttctccacga tcgagttggt gccctccacg cagatgtact gcaggtccgt
   123421 ctcgccgtgg atgcagtcct gagagcggtt caggtactcc tccaccgtct tgaacagggt
   123481 cttgttcgcg ttgatgatgt cgtccgtcgt gaagaactgc gcgcacgggc tgtagaagct
   123541 cgggttgtgg cccagcttct cgcggttgcg ggtgttgtag atcacgtcgc ccagcgaccc
   123601 gcgctgcgag ccccacgggt tgttggtcga cacgaacgtc tgcgggtccg ggctggtgtg
   123661 gtcgtacagg gtggccagcg ccgcgtcctc gtcgtacggg tcgacgccca gcatcgacga
   123721 cgagcgcccg cgcgggttgt tcgggtagcg gaagaactcc aggtcggccg acaccggcgt
   123781 caggatcacc tcgcacgtgg cgcgctgccc gtgcagcagc gccgggccgc ccttgtccgt
   123841 cttgcgcccg aaggtcagga tcgagatggc ctccgagtcc agcacctcgg tgcgccgcgc
   123901 gccggtcgcc tgtcggaccc aggcgtccac gtcctcgttg agatacacgt tcatcgggaa
   123961 gacctggaac aggtcctgca tccgcgagcc catgtcgctc cgcacgcgcc gcaggtgcgc
   124021 cgtgcacgtc gtcgccccgt accccaggcc catctccacc gtgttgatgt tctggctcac
   124081 gtggaacacc gtgttgatgt cccggtcctc cttggtcacg atcggcgtgt tgatgatcac
   124141 cgccgtcgac gccttggtgc tgtacagcag cgtgtccgtc tcgaacgtgt ccgtccgcac
   124201 cacggtcagc gcgaagcccg ggtgcaggcc catccggctc agcgccgcga tcgacaccgg
   124261 ggacatcttg tgatgcatga tcgccagcgt caacaccgac tccagggtgt gcgcgcaggc
   124321 cgccgagtag cacgagaacg gcgtgcggtg ccagtggtgg tactcgtgcg cgaagatggg
   124381 cgacagcggg aagccgccgt cgcaccgctg gtactgcggg aagtcgttca ggaacacgcg
   124441 gatgtcgtgg ttcgccgtcg ccgccagtcc cgggtccgag tagaaccggt ggaaggggat
   124501 caccgtcagg tactcctgca gcagcttcgg cacggtcgtc atgcagaacc cgttgtacag
   124561 gacgtgctgc agcgactcga agcccgccga cggcgcgccg tgccgctgcg ccgggtccag
   124621 ggccgcgcgg atctccagca tctgcgcgtt ctcgggcacg tgcgccacca ggtggaacag
   124681 ctcctcggcc gcctggttcg ccgtcacgtt ctcgtccgtc gccacgtccc gcaccagcgc
   124741 ggccagcagc gggttgttgg tcagcgcctc ctcgccggcc gtcagcgagt ccgggtccgc
   124801 cgtcaggaag aacttggtgt agaacagctt caccagcagg tgcttcaggt tcaggcccgc
   124861 gccgcacgcg tggttgttca gcacggcggg caccaggcac aggtagtata ccttctgcgc
   124921 caccatctcc tcgtccgacg tccgccgggc gtccacgaac agcggctccg cctggtccat
   124981 cgcgatcatc cgcgccacgt ccgaggtgcc cgggttgcgc tcctcgatgt gcgccgcgtc
   125041 cagcggcacg tcgtcggcca ccacgcgcac caggttcgcg ttgcgcggca gcgcctgcac
   125101 gaagggcggc cagaggcgcg ggtcgtgcag cgcgctcacg tacgccagca gcggctcgtc
   125161 acacagccgc ccgttcaggc ccgtcagttc gcaggtccgc gccacgaacc gtgtgatgga
   125221 cagcaggttg cggtagtgcg tgtacgccgc cggcaccacc gcgccgtcgc ccagccgcgt
   125281 ggcgatcagc cgcaccatgt cgtagctgtt ggcgaacgcc agcaggcccc gctgacgcca
   125341 gtagttgttc acgcagcgcg tcaccagctc gatgcccgtc tcgaaggccg ccgggtcgcc
   125401 gtggatcaga gactctatca ggtagaacag ctccgggtac tggtggtccg tcagcgaggc
   125461 ccgcagcacc tgcagcgtcg cctcgtgacc ctccggcgcg cgcaccttgg tcagctccag
   125521 cgcctgcttc gcccgcaggt cgtggaagtc ggccggcgcc agcgcctcgg gcaggttacc
   125581 caccatgatg cgcggcgtgc acagcggccg cacctgcccg ttctccgtgt ggaagcagaa
   125641 gtcgaagaag gggtgcagct cggtgaagag caggtagttg tccaccttgg cgaactcctt
   125701 ggtgctgaaa tcgtgcttcg cctcgttggc cgtgcgcggc gggtcgatgc gcgcctggta
   125761 gaagtgcacg agccgccgcg tggcgtgtgc catgtgctcc ctgacgaact ctcgccggca
   125821 gagcgccctg acccgatcat ccccctgggg cgggcccgcc tgcgcgaacg cctccagaca
   125881 gggcccggcg tcgtgtatcg cggggtggca gagagtcttg agcgcctcgg cgtgcgagat
   125941 gcgctggggg atcctgtcct tgttgtagaa gtacacggtc gtgggcagct ggttctcggc
   126001 cgtgtccacc agtttgatct tgttctccgc cgtgctgtag gcccggccgc tcggcacgtg
   126061 caggccgacc ggaaagtaga aggtgagctc gacgtcccgc tccagcgggt cctgcacgtc
   126121 tgtgttcttg tacacctttc gcaggtgctc cagcgccacg agccgctcgc ccaccttcag
   126181 cacgtccatc tgcgtctcgg tgaaggtcag ccgctggtcc aggaactgcg actcgggtaa
   126241 gtccttctgc gagctctgct ggatgcggtc ggcgtgctgc gagaagtccg ccatgatcgc
   126301 gtggtgcgcg atcgccgtca cggcgttctc cttgctcagc acgaacttgc cgtacgaggc
   126361 gggcgtcttc acgcccgtgc ggcggatcga gccgcccagc gcgttcagca gcgcctgcac
   126421 cacggtgtgc gtgctcacga tcacgcccgc caggcgctcc ccgccgccca ccgtgtaggt
   126481 ctccgggttg tccaggatgc tctccgtcac gcagtccgtc agcatgtcca ggtaacgcgt
   126541 cagctgcccg cggtcccggc tgcggtccag caggaagatg gtggccagca tcttgctctt
   126601 gaagccctgc gcgatgttgg cgcgctgcac ccgcgtcgcc atgcgccgcg cgatcgtccc
   126661 gtgctccatc agcgtacgca acacgaagca cgggggcgcg tggcgcagca gcacgcgcag
   126721 gaaggtgtcg atcaggccgc gctccatcgc gtcggccgtg tttttcaccg cacgcaacac
   126781 cgtgttgacg gcgtcggcgt tcagcagctt gtccagcagc gtgtcctcga aggtctcctt
   126841 caggtgggtc agacaggcgg cgctgatctc gaaagggatg gtgatggggc tcttctcgct
   126901 gtacttggac accatcaccg tcgtctgtcg cgaggtgggg atcccggccc cggtggccac
   126961 tcgagggacc tgtatataaa aaagcatctt gcccgtagtc attttgttca ggtcgtggaa
   127021 catgatcgcg tgagccgccg tcgccaacgc cgttcccagg aaggtcaccc actcgatctt
   127081 gttgcagtac gtgccgaaga tcgcctcgaa gctcaggttg taccgttcgg ggtcgtcccc
   127141 gtagtacagg cgaaagttgt tgaacatctc ctcccccacg ctcagtttga tgtgcgtcag
   127201 cagatcgatc ggcacatcga gcttaggcag cagctccgtc gccgtccagt tctcccccat
   127261 cgcggcggcg gcgctaccgg cggcggcgat cgccctctcg gtctctctct cgctctttca
   127321 ggcgggccct cggggacgtg gttcgggagc ggcggccgcg aggatcgggc gcggtggcgg
   127381 ggatgatgag cgcgagcgat gggtcgccgg cgtctctgtc ctgtctcgat ccggctttaa
   127441 tagttaagtc gccgactgcg cgcgtcaaga gcgctccggt ctgcgtcaac tcctacaatc
   127501 tcacccgaga gatctcgccg ttcgaggact cccgcctctc ccaggccgtc accgtcgacg
   127561 aggagcacat ctcctcgatc ttcaggacgc tgatggccgc gggacccgac cccggcgcca
   127621 ccgacgagga caaggcgcgc gtcgtcctct gccgcctgct catgggcccc gtcgccgtgc
   127681 cctgctactg cgacgagtgg gacgtcgacg actacctcgc caagtgcgcc taccgctgct
   127741 cgggaccggc gctctacgtg caccgctcgc gctgccgctg cggcgccgag ggcggcggga
   127801 ccatgttcac gttgttgcac gaccactaca ccacgcacgt gtttcggggg ctgctctcgc
   127861 tctccgagtg gaacgtgcgc ctgaccgacg tcttctgcgc ctgtaacgcc tttcgctccg
   127921 accggtatgt catggccgtg ctgcccaagc accagtccgt ctttatcgag tactacccct
   127981 atttcctcgt ctgcctcgcc aggtacctca ccgtgcccga gatcgacgac tgcgccaact
   128041 ccatgaccgc gcacctcggt ccggccatcg ccgcccgcgt cggcgtgcac tacaagatgc
   128101 tcttcggcgc taacgcccgg ccgccgcggg tcaccgaggt ggcccgccgc gccaactacg
   128161 acctcttcct gctcgagctg cagaagctct ggctcaacgt ctcctaccgt aatgcggtca
   128221 cccgcgactt cttcgagacc gtcttctccg ccttccacca cgagacaggt aaggtcatgc
   128281 tggcgttacg ctcgccgggc cgccagccgc tgtttccgcg atggatatcg atgtcgcggt
   128341 tcaagaaaca ggtcctttac ttcgagctcg aagtccgatg tactaagagc cggaaggacg
   128401 aactcaaaaa tgcgttgatt ttcaggaaga ccagcgttct gttcgcggac cacgacgtga
   128461 tctggaggaa cctgttctac acctactatg cctggtgcgc ccatcggggc ttcggcggcg
   128521 agagccggct gtgggggccg agcggcagcg gcggcggcgc cgccaccgag tctgagcgcg
   128581 gcggaggcgt ccgcgggcgc gatcaggcta ccactgccag cgccgctgct gctgccgcct
   128641 ccaccgacga cgatgcctcc gcggcgtcga cggagagtgg tgtggctgtg tctgcgcccg
   128701 cagcggcagc gacgtcggcg gcgaaggcgc atccgcacgc gccagccgcc cccacggtcg
   128761 ttggcggagg tcaggggacc gccgtcagca gtacagcgac tcagaagtac gtaaagatcg
   128821 tagatcgcct ggctctggtt cggctccgct tcagggagag gcggctggcc gccgaggcag
   128881 ccgtcggcag cggcagcggc agcgttgagg gcgccgtcgc cggcggcacc tctggcgttc
   128941 agaccgacgt gaaggcggac gagccagtag ccgtgccgag tttcgatttc gacccgtacc
   129001 gatgcctcgt cagacatcgt gcggccgagg gcgtgcgacg cgagggcgag ggctccgttt
   129061 acggcgcacg taagatcatc ggcgggcgcg agttctcgga gatgactgcc gtctcgctca
   129121 atcgggtggc cgtcaatgcc ttcaacacca accgcgtcat caacctcaaa gcgaccatcg
   129181 tgcagacgcc caggttgtct gcgttttatg tccctcgaaa catgactcac agcttcgtga
   129241 tgtacaagca caccttcaaa gaacccccat atacggtcag cacattcgtc tctaacgacg
   129301 cggcccacac aaactctcta aacgtgaata tcaggggctc ctaccaggag ttcctctacg
   129361 ccctcagtgt ctataagcta tatgttaata tcgagaactt ctttctgccc gcgtccgtgt
   129421 gcaatagtaa ctcctcgcta gacgtacacg ggatcgagga ccagggggtc atccgatccg
   129481 agcgggataa ggtctactgg accaccaact tcccctgcat gatctcgaac accgacaaca
   129541 ttaacgtcgg ctggttcaag gccgcgaccg ccatcatacc taaggtctcc ggcgtcgcgc
   129601 tcgagaacgt gctgctcaaa gagctggcct acgtgaccag catcgaccag ctctgcgtcg
   129661 actacaccct gcaccgcgtc tttaccgtgc tcgagaccag aaattgctac cagataccgt
   129721 ttttgagtaa gcagtttatt ttattcgtgc ggatcatgat gctccgcatc tgcggtctgg
   129781 aacacagact ggccgtcgac cggctcatct tccgcgctat acgccagggc gtcttcgatt
   129841 atcacaagaa tacggtcgcg cacaccaaga tcaaacacac atgcgctctg gtcggcacaa
   129901 gattggccaa taacgtccca aaagtcctcg tcaagaacaa aaaaatcaaa ctggactact
   129961 tagggaggaa tgccaacctc ttgaccctct gtcgccacgt tgatcacgcc tgcgtcgatg
   130021 ctcatcggct ggaggcgctg atcggggtgc tcgattgtct agagaagctc acgtccatcg
   130081 acaggaccaa agaggcgctc acgcgagcga gggtcaggct ctgcggagga taccgccccg
   130141 aggcagcgac gagccggcga tagagataga ctgtcactca ctcacgctca cttggcggac
   130201 ggcgtttcgc agcagcagcc gccgccgcgg cggtccggcg tcatggacga agaagacgcc
   130261 ggcagcatca acggcgagag gaaggacgag gccgtcgcta tccgcgaccc cggcgccatc
   130321 tggtgcgacg gggccgtgct catgagcgac gggaccatca tggaacacga gttctactcc
   130381 aaacccctgg tctctctgat cagaaggaag atcagggtgg agcgcgagga ggacgacgag
   130441 aggggaaccg ccttcgtcag ctcccgggag ctctcgctct ttgtcaccgg acgctgtcgg
   130501 cgccgcgccg ccggcttctc catctactgg cacagccaca gtgacctcat cttcgtcctc
   130561 accggcgtca cctactgcgc gcagatctac gtcgagtgcg ggaggatggc gccggacggc
   130621 accatggaga tgctcatcga gccgcgcgtc ctcctcgtgc gcgccaggga ccccaacggc
   130681 ggcatctcgc acgtctcctg gtccaagact ccgggcatct ggccgaagga cgtcggcatc
   130741 aagcttgtca agatctccag caacgcgccc gccgccaggc agcccacgcc cgtcatgccc
   130801 aacgtcggca tgatcggctt cccttgcgtc agactcttcg gcgagcccac caacatcgac
   130861 atcggggcct atgtgcccct cgtcgtgggc gaccgcgagc agtacaccga cgagaggcta
   130921 cggctcgact gcgagacgtc catcttcctg gagcgcgcct cggccgtcta cctgcgactg
   130981 ctcgccatcg agcgcgaact ggagaccagc ctcgggcgcc ggcgtgaggt cctcatgagg
   131041 tgtgtggagc tcgccgccag gaagagactc ttgttggtcg acggcacccc catcggcaac
   131101 atgttcgcct cggaggtctg cctctgtgga ctcggggagg acagttacgc caatgagata
   131161 gtgggggtgc tctggcggcg ccgggatact aagagcggcg cggtctttaa cttgcacaac
   131221 gtcgctctgg ccaacggtac gcagctcgcc ctgatcctca ggaggattca ggagtactcg
   131281 gcctacctgc cgcccgtaga gcggcgtctg gatatgaccg accccctgac atcggcggcg
   131341 cgagattttt atgccgcaga agtcgatgtc ggggtctcgg tcgtctccgt ggcggcggac
   131401 gttctgcgcg ccttctccct ccgggggttg gtgagcgacg gcgtcaaggt ggtcgagaag
   131461 ctgggcgtcc ccatgacggg tcccgtcgat cgggacgacg tgatcagggt gttacagctt
   131521 taaagggtac taattagcta gttagtcagt tagacagaca agagagggag gaaggaagaa
   131581 gtaggtacga gttggcgggt gttgtgtgtg agtgagtgag tcccttcgat cgatcgatcg
   131641 attgattaga tcggtttgaa gttgaaactc ctctccggcg agcacatgta cacggccatg
   131701 atcagggcga ccaccaggtc gtccgactgg ttgttccgtt tcgcgctgta tgtcacgtac
   131761 tcgttcaggg tgatgcgctg gatgtggcgg agctggtcga gcaggtactc gaccgggtcg
   131821 taactcagct tgatggtgtg cgagatcagc tcctgggagg ccttgatgta cgacgaatta
   131881 aacttggcta tgaaatcctc gaccgcgagt ctcttgtctc tgttcatgag gtagaacggt
   131941 tgttggatct cgttctggtc cgggctgtgg tagaacagcg tctcggcgtg cgccgacagc
   132001 aggttgtgtt tgatgttgca cgcgatgcgc accgccgccg cctggttcga gttgccttcg
   132061 atcgtcaccc gcacctgtga caggaacggg tgcaggcgca agatcgacag cagcatgtgg
   132121 gacacgcagt ccgcgatcga cgtctccgag ctgtccagca ggtccttcag gaagtagtgc
   132181 tccaacccgt acacgataaa ctggtcgcgg taggtcccca ccgctgccac gccggtgccg
   132241 gacgcgcggc ggttcgaggt gaacgccggg tccacgtaga cgctcaggat cgcgcccagg
   132301 tgagggtgga actgcgggtt cgtcgtactg tagcggaaca ggtcgaactc ctcgcggctc
   132361 tcgtcggtga tcagcaccgt ctcctcgttg atcttgttcg tgccgcccat gatctcgtcc
   132421 atgaacgagc cgggcataaa catgttcgcc gtcttccgca cgtccgagtt cagcgtgatg
   132481 aaggtcggct tgtggaggcg gtagcacggg caggccgtcg cgtcgccctt ctccgagaac
   132541 gcctggatgt gctcctcgca cacgtaggat accacgttca gcatgtcgaa gggcgccgag
   132601 gtcagcttcg tcaggaagca ggtgctgtcg ctcgtcgtgt tggtcgacga gatgaagatg
   132661 atcttcgtcg tgttctgggc caggaagccc aggatcgtgt taaaggcctc cttcttgatg
   132721 aagtgtgcct cgtccacgat caagaggttg aagttctgcc cgcggatgct ctgcgtgagg
   132781 aagagacgac acaacacata taaaacagcg tacggtatac gagaggtaga agaacccgac
   132841 ggggtcgggg cggctggtta cgtatataca tacacacagg gaaacgacat aaaacatcga
   132901 aatcggcggt ttgttcccct cagtctttgt acatgaaccc cgggttgacc acggcgtagg
   132961 gcttcttgat gctcccgggc ggcgagtcgt aatattcttc cgtaaagatc ggcttgcgcg
   133021 gccagagggt cgccttgtcg tctctgttct ttttcttctt gggaaatgcg ttcgccgact
   133081 tcttctggta gtacgggcgc agtatggcgt acaggcacac gatcaggccc gtgccgatgc
   133141 agaagaggaa ggcgatcagc acgtgcagga aggtgtaagc ctcctggggt tctctgccca
   133201 cggttccctc ggcgagctgg acctcgggat cggccgcgcg acggtaagtg aggcaggttt
   133261 tgctcaggat acggcgtatg cccacgtgag aacgctttgt gatgatgggc tcgatctttt
   133321 gcatgcactg tcgttttgaa aacatctgga ggtagagcgg ttgtgtggcg ttagtgttgt
   133381 cgaggtcgat tctcatggcg gtgaatctcg gtggtgagtt catcaggagc gagctgtggg
   133441 tctcgttgca cgtcaggata aagagcaccg tcctgaacct ggcggtgttg ttcttgccgg
   133501 tgacgcgaaa ccagttgaag agtacgggcg cgaacgtggt gtggatttgt ttggacgccg
   133561 tgtcgtattc gggcgcgtcg gcctcgttct gcgattgttc cgcctcggtc acgtaggcga
   133621 aagtgctggc gttgatacgt ccgctacggt ccgagtcggt cgccgagatg gtgacgttca
   133681 tggtaaacac gtccgagggc gacgtgatgt tgctcggggt cgcctgtatc caggtatata
   133741 agtccgccgt gccgccgctc gcgagcgcaa aacacagcag cactcccagc agcatgaatg
   133801 tgatcctcgg cgagctcagg aaggccggca tcgagcacga gaccctggaa gacgtgtttc
   133861 gtctcgccga gtccatcggg gaggcgtgcg acttcttcag gcaacccggg gaatcccgac
   133921 tgcgggtctt ggatctcgcg gtgtccttat ttgatcacgt tgcggcggag tgtataggag
   133981 acgtggtttc gctgggcttc gtcgagtcgc aagacggcgc gccgggcgga acgacgggcc
   134041 accctcgcgg agcgaccgcc tcgaaggact gactatgttc tcacacggcc gagacccgcg
   134101 gacgggcaag cctatatcgg cggccggggc ccgtgcccac gcacgcgggg gcggtagtgg
   134161 gaagtgcgat ggcggcggag gctgcgatat gaggaacttg tgcaacccgc tgacgcagga
   134221 gctcaacctc aggaatatgt acgtgtgcgt gcgctgtcac cgcactcacc tctgcgatct
   134281 acggcacgac tgtgtggtgg tccacacgca ggacggctcc gtctgcatca agacgggcct
   134341 cacctacggc tccgttttcc ccgggggctg cgtgagcgcc ctggaacccg tcaccgagcc
   134401 gcacgtcgac gagatcaatg tggtcggcgt cattatgtcc tacgtctaca cctatctcac
   134461 caggaacgct gaccactacg cggatgtcat agggagcgtg atcgaggggg gttggtttaa
   134521 caaacccacg gagaatgcga tctattttac gttcaaccgc gtcttcaagc agcataacgc
   134581 gctgcagaag gtgcccatca gcgtcatagg tcagctgttc gtgcagctgg tcatcggagt
   134641 gcatgccagg gtgaccaaat acgactcgac cgtgatcaaa gtcagtcgga ggaagaggga
   134701 ggacgggctc ctgaaacgga tgcgtttcga atatggaaac gcaccttcgt ttcgaacagg
   134761 ccgctagcga ggacgaccgc gacaggctcg tgccggtaca cgtcgttttc gctgaggatg
   134821 cgctctccta ccgggagttc gagggcctgc acacgctgtg cttcaagatc atctccagac
   134881 ccgacgcgcg ctgggagcac atcccctact tcgagcgtct ggaccgcgag ttcgtgctca
   134941 agagtctctt ccacgacaag tgcaggcacc tctcggcctc ccccggagac gggccctgga
   135001 ccctgcacgg cggcggcgac gagaactgtc gctacggact cgccttcagc gtggtgctgc
   135061 acctccgcga cgtcgagtgg tggaaggacg tgatcaagtt caggttgttc atcggagacg
   135121 acgagacggt cgacatcgac tgcaccttcg tcagacttct gcgcgaaggg ctccgctttt
   135181 tcggagaggt caggcgtacg cggcagccgc ggagcgggcc ccgcagcgcc agtagtcggc
   135241 tgctgcatca tcatcctcac catcaccggg cgggcgcggc gggtgatgac gacggggacg
   135301 tcgatgacga cgagggactg cccgagggac tgttgggcgc cgccgccgac ggcccgggtt
   135361 tcttcgatct cggcgataat cgcaagatgt ccgaggagat ggaggaccgg ctggccaggt
   135421 tcgcgctgaa acgcgtctcc gccgccgact tcggcccgct cgagccgccc tccaaggtca
   135481 ggggccgcga gatcaaggcc agacgcggcg agttcttcag ggacggtgac gcgccggccg
   135541 cgcccgaccc cgtcaggagc cgatcggacc gctggttcgg ctgcgacaac gccattcgca
   135601 tctcgtacgc ccaggaggtc accggctcgc gcaggttcgc cgtgatctgg tactccgagt
   135661 ccatcggatc gaccgtcgac gtcgacgtcg gacgggcgga cgacggggag gcggccgtca
   135721 cctccttcga acacacgcgc cgctgggaga cggccgtcac gcgggtctac ggcgccacca
   135781 gccgacagct cgccgcggcc gtaacgcgcg tcggggggct cgcgcagagg ttctacgtga
   135841 atctctacgc cgggctgcgg gcgggggatc tggtggagct gttgctgctt tcgcgcgacg
   135901 cctggctcgt gaacggcacc ggagggggct gcattattaa ggcgctctcc tccgatcttc
   135961 atcggcgtcg gcgatctggc gacctcgtcg atgggtgtcg tgtcggttgg gccgatgtga
   136021 tctggtacgc gcaggcacgc gtcgcgtctg ggatacccat aaagctcatg agggtcggtg
   136081 gggatggcct ctggcgatct tttctcgaca gcggaaaact gacggactgg gaactcaaca
   136141 ccgacgtctg tgtcctctac gccttcgagg accgcagcct cttctgggtg cttcccggcg
   136201 gcttctgcgc gaccttccag ctgcaggtag accatggcga cgtccagact atccgtgaaa
   136261 agtttgagaa gcatcagtag gttcgtccag tgggagtgtt gttggatgct cgtcaacaag
   136321 agcgcgcgct accgagagtt ccgcgccgtc accagccagt cgccggggct ggggaaggtc
   136381 tcctccaccg acgacgggag atgtctcgcc gcctccatga tgcttttcag acgtgacggt
   136441 aattttgtcc tctgtctggt cgtcaataag gagccggtgg gtcagttcgg ctgcagtggc
   136501 atgcggcgcg agaagatggt catcgatgga ctccaggagc ccgtctacgt gatgcgtctc
   136561 ctggcccccc tcatccccgt caagctagga ttctcgccct acatgttgcc gcctaagagc
   136621 atcggcggct ccggcggtct ggaccccagc gtcatctacc agaacgcgag tgtggtcacg
   136681 cccgaagagg ccgccaccgt cactatgcag ggttccggca tcgtgaccgt ggggctcagt
   136741 ggcgttggct cctgggtgca gatcaaggat ggtgggaaca tgaagctctt cgtcttcgcc
   136801 ctctgcttcg acgtctttac cgcctgctgc gatcggctcg ccttcccgtc cctggccaag
   136861 atctacagcg aaactgtgtc ctgcgaggcc gacaagtgcg gattctgtcg agattccggt
   136921 cggcacgtcg atcccaccgg ccgcttcgtc ggctgcgtcc ccgacagtgg cgtgtgtctc
   136981 tgttactcgc cgtgtcgcgg gacggatgcc gcggtcagcg tcagaagctg gttaccttac
   137041 ctggaactgg aagacggtgc gaacacgcac agcctcttcg tgcggcgcta cgacggcagg
   137101 aaaggactgc cggccacgat atctgactac ctcggcgcca ggaacagcga gggcgacgag
   137161 atcccgctga ggaccgagcc ctggcagctc ttgaagatag aaccgacgct gtccgccatg
   137221 atcatcatgg cctgtccctt actcaaaaag atcgttctcg agcacatgtg agtagccaac
   137281 agacatacaa atcaaccaac ccatccatgg cacaatgaat aataaaaaaa aaattgtttt
   137341 cctccctccc gcatctcttg tctggttttt ttaccgtctg agatatactc acgttagtgt
   137401 tgtagcagct ggcgaacagg gccgtgctct tggcgatctt gtggtccacg ctgatgacat
   137461 tatccttgtt ctcgaccatg aaccggcccg agaacatccg cttgcagcga aactcgacct
   137521 ctttgagcac gtactgggag acgtgcttct ggtgggccac gtagccgatg ctgatcccga
   137581 tgatgttctt cagtaggaag cagatcacgg ggatggtgaa ccaggtcttc ccgtgccgcc
   137641 ggggcacgag gaacaccgtg gccttctgct tgaacaggtc tatcgactgc gaggacagaa
   137701 aatgcaggtc gaaggcgtgc gtcaggtact ccgtcacgcg gttggccagc gtggggttct
   137761 tggtagtggc gaggaagaag agcacgtggg ctagcaggtt gcgttggaag ggctctaggt
   137821 agatcttgtt ccgtcgttcg cttgggcagt tctcgtcacg accggttgcg atccagttct
   137881 cgaagtcctg taggaagttc actatctgca cgaactccgg atctctatat aagtcggaga
   137941 acgcgttcat cttgctgcgg tactccagct gttccggggt acacggctga aacttgaccg
   138001 cgtcgatcgc cgccgacagc gtcggggtga tcttcagcgc gctcgtcttc gggctgctct
   138061 cgttgtagtc ccggtattgc acgcagaact tggtcagggg ggtgaacgtc tcgttgcacg
   138121 cgttcgtcag gcccagctcc gggtgtacgg tctgatatcg cttgcgacag aagataccca
   138181 cgtcgggaaa ctccgtggtg atcacggtcg tgggcttgtg tcgcttgttt gcaatttcat
   138241 catagcgacg tcggaccgcg acggcgatcg cgtcggtgag catggctaca gcggccggcg
   138301 gtgtttacgc tggtggcgag gatcaacaac aacaacggcc acgggcgacc gacgtctcga
   138361 ccgcgctctg cgatgtcgag gcgctcgccg ccgtcgagga gggtcgggtg tccgaggcgg
   138421 acgtcaacag gtacagggag gccgtggacg cggccctgat cgcgtgcgag gcctcctcac
   138481 ccagggacag gtttcgcctg atcgagacgg ccgggggcaa cttcttgctc gtcaccaacg
   138541 cgctgcccaa ggaccggacg gaacaacaac cgccgtgcgt cctcgagggg tcggggcggg
   138601 cgagcagcaa caacaactac gaagggatag gaacgccgtc cgcaggtagc ggtaacgcgt
   138661 tcgacgggct gttggcgctc gaacgcggca cgagcggcgg cggactgacg gcgacggtgc
   138721 cgtccgctcc gggatatgta gcgaaatcgg tgaacacgct gtcttacgac gggcgactgc
   138781 tgagtaactc ctacgtgctt tacactaagg aacagctgag gaagtcgctc tctcccgata
   138841 agcgggcgat cgtggagcgg atcctcaggt tcgtggacac gccggggatc ttagaccaca
   138901 ataacgtgca ggatgtcgag gccgtgctct ggctgctgtt ctgcggaccg cagagcgtgt
   138961 gtcagaaccc tacctgtttc gggcgcgacc gagagtgtga ggtgtcttac cccgtgctcc
   139021 tgccccccgt cttctacgac cccatcaccg actactcggc ctacatcaac ctggccgagc
   139081 tctacgtgta cgtgtggtat aggaactatg atttcgattc cgagcccacg cggtgctacg
   139141 agctcgggac ggtggccatg gaccgcgtca agaagacgct gcagtccgtc cgccagaggt
   139201 tttccgaccg cagcgtgccc gtctggcccg tctcgtctcg cacctgcgtg ttttgtgctt
   139261 tatataatca gaaccgtgtg tgtctggacc tcgctaagag cgatgtcgac gtgacgtcct
   139321 acagcccgat catcatcaag gactgtcggg atgcggcgac gaacgtgacc ctcagtcacg
   139381 tcctgccggg acagcgcgtc gcctccctgt ttcccgtcta cgacatcggg acgctgctcc
   139441 gagcgctctg cgactccaac gacggcgagg agcgcaggaa acgcatgcgg gagaccatcg
   139501 attcggcgct ctccaccacc gacgacgcgg tctgatgggg tcgcgacggc ccgcgcgcag
   139561 cgagagtgcg ctgctcaagg acgctatgcg ggcggacctg gagaaacggc agaagcgatt
   139621 tttcgtcgag gcgttcggtc ctgatcatcc cctggtgcgt attcagggga tcaggacgtc
   139681 ggacgccaag acgcgagcga gtatccgaga atgcgcgcag agcactcggg aggtggccgc
   139741 ggcgatcgcc gttggcaagg cgcagatgcg gagcggtggc gtgtcgacga cggggaagga
   139801 ctcgtcgtct tgggatcgcg ttcatcgcga cgcggacgag ttcgcggacg cgcttgccga
   139861 gatgagggac gtggccgagg aacttcgtag tgtgttcacg tcatcagaca gtgaggaggt
   139921 gtgactgacg gtgatgcgct ctgtcatgaa taaaagctgc cgctgtgttg cgcgctcgga
   139981 tcactctggt gtgtgacttt ttattattaa gtgagcaggg tccgtgacgg tggtccgggt
   140041 gagggtgatc gcatcccccg aggggtcggt cgacgaacgg acgggtacac gcactcacgc
   140101 gcgcacgctt cgtccgcgag aaaaaaaccc cgccgtcgcc atgagcgtgg agctgacgcc
   140161 gccgagaagc gacggctccg tcgggttcgc tcccgtcgtc gtccctccgg ctcccagaaa
   140221 gccgttgagg cgacgcgccg tgagcgatct ggaaaaactg tataaagtca agaggagatt
   140281 ggtgttcggg gccgacgatg gcgccgtcga caacgatacc agtaacaaca acagcggcag
   140341 tagcagcacc accagcaggt cgcggcgcaa gacggccgcc gatgtcgtat ccgatagtcc
   140401 caaacgcact gatgattctt ccaccgcggg cgaggatgga tacacacatt gcgtccattc
   140461 ctgcgcctgt acccccggtg agagacactt gctctgctgc gagctcgtct ccattgggga
   140521 ttccgtgtcg gtcgcccggt gtcccctgtg ttctttagga attagcacta cgtatctgag
   140581 ccgcggctgt tgccgcggcc gaagtaaggt gacgggggga gatgaggacg aggaggatga
   140641 ggatgaggag gagaatagtc aggatgagga tagggatgag gaggaggcgg cgtcggcttc
   140701 ctctagcggc gggctggagt ggagtgacga tagtaatagc gcgctcagtt ggtcggatga
   140761 gaatatcata atctccccgt ttcccgggtt gaaatgttat gtcacgacat tcgaggacat
   140821 ccgacagccc gtgctgctcg agacgggtag tgcgtacctc cccgtgtacg cgccgtatga
   140881 cgagagtttc tgtcggaaca ggtgtctgga acgtggtggg gacgacgatg acgagagaga
   140941 cgcgacgctc atcgggaagg ggtctttcgg acaggtgtgg agactctccg acaagaagac
   141001 ggccctgaag gccgccgcca gcgagtccat caacgagacc ctgttgaccg tctggatctc
   141061 gggcgtagta cgttcccgag cccaggacgc cggctaccgg ggagaactgg acgatagcgt
   141121 ctactgcaac atcctggtgg ccaccggcag ctgcctgaga cacaacctcg tgtcgttcgc
   141181 cagtttcgat cgggacctct acaactaccg gggctggcac tacgcgggcc tggccagcta
   141241 ccgccgcgcc ttcagcggca tcgccgacgc gctcaggttc ctcaacctgc gttgcggcgt
   141301 cggtcacttc gacgtgacgc ctatgaacgt gctcatcaac tatgaccgcg ccgacgacag
   141361 gcagatcgcg cgtgcggtca tctgcgattt cagcctgtcg cagtgtcaca ccgagggtac
   141421 taccggacac tgcgtcgtgg tcttccagca gaccaagacc gtcagggcgc tgcccaagag
   141481 cgcctactac ctcacggaca tctaccatcc cgccttcaag ccgctcatgc tgcagaaact
   141541 ctgcgccatc gagccgcgca agcagttccc caagccctcg gcgaaccgct tctgcgtctc
   141601 ggacctctgc gccctgggac acgtggccgc tttctgcctg gtcagggtcc tggacgagcg
   141661 cggacagctc aaggtcagga gcacctccga ggacgcgctc ttcggcgtcg cgcgcaagac
   141721 ctgcgacgcc ctcgcccggc actcggtgga cgaggtggcg aacttttgct cgctgctcat
   141781 cacgcgccag ctggcctaca ccgccacctt gctgggcagc gacgacatgc gggagcctat
   141841 ggcgcggttg tgtgactatt tcgaaacggt tagcgacaag gacgctcccg accgttttcg
   141901 gagcgtctat aaaagagcta gacgcgagat agacgggtca tacatggtcc ggctcctgtt
   141961 agccgcgtcg gagacggagg acggtaggta ccttctcgat aacatacgtg cgacgtgttt
   142021 aatggtggat agcgaggatc tcgacgtaga tccgtacaag atctttccct gatcgtcctc
   142081 cgggtcggcg aaatccagat atggcgacga cggtcctccc tccggaggcg acggcgatga
   142141 cgacgatacc gcggcggatc gtcgacgacg tcgtcgtcga cgacggtggg ggattcgtca
   142201 cccataatat cgacagcgcg ttcggcgggt ccgaacggaa cgagtgcctc gtcttcgatc
   142261 agagcgagca gtgtctcgct cgggtgttcg acgggctctc cagcgaatct tttgatattt
   142321 actgcctgta taacctccta gatatcaagg agcgtgtttc cagcgtcccc gtgtgcgcgt
   142381 tgcgcctggc gtattttcgg tcggtattca ataaaatcaa cctgacacac gatgggcccg
   142441 ggttggctac taatttcttg tcgatcgtcg accgcgaggt ctcgaacgcc ggcggcgaga
   142501 gcaccgtcag agatgcggtc gggggtgtcg aaggcgcgca gttcgcgctc gcgcgggcca
   142561 tctttcgcct gccggcgcgc cggctcctca gggtcatgaa ggcgatcgag agggattcgc
   142621 ggggacaggc ggctaacccc gtctggcacg cgctgcgcgt cgacaccgtg tcagcgacgc
   142681 ggtttcacga cgtcctcgcg acgcgtaaga tcgccttcag gaaggatctg gatgttcgcc
   142741 acagcagcga agcggtgcgc ttcggcatgc agtgcgaatc cgcgatcgcg caggtgctca
   142801 gggagttcgt ggccgagggg cgagggggag tgagcgatat cgggctgctc ctggacccgg
   142861 cgtcgggggt cctgggcgcc tcgctcgact tctgtagcgg tctctcccgc gacgacgacg
   142921 gcctgctggt ggtggcgccg ggggcggcca tcttcgagat caaatgccgc ttcaagtacc
   142981 tgcggtcgcg cgacgaccgc gcggtgcagg ggctcctgga cgaccccggt ctccagagct
   143041 tcgccgattt catcctggac caccacacgc cggccgtcga gttccggcac cagggccagc
   143101 tgcccacctc gcgcgagtgt ctggtgtcct acgaccgcgt ctttcggcag tcgtgcaaac
   143161 gacgtcgcac cggcgtcgtt tcggagtccc tgcgcctctg gatcgacggc ctcatcaagg
   143221 agaactcgga ggtcctctcc accgtcttcg ttttcgacgc gcgcgccgcc gagggcgaga
   143281 ccggcgccgc gacctgcgtc ggtgatgacg acgaggactt catcctgtcc gccgagcggc
   143341 ccccgctcta cctagatctg ttcctcaagg ccgcgttcgc cgcgcccgtc ttcgctaacc
   143401 cgcgtcaccc gtactactgt cagaccctgg tccagcacta tgtgttgagt cagtactata
   143461 taaacgcgca tcgcgatccc gaacgtatgt ctcccgacga actaccctcc gtgtacctgg
   143521 tctcggccat actgagaaaa cgggacgaga gcgaacgcgg gagagtgatc agaatcaacg
   143581 ggcaccgttc cgactgcgac gaggtgccgc tctgcgtcgt cgtgacgccc gtgcgtctgg
   143641 atccccactt cgcccgggat gctgtgagca gcgtcctcga cgtctgggag ggggacatcg
   143701 gtaagaagac gggtctcgcg ctatgggtgc agagtgctgt aaacagctat gtcgcagcct
   143761 gcatccctac gccgcggact ccctgaagga ttcctcgggg cgacgcgtgg acctcgggac
   143821 cgaattctct gtgctgacgg atacgtctga cgacgaagac caggtcggcg ccggcgagcg
   143881 agacgacttc gtgcagaaac agctcacgac ccccttactt tccgacaaga atagcgctat
   143941 acccctgacc gtggtcactc cgatacagct cggggcgaac aagggaggcg gaaagcggac
   144001 gtcgtctttg aaatccgcca agaacggcgc cggcgtgaag aaaaaagtca gggccttgtg
   144061 atatctatct atcgatcgac cgtgaggggg ggagaaaggg agaaagagtg gaggagattt
   144121 attaaaaaaa acgacatggt gacaacaaca tgttctcgtg tgtgtctgtg ttttttattg
   144181 attgatcttt attataaatg gcatctaggg gaaaaagggg aaagaaatat acagatatga
   144241 tacagaatga taataaaata agaagaagta agatatctct ttcttttttt ctctctcact
   144301 ctgcgtcgct tcgcagggcg cgtatctctt cgttgtccag ggccagggct cgatatcgct
   144361 tgttgcggcg cagcaagaac ctcaccgtac ggatgaccga gaacgccacg cagagcagta
   144421 gcagcaccgt gatgccgatg ttgatgtccc tcgcgtagct cgaggcgttc agcgcctcgt
   144481 agcggatgat ggggtacatg gcgccgcaga cgcccagtat cgtcccgatg tggtagccga
   144541 actgcacctt catgtagcgc gacagcaccg actcgatgat cgagaagtac acgcacgcca
   144601 cgatcgcgaa ggcgaccatg gcgccgaaca cgacgtgcgc cgtcttcacg aaaaagctgt
   144661 tgccgaagcc gagcgccagc gacatggcca gcaccatggt cgcgaagccc aagatcagct
   144721 gggtcaggtt caccaccgcc gtccgatagc ggatggtccc ctgcagcttc gggtggatct
   144781 tcgacagcgc gaaagcgctg cgctcgcgcg actcgtagtg ggtcacgagc gtcaccacga
   144841 aggccgtcag gcacataaag tacatgcact tgctgaacgc gaccatggac ggtaggcgga
   144901 acgacaggct cagcaggaag atctgaaagg tgtccatcgt cagcacgaag gtgaagcacg
   144961 tcgccgagtc gcccatgaag ttgatgtcgc gggtcgactg gttcacctgc gtgccgtgct
   145021 cgctgcggaa gtagatctgc acccagcaca cgatgtagta gctcagcacg cagaagaaga
   145081 tcagctccgt gaagatcacg tacacgatga gctgcacggg gtccaggaac agctgcggcg
   145141 tcagatggtg gatcgcgttg tacatcgtca ggttcatgtt gtcgaagtcg atgatgcgcg
   145201 ggtaatagca cggaaaaccg atgccgggga agtgcgccgc caccgagaac accacgatgt
   145261 tcacgaacga cagcaggcag cacgcgatgg ccatcgtcca cgtccgcagg ttcatgcggt
   145321 ccacgtggga gagcgtcatg acgcccgctt tcgccatcgt gcaggtgtct cgtgtccgcg
   145381 gtcgacgggg cgggtcaaat agtgagagca tccttagaga gaccgtccga gcctcgccga
   145441 gacgacgggg taacgtcgcc gcttcgggtg ccgagcgaca ctcgacacag ggcgcctcat
   145501 ctcggctgcc cccggtacta taaatcccag ggctcctgct gggatcacac cacacattgt
   145561 ctcagactct cggcggcggc gcttagggaa tcgcgatgga gaggcgatgg cgtcgggggc
   145621 tgccggtcca tctgtccatc tatgctttcc tgcccgagga gaaccaggcc atcctgcagt
   145681 gtttcttctg cgaagtggcc gacggagatc gcgtcgtgac cagactcttc gttttcccgg
   145741 tcaatatccc cgccgaaggg gagcttcgca cctacctgct cgctaattac acgtcggcga
   145801 tcgtgtcttc ttccctcgac acgatcccgg attcgacgac cgccgctaac gggtcggggg
   145861 taggaggaga ggtcggtgga ggaggcggga gcggtgatga gtgcgccgat cgcgtcgcgc
   145921 gccggtcgcg ggcgctcgca cagatcctca tgcacgtcgg gccggacttc gagcccctga
   145981 ctaggttttt cacgcccgtc gagatcttct ccgacggcgt cgagatcctt ggctcccgga
   146041 gatgggagaa tgtgcgcggc atctacaaca gcatcctgca gaccctggcc gccctgacgg
   146101 tcggcaggat ccgagccatc ggctcctatc accagatggc ggacgccgtc tcgatcgaga
   146161 ccagtacggc gatccagtcc atcatcgccg aaggcgccac gaccgaggat gccgaggacg
   146221 agtgccgcta ccgcaacacg cacgcctaca ggaagctccg ccgcggcttc gtctcacgcg
   146281 acatcacctt ctccatccgc atcggtaaca aaaagttcat gctcagcgag ccctccgccg
   146341 tgggcgccaa gttctccgtc tccgacgtct tcgtgatcca ggatgtcaag tggcgcggca
   146401 agaagctgcg cctgtgcttt ccgcgcgagt tcctggcctt cgtcttctcg gacgaccagt
   146461 gcctcgtctt actgcgcgat gccatgcagc gcctcttcaa ggaggtctac ggcggattct
   146521 ccggcctcta ccccgtcttc gacttcttcg ggcccaatat gctgcgctcc gggggcccgc
   146581 gctccgtctt cttccccggc ttccccgccg tcgccgtcta ctccgtgccc tggcgctacg
   146641 acatgaatac ggagaacggt gccgacgcca tcaacgagat caggtccttg gtcggcctgc
   146701 ccgacatcgt cggcgtcgcg ggtaaggtgc cgctcgtgcc ggagcccggc aacgccgtcg
   146761 acaccctgga cgccgtcagg atgtacgata tcgacctgca ctacgccgac atgaggcact
   146821 ttcgcatcaa cgccaggctc tgcgttaccc acgacatggg cgacgccgcg ctcgacgacg
   146881 agagctccgt cgcccacatc tatgtgggcg tcggcggcgt ctgccgcatc tccatcgtcg
   146941 atctcaggtt cgccgtcctg cggatgtgcc tgcccgggcc cgaatttccc ttcgtgctca
   147001 gcgacgtcgc gcgccgtgtc gaccgcatga tgatcgacgc tttcctccaa cgcctcgccc
   147061 acagctcccc gcgcatcttc cgccgcgtgc gctctctcga aaactacatc tgcaagcgcg
   147121 tcatggacgc ctgcgaagac gagggttacc cctggatcct ggtccgggac gactgcgaga
   147181 tcttcgtgcg acgccccgtc gactgcgacc aggtcaactt cgacaccatc gtcagggcca
   147241 acctggccag ggtctgggcc gagctcttcg gcctccagta cctctgcccc gtctgccgca
   147301 tcaccgtggc catgagcggc gtgctcttcg ccaccggcaa gtacctgctc tccggcttcc
   147361 ccgacgagca gaagtacttc cccacccccg gatgggtcgg cgccaccgga cgcctgctct
   147421 ccgaggccgt cttctgcgcc ttccagtccc ccgattgggg cgccaaagac aagatcatcc
   147481 gcttcatggc cacgcacatg ctgcgcctct cggccaggag gcacgagacc cgcttctggg
   147541 cgcagaggtt cgcccccgga cgcaaccgcg tccagcagca cgacggcgtc atggacgcca
   147601 acgagttctg cgggatccac gtctgcggcc gcatggtggc cgtccagccc ctggacgggg
   147661 ccctgcacga caacatctgc tacaacgact acgtcaagaa gaccttcgag gtgctcaggg
   147721 tgaccctcga gaaggtcatc atcgtcctct cgcaggacca gaccaacacc gcggtcgtca
   147781 acaacagcac gggcgagatc gactgcgtcg ccatcaagca ggaggtcact gacgacgcga
   147841 tcgtcagcga caccaccggc tcggatgagc tggacgccgc gctacgggcc ctcagggaga
   147901 ccacggccaa caccgtcggc atggtggtgg aacgcaccga cacgcacaac ctgatcgaag
   147961 agtttaacga tgtctttcaa cagactatgg actttgtcgt ggaacgctac tcggccttct
   148021 tttctatgaa ctgactgagt tggggaatca ggagggtgat ggacaggata ataaataaca
   148081 taaataacca taactaacta taactaacta ccactgtata tgcttcattt tcaataaata
   148141 aagacacact gcaaaagacg atcaacggtc tgtgttgcat atcatttttt attgttcgag
   148201 gcgcttttct tagtgtcggc gccgggagta gtggtggtgg tattagtatt attgttagtg
   148261 cttagtagtg ctatgtgact attagcagta gtagtcgtca tattcttctt agtggtggga
   148321 ggagtagtga tggtggtatc ggtagtagta gtgtctggat acatgcgctg cttggggttg
   148381 ttgtcgttcg ataaccagcg ggtcacgaca ccggaaccgt tggtccccag tggcacgtaa
   148441 aacacgttac acacggtgtt cagcacctcg gccgccaggt cgcccacggt gtcgccgtcc
   148501 ttggtcaccc ggtccgtcag cgtcagcgac accagagaca tgctgctgat gtcctggacg
   148561 ccgaagtacg tctcggccag catggtcgcc tgggcgcgtt gggtctcctt gtacagcatg
   148621 cagatctcgg ggacgtggcg cgtgatcctc gggtccgtct cgtcgaagaa caggtacagg
   148681 gacgtgcaca ccagcttgat gcagctcttg cagatcatcc gggtcagccc cgtgcggggc
   148741 ctggtgccgg tcaggaaggt caccaggtgc tccagcgtct gtctggacag cggcagcgac
   148801 tcgatggcga acagcagcat gcacagggtg aagtccgtgt tggtcttcgg gcggaacacg
   148861 gcgatccggt gcttggtccg gatcgaggac agccgcagct ccgacagggc gtcctcggcg
   148921 tccaggatga agaacaggca gaatcccagg aacgacgacc ggcagtccga gtccgcgcgg
   148981 tactgcgcgt tggggatcag ctctcccgac tcggtgtgga accagatctg cctgtccgac
   149041 accgtgatgc tcacgatctc cggcgccatc agtcggacgt agtcccggtc gttgtgcacc
   149101 tccatggcgc ccctaaccat taaggtgctg gacattgcga tcgcgcagcg tctcgagctt
   149161 ctgctgcggc gatcggaacc tcgggctgac ctcgggagcg ggcgacgacg gcggcggcag
   149221 gccgatcggg gtcgtcgtca cgatcgtctt ctgctgggga cggtaattcg ccgtgcctgg
   149281 tgtcgtttcg tcgagtcgcc tgatcttcgt cggggggccg gagacctggc ctggcgctcg
   149341 tccgatccgc tcgctcggcg ctgctgctgt cgctgctccc gctgccgccg ccgccgccgc
   149401 cgtcgcctgc tccctctcta aaaaggcttg gacgcgaatg gtctcacggt agcggatgta
   149461 gtcggtatat ctctgcagct tgctcgtctc gtagatgacg ttcgccaact cgctgagcga
   149521 cagaaataaa tactcttctg ggatggcatc caacatgggg aactcgatga ccgccgtgag
   149581 gaacgggagc agcacgcgct cgatcgtgta gttcgagtac gagatgctgt cctcggcgcc
   149641 ctggttcgtc acgttccgtc ggaacttgaa acatcgaaag tactcttgct cccagagacg
   149701 cgacaggcgc tcgtccgact cgcgctcgtc gggtacgaac tgcgagaaga agctgttgca
   149761 gacgacccgg ttgtcgtcca ccgtcaccgg cgccgtcggc aggccctgca cgcgccgcag
   149821 cgcgttgacc gtgtccaggg tctgcaggtc gaacgccggg gggccgcggc cgcgccggcc
   149881 ctcggactca tagcggtcca gcgcgtcgcg cagctcgcgc gtcttgctct cccacgtctt
   149941 gttcagcagc ttcagattct ctatctcctc gacatggtct tggatctggt cctccaggca
   150001 cctgatgacc tgtcgcctaa agagctctcg gatgtcctgc gcgcccgaac ccgagggtgc
   150061 cggttggatg aggggcgcgc ggctcggcag gaggcgggct tgatccacag acggcgtcag
   150121 gtcctgcagg aaagactcca ccgagtcctc cagtccgatc ttcgacttgc tgtcggacac
   150181 gttcagcagg aacttgacga tggacgtctt ggcgtccacc tgccggtccc gcttctccat
   150241 cagctccacg atgcgcttcg tgttcatctc gtgccggctc gtggtcacca ccttgatcgg
   150301 gttggtgttc agcagctggc agatcttctt gtggatgcgc agctcgttgt gtcgtttgcg
   150361 ctcgtagcgg atccgggcca gcggcgtcgt caggatcagc cgctcctcct cgaggatcgt
   150421 gggctccgcg tagatgaaac gcttcagccg ccgcttgccc gagaagcact cgatgtgccc
   150481 gttgctcttc agccggtgga tgcggatgtc gggcacgttc ggcacctccc gggtcatcag
   150541 cgccgacacg cacgcccgca gcgtccgcgc gcgcagcggg tccggcctgt ccaacaggtg
   150601 acactcggcc acctcggcca ggaagcgccg ctgcgccgca tcgaccgcct tctcccgctc
   150661 ggccgtgcgt acctcggcga tgggaaccac ccccaccgac acgatccagt ctacgtagcg
   150721 acagtacctg tcgtccgccg cgtacgtgta tataagcttc tccagcagcg cggctatgct
   150781 gtccacgatc gtgtgtttca gcgcgtccgc ccagatctcg aactgttcca gcgccgcgcc
   150841 gccctcgtcc tccgcgcgca cgaaccgccg ccggtgggag gcccaggccg tcgacagctc
   150901 gcccacgctg atgccgttca gcaggaaccg catcatcgcg tagaagatct gcttgcggaa
   150961 cacgctcggg tctcgcagga tctggtggat cgtctgcccg atacacgcgc cctccgtgcc
   151021 gttgatcatg gagaagaggt ccagcgacga gtccgtcggg aacaaggggt ccgacggcgg
   151081 ctccggcggg ttgtcgaggt acgacaacat cttcgtcctg aatatgtcgt ccgcctcgaa
   151141 gatcgagcgg atcgttgacc gcgtcaagtc gctggccttg aagcggttct cccgcgaatc
   151201 tctgtacaag gactggttcc gccacatgtt ggatccctgc gcgggcctgg tggcgcccga
   151261 gctcggcgac gacggcagca gcgaaggcgg cggcaacgcc gcgatgatcg tcggcgaccg
   151321 cgagctggcg cgccggccgc ccttcctacc cttctcctgc ctcctgatca ccggtaccgc
   151381 cggcgcgggg aagacctcga gcgtccaggt cctggccgct aacctcgact gcgtgatcac
   151441 gggcagcacc gtgatctcct cccaggcgct cagttccgcg ctcaaccgca gcagatccgc
   151501 tcagatcaag accatcttca ggacttttgg gtttaatagt cggcacgtcg ccctcgccga
   151561 ccgcgttcac ctcaggcggc gcgacgacgt cgcgttcgac ggcgacgtcg accccatctg
   151621 ccagcagcag tggcgcgatc tctcgaccta ctggccggtc gtctccgaca tcgccatccg
   151681 cgccctggac ggcggcaagg gccgcaagga caccgacgac ctctgccgca gcaacatcat
   151741 cgtcatcgac gagtgcggcg tcatcctccg acacatgctg cacgtcgtcg tcttcttcta
   151801 ctacttctac aacgccctca acgacagcga gctctaccgc cagcgcgcgg cgccctgcat
   151861 cgtctgcgtc gggtcgccca cgcagtccga ggccctcgag agccgctacg accaccgcac
   151921 gcagaatcgg gacgtgcagc gcggcatgga cgtcctctcc gcgctcatca gcgacccggt
   151981 cctctccgag tactgcgacg tcgcccacaa ctgggtcatg ttcatcaaca acaagcgctg
   152041 cctcgacctc gagttcggcg acctgctcaa gcacatcgag ttcgggctgc ccctcaagtc
   152101 cgagcacgtc gagtacctcg acaggttcgt gcgccccgcc ggcctcatca gggacccggc
   152161 gcacgccatc gatgtcaccc gcctcttcat ctcgcacgcc gaggtcaaga ggtacttcac
   152221 ggcgctccac gaccgcgtcc gcatctacag ccagcacctc atcttcgagg tgccggtcta
   152281 ctgcgtcctc aacaactcgg ccttccacga gtactgtgcc agcatgtgca ccggggagcc
   152341 cacgccgcgt ccggagacct ggttccgcaa gaacctggcc cgcatcagca actactcgca
   152401 gttcaccgac cataacctgt cggaggacat ccaggtcgag gagctcgccc agtcctgcgg
   152461 cggcggcggt gccggcgggg acgatgacgg cttcgacctc gaggaggaga tgatcaacga
   152521 gaccctgctc acctgccgca tcaccttcat cagggacagc gccgtcggcg tcacggccaa
   152581 aaccaaggcc tgcgtcgtcg ggtacaccgg cactttcgac gatttcgccg agatcctgca
   152641 aaaggacctc ttcatcgaga ggaccccctg cgagcaggcc gtctacgcct attccctcat
   152701 ctcgggactg ctcttttcag ccatgtatct cttttacagc tcccccctca ccaccccgga
   152761 gatcctgcgc gacctctccg agatcccctt gcccgacatc ccgacgctcg tcatcggagc
   152821 caacggcggc gacggcgcga gggacagcga tgataacgat gagtatgagg aggatctgga
   152881 gggtggcggg tgctttgacg gtgtttcggg gggtggtagc ggtaacggtg gcggtgagaa
   152941 gtatcgacgt cgactgacct ccgacgacga ggacgatttc tacgacctgt cctacgtcga
   153001 tcgaggtcgg cagccagagc caccgcagct tcaacctcca ccccaacccc aaccgcagcc
   153061 ccgtctgacg atgtcggcgg cgctgccgcc gcggcaaatc gacgaggaga tctccgacgt
   153121 ggagatgctc tgctattccg acatctacac agataagttc tttctgaaat attctatacc
   153181 tccgcccgtt agctccatca gtttcgagga gatcgttcac atctacacga tcttccgaga
   153241 catctttctc gccaggtatc ggatcatgca gaagcacacc aagggcgcct tcggcaagac
   153301 ccggctcgtc acctacaaca ggaggaacgt gtggcgcagg aagaactgcg agatcgagtc
   153361 ccagacggga tccttcgtgg ggatgctgac cttcgtctcc cccagcaaca actacgtgct
   153421 ggagggcttc accaaccaca acgtcttcat catggacgcc gaacggaacc gtatacatcg
   153481 gcggatcctg gagaagggcc tccccaggct gatcgtcagg gacgcctgcg gcttcctgct
   153541 catcctggac tacaacgtgt ccaagttctc cgacgtgata gacggtaaga gcgtgcacat
   153601 ctgcaccatg gtggattacg gggtgacctc gcgcatggcc atgaccatcg ccaagagtca
   153661 gggcatcggt ctggagagcg tggccatcga tttcggagac aaccctaaaa acctgaagat
   153721 gagccagatc tacgtaggta tctcccgggt ggtggacccc gaccgcctag ttctcaatac
   153781 taaccccgta cgcaacacgt acgagaacaa taccttcatc acccccttta tacgacgcgc
   153841 gttacagaat aaagatacca ctctggtttt ctgacatgag tctgtgtgtt tatttattaa
   153901 ttatctgtca gttcagtcta ccacctcgac cacgattctg ggtatctcgg ggatcgtgtt
   153961 ggtggattgt tggtcattgg actgtaacgg cataaaactg atctgttgcg tcgatcgacg
   154021 ctgatcgcga cgacgacggt ggtgttcgtg gggacccgct ggcggtctgg gtataggacg
   154081 gggattcaag cgaattctag cgttaccgcg gagcctgcga cttgtctgcg ccgtcgcggt
   154141 cgtcgtgatc gttgtcgtct ctgtcgtgtt cgcggcggcg gcggcgacgt tgtcatcgag
   154201 aggtagtgga ggatggaggc atccgtgtcc ctggatcgcg cagagttcga tgtgtccgcc
   154261 tcctcgcagc atggggatcg tgtgtccaca tgggacgatc gccccgggcg gtggcggcgg
   154321 cggcggcggc ggctgttgct ggctcgccgt cgccatctcg catcctgaaa aagaaaggag
   154381 agaacgggtg ggagccgagg ccgccgtgag acctcgactc ccgtgagacc agaaaattgc
   154441 gtacagatgc gggtggttag aatatagtaa tccttatttt tgcagaaaaa taggtatact
   154501 tttcagatag acagttttag acgtgtatat attttatctc agttcataca tctagggaag
   154561 tttaagatga ttgattggtt cattcttgat gaaaatgcaa gggatatatg tatatgttga
   154621 tggtattttc gccgacccag aggcgaatgg ggggtatggt gaagcgagat aaagtttttt
   154681 aacttgttat ttgtaatcta tgtgtggctc ctcccgagcc gcttcgtgtt gatggcttct
   154741 acgaataaaa tgacaaatat gatgtgaaga tctcaaaaaa ctaactacag ctagatataa
   154801 taagatctac tacaacgcag cggcatgggg ttgaaaatag tcagaataaa atgaatgtaa
   154861 cacaaatcta tctatttatc taaaatgata tggttgattt atattatatc tacctaaaaa
   154921 attatggagt ggatatcatt ctcgggcgcg aatgcggtcg cgtagactat acactggaaa
   154981 tgtgatggtg gcgattaaac taacattaca ttttatgagg tgtgtaaatt gtagacaaca
   155041 ttatagacgg ggtcgacgat cgcgcgatcg aagccgccgg atcgtgaata tgatgaaaat
   155101 tgtgtattct ggccggtgcc tgtgatggaa taatcgcaga catcgctcga aatctgtgat
   155161 gagataataa gataacaatg tattttctca tgtctaaaga taataaacaa aatgataaaa
   155221 aaagctataa atgagatcaa gaagatgatg aaatttaatg caagattttc agatctttca
   155281 aactaacaaa ttcgcctttt atacatctgt tctcacatcg gagacgaacg tcgtgtcacg
   155341 tcatcaacga tgccgatctg atctaagtgt gtgatttaat ttatcttaga gagtaaattt
   155401 aaactaaaaa agtataagaa cattactatt gccaggtatt ttgcatttaa ttcctatctg
   155461 tattcctaaa ggagattgtg attcggaaca gaacgaagaa atctaatgat gtaaaagaaa
   155521 aaatatagaa atgaataagt tctaaattgc tactgcgatc atacaggcta acgtttatac
   155581 aatggacaaa ccttatcatc tctatgacta ctgatatatc ggaaacttaa atgattaata
   155641 acaaaactta ttatatagtt agttcttcct actcctattt tgataaacct actacttata
   155701 agacattgtc atgaaaaaaa taaagcctta tgtgacaaaa aaaatgaaat aaaatgatga
   155761 caaagatata attcctctta caaacccaaa ctgacgagcg ggtttggttg gatgttgctt
   155821 aacaaacaga aagaaaaaat attaaaaatg gtgctcttgg tttctcgtgg agagatccag
   155881 tctttttttt ttcttattgt ttgagagttt tctaaagttt acaagtaaat aatcagttta
   155941 ttgaagaata ttgtgtataa atgtttttat aatttttcct agaacccata gtagtttaca
   156001 tagaaggaaa taaaagcatt ttcacagaag cgtgaacaga tttctagaga tgctgataag
   156061 aaagaaggtc gaaacagaga attagattga aacccatttc gatttgagag taacctctct
   156121 atacatgcat ggatattggc taaatatcat tcttaggaag atctagacat aagaatcttg
   156181 agataacagt ttcatacaat tgttaacagt ttcgcacaac tgtaggttga ttttgtattg
   156241 tatatggttg cacattcaaa ttttttttac gcacgaacta gtttctgaat gattttgtta
   156301 cgttttgtcc atgtttttcc ttagatctta ataaatgttt tgtgtatcgt gagtgaggat
   156361 gccgaatctg tggttgtccc ctcacacgct ttgttacggt tcggataaat caacgaattg
   156421 aagaagaaaa actgcatttt tttacatgtc gtgctagtta gtaggagatc tgataacata
   156481 acgattttct catagacgta gaagaataaa ataaaatcta acctttttga atatgctttg
   156541 attttatgtt ttcgtgaaca ctcaaaacga aacgctttcg ttaccatcta ctcttagatg
   156601 ttatctttct ctcaacctgt cgtctttctt ttgcttagaa aagtgctaca acttctatca
   156661 tctttctttt gtttagaaaa gtgctacaac ttctatcatt ttctgtatat tagtcgtaaa
   156721 gagctatgaa acgtgaacgt aacaacgtta acaagctacc tagtagttag aagagggttt
   156781 aagagagaaa tagaactatc aaaactgcat atggttcggt atgagattac ggacgatttg
   156841 atggattctt atcgaattta atagcagcct tgcgtagcta actaaatttt gtctttcttt
   156901 atttatcgcg gatggaatta gctgagagtt gactgtgatt ctttataaaa aaagaagaag
   156961 atgttgatga tgatactttt tccgtgtggt aaattcgaac aacatgaaga gaataagcga
   157021 gaactataac tagtagcgag gactagcagc tcgaaagttg aacgggtatt aacattagta
   157081 agttactata gtacgtagtg tgaacgaacg ggtaaaacgg gtaagggtaa agtagtaagt
   157141 agtgtgtttt ggtggatgac tcggttatgg attgctgatt gatgttcttc ccgacgtgat
   157201 gggttagaac tgactcggtt ggtctacgtg tcgcggacga aaagatcgag tgattatcgg
   157261 ttggccggcc gcggaggcgc gactcgcgaa cgaggtcgag tcgagataca ttgatcgatg
   157321 gtgaggatct gcggggcggt gcgagtgggt atagataata tcatcgtagg tatctctttt
   157381 attccgtttc ggtgggggtg actatgtaat gtaaaaagaa gagctcgatt ccttgacaaa
   157441 actaggtata acatatctgg atttctgggt acaatgtatc agaagtaagt catattgtca
   157501 tttccgtcta tttttatgta tttttcttgt cacatgtccg tattccaaga ggactttaaa
   157561 acaagtaagt ctgatctgaa tttccattga tttaattgat acacaggtaa aaagatgatg
   157621 aaacacctac gtacgtcgtc gtacgaacgt atgcaagcag tgagtagtat atttcgatta
   157681 gctggctttg attaaaggtg tttggtctcg ctgctctcca gcgaactttg tgactttgta
   157741 ttcatcatta agattatcgg attttttttt tttacgtggg cgacgtcaga aaacaaactg
   157801 catcccgtat ggtgcatacg aaggatagat agggtgctta gcgatcattt ctgttgtttt
   157861 ccgcaggtga tcaccgtcgg gaccgcggtc gcggcgatgt caacgtgttc ttttctcgtt
   157921 cttctacgat gatgccgttc tgaaacatta gatctgttgt cgcaaagtga tgaaatggtg
   157981 tgtataggat gggtcgtttt gagcgattaa cacgttgagc actgggttac ttaatgtgat
   158041 aattgttttg tttgtgatag ataatattac aaagtgaata aaaaagagta gttttaagag
   158101 tttttaagaa tttatgttac tatctagcat atctcttaca cccctattgc ctaaaattat
   158161 ggaaaatcgt atatggaaaa gggtagatga gaagtaaaaa cgaaagaaag catatcgata
   158221 agaccacgaa ttgagtggga atctagagac ctacaaaacc aataaaagtt gagcaattat
   158281 attcttcgtt cgttaaaaca cgagagaagt atgtatgtaa ttattaacta actgattgga
   158341 agtagaacga aagccctaag ttggagtaaa ataaatacat gtttaatcct ttatgtgcta
   158401 tatggaatat aactgcttaa tcactaaaca ccttatcact atttgttatc taacttattt
   158461 acctaccttg gttaactact gattgattcg tatgtgttct atggtgaact tattgctaac
   158521 ttatcttatc ttaactaaat aataaaagaa aatctatggc taccatgact acttttgcta
   158581 ccgtgaattg tttataaatg attaaatgat atcaataaca aaaataataa aaagagctca
   158641 agttaaagtt attttctttg gttttcatgt atcttcgaga atcgcagact gcgagcgcga
   158701 ccggcgcatc tctcgcacgc tcatcgcgag gcagaaactt cgaaaaaagg gaggttctcc
   158761 atgggaaccc gtgtgtctgg ggacagaatc tattagtttc gaacaacaaa aaaaaacaaa
   158821 cggttttttt ccactgaaaa ggatttagac aaaagtgaat gcttttgaaa gaatggtctg
   158881 cgcgcccgac gtgcgaccag cgcggccatc gggagcacgg cacggtcctt acacaccttc
   158941 ccttgctgcg aggaaggggg tcaagttgct ggatctctca atccttattt cgaaacgaaa
   159001 atcgcgtgca ggctgctgac cgacgcggtc acgttaccga aataagggtc tgattgctga
   159061 tcgttcttct tgtggagaga gtagttgtat agctagcgtg tgtgtacgtt ttgtttaatt
   159121 ttcttcttcg tcgacagccg tcggcgagag gcttcttcct tgtcccgtga ggggaattac
   159181 catccctcca gagacctcgg gtcgcggcga cccatgtggt cagaatcgcg atctggaccg
   159241 accgccgcga cccggcgtgt attacaaata gccgaatcgt taagcgttga agaaaaagtc
   159301 ctggatgaac attgactcag agagagtaaa acaaatattt cgtattgtag agcccgttgc
   159361 ggcaggatga tatatattgt ctggtaacgt tcatatgtta tagagacaaa aatcagttga
   159421 aggaacaaaa gacattgtaa tagatttgat attattactt actagattga tgatgaaatt
   159481 ttaacagagt gtccatgtaa agttgattat gtgttttttt tatatatata gagatagata
   159541 gattggtaga taggttatag cagaagaaga gataaaagtc acatataacc gtcggtcaca
   159601 cctccgatcg acgtcgtcgt tgtttgcgag acgtcggcgc gttcggcgga gacggatggc
   159661 gcggattcat ttggggggtc agggttgaac acacaaaaac acaaggggga gtgtatcgta
   159721 gcggtggaaa aactaggaga ccggagactg cttttttttg ggtgcaattt ttcgttgtct
   159781 tgttgagtct ttctccggag aaaattaatg acacaggtac aaaaaggggg acatatagca
   159841 tacccgaggc gctcctcgcc gccgtcgccg ccgatagaac gacgaccacg gagatgatac
   159901 caggggccag tcagctggca caatgtgttg acacacacag cttggaagag agagctcgcg
   159961 ttctcaccga acggttcgtc acgttagaga gcgagtgaaa tcagttcttc cctctataga
   160021 tctctctcgt cgtgtgggta cgtacgtggg tcgtaacgtt agttcgttcg tcggtggcga
   160081 gacgttcatt tgataaggtc gatgaagatt gacaaagatt gacaaagatt gatttttaac
   160141 tgttctgctg cggccgtgcg aacagtcaca gagggtcgca gttatagatc gaatggatga
   160201 atatcttctt gttgtacatt atgttgacaa tacaccgtaa ttgccctcat tcctcctttt
   160261 tgcgatttgt tttttaattt cattttttgc ctttgtagtt tttctgctaa tttggtcact
   160321 gatgtattga atggaatgtt gttacatctg cagttacatc tgcatttgtg attacataga
   160381 tctggttatt tgtccagtgc tctatgcgtg cttagtccaa ctgcaacaga gagcttcacg
   160441 catataagat atacagagaa aggattttgc tgtctaacgt cctatacaga tgttagtcgt
   160501 acactgtatc ggcgcatcag atagagttct gtctgtaagg atatatacgc aactatgata
   160561 acgtaaaaga gataaaaaga aaaccaacga agaggaggag aggaggagat gatagacaag
   160621 atctttgatt ataatggata ttgtgagaat attagctaat aaagcctttc ttttttttta
   160681 ttttttttat ttttcggtga gcagacggtt ctgaaaatac agaaaaccgg atcaccctgg
   160741 gaatggtggg taacaactaa gctaaggaat ctattatgat cgtactttgc attgcatgta
   160801 gtttctaatg gtagtaacta acaaaaagtc tcggctctct ctcgagaacc caagacgggt
   160861 ttcccgccga cgaacacgat gctctgtgtc gtcggtcggt tggacatcta tcgagttggc
   160921 ggcgtctgtg tgttgttcaa aacgcgctcc ccggatgtgt ttgttgtttt gtgatgagat
   160981 tgggacacat ttctgtttgt atcgtgttaa caacagtccc gagtttacat acagtttagt
   161041 gttgttgata tagattttta gtggccaaaa tgtgtgttga tagtgagtaa tctcgttgat
   161101 gtaggtgagg actcaagcac actgccctgc cgtgatgtgt ttttgtttga tctttaagtg
   161161 ttattctcta agtaaagcag tacgaggcgg catcgacgtg caggggccgg tcgacgctat
   161221 ctatcggcat tttttatcta gagagaatag agcgaaaatg atttacctag tatctagttt
   161281 catgtttgca tattagtcta ttgtataata ttgtgattat tatatatatc tgcaacagaa
   161341 cagaaagaag tttgatgtag tttggtttgg aattagtttc tttaattttt tcagactcta
   161401 cctagccagg attcctaggc cgattggaga aaaaatgaga tctacgctcg accgaggccg
   161461 agtgaaaaaa aaagtctttt tatagcttta tggaagatat agtacctcta acatagaaaa
   161521 aaaagtattc tgtttttcgg gtttttatga attaccatct aaaggaacga taaaagagga
   161581 cagtagataa agattgattt agtgtacaca cgttgttcct acctgagagc tccgggcctt
   161641 cgggacgccg tcacctccgc cgccgcctcc tcggcctccg ggagatgcgt ccgccgcctc
   161701 acctgagcct gctcggccgt tcgctcaggt gtgataatgc acctttcagt aacaccgtac
   161761 gtttatatat tctagccggg atgcgtcagg ttgcgtctga cggtgaatac ctacactcca
   161821 ggtatcctac ctagcgcggt cacgtccgac gccgcaaagt ataatagcgg agtacggaga
   161881 cacacggtgg tagcgtgatc attttatttc cccgtgccgg tggggttcct tcggccgacc
   161941 cggtcacgga ctttcttttt aacccggggg ctggatgggc gcatggacgg acggacgggc
   162001 gggcggacgg ggacgggttc ggagggagta cgtagggagg tgctccatcg gcggcctgac
   162061 cgacgctcgt cgaccggtca ctcgtctcga gtcaccgtcc gtagcgactc ggtgctcgcg
   162121 tcgagtgacc gctcgcgacg agtgatctct cgcttcgacc gacccctcgt agcgaccgac
   162181 cgctcgcttc gattacccgc tcgtccgtgt tatttgattg ccgcgaacgc cacgaccgct
   162241 cgatcgaagc gaacgggtgc tcgtaccacg tccgcgtgtc cgatgcgatc aagtaaccga
   162301 agcggacctg aaaacgggga aggtccgtca gccctcggag gatcggagga tcggacgacc
   162361 gctcgacacg agctaccgtt agaaacgaac ggagctccgt acgccgtata cttacacgtg
   162421 cgtaacgagg cggaagaccc acatttcggg cggttgctcg tgaacgagcg gtcgctcgtc
   162481 acggcgatac cgacggtgct cgaccccctc atcgagccga tcggaccggg aaaacccctc
   162541 ttcggacacc cgctcgacgc caccggcatc tcgaacgccg tacggtgcga cggacgccgc
   162601 gctatctcga gccgaggccc ctgcgcttcg gcgaaggcct cgcgcggccg gccaggacga
   162661 ggagcgccac taggttgaac atccgcacga gccgccgggc caggtctcgg acgggctctc
   162721 gagactcgat ctcgtgcatg tcggcggtcc gcggtgaggt tatagaccat ctgctaggcg
   162781 ggtccgggga gacaggcaca ttactggcct cggcgcccag cctaggcgtg tctagagctc
   162841 gaccgcgcgt ccggagcgcc attcgaccgg cgggtagcga gaagaacgcc ggagaccgca
   162901 ggttataaca acgtcatgca taaattaaga atgggcgtga tgcagacttt ataaatcgca
   162961 agccggagcg gatcctaggc tcatttcttc tgcgatcttc gcatttagca gaccaaatgc
   163021 tgatagttcc tgcgtcgcgg tagattacgt gcccactttt ctcgtcgcga ccggtgaaaa
   163081 gaccttcgtt cggaccatgg ccgcgccaga tcgacgcgga tcgcccatcg tttcgagacg
   163141 acgttacttc accttccgga actcgagtcg gacgctgcat cagaatgtca cccgcatgtt
   163201 cgacctccgt cagtggacct acgagagcgc ccgcgttttg gactgcacga acggcgaggg
   163261 ccgcaccgag aactgggggc ccggctggct gtgcgcgacc atcatgcagt ctccggacag
   163321 cggctcgtcg tccggatcgg cggcccaggg atgcatgtct ctggacatca cctcggacga
   163381 cggaccggag aaggtcatga acatgttcca ccgcgggagc atcgtctgta acaagaccgt
   163441 ctcttcggtc gcgacgccgc cggggtccga cggcacgggc gccagcctct tgactctggt
   163501 ggcggacggc agcttgctgc aagtcatcct ggtcgaacac tcgccgggcg cccaccgcgc
   163561 cgaagccgac gatgtcgccg agagcgtcgg caacgccgcg gtggccgccg ccgtgcagtc
   163621 ggccacttcg atgggtagct cgagctccgt cggcggcgcc ggtggcggcg gcttcaattc
   163681 ttcggaagaa cgtcgccgcg ataaagactc gtccaaatct cacgatgacg accgacgtaa
   163741 gagattcgaa ctctccaacg gtacccttca tagggagcgg acctcgggta gctccggatc
   163801 gagcggcggc ggcggcggca gcggcagcgg aggcagcagc ggcctcagta caaagcagaa
   163861 ggagcgcagc aggaggctcg aagaggaatg taagtagttc tgatcggggt tttactggtc
   163921 gctttccccc tcgaccttcg gtgaaccgtc acgggactaa tgatgttact ctgttcggaa
   163981 aggttctcca cgcagcgggg gggagcccaa gcgccagaag acccaccacg atccgagacc
   164041 ggagagggat ctggaaccgc ctaggagcag taccactgtc gatggtaatg cagacgaagc
   164101 tggagcggtc tcctttttga acagttatgc tgctagttcg ctgtccgccg tcagcgatgg
   164161 tgcgttacca ccctcctctc cggtgactat agagacacca gggtttaatg acttgataga
   164221 atccgaggag gaagacgatg gaactcggtg ttcgtctgcc gatggtacgg cgacggtaac
   164281 cgagaccggg gcgtctgccg agatcgagca aacgttcacc gacggtgggc tagcatgcat
   164341 gaggtcctta attgactcgc gggccctcat ggatctcgcc tttacgagcc gcatgacggc
   164401 ggtgaagtcg ggatctgagg gagcgggcaa cacctgtcct ggggaacaga ggctttctaa
   164461 ctgcaatctt cctccgaatt cacaggagga caacaacccg cgttttgaag gcgtctttaa
   164521 ttccctgatg agactcttag acgagtataa agacaagagc accagctcga gttccgccgc
   164581 cgtaccggga tccagttgta caggcaccac gcagacagag gggatgcctc accacagggg
   164641 tatcttcgac agggacacat ccgccgctca gcagaaacct gtatgtgaga tacggccctt
   164701 catcgacata gctcgctgtg tcgagccggc ggcggcgccg accgcttcgc gctccagagc
   164761 caccacggcc gccgctcgca ggcggggaag aggctcgcag cctcggagga acagtcgggt
   164821 cgcggcgcgc gtcgcccagg tcgatccgac cgacccaccc gcagctgctg ccgccgccgc
   164881 cgccggtccc accacgcggg gaaggagcag gagtaggagg ggaagacgag gcccagacct
   164941 cacggaggac gggttggaga ttgtcgagac gggcgccacc gccggcactc tggccgtttc
   165001 cgaggaggaa accgcgatgg ccgccgctat gttagaggat atggtcgact tggacaatgt
   165061 gttcgatgat cttaattgat ctcatgaaag atggataaag aaatgatgct ctgtaaactc
   165121 taactgactg ttgttatcga tcgcctcgtc tcgctcgggt cttctgccga tgctgccgtc
   165181 tgtaagcacg caagcaagca ctcgctctat agcagtagaa tatgtatgga tgatatactt
   165241 actgttgttg ttcacttact attatcacct atataaaact tgtattcatg atacttacca
   165301 ctgaaaaaat tgtgtatgtc tttttatact tttgaccacc gttattgatg ataagtatac
   165361 tcttctaact gtgtgtgtct ctgtctaccg ggccgatgga gatattatcc ctggtccccc
   165421 tctgtctgtg ctaacaacat aacatccatg taaataaaat taatattttt aatattttat
   165481 caataaaaac cacacatttg ttacaataaa cacgcagctc gcctttattt tttgtgtttg
   165541 gtggtggagt tggaggaggt tgtgggggag ataataatat tattctcatc ggtggttact
   165601 tcgaacacag cacgttccag tcgacgcgct ccccgcggcg gctcagatac tcgttcgcca
   165661 ggacgaagtg gttgttcccc acgaaggggt tgcgtgctcc ttgagcgcgt ggggacgggt
   165721 ggctggatcg gaggatcaga tgtttcctcg ggtcgatcag gtattccttc ttctgagcct
   165781 gcagccccca caacaagaaa accagtcctt ctctctgctc ggacagagcc tgcaggacgc
   165841 gatccgagag gatctgccat cccagggcct cgtgtgagcc cggctgtccc ttgaccacgg
   165901 tgaacaccgt attgattagc agcacaccct cgcggcacca cgcgtccagg cacccgcact
   165961 tcggcatcga aaactccggg atgctccgcc ggagttcctt gaagaccgtc actagggacg
   166021 gcggggccgg acggtctctc acggtcccga aggcgaggcc gcacgcgctg ccgtcgtggt
   166081 acggatcttg tcctaggatc accactcgca cgtcgtacgg gaaacagagt ctgctccaac
   166141 ggtggacgtc gctcttctcg gggtagatgg tacacatgcg tctctcctga tctaccctgt
   166201 cggtgatgcg gaccagctgt gacgcctgcg tggcggatag tttcagaaag ctcatccagg
   166261 cttcgtggat gcccagcgcc tccgcctgtt gatgaatcac gtcggcagag acgtcggcgc
   166321 cggcggcagc ggcgccgacg tcgtgcaccg cgatgtgtct gagcatccac tgccggagag
   166381 ccatcacggt ctctttcgtt gatattgagg gcgatagtgt tgtcgggtga tcttgatctg
   166441 gtcgctgact gaaaacacgg cggggaagcg atccctgtaa ctgcggagga ctcctatcag
   166501 gtccgtgtct agggacatat ggcctaagat ggtacggagg aggttatatg tgccgtcgag
   166561 cagggacatg ctgctggtcg ggactcggac caccgactcc gccttggtgt ggttgttacg
   166621 tagcagcacg agcacggaca gcacgggcgg tgacacgtcg aggcccaaca cgttctccgt
   166681 gaacaggtcg gtcgtgtagt tcaaccgcat caggtcgtgc tcgtagcaca cgctctccac
   166741 gcaggtgaac accaccgact tcggcgcgtc gcactgggtg taacccccca agaagctcat
   166801 ccagtcgctg gcgcggctgg tccgcatcag cgtcagcaga actcggagct ggtccgtgtt
   166861 gttgtggagc agggacagct gctccaggaa ctcgtcgttg agctcgatgg gcagcgggag
   166921 ctcgccgtag ctcctcttga acctgatcat cgtcgagaac ctatacgggt ccggacggat
   166981 ggggccgtca tcgtgcagcg gttggaactc gctcccgttg tagcagctcg ccagggcctc
   167041 gcggcacttg tgttcgacgg tggcgttgat gggctcgctg cgcggtaaca cgtatacggt
   167101 ggtgaggtcc aacgcccgtc gctcgccggc gaccggcgac tcctgcgact gcgccgcccc
   167161 cagcaggtta cgtgtggaca gcagtatgag caataataaa ggcatcatat gaagtctgcg
   167221 ggtgtgtacg tgtattcggt cagctcgctc gcgagccgta tcatcctgtt tgagagactg
   167281 agtcttttat atatcgtgag aaacaccgaa gcgcccaggc ccggatcgat aatgagcgag
   167341 tcgttaaata tggcgacgtc gctagcgcac tccgcgcgac tgaaagtcac tcgggtgaag
   167401 gcgctcagga cgaacggccc gtatttcgcg gggcagtacc tgcgagtgca taggtctccg
   167461 gggaatgtgg tgatggtggg attcgtggta gtggtggtgg tgacgacctg cgtgcggaac
   167521 gcggcgctag gagaagacac agactcggta gagtttatcc attcattatc tttattagta
   167581 gcattctgtg tgacactcag ttgtgtctgg ggcttcgacg ggaaggagga gaaggatatg
   167641 gtactactgc tgctgctgag gagaggagtg acggtcagag atgctctcga aggtacggct
   167701 gtggtagcgg ggtccttggt ggtgatggcg gtgatgattg tgttggtgtt gttgtcgacg
   167761 tctgatgtgg gtgctggcgg ggctgtcgtt agtgtggtca ggtacgggat gctcgtcggc
   167821 gggacggccg tgaccgtgct cggaacccgc gacgcgtcag tgatcgtcgc cgtctccgag
   167881 ctctgctgca gttctctggt ctgtcgaccc gctctcttca aggtcgatag ggacgtcgat
   167941 ttcttcggcg tctctttctg tagaccggcg tgaccgcttt ccgtctggac cgttgtcgca
   168001 ctctgtgttg acctgttatc ggagagcgga gagttagtga tggatccgac agtcaatact
   168061 accaacgcat catcgccgcc agtggcgtta gttacctgct gaggagtagt cttggcagcg
   168121 tcggcgagct tcgtcggctt gtccacgatc gaggcggata acatcttcga cgacagctcc
   168181 gtcgacgcgt ctcgggccgg ttctgtgttc gcgggggctg ctggtgctgc tcctggttgc
   168241 ggcgaactcg cgcgagtaga tgcgggtgtc gatgttttct tattcttctc ttgatctttt
   168301 tctgagtctg aggactccga ttccgatttg ggcgacgtcg agcctatgga ttcggatcca
   168361 gaatccgaag atggcgcctc cgaatccgat gaagcgccgt ccgagctggt agatgacgat
   168421 gatgatgatg atgatggttc atcctctgag tcggaggagg atggagagga tgatgaagat
   168481 gatgaagatg aatatgagga tgatgaagag ggttcggtct ccgatcccgg tggtaaggac
   168541 gagttagacg gttcgcttga cgacgagttc gtttcgctat ccgagtcgtc tgaggagata
   168601 tccgaagagt ccgatgacga agaggcgtag attaagatct tcgtcccgtc ggtgggggtt
   168661 aagatcttcg tcccgtcgct cgctcgagat agtatggtcg aaacccgttt tttagcggcg
   168721 gtggtggcag cggcggcggc ggcgacagcg ggcgtctcgg cccgagtgct agctgcggag
   168781 gcagaagcgg ctgctggcgc tggtgccgcg ggcggagccg gcgcggcgac cgtcgtctcg
   168841 ttgccgttct tgcccgcttg tgcggtttgt gcagggttcg gcgacgacat cgtgctcttt
   168901 tcgggcgctg cgtctgaaga attggcgttc gcggccggtt gagaggtgcc tggatccgat
   168961 tgaacttctc tcagtcctct atccagcttg ggctgtttgg gtatgctcgg ctgcttggag
   169021 gtcacggagt tttgagctcg ccctccacca ggcgaatgag tctggaggtg cttgacatcc
   169081 ggtgttatgt atacggccgt cacggcgtac gcgacgcaga gcagcgcgcc gacacgaaac
   169141 atgatgtcgt gccctcacgg cgagcgtgtc cgagaggtta aatagttgat gggggtgacg
   169201 gggaaaaact cgctacgaac acgtgtacct gatcgtagag aaactgaatt cgcatttgat
   169261 acccgtcttc ttggccacgt cctgacagac gcgggccgcg gccagcagtt cccgagacgc
   169321 tcgcgagcgc acgatcactt cgtacgggcc ggtctcgatg tgagtgttcg ccgccgtcct
   169381 cggttggtag ttgatctcgt cgaacttggg tttctcgtga cagcggcatt tctccgtcag
   169441 catctgcgcg cccatcacga tcttcaggtt ggggatcttc gccagcgcgt tgtaagtccc
   169501 gcgcgccgtt cgaaacttct gacacgagaa gtggatccgt atgtccgaga cgtcggtatg
   169561 cctgtcgctg cacaggtccg cgagcctctt caataaatcg tttccgaact cttcgtccgg
   169621 ggcgccttcc gcggtctttc tcttcgccgt gatcgtggcg ggtaccacga tcttcggtat
   169681 cttcttgtgt ttctttggtt ccgtcgtgca agaagacgcc gccgccgtct cggtttctgc
   169741 gcgctgttgc cgctgtcgcg gctccggccg gttcgcgggg gccgtcacgt cgcttaacct
   169801 cgtcggaacc ggcctcacca cgatcggtgc gcgtggtacc ttcttgatga tgagtttcgg
   169861 taccttgggc actttcgcgg gcctagcgtc cgtcggctgc gggacgggag agagctcttt
   169921 cctttttagt atgatgagct cggaatccgc gacgggtttg ggagcgggaa cgggaacggg
   169981 ctctgggagc ttgacgggct ctgggatctt aacgggctcg ggaaccgcga cgggttcggg
   170041 gacggtgacg ggctcggaat caggctcagg ctcaggctca ggctcgggga cgggttgggg
   170101 gatgataacg ggttcgggga cgggctcggc gggagaagaa gtaccgacgg gttcggattc
   170161 ggggacggtg acgggctcga ggatgagctc tatggtatcg ggatcggtag tagtaggttt
   170221 ggtgggtgcg tctgtaaaga cgatgagttc gggtggtgtg atgggctccg ggaacgcgat
   170281 gggctcggtg aacctgccgg gatcgggtat cgagatgggc tctggaaacg cgtcggggtc
   170341 gggaaatgtg aggggatcgg aggagatggg gatcggttcc tctatcatcg ggagtttggg
   170401 tagtattggt cgttgccccg gtatcgtggc cgtggccgcc gccgccacca tcggccacgc
   170461 ggtcggcacc atcgccgccg ggtcggtaaa catcggcagc atcgatgccg ctgccgcgaa
   170521 cgtggtcggg atgtcgaccg tgggcatgaa aggcagaggt agcggaggcg gattctgcaa
   170581 caacggcaag aagtgtagct gcggcggatc gacgaaggac gccgccggag gcgccttcgc
   170641 tgccgccgca gaccgctcgg cgagctcttc gtctgtcacg tcggacccta tgatacgaac
   170701 tcgagtctcc cagggagatt ctcccggagg tatcctggcg aacgtggtct cgttcgcgcg
   170761 gatcacgacg actttgtcgt cggagacatt ggccggcgtc agggacgtga ccagaggccg
   170821 agacacctta gcgtacgtga tggtcgacca cgcactcgga gctggaaatc gcacgccgcc
   170881 cgcggcgcga ttgccgctcc aaaacatcat cgttcgcgcg agtaaaaacg ctaagcagca
   170941 cgacgcggct aagtaagcga aggacacaca agacacactt tattcgaaat ctctggtgta
   171001 gcggaaagcg aggcgggcct tcaacgtccc ccgatgacga tgaacgatgt acgcgatgat
   171061 cacaagagcg gccaagacca gcaggacggt cagggcggca tagtatcggg tcgagtgtct
   171121 gcggaacaag aagagtttct tgtagttatg gttgtcgacc atgacgtcta cggtcgcgtt
   171181 cccctgactg tctgcccacg ggacactgaa cgtcatcaga taggtgatgg ttccgttctc
   171241 gttctggatc gacgtgttgg aggtcggcgt gaatggactg ttcttctcgt ggtacaccga
   171301 gatcgacatg gggttcggag atttttttgg tttgggcttc aagtccgtcc tgtttttgta
   171361 cgtgactcgc acgaacagat ccttgacctg aaacccggtc gtcagagaga tgagcgggta
   171421 cgccgtgacc ttccacgtcg cctctttcca atcgggcccg ccgtctctag tcctggcgat
   171481 gtggtaaaaa tgacacttga agaacgtgac acccggagcg acggcgctgt gactagcgtt
   171541 caatatatgg ttcttgttgt cataactgag tttcagcgag gctgtgggag agaaagacaa
   171601 agacagtcga ttagggtaga accccgtacg cggttagctt aactacggac ggacggacgg
   171661 acgcagcacg cgagcgcact tactgttgta gtacttggat ctgcggtcgg actcgaaatg
   171721 agtccatccg taggcgtcca gcctcgagat cttgtgccac ggtttgtgtt cgtgagcttt
   171781 ccagaaacaa tcgacggcga acatgccgcc gttcttaggg tatagcgtca cgctacaatt
   171841 cacgttggcc ccatagttcc agtacgtctc cgcatcgtga cacgacacgg aactaacccc
   171901 gtgcgctgtg tgaaatgcgg ccgcgaacag aaccaaacgt aacatgacct gccgatctag
   171961 ccttctgaaa cacgagacgg gcgcacgcgg cttaagattt aaataagttt attgctacgg
   172021 ctgtaggcgg taacatctcg gccgtcatag tatcatcaga gtcgcacgac agggcggcag
   172081 ccttctcgga ggaaccaccg agatcgatac gatcgcggac ggacactgat gtcattgcag
   172141 cgcacgcacg tccacatgca gatcgtcgcg aggatcacgc acgagaggaa gatcattccg
   172201 atggcgagac tgatgttcga tcgttcagag tcctcgtcgc ggtcctccgt ggccgccgcg
   172261 gttcgagcgg gggacgtagc gcggctcctc cgcagcttat gcagttcccc gtactcgacg
   172321 catttctttc cccgtccgct tttcagaagt ctgggcgaac cgtcgtcggt cgtctccgga
   172381 gggacgctga tctcgtcgtc cccgtcgggt cctcccgtca cgaacggccc ctcgtaaggc
   172441 ggccacctgg cgctcgtgcc gttacagaca aagtacacgg tcgcgttgac ttggatgacg
   172501 acggtgcaga tcagcgcggc cctcacctga cagtggatca tctctcccca gaacgaaccc
   172561 gtggcggaga tcgtataact cgactccttg tgcctcggca gcctcgggtt atcgaaatct
   172621 accaagtccg tcgatccata gtcccgaaag tgtatctcag agagctcggg cacctcgcac
   172681 cggacggtgc aattgatgcg cagatcgtat tcatagtaag agtacgacaa cgacacgtta
   172741 cacgggatcg gcccgccgac gctaagaaaa gagacacaga ccacgagatg gagtagcaaa
   172801 tcaattgaca tttttaatga cgatgtccgt ggagcaaaat aaaaaaagca aagcgtgcag
   172861 taatatataa ctaacgtgtt atttatgcga tgatgtgagg cgtatgcgaa tgagctgggc
   172921 gggtaggaag gatgcttaat cggtttatag tgtgtggtaa tgtcatgaca gtgaagcaga
   172981 gaataaacca tgcgttaagc cagtagactc agtgggttcc gtcacttcgt tgggatgtac
   173041 atgaagtcat cctcggcaga ttccgtgccg tcgccgtgat cgttgctttt cttattcttc
   173101 tttttttctt caggtgtctg cggcgcatga tcacatatag tatagagctg atagctggtc
   173161 agtcccagaa gcttttttag cttgtgcagg aataggttcg gatgcggtgc tctcatggcg
   173221 gccacggcca tcaggatccc ggagaggaat ccgagcgcta gcagtatgca cgagatgagg
   173281 ccgtacgtga ggagatcggt agacgtcagt tccatgacga ggttgaaaat agcgattgag
   173341 ctcggttggg gggttcttat cgtgtcgttg cttttcaaag atgattccat gaggttgttc
   173401 tcttcttttt cacacgaatc ggttagctag gacggcgatg gccgtcgagg agaacgctag
   173461 tcggaacagg aggttcttct tcgaggtgtc ggtcggcgac gagggtgagg tggcagagtt
   173521 cttagtagta gtggagttgc tgtaactttg gtgactgttt atagtctggt tcgaagcagt
   173581 agaggatgat gttgatgatg ggctgggctt aggggtgacg ttcgacgtac cggtggcggc
   173641 gctcgacgcc agcaccgaag cgggatgcag gaggtagatc agccacacca tacagaagac
   173701 caacggtata gcgacccgca tcaccgtatc ttcggcgggg aggtcggtcg atcacgtcgt
   173761 ttcgttaaat agatggcacg aattcgtcct cgtccacctc ctatgtcgcc gcgcgtccga
   173821 ccgaattgtg tcggatggtc tcatctcgac ggaagagatg gtctccggat gatgccgaga
   173881 tctcgatgac ataatcctgt cgacgagtgg gggtaaccct ttcgtccgaa tgacggctcc
   173941 ttaaatagcc tagtttttcg acgatccggt cgaccgaggg aaactgccta ggatcctatg
   174001 ggtttctcgg aaatcggaga cgtttctcga aaacacggta agatgaggcg ccgtcacgcc
   174061 gtgtgtgtgg gccgccgccg cctcaacact cggtagatcc tatacaccgc gcggatcttc
   174121 atccgcacga tccgaaagat caccgccaac gcgatgatcg cgacggcgac gatgacgaac
   174181 aggagctccg gcagcatgac gacgaaccgg acgatgggtg accagaggga gctgtcaatg
   174241 tatcccgaga ccatgtgtgg tagaaacgtc ggaaagtcgg gctcggttcg attgctcctt
   174301 agcggggcag cggggtcttg tggaaattct ggcatgatac ggcgagggga tagatgtgtc
   174361 ccctcgaggg gaacacgcgg gacgatggtc tgtggaaggg acggtgatca tctaccagct
   174421 tgtgtggtaa cgaattcctc ttggaccatt tatacgcgac agcgaacact aacgcggcca
   174481 gtaggatgat cagggtcccc gcgaatgcga tcagggagat aacgtagtca ggtccgccgg
   174541 aggagatggt ggtagtggtg acggtgtcgt tcatggtcgg gtagacgaga aagagcggga
   174601 gggacgcggt cacggactcg tacgtgtctt ttgggatcac aactcggtga tctcggcgga
   174661 cctttgactc tcggtcctgt tgcacggttt atataccttc atatcggaag gaccgcgaga
   174721 taggcgcgcg tgttttcctt tgtggtgaat cgtgaatatc gcggcggcga cccccgctag
   174781 gaagcacgcc accaccacga cgagaaacac tcccgtcggt tgcgcgggtg ccggaggact
   174841 ggggtcgtcg ccgggacctc gttctccgtc gggtccgtgt ccgtttccgc cgctcggtct
   174901 ctcgcccgtg gctctcataa actcgctatg caaaaagatc gtttcaaacc ctggagattg
   174961 cttcgttttc gaagagccca tgtctttcat ccccgtcgtg catctggtgg cactaccgta
   175021 cgaatcgttt ttcgatacta tgcatattag acaagccggt tgaggtggtc tcctcggact
   175081 gtaatacgaa cctactccac cgttcacccc gaacagatct gtaccgaaaa atccggtacc
   175141 gttctccatt ttgaccgtaa cgttatcctt tgcgtaaatt gtagaacgtg caccgagcgt
   175201 cgagtttagc atccataaga tggtgtatgg tggagtttgg ttatgtggcc tacagtccat
   175261 ctgaatagag cccagacccg tcgttgaact cactgtcaga ggcatctcga gaaataatag
   175321 ctttgatgaa gtgcctatcc tacacttgta acccccgtgt cgtgtggtgt tcatagttaa
   175381 cgtggtaatt gtttcacccg atttcgatac tttcacatac acgccgtatc ctccgtcgag
   175441 accgtaaggt tccatgacga cggtcgtgtt tcgaaagctc ccgatcagat agtctgtctt
   175501 gttgtagact ctagaccacg atcctgtatc accgtggcct atacaggtca tgttagtcgt
   175561 tttccaggtc gaggtcactt tccagtcgat cttacattgc acgcgactca ggtagattac
   175621 gcacaagatc acggcgaagc acaggaggct gcgagcacgc cccatcgtcc acggaccgtc
   175681 agtagacaga acgcgtccgc cgaaagagta acgccgccaa cgatgtcagt atccacacca
   175741 acaacaccgc acctgcgagg ctaattaata gcacctggag tgggtgcgtc acaaaccacg
   175801 tccccacctg aggcgttact acctgtccgt cggtgacaga caacgggtaa tcatgcgtat
   175861 cgatttccgg ttcacctgag accacgggga gaaggtcgac cacgcttata gtctgcgtgc
   175921 gagtagcagg acgccctata ggtgtgttcg agtgagaggc ctgaacggtc gccgaatgag
   175981 acctcggtgg cgaggatgac ttcgccgatg tccctaccgc atcgctcttt ctgctggttt
   176041 ccttcgagct cactgttccg gatgcggttg tggcacctgt tccattggtc cccgctgctg
   176101 aactgttaac actgccggtt gcgacgaccc gtacggaggt agattgtctt tcctgcacgc
   176161 tggtaggggt tgatggggac ccgttcgctt ctgaaactga ttgtgaccgt acttctttcg
   176221 acgtaactgt cgcgggcccg gtggaatttg atgttgttgt tgctgctgcc tcgagaagcc
   176281 gccgcaagcg gtatcctgac gggcgctcct cgcgtcgtct ccttcttcgg acagaggagc
   176341 gtccgtctgc tgagacgatg gcgacggcgg cggaggcagc tgtttcagag tctgacggtt
   176401 caccggctct cggcggaccg cgcagacctg ctgggctcgc ggatcctcca gcctgagtcc
   176461 ttgcatgcgc tgctctagtt ggtactgagg attggtgatg tactctgccc tctcttgcaa
   176521 aatctgatga tacagggaga gatggtgtcc ttgcggacga ggcgccacca tctgctcgca
   176581 ccacggatga tagggcgccg cgcccggtgc cattctgggg atgtagaaca tgtctctgac
   176641 taagatctgg ggtcccagga accttaggat ctgaggtgtt gttgttgttg ggaaggggct
   176701 cagcgtgaag attgtcgggt gaacgcccga gaacggaggc tggtgagcca tcattcccac
   176761 gctgggatag cggaagtgtg gaattagagg cagacgagga tgatagcggg cgcccggcgc
   176821 ctccacgtac gatctctgtc tgtagatcaa ggtcggcggg tattgatacc tcaccggtcc
   176881 cgcgcgtagc gggttggaga acgtcatcgt gtgttggacc gcggtgttgt ggcgaatcag
   176941 tgacgcggga gactcctcgc gccccaaggt ttgaggcgag gcgcgtgcgc cagaccgatg
   177001 aaagggagaa ttcttgttct ttttggactt tttcttgttc ttgggtcggg cggacggctc
   177061 ccgtcgaggc tctgggaagg gagagactgt catctctctc tgctcctgag gttggtgcgc
   177121 catagcgtgg cgtcggtctc tgttctctcg aagtcccccg accagcgacg ctcctcaggg
   177181 cgctgtatat atcccgcgtg tcagcgaact cctccggatc gaggacaccg tagacacaca
   177241 gcagagtgtc agactctgag gtgcagagcg cgcacggggt ggcaccctcg gtgtctgtct
   177301 gtaagaagaa gatgatcctg gggaggaact gcgcctcgat cggaggagcg tcctggccag
   177361 agtctatgtt gaaccactcg agcgtgctga cggtgccgtt cttgtcacag aagagagcct
   177421 ctccctgact ggggaataac atacgtagga cggtgatatt cacaacgtga ggcccggcct
   177481 cacagaacag agtaccgttc tcatagttga cgatgaggtc tccgttctcg gcggtctcgc
   177541 acgtcacgtt gctagcgtcg gatgtgcagc cggtgttccc gacgctgact gatatatcac
   177601 gtctggaata ctctcctgtt ccctcctccc ccacaaaagt agtgcctcct tcttcaatga
   177661 agaggcacca ggtgttagtc acttgagcgg cactctctgc accaccgcca ccgcgcgcca
   177721 acagcgccca acaccccacc gccaaaagga ggacggtgtc tactggcacg cgcatgatga
   177781 tgtctcagag acaaagaggg acaagacaca agtgctcaat atatatcaaa aaggatttat
   177841 ttaatagggt tcgacatgag ttaagattgg gggtctcagg tctcaatcaa atatatacac
   177901 agacagttag ttagttagtt atgtatctac atattttaca aaacagggtt catctttaat
   177961 accaagtcca cagtacagat cactcgcagt cagactcata ctccccagac tcatcctcat
   178021 gatggcttat atcatctgcc tcaaactggg cgttcacata actgctgaca gtctcctcat
   178081 agatgggaag aggattcaac ccgcctgtta tgctgcagag cctcatgcac acctgcttgg
   178141 ggaagacctg actcaaatgc agacaggtct tcaccgctcc caagaagtct ggagggttgg
   178201 ctgcctgaat tatcatgctc ctgtagtctg aggtcctggg cacacacttc tgacctcgtc
   178261 tctcctccat gtcccacact gcctgagtac ctgcggtgca ggccgctgag gttctatcta
   178321 tggtctccct gctgtggtta atgggcttgg tgtgctctgt catgaagggg caggagatgg
   178381 acaggttggg gcgcatcccc atgcgggcgc gtgtctcatc cactgccttc ctcacatcct
   178441 gactcctggt gtagaacagc atgatgaact tgtcatgcac ggtctcctcc ttacagaact
   178501 ggatggcctt acccagtaga tactgtgggg actgaggtct gaagggcagg ttcttgtact
   178561 ccaaggccct ggctgggtac ttcctggact tatcttccct gcacttcttg tgggcgttgg
   178621 gggccacgta gcctccggct gtcctgtcta ccatgtctct gatcttatca ctcccactac
   178681 tcatcacagg cttcttgcta ggggcctgct gctgctgttg cttcttgtgg ctactactag
   178741 tagacccacc agagctgctg ctgtgtttgt tggagttgga accagagcta gggggcctga
   178801 aggacttgat cttcagggtc cccctctgta ccatggtagg ggcatcatca ctgtctgagg
   178861 aatccacacg cacaggacac tcatatctgc tgctgggggc agcggcggca tacctcttcg
   178921 cagagggagg tgtgaaagga tggtggcgtt caggtaccgc cttcctcttg tggtggtgtc
   178981 tagaggaccc gctccctgat gatttaatgg aggaccttga tgagtgggag cctccgtgtg
   179041 gcctgtacct gctgctgtct tcactcctac tgctccccct gtagccacta tctacccgct
   179101 catcatcctc atcatcttca tcctcagaac cactagacag atagaactgt ccatctctac
   179161 tgtttccccc actgtgccca ccatgatctg aggaagacct gctggggctc ctctcatcaa
   179221 agtgttgagg agaggaggag atcacctggg gctcctgctc ctcctgatac tcctcctcct
   179281 gaggctgctg aaaaataaag tcctcatctg cctcactctc agagggctta tgtaacttag
   179341 caactacttc atcaagtctc tggcgctgct tgttcttatg cttcttagct ttcttttctg
   179401 agtgtcttct gaagtctggg gtgtttggtc ttctgattgg cagggcgctg tgtgaggcag
   179461 tagttatacc tgacatggag gccgctgctg taacaatatc tatgttcatc tcgggtcctg
   179521 tgaaccataa agagttaaag aagtctttaa tgtgggtaca ataggatcac tttattcaga
   179581 aaacattaag tacagagaat aaaagagggg gtgtggtgtt agtaattgtg tctaagtggg
   179641 caggtgagga gtgtatcatc atcattgtcc aagtgttagt aaaaaagtat ccatcattgt
   179701 ccaagtgtta gtaaaaaaac attgtccatg gtgatgggtg gggagctggg cttgtggatt
   179761 cacttcttgc tcttcttctt gggctgctgt tgattctcag aagacttgga tctggtatgc
   179821 accatggcgt actgcctctt gagagctggg cgaggagcag tgccagaaga agctgccgct
   179881 gttgcagatc tggtcgtagg ttgcaggaca ggagatgtca tgagactgaa tcccactggg
   179941 atgcgggtca cctcatcatc atcttcagaa tcagaatcag tttcgctgtc agtcagaggg
   180001 gcagcaggtc tggataggat gagttgctgt gatccttcca gctcctgaga ttctccttca
   180061 tcagcacttt gggtctcctc atcctcagca ggtgttggtg tctctgaaga ctcaggtacc
   180121 acctggttgt cacttggtcc aggctgggac tcatcttctt cagcttcctc agtggcttca
   180181 ccagcaggtt cctcttgagt gacaccacca acagctcctc cttcctcctc atctgcaggg
   180241 ggctcctcct ctacctgctc atcctcctgc tcttcctctc tttccagagg gggcatctca
   180301 ggatcatact ctatctcctg ctgctgttgc tgttcttcct cccctgcctg ctgctgttct
   180361 tctatcactc cctggggtga tggtgcactc ctgttatgga ctctatcagc tagctctctg
   180421 aacttggcca gagagatggt cctctccaca taactcatac accttgcttg tttcatagca
   180481 cctctgatcc taggcatggt gaagctatca aagatgtgca tctcactcag aagaaaaagt
   180541 gctagattgt atctggtgct cctcagatca gctaaggtag ccaaggttct gcctctggcc
   180601 agcatacagg tggtctctag atggtctttc atgttattac acatcatctg acacaccctg
   180661 tgatattggt gtctctcata ggcaatcgtt tcctgcactg ccttagccag attctccctg
   180721 agcttcaaag cttccaccac taccacatgt gtggatacgc tctcactctc tatagccttc
   180781 atctgctgcc atactgccag ctgagacctg gcatccagga aaggcttggt gtaacagggt
   180841 ggatcatgaa gcctcctgat ggccccaacc aggacacaca tctctgactt aaactcccca
   180901 ggcaatgaac aatcagtctt ggcccatgcg gcacgctcat ctagtgcgtg gtcaatgttg
   180961 gtggctgcca ctatggcctc acctacgtag ctcatccaga ctctcttttc tgagggccct
   181021 agattagtgg gcatgaagtg tgggtacatg tcatacatga gcctccctag ctggacatta
   181081 tcaaactcag atctgaaaca gccgtatatc atcttgcgtt gtctttcgat gcgctcgaag
   181141 atatcattgg ctagctgaca gagaatgttg gtagcagagt tgatggctga ttgatagttc
   181201 tgttttatca tgaggtgtgc aatcttacag gacaacagaa cgctcctcac tggaatataa
   181261 gagtggtttg tataactcaa gtgttctgtg tgggtgaata tgaaagacag agacaggtag
   181321 aggagataag atagttagaa gagtcatgat gtgaataact gagacactca cctgcagcat
   181381 gcttgatggc catgtcgctg ttatcattcc ccacgtggtc agcgatgcgg tccatgagga
   181441 tcttctcttc ctcagtggga tcatcatact catagtctcc caacatgtcc tccagagtca
   181501 ggtcacagcg gacggtttcg gttccagact cgaggatctt gttggcgaca tgagctggca
   181561 ccctgagaga acaagagtgg gaagaccatg agtcaggggt tatgtaaatg cagagtcatg
   181621 aaatgtgtca caagagagga aatggaaaca gaaacttact tgtctgatgg gtagacacgg
   181681 ttctcatcca agtgacggcc gtgggcgttg acggatgcct gatcggcgat catgatcatg
   181741 ttgcaactgg gtgcggcggg ctccatctct ctaaaaaaat ataatttttt atcatcaaca
   181801 gatgtccaca gagaccagaa gatatctaaa gtatacagtg ctaataatca tcagtgcact
   181861 cattttgata tactacctgt cagttgctga taaaaaacaa ctggtggaag agatctcagg
   181921 taaagaaaca acatggaagc ccccttgaca cagacagaat cctctgtgcc ctctcctaac
   181981 tctccctttt ttctgtcagg gcctaggttt tcaggacggg gcaagagaga tcttcgcagt
   182041 acgagcaaca acacgcagga actgacggag tcctccacgg gaaaagagca ccacagcagg
   182101 ccaccaagat ggctgcagcc tctgagtaca atattctgta ttctgctcat ttttggactt
   182161 atcatggcgg ccgtcgcttg taatatctgg tgtgtgaaca caggagacga tctgagcagt
   182221 catggagact ctatcttgga catcgagctc gcaagctccg ccggtgctac agacacatag
   182281 catcctgggg agagacgcgt acgtgtcagg cctttttctg taccacgtta cggtacccgg
   182341 caccgaagca caccgcggcc atggaagagg gaccatcacc agcatatata tataagaaat
   182401 ggagaaggag gccaccatca ccagcgctaa actgatagag agcaaccatc accagcgttc
   182461 tacttgctat caccctaagc taacaaacac cgtacgcagt atggagctag agagccaggt
   182521 ggatagtaga tagataggga tagacaggca gcttgcctta acaccgcagc caataaaagg
   182581 ccttggtcta cttacattgt gtgtcctcga gggggcgctg ggcagccggg ggtcctggtg
   182641 acgtagcctc tgggcctggg tcgctgggtg ggcggtggtc ccaattgggc ggtggtccca
   182701 ataggggcgg tggtcccaat caagatggcg gcgttaccaa tatggcggct gttccaatat
   182761 ggcggatggg cgtggtccca atagaaccga gcgggtccga tgcgcttcag tagccgggga
   182821 aggtcgctct ttcctgggca ggatactgca gcgaggagct ctgcgttcta cggtggtcag
   182881 accgaagact gcgacggtac cgacgctggt cgcgcctctt atacccacgt agaacgcagc
   182941 tcagccaata gaatgcgtgc caatatggaa tttccagggg aaaaccgggg cggtgttacg
   183001 ttttggctgc cctttcactt cccattgacg tgtattggct cgagaacggt actttcccat
   183061 taatcagcta tgggaaagta ccgtttaaag gtcacgttgc attagtttca atagcccatt
   183121 gacgtcaatg gtgggaaagt acatggcgtt ttaattaaat tggctggaaa aacccaatga
   183181 ctcaccccta ttgaccttat gtacgtgcca ataatgggaa aaacccattg actcaccccc
   183241 tattgacctt ttgtactggg caaaacccaa tggaaagtcc ctattgactc agtgtacttg
   183301 gctccaatgg gactttcctg ttgattcacc cctattgacc ttatgtactg ggcaaaaccc
   183361 attggaaagt ccctaatgac tcagtatacg tgccagtaat gggaaaaacc cattggctta
   183421 cctcccattg accttatgta ctgggcaaaa cccattggaa agtccctatt gactcaatgt
   183481 acttggctcc aatgggactt tcctgttgac tcacccccta ttgaccttat gtactgggca
   183541 aaacccaatg gaaagtccct attgagtcag tgtacttggc tccaatgggt ttttcccatt
   183601 gactcatccc ctattgacct tatgtactgg gcaaaaccca atggaaagtc cctattgacg
   183661 cagtgtactt ggctccaatg ggactttcct gttgattcac cccctattga ccttatgtac
   183721 tgggcagaat acaatggaaa gtccctattg actcacccac attgacctta tatgcttgcc
   183781 aacaatggaa aaacccattg gaaagtccct attgagtcag tgtacttggc agcaatgggt
   183841 ttttcccatt ggctcacctc ccattgaccc aatgtacttg ggcaaaaccc agtggaaagt
   183901 cccatttgac tcagtgtgct tgccagtaat gggaaaaacc cattggctta cctcccattg
   183961 acccaatgta cttgggtaaa ggccattgag tcaccacccc tatgctggga aatggtgaac
   184021 gccccctatg tggaaagtcc ctatgggccg ccattagagt gcatgaccgt gctgattcat
   184081 atgccatatg agtgtattag ggggctttcc gcttgggaaa ttgggtaaaa agtccccgta
   184141 ttactcacat agggggcgtt tggctttgca aattagggga tttcagtgca tttggcatta
   184201 aaaactattg gttctagtca taaaacgggc ggagttaacc atataaaagc tgtcccccat
   184261 gccattcgag cccagagcag gacggaccgc ggctcgatac gaccctatct acgttaacga
   184321 gcgggtgaac ggagcccccc aggccgggta aggttgcatt gggctcggct atgggacggg
   184381 gatttggccc ggtactttaa tatgggtggg gtcttatggg tagggggctt attaatataa
   184441 cgccccctac ccatacatat tgcgtcacgt aattagaagc cccctaccac gccattggcg
   184501 cccgcccata gcggtacttt cggttctata caagatggct accgcggttt tcgatcgctc
   184561 ccgggggtct catttctata gctggaaagc atccgacccc catgatctgt gccttagacc
   184621 ccagggtacg tgcctggata ggtgggcgac ccctagcggc tgcttgtatt tttatatcag
   184681 agatcgaaaa tcacagccgc ccgtaacagc tgtcagggct atacaagatg gcgaccgcta
   184741 ctttcgatcg ctttttcttc cctcgatcct gcttccgaaa cgcaacccac ccccggggta
   184801 tgtgccttag accctataga tgccccccag gacgcaggaa aaattttagc tcccctctat
   184861 aattttattc gagcgatcga aatccgcgga ccgcccgggt ttttactttc gttttctcgg
   184921 tcgccgctcg gctcggattc cgagcagaaa aagggctaga aagctgcgct cacctgccga
   184981 aacgcgttgt tcggatcatc ccgggagggc cagcgtagtc tccgttgctg ggttcggccg
   185041 agggatcgag tcgagcgggc ggcgggacgc cgggaacgag agaggatcgg gagcgggcgc
   185101 ccgggtggct cgggagcggc cgggagacgg tctgcagagc tccagagctg cgtgtcctga
   185161 cactgaacag ttgggaaaaa tactggatct tataatgacc caggggaagg ggtccgagat
   185221 cctcccagtg tccgagactg ccaagagaca ctcctgttga aaagcagctc taaaacgttt
   185281 tcctgctcat ctctgccaga cccccgccca ctgacagagc tcaattgata gcagatgtcc
   185341 tctttggaag gacacacgct tccacaaaca ccgttcctca ctgaggtgca ttgtctggga
   185401 gggaaggtca ccttcttgtt cattgtggac ggtgtgcggc ccaggcctcg gacgaccctg
   185461 gcccgggctt ccttcttcct gatccaggta gattgacgtg cggacatcgc gaacgaccgc
   185521 agtcttcctg atctttgaat gactcgagta catgagcgca cctttcgaga ctgatctctc
   185581 ttgttctcca taggtcagct acgcccctgc tccggactcg ctactgagat acctttgttc
   185641 ttcagactga cgccgctaga ggacttcctc ggggagatga ggacaccggg acaggtgctg
   185701 ctgacctgtt gttactagtg agtacagtgg ctggctgacg tgtccctgcg gatcttatac
   185761 aatagttctt gtgtcctgac agaatagcat tgtgggagat ttgcaaggta acctaggctg
   185821 cacaggtgag ataaagctca gagcagagcg tccgagcacg gagcaggtaa gacggcggtg
   185881 ttctctgcac ggatgctggt gaccggtcat ttcttggtga agggactctt gctctcgccc
   185941 gcccgcccgg tcgttcgctc gctcgctcga tccattcttc tttctgattg cagcacggag
   186001 gtcggggtag cagctgtagt gagagtctct cgggtccggg ggcgtgaggg acgcgactgc
   186061 tcacggttct gtttgtctgt agatatggag cgtgttcggg gagcttcctc ctcagactcg
   186121 gtggcgaccc tccacggcga tcacaactac cactgcatgg cgaccttcaa gctggattgc
   186181 acttcggctc ggacccgggg ggttgtaagt atcctggagc acagggaccc cgcgaccgtg
   186241 gacgatatct ttatgcagcg ggtctgtcac gacatcaacg acgtgctgcg gccggtcgaa
   186301 tgtctcacga gcttccccga atacagaaga accctgaggg tggccgtgga ggccgccacc
   186361 gaactccacg gcgtctccgc tctgtccggc cagctgacca agttcttgga ggaccacgat
   186421 ggagcgatgc tgcccctggc ctggcccccg aacaggtacc ttcgcctgac gtcgggcaga
   186481 aagctgggtt atctcgacgt ggcggagaag ctgcgcaagg aataccccat gtgcaacggt
   186541 cccctcgagg ttctcggcgt gatcctcgga cccggacagt ccctctacag cgaccagcac
   186601 cccgtcctct tgatgggcct caccgggacc atcttcctcc acgccagagg caggcccgtc
   186661 tggagtcccg actacgatcc ggagcgggac gccgatcgac tcttcctggc cgccgagtcc
   186721 ctgcagtcct tcggtaggga aggactctgc aggtgcgaca acgtctacac cgaggacggc
   186781 ggcgctccgt acgctactcc cgaggacccc gtgctcaaga acatcgtgtt cacgccccat
   186841 ctcggcggga aggcgctcca ccagcagatc tgtaagatca agggacacac ctggtacctg
   186901 aacggttgcc ccggcatgct gaaggacagg gtgttcgtcg ccacgccgga catccccccc
   186961 ttcgtccgcc acgtgaacct ggaactcttt ggacataggt ttctacccat cggtagggtg
   187021 acccgttccc ccgaggatcc cgagtgtgag atgtttatca tggtggacgc cgggggggcc
   187081 atctacgggc acatgttaga tagcgggaag gtgaggaggc tagctgataa ctttgaccag
   187141 ttcatgcgga tgggcacccg gagggcttat ttcaatttcc agatggttaa gggagatagt
   187201 ctcaacaccg agtacgagga gacctcgttt gggaccaaga accacgggtt ctttctcttg
   187261 accagagacc tggtgaccgt caggaagaag attcagtgag aggacacgag gtatgtcatg
   187321 gtttttaatc aataaataaa gaggttttat tcatcggaca gtcgttgtag cctgtaaaag
   187381 actcgccccg gagggggttc ccccgatgtg aggggcatgc agtagtatgg tgtcctgagt
   187441 gtctcggatg cgttcttgaa ctcgcactct accgccgtgg gggttaataa agtttttgct
   187501 gcgccggtag ggggggaggc cgaggataat aaagttgcta cgtactggtt gaagtctaac
   187561 aatctctcgg ggggatccac ggtccaccgt ctctcggaca cgtgcgagct gttgatgcag
   187621 cgtgaggagg ggtcgttatc cttgccggag aacgtcatct gcaacgtgta ctgtatccac
   187681 accgtgggtt tgaacggatg tatgccgagc ggccagttcg taccgttccc gacccaggtg
   187741 atctcacaga cacactctat ccagttttca ccgtccttca cctcgtaggg gtacttgccc
   187801 accgtgatgc gtggcgattc cgtcatcaca tcggccacgt acatcatgtc ggcggggtcc
   187861 acgggcacga gcctgatggt ggtgttgaaa gctttcagta gcgcaccaaa gataagcagg
   187921 acacgcagtc tggaatctga ccgagatcta tatacacaca gacaaacaga tcagacaccc
   187981 cctatcgcgc cccccgccga tccctctcct ttcagatcaa aacactcacc tgaccagaca
   188041 caagagtctg tccgaccacc aggcccgctt agcgcacacc ctcatcccag agaaggtagt
   188101 gaaaaccacc tctcgtccgc acgaagtgtt agtgtattcg gcgctctgta ccgcgtacag
   188161 cgggagaggg tgcagctgcg gccgcgcgca acatggctcg cggaggtccg cgacggtaga
   188221 cacgaccaac acgacgcaac agacgaggca gcacacgagg agcgttccca tttcagatga
   188281 gattttattg tgaatcagtg aaacgttaag caaaaacata aatatacata ggccgtgggg
   188341 tctccagctt cccataggca gtaacgacac cttcatcgtc acacgtcatc ctgcacgctg
   188401 atgaatactc tagcattcaa cacctttttc ccgggttgtg tcgaggcgga caggtcggcg
   188461 gtcatcttgg ccaccctcgc gttgtaactt cccagcacgg ggcgtacgac ggtcctgttt
   188521 tctcttccct gtctcacctc ccgtgcgtca gatgagccga ccaacacatc gatagtctta
   188581 agatagcctc ctatatccag cctgaaagac aaaaacgggc acacgtcaga gccggggggt
   188641 gattagtcag agagagagcc cttctcggaa cccgaccgtt tctcggaaga gctacctctc
   188701 cagcgccagt ttcatttggg acgcgttcag ggatcgatgg ttgaacccca gctcgagccc
   188761 ggagagcagg acgctctcca cggccagcac cccgtctcgg tccgtcacgg cgaccgtgtc
   188821 gccggcggcg agcacgtacc acaccacgac cagcggtaac ggtaacggca gtatacgtac
   188881 cgcgaacatt tttttcacca gccgggcgac gctgtccagg cttaatagca ggcgcacggc
   188941 ggcgaagccc accagggcga tcgcgaccgc ccacacgctg atcaccaacg cgtgcacgat
   189001 gcgcacgttt cggatgtatt cctggtgccg cttgtccgtc aggcatggac gcgccatcag
   189061 cacgtacttg ttgtccgtct tcagcaggca tacgcggcag gtgcgcgggt ctccgggttt
   189121 caccttggcg ctcatggtca cgtatcttcc ctcgcgtatg gatttcttgt agctggccgt
   189181 tttggcgcag gcctcgatcg gatctttcgt tttggcgccg aaggtgcagt cgtcgttcaa
   189241 ccacgccgtc tcgatcttct gggtgtccgg agttacgcga aaccggcacg tgaaataagg
   189301 ccggtgattg acggtctcca ccgtggcccg gaccaacata ggcgaaaaat cgcgccgttt
   189361 gggcgtgtgt aaatccttta gtaagaccgc cattgtcgtg tccttgcaca tcagacatct
   189421 ctccatatcc atcgaatcgc ccggtctctc gcagtaaaga cacgggtgac gtttctcaaa
   189481 ctccgggtct ctgaacgaca gccggcgatg ccgcttgccg gtcgaactat cctccaccaa
   189541 cttggtggtc aggtagttgt cgtgaagcaa gatcgtgccg ttcggcgtca ccgtcgccga
   189601 ggatttgatt ttctcgggaa ggtagcagtt ggtaaacggc agcggcatgt tgttgggtct
   189661 cggcaatacg aattcacagc tgtaggttcc gttttcataa tcggagtacc acactgccaa
   189721 attgctatag cccgcgagcg gcctggaccc cagcgcgaaa aagagagaaa tcgtgaacag
   189781 cagcggtggt gacattcttc ctgtcgggtg cgaaagtgtg tagatgcggg aggttgatat
   189841 ctactcttta tacaccgggt ttgggggatg gcagtcgacg tcacgaacag ccgttcaatc
   189901 gatactctcg taaatctcgt ccagcgggaa ggagtgcggg ctcatgtctt cgtacccggc
   189961 ggggcgcccc agaaaccccg gggggatgtc gtcgtcgtcc accccgttgt tctgtaccaa
   190021 atagacgcta cattcgatcg ggacctgctc gtcgccgcga ggggtttgct gccgtcggca
   190081 gcgtctcacg agcgcggaga tcgccaccac caatatagcg gccgccaaca acaccgaagt
   190141 cagggcggcg caggtcagca cgatggtctg agcggacacg gtctcagagg gagagggaca
   190201 ttctgtggtg ttaatagcca tgcctcgccg cgattctcct gtcccctctc tcacagagag
   190261 ttctgttctg tccgacaatg agccgcggca ccggaggatc gcgaagtttt tattcccccc
   190321 ggcgctccgg aattacaaaa ctctgataca gcttgtaacg cgggtgcagt tcgatgatca
   190381 gatcgatctc cctcggtgga cacggttgca gcactgtgac agtgacgagc ggcccgccgg
   190441 gtcctaagta acccgatagg aaactccccc gttcgtactc gatatacgcg ccccctggct
   190501 ctggtaggtg gatgctgtgt tcgcttccat tcacacgaac ggtcgcggtc aagtatcctt
   190561 tggtcagcca cccgtagcct tcaggctcgc agctgtatct ggctgcatcc tcactgactt
   190621 tcaattcaca cacaaaagag atctctacct tcataacctt ctccaccgac catctacctg
   190681 attgtgtgtt gatgtaggaa acgaatgacc ccgttgaatc gtggtttatg gtcccctcaa
   190741 atttcacacg caactcttcc atctttttgt tgtcaggatc aaatctgagt atctgtatca
   190801 tggcgtcctc ggccccgacc aacttgcgtg cgacgcatct ctctgtcgtg aatgtagtcc
   190861 acgaggtctc gaagaggatc tctgtgtcgt acaacgtcct gttccacgtt acgtttaggg
   190921 aagcgaacct ttcgttcgta cgaaagcacc actcgatgta ggttttgtta cgtgcggtag
   190981 tgtaacctcg cgtctgcgag acggtagtgg tgatctgcga cgcgacaccg tgcgcgagaa
   191041 ataaccacgc cgccgccgtc ggtaaaaaca ttttattgcg atccccgtca cagttcttgt
   191101 aaatcttcac ggtctatcag gcctcggagc acccatccga tgaacatcgc gcaccaggcg
   191161 atgaatgcct tctccgtgtg cggggtcacg aagtactgtt cgcccagcag ggccagtagc
   191221 acggtcgcga cgatcgtggt catctgcgtc accttccacc agaacccccg cgccggtcgc
   191281 tcgagctcga cacccgacct gccgacgaaa ccgccctgac cgtcgtcgac ctccatgctg
   191341 aaacccagat cgaacgggtc gatcttggcc gtcagcgcga acgtcgtgac gttctccttc
   191401 tccgtcgttt tcgagaagtt cagcccgggg ttgctgatcg ccgacttgat gtgatccagc
   191461 ctcgtctcga agtgcacttc ggggccctct ctgaggcgga gcaggatggt gccggccgcg
   191521 cgtgacacca tcgcgctcga catgtggaat ttggccgaca ggatggagtc tttcacgacg
   191581 aagactcggc gcaccctcgc cgtgagtatg aaggtcgcgc gcgagatgtg ctcggtgacg
   191641 accgaggagt cctcgacgcc gaggtgcggc accaccacgc acgcgtgtcc ccccaggttc
   191701 tcgtgcctcg gctccagctc gatcccgagg tccacgtcca gcaagggcgg ctcactcttc
   191761 cgcacgcgtg cggtgatcgg cgcgcgaaaa ccgtcgtcgt agacgccctc tcccgcgaag
   191821 tccgtgtccc cgacgtattc cacccacatc gaacgacatc tcttcttggg ttgaccgccc
   191881 gaacatttga cccagcccac caccccgcgg gagaatcggg tcgtcagaga acagttcaac
   191941 acggtgggct gggtgtcgta catgttcctc acgaactcgg gctgttcgaa cgacaagccg
   192001 gagggatccc acccccccgg ggctatcagt gccgtcgtgg tgacggccgc gactatcgcc
   192061 gcgatggcgc cccgatacca gtatcgccac atggagagag aggcaagaga gccgtgaccc
   192121 gtcggagacc gaaaataaca gagtaatgaa ggaaccgtgt ctagtttgag agcttttatt
   192181 tatatatgct gggggtcagt cattagtaag tgttagtagt cgatgacttg agttacgtgt
   192241 gacgtacgca acccggcagg ttacacggcg gcgacgagat ccagaacgag atgtggacca
   192301 acacgaggat cgcggctagg aagaaacaag cgacggccgc cagacggcct tccgcgctga
   192361 cgcgagcgaa tagaggatag taggggtagc ttttgagcgg ttcttgcgtc tccaacagaa
   192421 agtcatcgtc gtcggttccg tcgaccttta ttctgatctc ttctagtttc ttggcgggtg
   192481 aggggggtga tggtgttgtg gtcgtcgtag tagtagtggt ggtggtctga ggggacgtga
   192541 cgggctcctc tgtcacgagg gcgtattcca tcctggtggg cttcgtcacg gtgatcgctc
   192601 gggataccag attcaagcat cccgagcgga cgcggcacct aaaccggccg atcacgccat
   192661 cgtcttctct caggtacacg gacaccgaga tcttgccctc ggacagccgc gagccgttga
   192721 tcgagatgga gtcgtcggag acgaaggact cgttagtgcc gacacggctc tgatacaccg
   192781 gctgtccgtc ttccacgcgc tccagcgtga acgcgccgtc ggacaccgcg tcgaaggtac
   192841 acgttatttg gatctcgact ctactcacga agtcgtgtgt cgtcttcgcc tcgatcgtta
   192901 tgctgccgtg taccatcagc gaccggccgt ataacgatcc actctctctc tcgaagatac
   192961 actggtactc acccgggggg aggcctacac ccgtcttttt agatgtttgt atgcatacgc
   193021 cactggaggt gaaagcgtag ttccatgtgt cgacgtcgta cagcatcaag accgattcca
   193081 gcggcttttc caccgcggct atgtagaaca tgtacggcgg gatgtcgaag gcaaacaaga
   193141 actggggttc tgcgcactgg acggtcgttc tggtcacggt gacgcgcttg gcgaaatccc
   193201 agttatggta atcatcgagc ttacagcaga ctctgttggc gacttcagtc ccggtggagt
   193261 ccttggtgta ccttttcact cccgatggca tggtctgtct gtattccaac atcagaggct
   193321 tgctgaccgc aaaaggaacg cacgagagag gagtcatgat gcactgatat ttcacgtgcg
   193381 tcatgggccc ccctctgatc gagacgagaa atcgcatggt accgttgcga tgtgagaggt
   193441 ctagagagac gcgcgctttt ttcactgcat atcgtccggg ttttgtgaag ttgacagaga
   193501 gaaccgtcgc gccgttcgcc tcgagtgtga attcaccctt cgagaagatg cccgtcacgg
   193561 tgcagaggac aaagtctctg cttctgccgc cctgcctcat gccccagatc gtcatcggtg
   193621 gggtgatcag ttgcgtcagg ggagtcgtca ggttacgctc ggtcacgttg acgtagtaga
   193681 ccccgatgtc ggcggtcgag tagttccacc tggcggagaa atgtaatttg tctccgcgcc
   193741 gggccatccc gatccatccc tcggtagcat tgccttcgcc gcagaggtct cgccagacct
   193801 tgaccgtgga gccgttcacc aggtcgcagg agatattgaa cgggacggag gtctctgtgg
   193861 gcaagcgcca ctggcacgca ggtaattgat gcgccgtcac ggccgcgagg aggcagagtg
   193921 cgatcagcgt cgaaggcgcc atcgcctcgg ctctgccgac cgagagatga tggcgacttg
   193981 agctcgcgct ctgtgacaga gtttctgtga tgcggcacgg cttttataga ctgatggttg
   194041 ctgcgcgccc ccccgcgagc ggctgacaca gcgccgctgg actagcgatc ggagccggtt
   194101 tccatgttgt tgctcgtcga tcccgcctga gtcgcgcgga ccagaggtgg cagtttcaat
   194161 ggggttcccg tcttctggag cgagccgacc ctctcggccc tgatgaacat aatctcgcgc
   194221 tcgctcttct ccttgccgcc gtcgaacatg tccatggcgc ggacgtaacg acgatagaag
   194281 tcgcggtcgg agcacgacag ggaggcgtcg cagacccgcg ggtatcggta cggcctcgtc
   194341 tgtcccgaca gggattcgaa ggcttcctcg ggatcccccc gggggtggta agactccgcc
   194401 gtcacgatgg agacggggat ccctttggcg ggatgggtca gctgcctctt cgcctcgctc
   194461 acgttcgaca gggccacgcc gtcctgcaac cgcgatctgg cgccgagtcg ccagcggtac
   194521 cagtcttcca ggtcgcgacg cgcgatctcc tggctcgcga gcgacgtggc gatcggcggc
   194581 cggtcttcgt ccctgtgggg acagagcggc gggcgttcca gacggagttc tccccgggcg
   194641 cctcggtcga agcggttggg cacggcggcg ccgccgctca cgcctcctct cttgaagaag
   194701 accgagatgt cctcggcgat cctgaagacg tcgttactca gcaggcagaa accgtacacc
   194761 gttccgcggg ctccgaccag cacgacggtg gacacctcga agacgaagcc gtcgtcccgg
   194821 tactctccca cggcgccgat gacggtccac gcctcggcca gccgaaaggt gatgtactcc
   194881 cgcacgagtg tgtacgtcgt gtcgtccatc cgcgagaagg gcggcttcct cttcaggtct
   194941 gacgccccga acacctgaaa cgtctcgcgc cgtcccgaga ccgggtcgcg cagggcgatc
   195001 gtcgagcccc tgaacgccgt ggcggtggcc gccacgttct ccaggccgac cacggcggcg
   195061 gacacgatct tcctgaccag ggtcttgggc ttcggcatcg agaccacggc gccgccgtct
   195121 cgatacaccg gctcgcacag agacagcccc cgtctcgcca gctggtcgat gttcctggcc
   195181 gcgtagtaca gcccgtcgga ctcggcgtcg tacaggaaga agcggccgcg ctcgtccatg
   195241 accagggcgc acggcgtctc tctgaagtgc aggtcgggcg agcgcgcggc gcagaccccc
   195301 aggggcgtca gctcgccggc ggtgtcgccg cagcacagat acttggacag gtccacgccg
   195361 cgcagcacgc ggatctcgga gcgtctctgc gggatcaggt accagttctc cgggtagcgg
   195421 agcacgaggg gcttgccgag gtagtgcacc accgcggccg cgatctggcc cggcgggaaa
   195481 ctgagggcca ggtggaagct cttgaagtcg cgcatcgtca gcgagtagag tcgctgcgcc
   195541 agcttcttct tctcgtattt ctcgacggcc ttcctggaca ccgtgacggc cgaggtcttc
   195601 cacggcgagc cgtacacgta cgctcccgcc gcgtcgccgt cgtcggacag gtccgagtcc
   195661 gactccatgt cgaagtctga gtcgctctcg ctgtcgcggg agcccgcgtc agagcgcccg
   195721 gtcccgtcca gcgcggcgcg atctatgaac aggtcagact ccgccatcgc gccgcaggat
   195781 tcgcgtcccc cggccgtgcg atccgtggag tccaatggca ggccgaagga aaactggtca
   195841 tttataaagc ttcttggggg gtaaactggt gacctgatcg ggggaaggct cctctcgtcc
   195901 acgccgccgt attctccgaa cttctggtcc atgcaatcct cgtacgccaa acaccactcg
   195961 tcgtcctgac catcgaaacg caggtcgcgt ctctgggcgc cgcggagaga ccacatcctt
   196021 ctctctctct gtctgctccg tctggcgccg gcgccgtcaa ctcacggtct gcagagtctg
   196081 agcggaaagc tcagagagta gtgactctct tgcctctcca agagccttct ggtcgccacc
   196141 tcttgaaacg tgaccttttt ctctgacatg taacgcaaca gggttcgggt gtctcggttg
   196201 cgatccgggc gtgtcgttag cacgctctcg ggccaccacg tgcatgagcg cgagccatcg
   196261 tcggggcccg tgatgtccat cgcgtgtccg tcgaatcccc tgttgtcgtc gtcctcctgt
   196321 tcccactcgt tggtatccgt ccagtcctcc tcctcgttcg tgtacatctc cccggccttt
   196381 ctcttcatgg cgcgcacggc gtggttgatg gccagcttgt ccgcgtcgtc ccacgtccgc
   196441 atgtcgggcc gaaagcggtc ccggcgacac agccactcgt gttcgttggc gtaatcgacc
   196501 tcgctgcgct ccgacttgcg gtgatcgggc aggtggggac agatgactcg catctcgcag
   196561 cggccctccc cgcgcgccgg acggtcgaag cgcgccccga acgcgatggc cttggccatg
   196621 ccggcccgca gcagcatcgt gatgccgtcc gccacgcggt agaacttctc gcgctgcatg
   196681 tccagcgtgt agatcgcgcc gaacgtgtcg atgacgagca ggtggtggat gctgaagacg
   196741 cctgccggcg cgtaggcgcc cacggccgcg aacgcgtgcc agaagcagca cagtcgcccc
   196801 gtgatctcgt ccaggcaggc cttcaggttc gacgggttca tgatatccag gggccagtag
   196861 cgcgcggcgt ctctcacgcc acccagcagt ttcatcggct ggtacttgaa tccgggggtg
   196921 tacagcgcga cgtcgcgccc gctgttctcc tggcagtaat cggacacccg gtcgagatcg
   196981 tcctggcaca tgatcagccc cacgacgagg cggtgggggg tcgtggtcac ctgcggcagg
   197041 tgcgggcgac ggtacagcgt ctcgcagtgc agcagtccga aacgcgccag tttatccagg
   197101 tccggggcca ccaggatcat ggcgtcctcc tgaatctcgt agacgaagac ccgggtccac
   197161 gctcccagac acaaggcggc gcccgcatcc tcgtatccgt cgttgttgcg gatgacgatc
   197221 cgaccgacga ccgtcagggg ttcgtcgcaa cacacgatgc cgttgatgtc gacgcctttc
   197281 agttcctcgt agcggctcgc gggggtcagc tccacgaacc agttgtgggg gatgcccagc
   197341 ggcagacgct cgccggcgcg cctctcgacc agggacgcca gctccccgcg gttcgactgg
   197401 tggcggtaga agtcgcggaa cgcgagcatc acgcggagaa acgatgagcg ggtggcgtgc
   197461 cgatagggtg ccggatcatc ggtcacgggg agcgactccc acagtgtgct gtccatctcg
   197521 ccggatgaga tgatggtgat aatggtctag agaaaaacgg gccgattctc cgccgcgggc
   197581 cgtggcgatg ttgacaggca gtcccggtga cggccgaggg ttattagatc tgatgctgtt
   197641 agtgagctag gtggagatga taatgccgct ggtggggtgg gggggggtga tggtgggggt
   197701 gtggctaggt ctccgaggga cccggccgcg cgcggtagaa ggggacgatc gtatcgcaga
   197761 aaaactgccg tcggcggcac gcgtacacct cctccatcgt catagactcc gtctcgtggc
   197821 aggtcaacgc gaagtacgtc ggcggcaccg ggctcagctt gtacacgtag ggaccctcgc
   197881 cgtaccgacc gccgctcgac tcgacgtccg acgccgtcgc ggccgccgtg agcttcacct
   197941 tggcgatcgc cgactccagg cggtcccagt aggtcttcat cggatcgccg gtgtccgcgt
   198001 tggtcaccag cgcccgcggc gccacgttgg ggtcgtccag gtcccagggg cggcaggagt
   198061 gcaccttgac ggtggactgc accagccagg cgtagtgctc ggccatgcaa tcggcgggca
   198121 cgtagtcctc atcgtcggtc ggcgagtcga agcggtcgcg gcagttctcc tcgatgtact
   198181 tgaacttctg ctcgggccag tgcgggcacc tgggcatgct ctccagacgc tccttgcggc
   198241 gctctctctg tctgaactcg aagctcgaag agaacaccct cttcagcatg cccatctgga
   198301 agaattcggc cacgctgtcg gcgacgcgcc gcgtcaggcc cgctctcgag tacaccagca
   198361 ggctgtacac ggccccgaac ttgtcggcca cgatcacgtg gtcggccctg aactccgcgt
   198421 ccggcaggcc ccccggcctg tagcccagca ccccgatcaa cgaccacgag cagtgcaacg
   198481 cgtccgacac cgcgttccag caccgcttga actcggggtc gcacatgccg cggaacggcc
   198541 agatccccct cagctcgccg gggtccttcg ccaggaacag cgccgacgtc ccgtagcccg
   198601 gcgtcgtcag ccgcacgaac ttgccgtcca cgaagcgagt gtagcccacc gacgtcgccg
   198661 cgtccgcgtt cgggtcggag aacaccacca gcagctccat gccggggtag ccccgcggca
   198721 cgtcgcacga ggcgatgtac ctcagccgca ccaggtccgc gcgcggcacg gaccgctgca
   198781 tgtcttcttt gtaggcgaac gatcgtcggg agatcccgaa acggccgagc tcctccaggt
   198841 tgcgcgccac caggtgcagc gtgtcgtccg acgccgtgta cacgtacacc cgtccgtact
   198901 cgcccgacag cacgagggac accccgtatc ctcgcaaccc tcgcgtgtcg tacgggtcgg
   198961 aggtccgtcc gcacagaccc aacgggatca gggcctcttc gcaacacagg agcgcgttcg
   199021 ccctgtccgt cagaacggac cagcaactct tgcccgatcc gcacaccacg taccagtcct
   199081 gcggaaaccc cagggggatc accttcccgt ccagcctctc gatcgcgcgc cgccgggcgt
   199141 tctgatcgcc gcccgtggcc accagccgcg agaaggcgtc tatcacccgc ttgtacgcgg
   199201 agatggcgtt cgccgtcacc ggcctctcca tctcgccacc ccggcgcaca cacacaccaa
   199261 ccacccttcc tctcctctgc ctaggacacc cgagaggatg aatgacagac gataacgcga
   199321 cacagagaga ccagagccag aagtgatctg agaagatgga aactttattg tttatttatc
   199381 aatactggag cggggagggg aggggtttat gtgatggcga ggcgatgtac cgtccgtccg
   199441 tcagtcgtca tcgtcggcgt ccgcgtccgc cgacctcgga ttccgagggc agcctctgaa
   199501 ggtggcgtcc acgtcgttca acgcgtccgc cacctcgacg tcgcgacgga ccagctcctt
   199561 gctctccgcg tcgaacgtct tcctcatggc gtcgtccatc tcgtcccagg tgccgctcga
   199621 ctcgtcgaac cgaccttctc tcatcagcca ccccagctgg gacgcgaagt cgcggacgat
   199681 gcggcagccg aagatcacgt acgtctcttc ccacgcggcg gccgccacgt gcgcgcagcc
   199741 gggcgcctcc agccgggcgc gccccatcgt gccgcggtcc agacgccgct tcggcaggta
   199801 cagcttggtc agtcccatac gaaacagctc gtccacgttg tccgcgatcc gccaggtcac
   199861 gtccatgtcc gggtccgtgt ggaagatcgc cccgtttccg atcacgctca gcaccgactc
   199921 gacgcgaaaa ggatcctgcc cgacccgcag gcccacgacc ccgaagtgct tccagtggct
   199981 cgtcttgagg tttcgggtga cgcggtcggt gaacttggcg aactctccgt cggacatcct
   200041 gcagaacggc caccaccgcc gcaggcactc gtcggtgccg cacagcacga gcggccggtc
   200101 gccctccccg ggggtgtgta gcaggatcgt ccgtccctga cacatcagcg cgcgctccgc
   200161 cacggcggtc ccgtctctgg gatcgagcgc cgagaactcc gccaccagct tgacgggcac
   200221 cgcggtcgtc aggggcaggt gccgttccgc gtacaggggt tcgaagttca ccaggcctct
   200281 cctcgccagc tcgtcgatgc tcagactcat gacgaagacg gcgtcggtcc gctcctggtg
   200341 acagagcagc tggccctggg gacccaggta cacgaaccat ctcagctcct cggtcggaac
   200401 gacgcctcgg aatctccgga cgacctggcc gagcagcgtg taacggcccg ccggagcgcc
   200461 cccgtacgtc tcccagacgg gatagccggg gaagctctcg acctgatcgg cggaacgcag
   200521 gcagaggtac cagcccgtcg gggcgccgag gctcagcaac ctgccggact ctttcctgac
   200581 cacgttctcg acggacgtgt ggtcgttctg cgccaggaag atgtccgcga agtcctgcag
   200641 gaccgcggtc accgcggccg ccgtcagata gcgggagcgc ggcctgatgc cgacaggcct
   200701 ctggtctctg aagtgatccg atcggatcgc cgcgcacagg gcgtccatgg cgagggcgac
   200761 gggcggcagc gggaacacgg gtggagaagg gtggtcgcgg gcgttcttga cctatcactc
   200821 acacactccg aataccgatg gcgtcgcgct cgaggcgaga tcggcgtttt atcgcccaag
   200881 tgtgagagag gggcgggtga catgagagat gacatgtcgt cacaggggaa aaccgccccg
   200941 tcgtggacct cgacgaggcg gctcacgcgt cggtcgctct ctcgtcgcgc ggcggtggcg
   201001 ggcgacggcg tctcggcgcg gggatcggac ggggcgacgg ggacgacccg gtggagttcg
   201061 gcgtcgacgg gggcgcgggc ggtggcgaat cgtcggtcgt gtagcggtac tgccgctctc
   201121 ggaggcattc gtgacaatct ccctccgcct cggagcgcag ggagcgcggc ggctccagga
   201181 tcggtgcgtg gtgacgggtc gcgacgccgg tctgactcga ggccgcgtgc gcgcggcgcc
   201241 tcgccaccgc cgccggagac tgatccgtgt cgtagcgccc cgcctccggc gacggaggcg
   201301 gcggcttctc cttgaaccga ggcacgatgt ccgccttgtc cgccgactcg gggcgccagc
   201361 agtcctcgtc acgcagcagc gccgacacca agcggcgcgt cccggctcgg gcggcgcggc
   201421 gacgtgcgtg cagaggaccc gcgagctgtt ctcctccgtc accgtcacct tgagcctcga
   201481 caggcgcagg aaggcgtccg ccaccgcggt ctcctcctcg gacaggatct ccgccctgcc
   201541 gggacgtgag atccacgcga actgctgcgc gagctgcgcc tcgccggggg gtgccacgtc
   201601 gacgcacaga tgcgtcgcgg cgggtcggga gtggaaccac agctcctggt cgggtggggg
   201661 ctcgagccgg acgctccccg cgagatcccg gtcgacccga cggcccgcgg tgaagatctt
   201721 cagcagtccc atgcgacgga gctccgcggc gctgtcggcc agacgccaca actcgccgct
   201781 gatcagcgat agatagaaga tgctgcccga gtcgtcgaag accaggagct gcgccccgtg
   201841 gaacaccccg gtgtcccggt agacgccgac gagtccgagc gtgtaccagc gcgaggacat
   201901 ctttcgagac gcgtatcgga tgaggccgtc gatccgagat ttgtccatcg ccacgagcgg
   201961 ccagtacttg cagcagagtt cgagccggtc cagtaggatc agggggttgg tctcctgctt
   202021 gccgggcgtc cgcagctcga tcaccgagtt gcggtacgtg gacagatggc ggttcaggtc
   202081 gtagccggtc acgcagaggc cgatggcgtc ccagaccggg tctttcttca acggtatcga
   202141 cagcggcacc ctgtagatga actccaccgt cagcagacct atccgcgaga actcgtcgag
   202201 gtcgttggcc gccaacgcga tggcgtcctc ctcggcgctg tagacgaaca tcctcgactc
   202261 cttgcccatg gcgaggtaca gggacgtgtg ctgcaccatc ggcgacctga tctcccccaa
   202321 cacgaccacc cactcgcccg tcggcaggat cggacggagg tcccggccgt ccatctcgac
   202381 cagttcgccc cgcggcacca cggccagcca ccaccccggg gggtacccga cacagagctt
   202441 ggtgccgctc tcccgcttga ctgtcttttt cagagaacgt tccgacgtct gcgtgaggaa
   202501 aaaactcttg aagtctctca ggatctgctc tcggtccgcc gggcggatca gagcctccgg
   202561 cctccaggcc ggatctccgg tcacccaaga catcgcgcac gagacgggcg gacgaagcgg
   202621 agcggagccg aggcaaccac ctctctgctg tggaaacaga gatctgtata ccgtttctgg
   202681 agttacgcgg ccctctttta caccatccgg gtgaccacac ccagacagat cagaggcgcg
   202741 ctcaaatgct gggatccggg accgtgacga tcggaccgtc cccgttcgac caggcgtccg
   202801 acaactcgcg ggcggacatc gtgacggcat acgccggaca ggcctcgacc tgagtgctca
   202861 tcacgttgtc gccgcggaac cagatggtca tcggtaggtc gcatggcggt tccgcgcgtc
   202921 tcttcacctg gtaggacggc cgtttcggct cgtgtcccga gcgccgtccg aacctcctac
   202981 gcgtcttcct ctgttccttg ctcttctttc gtatcaacac gctgccgacc acgaccgccg
   203041 ccatgacgct cgcgggtatg aacagggcca acaggacgac cgagttcccc gcgcctctcg
   203101 cgtagccctt ccacctcacg atctgcagtt cgagcccggt cgcgataccc ttgactcgac
   203161 acgagtacac gtgctccaag cctccgtcca catagacgtc gatatgtttt tggtagagcc
   203221 cgttaccgga cggtagcggg tcgtggtgtt gttttgacgt ttgaggcagc gcaccaccac
   203281 cgccatcatc tttccaccac cgaatctcta aatcggcggg atagtagtcc ctagcgaaac
   203341 accgtagtct catgccgccc tcgcgacccg aggaccgtct ctcgacttcc agctgtggtg
   203401 atacggcgga cgcgagtacg agtttcctat attcagttag ttttttctga cagtcacggt
   203461 ctcgttcact ggcggacgta gccgtatcat cctcggtttc gttgccgtca tacgcgtaat
   203521 gtttctcgat cttagatgta caaccgacgt ctagttgtac ggtcttgacg ccgatcacct
   203581 ttgagttgtt ttgcatttta tctagctcgg cttgcagttc cttacactgc ctcacgaact
   203641 ctttgttctc ttcctctacg tgagatgcgt tcacccatct accgatcccg tgtgtcttgt
   203701 tattggagta tcccacaaag gcttccccgt cgacgtgtcc ggtcccaaaa caacggcgcg
   203761 tatttgcggt gccgtcgacc accaacgtgt atgcgtaccg cagtccggac tcggacgagt
   203821 cctctgtccc gtggcgagcg caactctctc gccaacacac ccacaccacg catatcagcg
   203881 ccagagccct cataattaca catcacacat acgcacacca tgcgacatct cacattcatg
   203941 tcggtacgaa gaaatattac gatgacacgg ggtgagggga ttatgtcctg tttattgtct
   204001 cacgacagac atacagagat tcggacagtc acgcctctat cgtcttatac caagacacca
   204061 cagtagacaa tctgttttta gcgcgagcct tttcgatgtc gagttctccc gaacgtagtt
   204121 ttgtgcggct cgcgtaatag caataataac aaaataccat tgcacagatg cacagggccg
   204181 ttaccgcgac gaacatggcg actaaagtcg gcgtatctac cgaatagccc gagtaatatt
   204241 ttccttgctc gccagttacg atacccgtca agacatcgat cattaaactg atgtcgtccg
   204301 aggaggacgt ggtttccgag acctcgatgt tcgtagagac ctcaacggtc gcggtcttgg
   204361 tagcggtaga cctgacactc gatatcatgt caagcgcggt actcgagacc gtcgggatga
   204421 tagtcggcct tgtcggtcct agagtactga cggtcaagag tgtcgtgttc atactcgaga
   204481 acggtgtttc tggcgtagta tgaaacggtg tagtgtcagt aaataacgta gtagtcgaga
   204541 gcgccgtggt agtcggggac gtcgtgatgg ggggaggcac gtagcgagga tgtctcacgt
   204601 ccttacaagc tccgcgaacc gaagaccgga tcttacagat gctcttagac agatcggagt
   204661 ctgatgtttg gttttgtacg cgcatatata tagtgaacca gctcttggat acttcgcctt
   204721 ttacgggagg gagtccggcg acctctatct ctatagaaaa atagagcggc gcgtacgtcc
   204781 acacctcgca gatcgttgtg ttgttcgacg tgcggaatcg ggttttcagg ctgttcggac
   204841 cgccgagttt ggcagcggct ttgtagactt tcaaccacct ggggtagaga cttgtgacct
   204901 tgtttttcag tagatcggtg tcccgtccct cagcgtagtt cttcaatttt tctgcagttt
   204961 tattgtatat caatgtgtgt tctgtcccat tcacaaaagc cggattatat ttcaacaaaa
   205021 cggtttcgtt cagtacgatg gtcacaacac acccgtacca gaatgtagcg ttgaaggtac
   205081 attcgtatcg tacaccacac cgtgatctca gttccatcag aaccgcccga accgttttga
   205141 gaaattctcg ctggttttta aaaaaatcat attctgttgg tatatcactg tcgttagccc
   205201 atccgtaact gtcagtgacg gttccctcat cagtatgatc ccatctcgga gtattgttcc
   205261 atttgaccgt cagaaaactg gtagtgtcat ccaacgcgat cgtagctagg aagtgaggat
   205321 acacgtcgaa gcttagcatc gataaaacca gtgtcaggtt cacgcggtcg tgatgcatct
   205381 cttcgaaccc gcgagcacat tcgggatcta cgtcgccggg ggtacgttga tcgtagctag
   205441 cgaacgaaac cgccaaggcg cacattaggt atgagaccac ccgacggtcc atcgcggagt
   205501 tgaaacaccg gtcctcagag tctgccccta catctgtgtg cggttttaac ccgatgagct
   205561 cgtttacata accctttcaa tttgacgcag ttcatcaaag aaaacacggg gtttattttt
   205621 attgcattgg ccatctgact cttacacgca cacgcaaggc attggcgact ttcgttgcat
   205681 gtagatgagt gccagtacag tgagaataaa taacaaacct gcgataatgc ccacgatgac
   205741 cgccctcgga tcgaaaggtt tcgatcttct cgatctgtgg taatacgacc gcgtggcaat
   205801 ctgtgacacg cgcagcaatg ttggtcgcat ctcgtgttgt tttgcgttat catctgctat
   205861 gtcagttcga ttgaaactga acgtatattc agctttccac ccgaccttcg attcaacatc
   205921 acaacttagc catacgggat tatgaccaaa cttaggtatt tgctgcgtcg catatgcgac
   205981 aaagacgcga tcgtctaacg attgtacaac gtcctccccg gatgatgtcg gttgtgccct
   206041 gttgtctgct cgtgcgtcgc tcccaccatt tacagtgaaa catacattta aagttaaagg
   206101 acacgatatc tttaccgtac acgtcaaatg aatcatctcg tcccgtttat atgccgaaaa
   206161 cttagtgtct agtatcccaa ctacacaatt attgagaatg tttcggtgta tgctcgatag
   206221 ccggctgtaa actgtagaat aatcggagat gcgtagaact ccagttaaca cgtttatcac
   206281 atcaatcaaa ctctgtccgt ctccgttttc agggttcttc tcaaatcttt cagatatgag
   206341 tcgaccatct gtaacgccgg ctatcgagat cacagaaatc ataactttat tgtctttcgc
   206401 gaacgaagat acgcactcga gcgtatcagg cgttccgata cattcgtgct gtgctgagac
   206461 cgaagcttgt gtgtagagtc tttctcgaat gctcgtgaga tcttccctat gtaaacggag
   206521 aaccggatca aacgcattcg tatcagtgat attacgtacg taatccgtcg tatcctttcc
   206581 tgaccgcgag ttcagagacg ctataggaaa agaataagga aaagaaatat cggactcgaa
   206641 cgtgtaacta ttcgacaata acctgctgcg tacgacgaaa gagacatcct gggcgttcgt
   206701 cacgtagccc acccaaagcg agaccacgca ccagacggcg atagcgcgga cgcgaatcgg
   206761 actcggcgtc gtcatcgtcg cgagccgcgc gcgatacgga tagagactaa agacaacatc
   206821 acacaagttt attgagatgg gaccggaaag gttgaatttt tttattcatc gtcgggaccg
   206881 cagggttccg ctacatatct gttagctatc ccacggaggg aatatgcatg cacggtcaac
   206941 acgccgataa cgaaggccgc ggctacgggc gccagtcgta ccgcgtcggt ccccctctga
   207001 tgccgctcgt gtcgcgtcca gagtccgtgc gcctgcacgg tcagatacac cagccgaaag
   207061 gcgatcacaa agtagatgag gatgcagatg ggcggaatcc atttcaagac tatcgcggtg
   207121 gaccagtccg gccttttcgg tacctcgtcc tcctctcggt ccgcgtctct ccgatccttc
   207181 actctgaacg tcaggtagtg tcccttcaga taactttttg tttccgatcc cggtcttcgt
   207241 tgcatcttat tccacaaatc agtctgtatg tgaaaattaa catatagatt agcaaacatg
   207301 atgttctaga tatctaccca gcaggatgac cgtctcgttc ttcagagacc tccgaattct
   207361 tctcgctgaa tttaccgcca ccttcgacac cgtcccagac tccgtcgtcg gtgacgtaca
   207421 cgagcggaaa tgtccaacca cccccacaga gccgcacggt acccaccatc aagaagacgc
   207481 atcctccggg gtgatcactc atgagccatc tgaaaggtct gaggtggaaa gcttgccaaa
   207541 aaccgcttta tatacaaagt ctaagcggag cgggtgtcac gcggcatccg gtgatgcttc
   207601 ctcgtgtcaa tcgaccggtc gatcacacgt ccgtgctcga ctcgccaggc ggtctgccga
   207661 agacatagcg tgcgctgatc tgtctgtgcc gcgtcggagt cagctcgtcc agactcgcgg
   207721 cgcgatagcg gtcgtcggtc ctcctcgccg cgcgctccgc gtcgtcgcgc ctgagaaaca
   207781 cataggcaca caagaccccc ttcaacaccg taaacgtcga tacgatcgcc acgacggtga
   207841 ccagggacag ctccatgccg cacgcggccg gctccctctc tgtcgtcgtt gccgttctca
   207901 agatcttggc ctcgtcgtgc gacggggtcg tcaacgtcac cgtccacccc accgacgatc
   207961 gaatgacaca gaccagatcc gagggctcga agctcgaggt cgtgaaatcg tttaacagcg
   208021 ccaccgtatc cgaaaagaac cggcgggacg cgttcagaga gaccgatctc aacccaccgc
   208081 ccctcaccgt cacgtcgaag ggtagcgggg ccgggctcca caccgaacag cagaagaatc
   208141 cgtgtcttcc cacggaaacg tgaaaactaa cctccaagtg ctcgggagcc gccagcttca
   208201 tgatcttcaa acgcgtgctc gaccaacgac cgtgaatcga gacctcgtta cgacgcagca
   208261 cgctcagatc gaggtcggtg gtgaactttg tcaggttgtc cgatgagtga tccgcgatca
   208321 ccaccttctt cttatctcgt accgttacga tcgccgatct aacgttcgta ccgtccgcgg
   208381 tgtgtacaac gaggcatccg accaactgcg gtgcgaaatc gcactcgtat gtcacgttgt
   208441 gaacagccgc gctttgaccg aggagccgac ggaacgcggt caggtggaac cgctgatccc
   208501 acagaaaatg tacttcggga tcatcgacct tcaggtcgga tacagaggga tcgcggtcgc
   208561 gtatctgacc gcgaccgtct attcttacga ggggaaagct atcgttcagg gagattgtcc
   208621 ccgcaacgaa gctatcgctg aaaatcgaag ccgagaagac taacgcgact gcgctcgcgt
   208681 tacgcacgat gaaataacac accaggataa ccccccacgt tcgcacacgg accaccgcca
   208741 tcacgacaga cgtggagagt gagtgagaga gaaccgcgac aatacacatt tttattagac
   208801 cgccgacaat cagttatcga aagctgagct cgctgtggga cgtcgattgc gttctcttgc
   208861 ggaacctggt gaccgtccta tccatgagca gcagtcgtat cttgtgtcgg aagatgacca
   208921 cggaggatag cacgacgagt agaaccgcgg gaacggcgag cagatagagc aaggaacaag
   208981 atcttttgcg accgacatgc gatgtcgcct cttcggcgta gctcacgacg atcgaccgat
   209041 tggtgtatat gggaagatca tccagttctg agccgttcga gacggagagg acggtgcgcg
   209101 gtgacggact gagttctccg ggcgcagcag aaagtgccac acgtctctcc gtcgtggcgg
   209161 ccgaactgtt cggctgccgg atggtgacgt tccagcccgc ggagcatatt atctcgcacc
   209221 gcggtgagtt gttcggggag acagaagaaa aagctcttac cgaagagatg ttattagtgt
   209281 tatcgaacac agatgatgca ttcagctgaa catcggaacc gacgatagtc atccacagta
   209341 tcaccggtga cgagactgtt gcttcgcata cgactccgtt cgtcatacta gagaaactgg
   209401 acaccgaccg ttctttggtc gctttctcca tgatgagcgt acatatgctc tgccatctgc
   209461 gtcgaatatc accactgtgt gtggttaggt cgaatacccc ataccctgaa gccatggatc
   209521 tgaatgcatt cacaagactc gttattccat caccatcatc actgtcgaaa ggcgaggata
   209581 ttaagttggc tctcccgaca ttataatata acacatccgt ggcgtttaga ctgtgcttga
   209641 cgctgcagta gaaattcacc gatagatggc actcgtacac cacacttatc tcaccagcct
   209701 cggaaagcag tcctcggact tgggacagat gttgcttctg tccttgcatg aaaatgaatt
   209761 caggatcgtc cttcgtcaac atgacccacc ctgtaccaca gacggtgccg ttatcgtaca
   209821 ccgtcaacag cggcactgtc tgctttagac cgacggtctt tgtgaccgca tcatgaagcc
   209881 cggccgtcga cgccgtaaga acgaggaccg gcgactcaca cacagaggct gcggtcgtct
   209941 tcaccaaagt ccaccacacg agcgcacgta tcacgccaat catacctcaa cgagcccccg
   210001 tccctccatg cgcgaatatg ttcgttcaat gagtcaccac agcggaataa agagttgact
   210061 aataagttat ctttattgta caagtgttgt gtgttatccc tgagcccatt cccaggtcaa
   210121 cccgccccag attccccacc gaggttgatc attgtccagt tagtgtatgt ggcccgacgg
   210181 gcggctcgag cgagagcacc cgacgatctg acattgtcca gtgtgccggt cgcacgaaca
   210241 tcaccacacg cggcagttga tgtagaccag gcgataccgc atacgaggcc agacccgatt
   210301 gatccacacc acccgtaact tcaccagata catgaagacg atcacgaaca cgactccgat
   210361 cgcgatcaag gaccacacgt ccatgaagaa gatggagtac tccgcggaga cgggaggagc
   210421 gtgcttgaga ccgtgtcccc tgtgccacga gacgaccgcg gacgactcga actgcccatc
   210481 gatcgacgac aacagcatgc cgggactctg ttgagggtac tcagaatact tgaccgtagc
   210541 gtaccatccc gtcggggaag aaatcacgaa cgcgaagtcg gtactaccgt tcaggtctct
   210601 gagatcgagc cacgcttcca ccttcaatcg tccaccagaa tacatgcgca tgtacttgta
   210661 gatgtccact ccgttcgcga gactgatgtt gtacgccaac ggaacctgag tgcgcatcgt
   210721 acaggacacg tagccgttgc ctcgattact gtacagcgag tattcgttgt gtctggggtt
   210781 gtccatggcg acgatcttcc gacagaagga cgtccagcgt ttctggagta gagcagcgtt
   210841 gtccctcaag atagagattc cggacccttg tccgtagcgc gcgatgtcat cctcggatac
   210901 gtcgggagag tacggcggag acccgagcgt ttcgacgcct ttgtctacgg tgtaacgtgt
   210961 caacgtattg ccgtccatca tctgaagtac ggtacattcg aatggaacga acttgcatct
   211021 atattcgaag actaccggcc gtccggcttt gaagacattc ataatgtact cgtatacgaa
   211081 cctctcctgc tccacgaaga acgcactctc ctgcgccagc tcgctcacgt tcatccaagg
   211141 aaaatgtttc acctctccgg aggcttcgat ccgaaagata tcagacgact gctctagatt
   211201 gatactgtgg cggaacatct ccggaccttc tctgtacgag atgaacgtcg ccgtcaggtc
   211261 ttgacagatg tccacccgct catcctcgaa tatgcgcacg tccatatagc tgctgcccgc
   211321 cgtctcgcct cggtttatga gaaccgagag gagcaagtag gtgatagcgc ccagcattgt
   211381 acaggctagc gatcgggaga ccgacggtga aacgtggagc ggtgacacgg cttgtgatgt
   211441 tactctttcg ggagtagccc gcgtctgagt tctctgtgag cgcctctgct ctttttatac
   211501 tatgtgtcca tgtttaccta acatcgaaag cgaaagtccg gactttccca aaggcctgag
   211561 ccgaccgagg cggactcgtg cgtcgatcac accacattct cctccgtatc cgagcactcg
   211621 ttctcttgta accccaacat cgagaccgtt tcatcctcgc gcgtgtaacg gatcgaatat
   211681 cgcagccgtt cggccatgcg agccaggcgc ccggtgacga tcccgtgcac caggagtccg
   211741 acgaccacga ataacgcgac gaatgcggcg acggtgatcg cgatggtcac cgtggtcagt
   211801 ctcgaatcgt tgatcgtcct ctggacgaag gccggaccgt gttcatcgga catgaatccg
   211861 tgcggttcta cggggagcag cggcctcttt tgagcctgcc tcgctttcga ggccgctacc
   211921 atctcctcgg agaaccgaag acggaccgtc cagccgctcg acgaggtgat ctcgcaggtc
   211981 gtattcaaga tctgacttct gttgaccggc agataggaag ccacttcgat gtccgtgtag
   212041 tagtccgcgg acaaggctat cgcacgggag tcccggccgg cgctccacac ggtcatatgg
   212101 tatttcaaag ggacctgggt cgtcatctga cactgtacga tatccatctc gatgtcatct
   212161 tctagaatgt catcttctag agtatactgg ttgtcgtccg gacggtcggc atccttgagc
   212221 ttcttacata tctcagtcca ccggtgttcg atcgacttcg cgttgtccgt cagcagtgtc
   212281 acgttcagac ctctgatata cttcaccaag gtatcctcgt tcttcgtcgt gtattccgat
   212341 gtcaccgatc gtatcgtctg tatagcaccg tcgaacgaca tgatcgtctc tcctttccac
   212401 cgatgtgtaa tcgtacagtt gaactgaggg accggacatc tatactctac gaccagctcc
   212461 ccgggggtct ggaccacatc cgcgtagtac ttcgagacga actcgcggtt ctgtagtaga
   212521 aactgtatct cgggccacga ctcgttcgcg ggaaacgacc actcatacgt gccaggcttc
   212581 cccccgttct ccatgctgac aatcgagagg gtgtttttga gcgagatcct ctctcccgtc
   212641 gccccgctcg atgttctgga gacggaaaag atgagctcca taggtccctg gcagatatcg
   212701 accgttcccg tcctgttaac ttcgggccgc acgacctccg ctgagccgca cgcccagaac
   212761 cctcctgaga tgagaaccaa cggcagaagg agaaggggaa tcatcgttct cccggtaccc
   212821 agctttgtgt gtggggccaa aataaataag cgcgccgata aatcacgccc ttatggttcg
   212881 aatgcccgta taaacaccgc accagagacc aagtataaag cagttttatt gagctgatga
   212941 gtcacacata agactcgtca taaccttccc cgagtgccac ctccccaccc ttatcgtctt
   213001 cccaacggtg tgtgatcagg agtactcccg cggcgatccc agataaaatc acaacggtga
   213061 tcaggatagc gagtatcgtg tcgagccgat tcgggcctat ctggttttcc gtatcctcat
   213121 cccggtcgat cagcgtcgtg agggtggtga tcgtgtcacc ctcgtcggag gtggcggtcg
   213181 gagaggcggt agtccctgtt ctcagcctgg tcgtactcaa ggtcgtggtc gggatggatg
   213241 tcttagacgg tgtgctcccg gtagacctcc tcgaaacggc cgtcgtgcta ttcatcggca
   213301 tcgtagtcgc gatactggac gccaacttca tgctagtcgt gtatccctgc gtggtcaccg
   213361 tagtggcgtt ggggctggag ctcatactcg aagtgatcat cggtgtcgtg ctaggtttcg
   213421 aagatgtatg aacgacggcg gccgtggacg atggttcggt cgtcggtagc acagtagaag
   213481 tggtggtggt ggtggtagtg gtagtggtga ccgtggacga cggttcggtc gtcggtagcg
   213541 cagtagtagt ggcggtggtg gtggtatttt gtcccttcgt ggtaacaggg cttggagtag
   213601 taacaacggc acctgcacta ggggttgccg ccgaagagat cgcgtccgca gcggtagagg
   213661 tatcgggctc cgtagtctcg ggctgaggtg tagtcggagc ggtcgccgcg accgtcgacg
   213721 ccacgaaagt tgacacatct aacgtactga tctcgctgct gacaagcgta gtcagcagtt
   213781 cggtcgtagc gaacgtggta ccgggctcgc tagtgggctc gggcgtcgta ggatcttcgg
   213841 atgtcataag atccccggac cccgtcatct ctagggtagt ctcgctagta gcgtcgagag
   213901 ataccgtggt agaagtggca ccgacagaaa gttccattcc taccgaggag actaacgcca
   213961 aaagctctaa acgacccaat gcgacgacgg gatggaataa gcagcagacc agcgagctta
   214021 gcgcatatat ccgtaacatc gcccgcatcg tggtcgagac cgtatctcgg agcaccccct
   214081 cgtgaatgtg attggcgggc agacgcgggg ttctggtctg ggtctatcct atcgtcaaga
   214141 tattgccttt catgtttgag tggccacacc cagatatcta cggtccccct gacaatcgta
   214201 gtcatatcac atgatttctc gacagatcga ctacaccacg ataatctgtc aggacatcat
   214261 gtgtttaact cgatgttttt ttaggccctt atatataaga ccacgatccg cgagagaaat
   214321 ctgactcgtg cggccggtcg cacgcgccga caataaaagg acgcgataca cgtttgggat
   214381 agcgagtgtc ataattgttt tattaatcga cgggagcggg gggaccgggg tgatcatttg
   214441 tagacgggcg ggacgctctt cttctcccct tcacaggagg cggcgaagca cgaacggatg
   214501 tttctccgca gcatccagca catcacgacg aggagtacgc agagcacgac cagtagggtg
   214561 tacgtgacgt tgatgatgag ttcggcgtcg tttaggtacg gaaccacttt ggtatgattc
   214621 ttcggcgtcg aggtgacctt gacggatgat ggttccgagc gaaccctcct gttgagcggg
   214681 catctgggat atccctgcac cgacttacga cgcacgcgtc ccgaagtggc attcctcacc
   214741 gagcccagcc aggtcgttcg caccgtgcat acgagaccgg gtgcactctc cgtcacggct
   214801 tccagataaa agccgcctcc cgtgtaattg agccgaccgc cggcgtatcc tatgttaccg
   214861 cattcgtccg tgatggcgac gtgcatcctc cttcgtcctt ctgacttcac gccgcatttt
   214921 gtgagattcc gaccgtcttc cacttcgtac cagaaatcta tctcaagtct cgagaactta
   214981 gccgacctga cgttccacag gcacgttgcg ttccaacgct ctctcacatc atccgcgtgt
   215041 tcgagaaact cacgtaaacg cctcgcgttg tccgcgtccc acagcgtatc gttcaacgaa
   215101 cagttattag gctttggttc tccgtaggtt atggtacgat tcttgatgga gttatagtac
   215161 agacgacagg tgtcagacca aagaccgatg tagtaatccg acatgttgtt gggtctcagg
   215221 cgaaacgtat attccaattc cagagggccg tcacccacga gctccctcac ggtctgcagg
   215281 tacgtgctct gattcgcgat cagagccagt tcggacccta gatccgtagc gttagggcag
   215341 ccgttacatg acatcgtgat ctgtccgtct tggatggtca tgagatcgaa ggtcattata
   215401 gatctgatac gagcgacgta atcggtcgaa ttctctgaat tcaggtagat tgtcaggacg
   215461 gtcagaccat cgcagtaatc gtcgttgtca tcatcatagt cttgtaaatc gatgtaggcg
   215521 taggcacaag cgatcaagag caggagagca catactcgta cagacatttt cgacgaaagt
   215581 ctgtaagaca aaagtaaatt ttagtcgcgc gagacgcgag ctgtcgatga tacgtagtcg
   215641 gacaatgagg gggctgtgtg ccaaagatct ttctggcact gaatggacca gacgggtcat
   215701 tgaagttcaa tatatgcgat gtcacaatac acgtcatacc ggggactaca tcggtcggta
   215761 ttgaattagg gtagctcatc tcacgtagaa catggtacac aaacgcagat actccgaagt
   215821 cacgaccgtc agtgagatcg tgaccattat caccaagata gttcccacca taattcccat
   215881 cgtcactaga gtcgtcaaac gaccagacgc ataaatacca cacataggat gagtatcggt
   215941 aagttcggta aatgagaagc ggtagaacgg ttgacattcc ctttccagtt gacgatcccc
   216001 gtccatttcg aagagctgat attgacaggc acgcgtttcg tgcgatattg tgacggaggc
   216061 gtcacgacgc ccttccatcc caaggacgaa gtcacgtaac atctttgagc gtgactaccc
   216121 ggggccttca cggtaaggat ctgacagtcg accgtcgatt cgtcagtaac gatcgcagag
   216181 ctgttagtgt tcaaggataa ttctacggtg aacggcacgt tcgacctcga tgtgaccaca
   216241 cacgtggtca agccggtcgt gttgtaccag aactcgactt cggtcgcgtt catgtatgcg
   216301 agttgcttta acttttggac tgttgaccgc catctgttct tgatttcccg aacgttgctt
   216361 tttatcatat aggtaccaat ttcttttgcg tcggaagttg aaaattttcc tgatccttga
   216421 atattaatct taccagtctg tcctgtatac gctaccctga ccgtatcggt agtatgatag
   216481 acatcacata taacgtcgaa tcccaaaaac agacatgcat atcgtacgca gatcctttgt
   216541 gtgtcccaga gactttgtgt caataggtta tttagacgca ttttttgtat gtctagaaag
   216601 acgtactcaa tatcagtcga actgacatcc ggacagattt tacatatctt ggggtctcta
   216661 tctccaacgt cccacacgac gactggacgt ccgttgtcta cagaaatcgt acgcttatgg
   216721 acgccacctc ttgtaacggt aacttcgaat tccatagtga atgtaaattg aaagtcgtcc
   216781 atattcacaa tatatgtgtc atcaggatca ggattgaaaa ttgttacagc acgttccgag
   216841 ataaacacaa tcaagagtaa ttttactagg gggacgatga ccatgtcaag aggtactgaa
   216901 tatcggggta cactttctca aatatcgggg ttcagattct cctgcgtttc acacgccacc
   216961 tccaaaagaa ataagcaccc acagacaccg gcactaacaa gagtgacacc actaacacgt
   217021 ctaaccacgg agtccgcagg gttgtatcat tatcctctac agagacggac gccgctgtac
   217081 ggtttctcac cggtttgacg gtcgttcgcg gcggcgcgag gtgcgagaag agaagaagat
   217141 gctccaagac ttcgtcctcg gacgcgacac ccgggacgac gtcctcgtaa gtcagcggtc
   217201 tacggataca accgtgttgg agatcgccct cgtacttcac tgacgccaac cagccggtag
   217261 cagagtagat cttacagacg ggcgttgccg agaagtttcc agccgccgtc acgctggcct
   217321 tcgcgtaatg taacacggga atcgtatcaa cgagaaagtt tgtgcggtcg acgtataata
   217381 ttaccgtgag ccgcagaaac gacctcgaga tcgcagtgca gcgaaagccg ccggtcacat
   217441 tacagaattc tacctcggta tgcggcggtt tcccgaattg tattaattta tcaagcacag
   217501 gggaccagac tcttttgata cgctcggaat tttggagtag tacatcatat ccaggttttg
   217561 tatgatccaa tctgatgtcc ggatcagaag catcagcgag gagcggggat aggagcggcc
   217621 tatcatctcc cgtacgtgaa acatcgcatc gcacgtcgtc tccgaacgta cacgtgtacg
   217681 agacatcgat cacttgagca ccacgttcaa gatcacgcag gttcgctaga taaagtcctt
   217741 cggtctcgaa aaagagtatc tcggtcgaca actcgtcggt atcgttgggt acgacccagg
   217801 ttagaggtac gagatcgcct ctctgccatt cgaggagacg gtagctaccg ttgatcgaga
   217861 gactcgccgc gaactgaacg ttcctgtcga ggtatccgat gatctggata ctcagcggca
   217921 gtttgctgag aatgaattct tgagcagaga agagagctgc ggagaccaga aggcagccca
   217981 gcgttcccca cctcgacaac atgtcacaac ctgactattc cccgaacgcg cgatagaaat
   218041 agcggcacac gactcgatga gaatgtaaac tttattatcc tcgacagaga tttcgataga
   218101 aactccattg ttaatactga caaactggaa aatatagtta gcaccgttag agagggcgac
   218161 agatttcgat cagagatcag agcacatagt tttcaatcgc cgctcgcaga cgaacgagca
   218221 aaagccgatg caccctatca tcaagaagac cactaagacc gcgacgatcg cggccaccag
   218281 catcaccgga acctcgctgc ccatgggtag cggtccgtaa ggatagggca ccaccatgaa
   218341 agacgcccac tttccgggcg aagacactag acagctcaga cggtgaacat catccgtggg
   218401 aagggtgatc ttgatccgtc cgaccccgcc accgactccg tccggcatcc aataaaaacc
   218461 cctaggttta atctcgtacc catccagtaa ccatgacatc tggatgtcga aagggctgga
   218521 agtcctgaca aaacacttga ccgtagaatt tctttcggtc gcgttgatga ccttcgtgta
   218581 gccgacagcg cgaccgagag tattgagtct tcggatatag ttcacgaagc tactccaacg
   218641 ccccccgatg gtattcatgt gcggccataa actagtcatg gccgtgttgt tgatccacac
   218701 ggaaaaagta ccgttatcat cggagacgct gacataagtg ttgttaaact taaaatcatc
   218761 ggtcagatta ccgtttatcc tctgtcgaac ccagcagacg gtcccattgc ccagcatccg
   218821 acaacagtcg tacgtgatct gaacggagat catgcccgtc tcgtcgaggt agttcgaaga
   218881 cctgttctga gcggtatctc gcataaagtc tcgatgttgt tggagaaagg tcacctcttg
   218941 ggacgtgttg ccgacatcgt agccgtacgt ccacgtcgtg gtcgaattat cgttcacgct
   219001 gagtaagagg gcatccctct cattgatgga tgcaccccaa ctgaaattat aaaaggttcg
   219061 acacgaagga acggcggtta tgagctctgg tgtcgtagac ggcagagtgg ttagattctg
   219121 caaggtacta ttgtgtatcg acgcggtcgt tgaaacgttc gcagaaccag gtgtcgtgac
   219181 gagcggtgta ctaattgccg cagtagacat caccgatgct accgtaggag ccgcggtaga
   219241 aaaagaacaa tttgtatatt ctccaattat atatagattt atctgaggca tgtatagaca
   219301 ctcctgactg aacgttgaga gaactaacgt acccagtccg attaaaaaat acgacgtcgt
   219361 ccacatggtc gctcctgcgg agaatcacga gataatgaca gcgaccgaca cacccgccct
   219421 tatctgtata gaagcgagcc aaaacaatga caaatacagt atgttttaca aaagtttatt
   219481 acatataacg gacaatgttt cgtatagaaa gcatgggggt attgcaataa gctcgcagat
   219541 cgattgaagg ttcgatctga caggaacagg caactttatc ttctccagcc atttgagtta
   219601 gcgtgttatt aggaagactc ccaggaatac taatagcatc tgttgccacg atgatggctg
   219661 gatgcgatgg cctgatgagt aataagcggt gtaacctgaa tcacaaacca tactccatac
   219721 cgcagctcca catgtttcta ctttacagga tacacagtac gcgtactcaa attcgtcggt
   219781 ccacagcgat ctgttaactt ggacagatcc gtcatggtcc catttaagtt tctcactgcc
   219841 ccacgttgtg ttacatccat ctgaataaga ttcattccaa tacgttgccc gacctatcgt
   219901 tgtaatcgta ttagatgaat gataccaggt tacattgtac gtgccacaca tcctctgtgg
   219961 tctgcatgac atctgtactc cgagcgtttg tccggtccgc gttcggttgc gtgtatgtgt
   220021 tgtgatcaaa ggtcccaaca ccggaagcgc ggaagaacga ccggtaacat cggtactgtt
   220081 gtaaccaagt ttgcatgaga taagtccgtc acacaaaggt ttcattttaa gtgttgaaga
   220141 tgggcctgat tttgaagtgg tgtcgtcttc atcctcttcc tcttcatctt cctctgacga
   220201 ttctgaatcg cggttagcgc tacgtgaagg aagatgtata tccatagttg tagtcgatga
   220261 tccactaaga acatatggat gttttctttg aaatccgcca ctatagccac caaaagtagc
   220321 tagaatagtc tcggtcttat taccggtaca tagtatcttc caaaatcctt gaacattttc
   220381 aaagccatca gaaccagatg acgtacaggt atattcgagt gaattgacat cggggtcttt
   220441 agctgtgaga tgaacttggt agtccgcgtt gttaatttgt atcaggtatc ctagaagcaa
   220501 acagagcttc gttatgagac gcatggtcga agcgatcgtc gtttgatgtt atcggggccg
   220561 aagcaagagt tccaagcaga tagatatatg aaaaaaaata taagctgatg acaaaaagaa
   220621 ccacggtcga cgagattttc caatctctgg gatcagctgg cacgtaaacg tcaaagacgg
   220681 gatcgtcgaa acggatctcg ggagagacgg cgatcttgtg aagcgatcta cacgtacagt
   220741 gcgtgcggcg tcccgatatc cgtaaaccgc gagaaaagta gagccggtct cctcgccaac
   220801 gagacgtgtt tcgccacgtg ccgctgatct ccaccgtatc ttgcactatg ccgtccggtc
   220861 gaccgtcgac agtagctacg tgttcagagt ccacatacca agagatggta tgatctaggc
   220921 gattgccaaa aggacaatgg caggcgacta cgagatcgct caagttttga gaactagcga
   220981 tgatgacgcg tgcggttaag gaaaacccag gctccgaccc cgacggagac tgttctatac
   221041 atcttaagga catgtcgtcg ctccgggaac agacgtgtct cgattgtgta tgcatgaaaa
   221101 gcataaaggc gatgatgtgt atcatcgtga ggtgatagga aagccccatg tctatcggaa
   221161 acacactacg gttcaagaga gggccctact cgttagattc caccatctca gattcgggaa
   221221 tggtgcgaag gaccgcccgc agttgcaagg gggtacccgg gtcgaactcg ccactgtccc
   221281 tgttcagagt ctcagactga cttcgtctga ggtcaaacgt accgtgcgcg tagataagcg
   221341 cgaacagtag gctggctgcc aggcagagga tcacaagact cagggccacg gccagtgccg
   221401 tgtaactacc gctcgtgtaa atcaccgagc cgagaccgtt ggttgtggtg atcggcggac
   221461 ctcccaaacc gttcgaagga tatgccagga tatgaaccct gccgccgcca ccacggcctc
   221521 cggtcgtcac gttttcgata acaggccccc ctaacgcgct actggcgacc accgtcgacg
   221581 ttaaaatctg cgacgtggta gccaagacgg tgtgatcgga ataattgtcg gcagggacgt
   221641 aggtggtgtt attatagaga tacataccgc gattcggtag gacgtacagc gctatacgtc
   221701 tgtgtcttcg cgccgcgatc caccgttcga gccggtcgaa agccacccga cagtgaacgg
   221761 ccgggtgcct aacgagtgac acttaaggtc gcgagcgggg gaagaaagga gaacacggaa
   221821 acgaacaaac gtacgcacat caccagtgtt ttattagaaa cacgttaata aaaattatac
   221881 ccggttatag ggaacgggac ccagtctctc tttgtcaccg ccggatcgcg atccgttcgg
   221941 ccgtctgagg tacacgaccg ctaacaccgc ggccccgatc agtccgatga gcagaaaggt
   222001 cacggccgcg acgaaaggac cttttccgat gctcgtgttg agatcgtcgt ttatcagaag
   222061 cgaggttggg gcgtcgggtg ggtggtgctg gtgggaatcg ttcttcagat ggccttctgc
   222121 gtcgacctcg acggcgcccg gctctggggc gacttgttgg gtttcttcct cgcgacctag
   222181 tatatctatc atctccgtga ggtaggcgac gtcgggaccc gaagacgata ccgcgtggga
   222241 ctgcagcgcc tcttgaacgt cgggttgttc gcttatggtc ggtccgtcac cggcaccctc
   222301 cgtcgggtac gaaggcgttc ccgatacact gcttgtcgcg cgatcgacga ggagaagagt
   222361 cagaatcatg acgaacgtcc gacgcgcgac gaagcgttcg ttgcggccct ccatggctga
   222421 tggttgcgcg acacgacccc attcaccggc acgccaccag taaaataccg gatttcgaac
   222481 gtcgggaaca gcgacggcct gacgtccgag accaggtaga tgtacacgac gatcgtgacg
   222541 atggtaatac acagcatcac cacgaaggcg gcgaggaaac gctccaactg acagtcgcag
   222601 ctcttcgatc cggttgaact gcgcgccacg tggacgggtc gacattcgat cgtcggcaag
   222661 gatagcaggt taccgccgga cccgacgacg cacgatacgc agacggggag gtcggagcgg
   222721 atcggaaaac tgagggccag gtcggatgcg ttgacggtaa aaccctcgag ccggttcgac
   222781 atccacaaga agtcggtggt gcccaaggtc tcctcgcccg ctgccacgat ggcctggttg
   222841 ttgacggccc agaagatgcg cgagtaccga ggagggcccg cgtcagcgcc ccacgtccga
   222901 cagtagtcct ttccgaacgg ctccgccgcg tccggtacca ccggctcgat cgtcaggagc
   222961 tcctcgcccg ggacccaacg taggagggga ggcggaatca gacacatagc ctggctcaca
   223021 tggtcgatgt cgcacacgac gaggcccgag aagccgctag gcggccacag ctcggtcgtc
   223081 attgacagcg cgtccgccat ccccgtgaaa ccggcgacgt ggatgtgaaa gctctcggca
   223141 tcgaacgtgg cgatcgtcgt cgtctggaaa tcacggcctt cgggcagcgc gaacgaccag
   223201 ctcccgacaa acttcttcac cgaaccgggt ttcacgtggc agatcacggc ggctttgtcc
   223261 tggtcgggat agatcttgtt catgcagtta tctgagagga ctccgtcgac gcagcttccg
   223321 acggcggacg ccgaggccgt gcccgcagct gaagccgccg cgtagatgag ggcgagcatc
   223381 ccggccttga agagtcgtcg ggatcgacgg tcctcctcgg tccaggggat acagaacggg
   223441 agtcgtcggc ggtagcggcg acgcggtctt ctggaagagg tcggtacaca gcgaggacca
   223501 cgaggaccga cccgagtgcc gccgcggcta ccccgatcga aatggctaca cgcaacgcgt
   223561 cgtcggcaca tcggcaactc gggttccccg catcctgcca gggagacggt agctgcgcgt
   223621 ctccccctcc gacagccgcg gagaaacatc gccttcccac gtgtgtggcg acccgaggcc
   223681 ccaagatctg gcaggagaag caccggtccc gagaccgtct cgggaccagc agatcgccgg
   223741 tcaggggatc tagtgccggc cgcgacccga ccgtgcggtt cgcgacaacg cgagcgagac
   223801 cctctcgcac acgctgcacg ctcccgacta aacctgtatc tatccaccac ctcactgtat
   223861 atatcccttc cacccctccc acactacccc cgtcacccag atactgctca caccgcacgc
   223921 gagaaaagtc agaaccgcga ttcgctagcc gtctcagcct gggaccggcg acgaccgagt
   223981 acttcgtcgg ctccctctcg tccccgccgc acgacaggac tacctccagc cggtgcggca
   224041 gatagaacac gaccctgtcg gaggacgcga gcgacaactc gtactcggcc gcccggcccg
   224101 gccatctcgg ccggatcgag atgtagtccg ctcgcgaagg ccgagaccag cggcagccca
   224161 ggaggagacc gggtctcgtc agcggcaggg tcaccaggac ggatggccgt cccgctcgtg
   224221 taggggacat caacagccac gtcaggagca gggtcagcat cgtaggcccg agggccatga
   224281 cggccggtgg ccgcgagaaa aaggaagaga acgcacagac gttgaaagtt gaaagcagaa
   224341 agagaacttt attgggggag gttgtaacat atcaacggtt taataataga aaaggaaatc
   224401 gggtcacagt cctcacgccg tctcctcgtt cacgagtatc tcataggccg gtccgccttt
   224461 ttttcctcct gcgcccggcg agcgggaggg gaagcaacag ctgcggagca gcgctagcgc
   224521 gttgccgatc agcacgatcc ccagggccag gatcccgagt cccgccacga accacgtgat
   224581 gacgatcagc acggtgtgca ggatgtccat gtggcggcgt tccgtcggcg tcaccgtggt
   224641 atcctgcccg aagtcgaacg gcagcgctat agttttcgcc cgggccgggc agctcaaccg
   224701 ggagctggta gctaccttgt ccgcctgcat cgtgcactgc agacatgcca ggcgctggat
   224761 cgtgctgcgg gcgaagacgt ggatgtcgcc cgtgtaggcg ttcacgtagt acgtccgatc
   224821 gccgtcgggg agttgttccc aacgcacgcg gccctccacg gggttgttct cgctccactc
   224881 gatgctcacc aggggatagg gaccgtgcca ccagcgcatc agggtaggct gcaggggtgt
   224941 cgacccacgg atgttggcca ggcaacgaaa caggaacgga gcgagcgtgt ctctgtcggt
   225001 gctctgcaac agcgccacct gagcgggcgg cagcacggtc acgaccgccg tctgtccgta
   225061 gcccttgatc acgatttccc cgacggtctg cggtggcagt ttgagccatc cggacgcgta
   225121 cacgtccacg gtgtcgtcgg tgagcggagg cccgtgaaag atcaaggcgt ctccgacgta
   225181 gaggtcgctg ttatctcggt acctcacgaa gcctctccag tcgagctgac ccaagtacac
   225241 cgtctggtcg tcgtggttgc gataggagac gttgaagccc gagcgcacgt cgtgatggcg
   225301 gccgctccag gagaactgga tcacgttctg gtcttgggta tcgtacagga agatcttgat
   225361 gggctcggga cgcggacgct cctcctgggt gaccgagccg agggcggcgg tggtggtggt
   225421 tttcttcggt ttgctacagt ctacgagcgc ggggcggctg acgagccacg cgagacacca
   225481 gaggcagagg aggacagaga agctggccgc acgtagcctg gcgactggcg atagctgttg
   225541 aggaattgct ggaagcgcca tcccggatcg ttagtgtccg ccgccggagt cctctgtctc
   225601 tggacgcccg cggcgggggc gctggcgctg atggtgccgc tccctctcga agggtcgtgg
   225661 cgaatgctgg ctaaaaactt ccagacctcg ctcttttcta gatctcctga gggggaggcg
   225721 ccctgacaga gcgaacgtcg atccaaacac cctcttccgc acgcgcagct gctggccctc
   225781 aatggcgact gttgcggaac ctgaccgacc cgcgacgagc tcgaggcccg agggtcagcg
   225841 tcaggcccgc cgtggccacc gctccgaaca gcactccggc tcccgccgcc gccgtcgcgc
   225901 tccacgcgca gccgtttggg gtcgaccgtt tggaaacgac ggggagtctc ctggaaggag
   225961 gatgagaacg acacgccgtc gtggctaccc ccagcagtct cggttggatg accgtgcatg
   226021 aaacgcagag ggtccccgcg gcccaggcct ggtcctgaag caccatccga tctgacaccg
   226081 tttcgatctc gaaccacggg cggaggtccg gacttggtct tcgggtctga gggacggtgg
   226141 ttgttctgct gttgccgctt cccgtcgtct cccgcggcgg gtgttgctcg tacgagaagc
   226201 tgcttgaacc aggtcccgag gtctccatcg ccgttctgta gatcgacagg gtctgaggtc
   226261 ccgaggactc gggcggatac gatacagtag ccgccactga cccgtttaac caccaggcca
   226321 agccgtacgg agccgaacga ttcgaaagca ggcgggggtc gccgcgtgga ggctggcatc
   226381 gcacagccca gctttctggc gacgcttctt cccagcttaa cgagggcgcg ggctccacgg
   226441 agacctcgga agacgagttg aacacggcac acgccaggct gcccgcgaaa ttttctgtca
   226501 actcgatcca cgaatgtacc cagtactcct tcgtcttcct cggaggcttc ggagtctgag
   226561 tctgtttttg agggttgcca ccacttcttc tgctgttgct gacacctcgc ctcgagccac
   226621 tcggagagcg cggaggtcgg gacgaagaat ctgggcggcc gtctccagga gagtcctcgc
   226681 cgatcgagac cgggctcgcc ttctgccagc gccgctgcga ttctttcgag gtctcgctct
   226741 cccaggcgaa ggcccctccg tctctgagca gggtgatcca ttggaaccac gagccgttga
   226801 acttcgcgat ctccgtccga gtcgaacctt cgatctgcca ccaggtcccg ttgatccgag
   226861 gagccgaacc gtgccacacg cactctgcaa ctgttctacc gccccgaaac gacgttgtta
   226921 tatacggaac ctttgtttcc acccacggtg gaacgctatc gacgctccaa tcaccgttgc
   226981 tcgagtcaca acaccacccc agaatggtta cacgcaggac caaccaccac aaaccacgtc
   227041 gggtcgcaac atccgctgtc aaagtttcca cactctgcca cgtgagcatg atgtctcatg
   227101 ccacttgagg tagaaacttg gcccgggacc gcggaaagtc cccaaacttt ccacactcaa
   227161 aggtcagttt cgatgcaagt gatccaaaac taataccact ttccggaacg agacgggaaa
   227221 ccgtcgtcgt tcgaccgtta ctcacgccaa gttattgtcc tcccgatggt tcgtcggcgc
   227281 cagagaggtc gctttcccag gaggtcttgg ctctcgagag ccgagcccgg tgccaggaac
   227341 cttgtaccca caggatggcc tgccgaaccc acccctccat gtgacgcggg taagcaccca
   227401 gaaaaacacg atgtaccaga cgagatgtca aatcattgaa tagcttttat tgattcgaac
   227461 tggcgaaagc tcaagcggga aggagatgag aggtcgtccc ggatgagacc gaccccccga
   227521 cgtccgctcg gaacagaaaa acaaccccgg gaacgaactg accgttcgat gtgacgaagg
   227581 gcgaggggaa aaacatcggg gaaggacaaa aggtcattcg ggagctgggg tcatggaacg
   227641 gtcaaggtta cgaggaaaaa ggtcgggaca ggtcagggat cttaatgcta agtggataac
   227701 acggaagacg gacggccgtc gaccgatcgg accagccgac ggttgacggt gaggatttag
   227761 tggcatgtta gcaccgcgac ccggaggtct tagaacatat agggaaccac gatgagggtc
   227821 tcggacggag ctatagcggg gcgaccgaga agacgaaact tcacgagccg tttacacaga
   227881 aacgaaacct aaggacgggt catctacgaa ctagggagca tgcgaggacg gacacacgag
   227941 ggaaggatgt atgtgcgtga aagaacacgt tctcgtaaaa aacaaaaagc gtattgcatt
   228001 caagtagcat ctcccgatga ggagaccgtt ctcaggcaga catccgaagg gacttctttt
   228061 cacagcttat tattccgcag atcgtcgtct gggggagatc acggacgggg ggagacggcg
   228121 gacgaggatc gctccgagga tagcgtttct actccgaagg agacgggcag tcggtcggat
   228181 gtttcaggac ggaggggaag gaggattcac gtcgaggacc gagagccagc cggagaggtt
   228241 gtcacctgtc agacaaaaac aacgttaata attatcatcc gagccagatc tagcgtcggg
   228301 cctccctcat cacggggggc acctacctct ttcggtggcc cgccgctcct gcgtatccaa
   228361 gatcttggcg aacgtctgat aacgacgtct ccaaccgcgc tgggcgaaca gaggacgctc
   228421 gctgatcgga cggacgttcg tgtagtacac ggcgatgcga cgtgaatcca ggtcagggag
   228481 gtagaatgcg acacccagcg ggtgaggccc gtagggttcg cggggatcgt agggacagca
   228541 acagaaaaga cggcaacggc tatcgtcacc gaacactttc ggtgacatga acgatgaagt
   228601 ggcggagaaa gtagcaagct cggtgtcggt cggacgacat tgcagctccc agcgacgaag
   228661 gttgtggccg atacccgcgt aggggacgaa cgggaccgcg ttgctcatcg cgagtccggc
   228721 gtcgcgggga gcgaaaagct gattagatgg tgttgataca cgtatccatc gcaacttcgt
   228781 cgcgcgcgaa gctgacagac cagcaggact tggtttcggt cttacgcatg gtcattccac
   228841 tgcacacggt gtgggccaga cgacgcagca gctgattttc gcagaaatct tcttcggcgt
   228901 tagcgacaga ggtatgcagg cagtgttcac tggaacggag ggtttgtgtg atacatgcac
   228961 cgttatcgat ggccatattt agcgtgtcac acgacctgga cctcatgacg gacgcgggaa
   229021 ccgccggagc acagctcacc acagacaggc agagagagac caccgaaagc gacaggtcac
   229081 cgggatgtga agctgtcgac tgcgaccgct ccacactcag cttttataca cttcaagcgc
   229141 acccgcgcgg gggaggagac aaaagagcgg ggatttccga gaagtcagac cgatgagcgg
   229201 gaacggacag cgatccgcga cacgaacggc gagggagcgc gcggagcgag atcgcgcact
   229261 cggcctcccg cagcgctcac agggaaagtt gaccgatcac gaactcggct ggaaagacag
   229321 aacacacgaa catcgttatt acctggtacc tgcgcggcgg tcaacccgta acgcctgtag
   229381 catgccggcg gggcgccctc gcccggcagt catgcgctcc gcgtaacacc tccgtgaacg
   229441 acgttctccg gagcgcggta cgtggcaaca ctcgaacagc ggaggaacgc tcgaaggtcg
   229501 agcgcgaacc cgcgacgcgg cacgctggtc gcgttgcgtc accggcgtcg cgttacgacg
   229561 ggcatctcga aacccgggcg gtcgctcgac cagcgagcgg gtgctcgcta cgcgcggccg
   229621 gacgcactca cccacatccg ccgcctgacg agcctgagcg cgtaactggt ctgccaccac
   229681 ggggtggcgc tgccgccagc cccgttgcgc gaacaggggg cgctcgcaca gggggcgcgc
   229741 caccgcgtag tagactccca gaaaacggct gtccaccgtt cgcgtataaa atgacgccca
   229801 gggtccccgg acgttacgcc gcgagggcgg ctccaggggg ttcacccccc gggcgcggaa
   229861 aaacaccgtc tcgtgcgcca tcccggccgg cggcagtggc aggtgggcgt cggggcgcgc
   229921 gtccgctcgg cgatctaagt cacccacgcc gtacacgtct cgcgggcgcg cgcacagttc
   229981 ccagtacact cccgcggtag tcgtgccgga cagccggacg aaggccaact cgttaaccga
   230041 gcacatgttt ttttaacgac tcctccacac acatatgagg tttagataaa aatgtgaccg
   230101 cacacctcat cctcagcaac aactagcagc ccaacaccca ctccacgcca ttcacttgca
   230161 tgggcgggct gcactttttt gccgccgagg gcgccgcggc acatacttct ttttttcgta
   230221 gggacctagc tcagtaccac tttttatccc ccccggccgt ctgagtgcgc gcgggccc
//
DBGET integrated database retrieval system