GenomeNet

Database: RefSeq
Entry: NC_006150
LinkDB: NC_006150
Original site: NC_006150 
LOCUS       NC_006150             221454 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Macacine herpesvirus 3, complete genome.
ACCESSION   NC_006150
VERSION     NC_006150.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Macacine betaherpesvirus 3 (Rhesus cytomegalovirus)
  ORGANISM  Macacine betaherpesvirus 3
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus.
REFERENCE   1  (bases 1 to 221454)
  AUTHORS   Hansen,S.G., Strelow,L.I., Franchi,D.C., Anders,D.G. and Wong,S.W.
  TITLE     Complete sequence and genomic analysis of rhesus cytomegalovirus
  JOURNAL   J. Virol. 77 (12), 6620-6636 (2003)
   PUBMED   12767982
REFERENCE   2  (bases 1 to 221454)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 221454)
  AUTHORS   Hansen,S.G., Strelow,L.I., Franchi,D.C., Anders,D.G. and Wong,S.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2002) Vaccine and Gene Therapy Institute, Oregon
            Health Science University, 505 NW 185th Ave., Beaverton, OR 97006,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY186194.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..221454
                     /organism="Macacine betaherpesvirus 3"
                     /mol_type="genomic DNA"
                     /strain="68-1"
                     /isolation_source="urine from a rhesus macaque"
                     /host="Macaca mulatta"
                     /culture_collection="ATCC:VR-677"
                     /db_xref="taxon:47929"
                     /country="USA"
                     /acronym="McHV-3"
                     /acronym="RhCMV"
     gene            1040..2566
                     /locus_tag="grh01"
                     /db_xref="GeneID:2952846"
     CDS             1040..2566
                     /locus_tag="grh01"
                     /note="similar to human cytomegalovirus TRL1"
                     /codon_start=1
                     /product="rh01"
                     /protein_id="YP_068095.1"
                     /db_xref="GeneID:2952846"
                     /translation="MLLLIPPSFAFPLHSLQHSQPRTLKPSSLLRVALTLASPTNMSH
                     TPGACANTSSPFSLSPLTRWRACTIFLPAQRCPTCGDWSTAEHESGTCRAPDADLTDY
                     SGGSTSDDEAVTAYAHALRSMPTNPSYAKHLRSYSARSRSSRARHRQCRRQPPSAATH
                     SPAPRHPTPSLSSSTSATPPPPALTCPLTHLRTPPRNPPPPDTRQQHDPLGDQADEAL
                     RIYGYPISRYDMRTGTADRLSPDRGGPLEPNCWCLWGVHAHKNHRPIIPLLTARARDG
                     PIKSGGWDVLYGRGYGYRAFPGPEGESRPVWTQHIVFLLGGHGPRLQLNRACAREAEA
                     RGLLPLWPVHSRTPQTSTDSDSSIDGIPRSNLPRLLQKHTAQHTRNGTSRQAERAERG
                     AWIVSDTFTAPGLRNTWNTRTHEEFWQRNYTKDYMEHSVFLPTSPNRFYDPFQSRRPC
                     RHSSTTSSDTDSDGDDNENTVPITPDSYIPPDGTCKHSPPETHSHTSSTTPETETTRL
                     "
     gene            1486..2037
                     /locus_tag="grh02"
                     /db_xref="GeneID:2952851"
     CDS             1486..2037
                     /locus_tag="grh02"
                     /codon_start=1
                     /product="rh02"
                     /protein_id="YP_068096.1"
                     /db_xref="GeneID:2952851"
                     /translation="MPPPTPLRRHPLTCPPSPYSLPLLIYLRHTSTSCTHLSPHSPSH
                     TSTQPPTPRHTPTTRSPRRPGRRSAPHLRLPHQPLRYAHRHRRPPQPRPRRPPGTQLL
                     VPLGSARTQKSPSYHSFINSARSRRPHQKRRLGCSVRSRLRLPRIPRSRRRISPRLDT
                     THRLPPRRPRPSPAAEPRVCPRS"
     gene            2618..3082
                     /locus_tag="grh03"
                     /db_xref="GeneID:2952858"
     CDS             2618..3082
                     /locus_tag="grh03"
                     /codon_start=1
                     /product="rh03"
                     /protein_id="YP_068097.1"
                     /db_xref="GeneID:2952858"
                     /translation="MIFVSFLPPCLLVRHILLAICPPSYTAVVIIHPFLVPSRPSHLQ
                     NASSKLPTRRACALPPPAAERSTAALVVPLRPTILYRLLHLGDALAAERKLLARTSLA
                     VPVCLHYGSLLDHSAVHIPRTQMHRRFSWGRDIRRANGPRSSVVYCSTFPFS"
     gene            complement(2703..3401)
                     /locus_tag="grh04"
                     /db_xref="GeneID:2952857"
     CDS             complement(2703..3401)
                     /locus_tag="grh04"
                     /codon_start=1
                     /product="rh04"
                     /protein_id="YP_068098.1"
                     /db_xref="GeneID:2952857"
                     /translation="MRASGDSCRFNTPRFAIGARRGKCVRSPLPWRQRRSPLYSADSL
                     QTCCSAGRRTNMALVPCSSAVERDELLDRMEDLVDAFDTPWWRACGRAFVNTMEWEAT
                     RYIYTRKREKWSNILLSFAARWLVEYLCPTKNAYASECEEYAQQSDPRENHNVGKQEQ
                     QARYEPEACVQQPVRRRDEAVGTISSGEVVRPTQQWSAQQQEEAERRHGALEAWNWHF
                     GDAKGEKGPERDEL"
     gene            3528..4349
                     /locus_tag="grh05"
                     /db_xref="GeneID:2952849"
     CDS             3528..4349
                     /locus_tag="grh05"
                     /note="similar to UL153; RL11 family"
                     /codon_start=1
                     /product="rh05"
                     /protein_id="YP_068099.1"
                     /db_xref="GeneID:2952849"
                     /translation="MCPGLFTYITLTGMVMHTVSGNPRQLLCNVTRFPGNNVSQVRLS
                     TGDNVTFLYNVSQGHSLSWLYSNLTANSSRHLRKYTLCSVTSNYRMTETRNNMCLHCN
                     RSSLTLCSARPQDSGLYVLRDDTNNTDVMRCNATVTGNGQLPVTHRPHSRPTVTRISS
                     AHLSGITLGNQKHSPTTWNTWMVHISFATMALACFGVAVVLSGCVCLRSVRAWTQKYR
                     PLNEDPAPQKIDFPDGTMKEHPHVTVIEPTKSADGTVVGLSAVSDDKPATLWLSR"
     gene            4710..5198
                     /locus_tag="grh06"
                     /db_xref="GeneID:2952639"
     CDS             4710..5198
                     /locus_tag="grh06"
                     /codon_start=1
                     /product="rh06"
                     /protein_id="YP_068100.1"
                     /db_xref="GeneID:2952639"
                     /translation="MVITIIVLYLLLVKPSNSSTNTHTYAVPIGGNVTLSDFTNDITH
                     YTLGIWYFTSSSGMCQIDISDNDRHRKLCNIYYARTECETLTLRSACKLAIQHSCNMT
                     TLTIYNVKDYTPKDYTLKKRHKNSTETTQYYRIQLVFPTTQIPKTNTVVYPPPHQRTQ
                     VL"
     gene            5325..5906
                     /locus_tag="grh07"
                     /db_xref="GeneID:2952641"
     CDS             5325..5906
                     /locus_tag="grh07"
                     /codon_start=1
                     /product="rh07"
                     /protein_id="YP_068101.1"
                     /db_xref="GeneID:2952641"
                     /translation="MRCSSYVLYSITFLFREMCYTKHIIYNYSTVAGGTVTFFDVTGY
                     SGFTKGTWYFQPVNDSCFNTFVTNDAFTKLCGVYYQINYTDLSTIIESCQTYFNHTCN
                     LTSLSLHNITPQAPTTYKLVKNAVTRKQNITFYNLQIISIENVLPSQANYASRGSLYN
                     TPIIATVILIIVITVIVYMQYHHKDHERIPYTH"
     gene            5881..6396
                     /locus_tag="grh08"
                     /db_xref="GeneID:2952649"
     CDS             5881..6396
                     /locus_tag="grh08"
                     /codon_start=1
                     /product="rh08"
                     /protein_id="YP_068102.1"
                     /db_xref="GeneID:2952649"
                     /translation="MNAYHTLISCLCFFILYAYITESTRVVTLQYVYNVSIGENVTLS
                     KPDNLSFQLHSWFCNNRASACNNPIMKLCEETAGNNKPNSYTRFQNNCHPPTFTCNTT
                     GLYLYNVQETDPTTYTLTQRAGNGNITDRNTTYIIHFITSTTPPPVTKLHMQFIFNQL
                     HKHKQLPTIAT"
     gene            complement(6724..7029)
                     /locus_tag="grh09"
                     /db_xref="GeneID:2952658"
     CDS             complement(6724..7029)
                     /locus_tag="grh09"
                     /codon_start=1
                     /product="rh09"
                     /protein_id="YP_068103.1"
                     /db_xref="GeneID:2952658"
                     /translation="MSEIQNVVENYKVLCLISGGGVVEKSMLYVMFLYGNSDKPPCCI
                     KKYVTGTVVRTFCKYKPVRLHINVSGIQYGGFGSYVRMSFGNWLHSCVFGQISLRRD"
     gene            complement(8521..10932)
                     /locus_tag="grh10"
                     /db_xref="GeneID:2952842"
     CDS             complement(join(8521..9027,9270..9941,10031..10216,
                     10289..10432,10527..10661,10762..10932))
                     /locus_tag="grh10"
                     /codon_start=1
                     /product="rh10"
                     /protein_id="YP_068104.1"
                     /db_xref="GeneID:2952842"
                     /translation="MSKNIIVLIVSYSLSSHRSQPLLLPSVSKRGICMTVGFHHYKCD
                     CTHTGFYDHDCTTTRIKLFLKPDPDTVYYTLTHFSTIWWLVNNIPFLRHAVMRYILTS
                     RSDLIDSPPIYNADYEYPSWEAFSNLSYYARILPPVPHDCPTPLGVKGGKKNLPDAAH
                     VVEKTLLRRTFTPDPQGTNLMFAFFGQHFTHQFFRTDLARGPAFTKGLGHGVDLNHIY
                     GETPEKQSKLRLFRDAKDKYQIIDGEMYPPSVKDVQVHMIYPPEVPENMRLAVGQEAF
                     GLVPGLMMYATIWLREHNRVCDVLKREHPEWSDEQLFQTTRLIIIGETINIIVTQYVQ
                     QLSGYHFQLLFKPELLFGTSFQYQNRIFSEFNMLYHWHSLMPDAFEIDKTKYDYINFV
                     YNNSILMTHGITQLVESFTKQIAGRVSAPLNLSIISVHVVFVTNMQNVLIMCPWHFIF
                     INKTGEKEIAAELRALYGDIEAVELYTGFLVEKPRPNAIFGESILELGAPFSLKGLMA
                     NVICSPGYWKPSTFGGDVGFGIVKSATIQSLVCSNVKGCPLAAFRVPNKELLKARNGS
                     SSSSSSSPPSPSSSSSSSPSVQQHVDPGVVIKREHAEL"
     misc_feature    complement(join(8692..9027,9270..9941,10031..10216,
                     10289..10432,10527..10616))
                     /locus_tag="grh10"
                     /note="Animal heme peroxidases and related proteins;
                     Region: An_peroxidase_like; cl14561"
                     /db_xref="CDD:265428"
     misc_feature    complement(order(9025..9027,9279..9281,9285..9287,
                     9402..9404,9453..9455,9462..9473,9480..9482,9741..9746))
                     /locus_tag="grh10"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:188647"
     misc_feature    complement(order(8818..8820,8827..8832,8839..8844,
                     8854..8856,8866..8868,9465..9467,9471..9473,9483..9485,
                     9567..9569,9579..9584,9591..9593))
                     /locus_tag="grh10"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:188647"
     gene            9462..9902
                     /locus_tag="grh11"
                     /db_xref="GeneID:2952661"
     CDS             9462..9902
                     /locus_tag="grh11"
                     /codon_start=1
                     /product="rh11"
                     /protein_id="YP_068105.1"
                     /db_xref="GeneID:2952661"
                     /translation="MPVIQHVKLGKYTILVLERSTKEQFGLKQQLKVVAAELLNILRH
                     DNVDCFPDNDESSGLKQLFVTPFWMFSFQNIAHSVVFPEPDSSVHHETRHQAKSLLTD
                     SQTHIFGHFGRIDHVHLDIFDRGGIHFTVNNLILIFRVSEETQL"
     gene            11225..11920
                     /locus_tag="grh12"
                     /db_xref="GeneID:2952665"
     CDS             11225..11920
                     /locus_tag="grh12"
                     /codon_start=1
                     /product="rh12"
                     /protein_id="YP_068106.1"
                     /db_xref="GeneID:2952665"
                     /translation="MHFYITFIILTFSPCGESVSLLIKNHTVTWDSSVILKDVDNNTM
                     NNLGEWAAYLVNTTVCPNTNVTLCMINPHLLPNKTDNRTNTTRISQCLNMTTFICNTT
                     LQITNITNETHTDYMLTRYRNCTNGDHSNENTEPEYTQFHLEFTMTTLPPTTVLLTTT
                     METTTSEYTATSTPLALELSESFYMASIGIPAMIFVGGGLLFGLCYYAYIQGWCSCRT
                     RTTSSAHTERLLS"
     gene            complement(11233..11547)
                     /locus_tag="grh13"
                     /db_xref="GeneID:2952679"
     CDS             complement(11233..11547)
                     /locus_tag="grh13"
                     /codon_start=1
                     /product="rh13"
                     /protein_id="YP_068107.1"
                     /db_xref="GeneID:2952679"
                     /translation="MFVICKVVLQINVVMFKHCDMRVVFVRLSVLFGKRCGLIIHNVT
                     FVLGHTVVLTRYAAHSPKLFIVLLSTSFRMTELSHVTVWFLIRRETLSPQGLNVKIMN
                     VM"
     gene            12506..13087
                     /locus_tag="grh14"
                     /db_xref="GeneID:2952668"
     CDS             12506..13087
                     /locus_tag="grh14"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh14"
                     /protein_id="YP_068108.1"
                     /db_xref="GeneID:2952668"
                     /translation="MEHYTVTVLPIPQPPAPQVTTVTNCSLTFFSEHLWRNATTRIIT
                     TTTQSTSTTTTRTTKPTTTTHRTTAGRVSTPTPEESSTSTTTEESTTTTWPPGRPKFI
                     SKYSKLSVYAAWTAGLFGTALFIFLVVFVCALRHLNNRQGALYRPPPGLPEKDKEKKK
                     TKTTRSGVYHLLPSEKKKSSINILRCEVNVFLE"
     gene            complement(12556..12879)
                     /locus_tag="grh15"
                     /db_xref="GeneID:2952684"
     CDS             complement(12556..12879)
                     /locus_tag="grh15"
                     /codon_start=1
                     /product="rh15"
                     /protein_id="YP_068109.1"
                     /db_xref="GeneID:2952684"
                     /translation="MNRAVPKSPAVHAAYTESLEYLEINFGRPGGHVVVVLSSVVVEV
                     ELSSGVGVLTRPAVVRCVVVVGFVVLVVVVEVLCVVVVIILVVAFRQRCSLKKVSEQL
                     VTVVT"
     gene            complement(12937..13458)
                     /locus_tag="grh16"
                     /db_xref="GeneID:2952688"
     CDS             complement(12937..13458)
                     /locus_tag="grh16"
                     /codon_start=1
                     /product="rh16"
                     /protein_id="YP_068110.1"
                     /db_xref="GeneID:2952688"
                     /translation="MLLRYNIESMLPLSSVRMFPLFVTDIMTVFAPRTLSFTFHFFFS
                     ETIAVRWTPFRSSFPRHRRLHLAPLPFGTRSFFCVYCWGLSSGLCWSGLLCGSSSKNS
                     QWLLRVACRSARTFECRVGPSSYSRKTLTSQRKMLIEDFFFSEGSRWYTPDRVVFVFF
                     FSLSFSGRPGGGR"
     gene            13525..14625
                     /locus_tag="grh17"
                     /db_xref="GeneID:2952678"
     CDS             13525..14625
                     /locus_tag="grh17"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh17"
                     /protein_id="YP_068111.1"
                     /db_xref="GeneID:2952678"
                     /translation="MKKHVSRLMCSYFVMFWPILATDNSTNSSSSVNMTTELTTLSTT
                     PRSTNSSYINSTTWTTTYGSASTSQGNTTTPMSRTVTSISYTSQNASCTSDVTLTSYT
                     NTLSNESTNVSRNNSYTTTTTSWTSTPEMNITTPPPWPFEMHGHYFTLWVNNCYCGYL
                     KVLPGSNITFNGTKKNDTDSIWFLARYFNYWLCIFTADANYTMDYINLTHTCTSETMT
                     LWNVLEGNSGIYFQRRTDNQKYDSTYICYILNVTADAANTTYPEITTTKCHRPPWRNR
                     PDFASIEAHPITPDYEELSIQDILESLSLKGGLKGSLLKFVLRFGWLCGIVVGVTVTL
                     IIILKLPQKLCFLSSYVPQRRGYKRLSSNQIL"
     misc_feature    <13657..>13872
                     /locus_tag="grh17"
                     /note="Endomucin; Region: Endomucin; cl25495"
                     /db_xref="CDD:330316"
     gene            complement(13557..13922)
                     /locus_tag="grh18"
                     /db_xref="GeneID:2952680"
     CDS             complement(13557..13922)
                     /locus_tag="grh18"
                     /codon_start=1
                     /product="rh18"
                     /protein_id="YP_068112.1"
                     /db_xref="GeneID:2952680"
                     /translation="MFISGVLVQEVVVVVYELFLDTFVDSFDNVFVYDVRVTSEVQDA
                     FCDVYEMLVTVLDIGVVVFPCEVLADPYVVVHVVLLIYELFVDLGVVESVVNSVVILT
                     LDELFVELSVARIGQNMTK"
     gene            14707..15642
                     /locus_tag="grh19"
                     /db_xref="GeneID:2952681"
     CDS             14707..15642
                     /locus_tag="grh19"
                     /note="similar to human cytomegalovirus UL07; RL11 family"
                     /codon_start=1
                     /product="rh19"
                     /protein_id="YP_068113.1"
                     /db_xref="GeneID:2952681"
                     /translation="MQISKLVYASIAVFWATAFIHGQTSDSSYKATTTLWANRNSTSQ
                     SSTMQLTTEPTASGYRNSSHRNGTTAPPWTTIADDNTTTLPPWPIEIQSTYFSLWVNG
                     CYCGSLSALPGANVTLNSTKKQNNTETLWFRLGMFTNLLCIFYFDNDNDSIKYDHLTF
                     TCTQNNIILWNVSEKYSGIYCERQMSLTTYNSTYICYNLTVTADATNATDPSIVTTKC
                     YRSREQYYSVETSTTSDSALNIDDILNSRRNFRDNGQRNLLGSVLQFGWLGVIVIGST
                     ITLALVFRVPQKFCYLFYEWKHRYRGYEKISGQIL"
     misc_feature    15028..15312
                     /locus_tag="grh19"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            15700..16293
                     /locus_tag="grh20"
                     /db_xref="GeneID:2952682"
     CDS             15700..16293
                     /locus_tag="grh20"
                     /note="similar to human cytomegalovirus UL06; RL11 family"
                     /codon_start=1
                     /product="rh20"
                     /protein_id="YP_068114.1"
                     /db_xref="GeneID:2952682"
                     /translation="MKILIMLIFVICDSQTIHLPTCSLKTCCIGDDVSLNSNIPTGCN
                     RTTWYRHKNNSGIMLCSFSGGGMTSSSKERINRTCSRQSFIFINIQMPSTGTYYVVGN
                     NCTTSPLMSTCYNVTVEPRSTTAMTVAVNPSINITAQLPQRLASHFNATSFENETVTV
                     HGAWGLVIVALLFLWVAIEFRLHKKCFAYFRNYVTTF"
     gene            16327..17004
                     /locus_tag="grh21"
                     /db_xref="GeneID:2952686"
     CDS             16327..17004
                     /locus_tag="grh21"
                     /note="similar to human cytomegalovirus UL11; RL11 family"
                     /codon_start=1
                     /product="rh21"
                     /protein_id="YP_068115.1"
                     /db_xref="GeneID:2952686"
                     /translation="MYNFNTAMIVCTLIHKTLSTYIRCNNDFGISNTCTQYNETATVG
                     QNVTLGICIEKYNPVSWHKKTNNKAIIMCQYSDSTNCNPHHDICYHCLSNYSLLLIDV
                     QTNYNGMYYLSYLKDNKYTDLCYNLSINTPTFNVSHTQINRTTVECIFKSNINNVKNK
                     NAHTTVNDARTTNIASYTNDLPNMQHAWLLLPFAITITIVLFWVYMPKKYQSRLNTHR
                     EYTRLQY"
     gene            17111..17818
                     /locus_tag="grh22"
                     /db_xref="GeneID:2952690"
     CDS             17111..17818
                     /locus_tag="grh22"
                     /note="similar to human cytomegalovirus UL11; RL11 family"
                     /codon_start=1
                     /product="rh22"
                     /protein_id="YP_068116.1"
                     /db_xref="GeneID:2952690"
                     /translation="MYITSISVVTYVFIQITINYKTKETCSEYSIALNSHRKHCNTTL
                     SYTGQNVTLGVHIGPWTPAFWNLQINNTEISLCEYTHTVLKCNLHTICYQCLSNYSLL
                     LINVTKQYSGIYWLSYDINNGNYKYTEMTLCYNLTVHSRNATSNKLLTTSATHTTITP
                     YVTTNLQHNESIVNDTFQTYYTANNHTPWLALPILIVVLIVLCWFNMPQRYKYQPYTW
                     ASCFYRVCTQTHCLQKK"
     misc_feature    17114..17740
                     /locus_tag="grh22"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03240"
                     /db_xref="CDD:165499"
     gene            17716..18411
                     /locus_tag="grh23"
                     /db_xref="GeneID:2952685"
     CDS             17716..18411
                     /locus_tag="grh23"
                     /note="similar to human cytomegalovirus UL11, RL11 family"
                     /codon_start=1
                     /product="rh23"
                     /protein_id="YP_068117.1"
                     /db_xref="GeneID:2952685"
                     /translation="MLVQYASTIQISTIYMGVMFLQSMYSDTLSSKKITCIPVNSTAG
                     RNVTLNPPPFNHHTTYVYWYRQLGKGKNELCRYVPNKQERNARIKFQCLSNYSLLLIN
                     VTTSYNGNYTVNLDLGLGTTSTTCYTLTVKTATQIVKTTTRKPTTTRKTTTTMSITST
                     TTATTTTQTTCSTKSPNTNVHSDSDPDMVALNETRELQIREHTNIHAIWLLLPVLIVI
                     ICFFTANSKTTEL"
     misc_feature    17830..>18048
                     /locus_tag="grh23"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            18428..18817
                     /locus_tag="grh24"
                     /db_xref="GeneID:2952698"
     CDS             18428..18817
                     /locus_tag="grh24"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh24"
                     /protein_id="YP_068118.1"
                     /db_xref="GeneID:2952698"
                     /translation="MIMHINALTMNKKGSFVWIMWHIPQVYICYVTNTKYEINTNGTN
                     TSLDTPTSEAITASKAYMAVPNAHTAHADSNPSGYHVKGQNDDDYANTTTIIILVILF
                     IVIILLFFRIPQRCWEGYQKTRVNSPY"
     gene            18896..19570
                     /locus_tag="grh25"
                     /db_xref="GeneID:2952697"
     CDS             18896..19570
                     /locus_tag="grh25"
                     /note="similar to human cytomegalovirus UL09; RL11 family"
                     /codon_start=1
                     /product="rh25"
                     /protein_id="YP_068119.1"
                     /db_xref="GeneID:2952697"
                     /translation="MIPILRECGWFGYIGITCLLVVTQLIDTLGNKCSKTETRTGTVG
                     TNITLVTNSPPNNKGLLYWYKPNCTSNDRLCDYSGFTGTNAVSNRTKLKFTCMNNSTK
                     LTLINVTAHYSGQYCSRTITSNGSVDICFNVTIHLHITPAPSPLPVPFQTIPGWNHRT
                     TVLQVQIPSSGQPGSYESQQQDAAHIASILILLLLFIAIIILFFLKIPQKLWDKYHKS
                     KHAPSA"
     misc_feature    19013..19300
                     /locus_tag="grh25"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            19554..20402
                     /locus_tag="grh26"
                     /db_xref="GeneID:2952728"
     CDS             19554..20402
                     /locus_tag="grh26"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh26"
                     /protein_id="YP_068120.1"
                     /db_xref="GeneID:2952728"
                     /translation="MHHLPNKTHFAHIMWKTLLTLISLIYVNLAAECKSTTHYREKED
                     DCALFKVKLPDSGLSHYWYRPNCTTRDMLCYKTATGQGDLKAHNPDLPFTCLDNHTEL
                     LWCNIWRNHSGIYCHSVFTSTNNGINRVDTCFNLTVVPKITTTKKATTTKTTTTTTLA
                     SKLKTRSTPVIKNPHIDGTPPPSHEKPSLKKPSLKDTLQAHTTLTTLLQSYPPLTTTP
                     GYEVVQHTPEKQVQNVTHLATIVVLIVVFVGIVTLFIFKIPQKLWGKYRKAKTHAHFL
                     ERDYDY"
     gene            20547..21152
                     /locus_tag="grh27"
                     /db_xref="GeneID:2952714"
     CDS             20547..21152
                     /locus_tag="grh27"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh27"
                     /protein_id="YP_068121.1"
                     /db_xref="GeneID:2952714"
                     /translation="MTLTWTRLILLSNQLQMIWTLECTITKVVTTQSGANVRLGDSSR
                     QGNIVWHRPPCGNEQDVLCNKTSRSEEMFFINRSISFMCEQKSNMLNLRRLTPGNSGQ
                     YCKTISTTRNGKKESYRECYNLTVISTTKSTPTIMTTQQETSSHRTSNVTTPSRFLGR
                     TVNNKRDRYDDLAPALELVGFLFFITIVVLFCLRTELFEGM"
     misc_feature    <20772..>21113
                     /locus_tag="grh27"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03240"
                     /db_xref="CDD:165499"
     gene            21154..21777
                     /locus_tag="grh28"
                     /db_xref="GeneID:2952720"
     CDS             21154..21777
                     /locus_tag="grh28"
                     /codon_start=1
                     /product="rh28"
                     /protein_id="YP_068122.1"
                     /db_xref="GeneID:2952720"
                     /translation="MTIYIQKYLIQWIIAISLVHTRIQIAHPCKITSLINVTAYETVV
                     LNATLALDKCFIMWYKSPTEGMCQYNASHAMKASSYNGKLNYTCTFYTLTILNANSSA
                     TGMYYTLGAPNDECVREKICYKVQVQFTVQHEAPIATQISPLIQNEPSMSESTIIWYV
                     FLASGLLIIMFYLAKNAHSYWKHGHYHVPQIWWIQVEEPQLYRSMVS"
     gene            21854..23239
                     /locus_tag="grh29"
                     /db_xref="GeneID:2952712"
     CDS             21854..23239
                     /locus_tag="grh29"
                     /note="RL11 family"
                     /codon_start=1
                     /product="rh29"
                     /protein_id="YP_068123.1"
                     /db_xref="GeneID:2952712"
                     /translation="MFTRRYRTTHNFWQLVFISILAFIIHLHYSTSPSIPVNVRTGDN
                     ITLNATLNLTNGIGYWYHNDSILCGCTPNNAESASRPLLKFICHRNCTITLLNVSSHS
                     AGDYCLMAKPKNDKPKDSLCYNVTVLPTNHHLSKTTQHSVTTTITTNPTAVTVTVPTT
                     TITPVLTTTTVQITPLATNATTMLPTTNSTFPSTSMTTNNETTVPHITTKAKRTKKTR
                     KKKLGSTKAPTTALHSSNPLLTTVTTTAATTVPLTSSTTVTTTAHTALTTVTTTRNAL
                     STGIVQLTTVTTTAQTASPDSKTRSNIQNAVTTSVYTTEGNTTALTNTKPATTLPTTT
                     YSTVPPTTVATASTLSTTLPTTRWYTTSTSTSTKQRNTQTSSYQTTTPLLNSPTATTI
                     SQNETKSPHVKHHNAHHHHAVTHAFWVILLIVVIVIIILWWNKIPQRLFQHYQEQKYG
                     GVALSDDWQFY"
     gene            complement(23315..23638)
                     /locus_tag="grh30"
                     /db_xref="GeneID:2952729"
     CDS             complement(23315..23638)
                     /locus_tag="grh30"
                     /codon_start=1
                     /product="rh30"
                     /protein_id="YP_068124.1"
                     /db_xref="GeneID:2952729"
                     /translation="MLRCMVFSSWRLGGLGDRTSSHDGMDGGLPSISDRRPRTGAAAN
                     LNAICLVVCMMISCSSTYSSTISRALSKCIQLPRITVSHRSQHLWHLCLAIALGGGPW
                     TGWRR"
     gene            23355..24662
                     /locus_tag="grh31"
                     /db_xref="GeneID:2952732"
     CDS             23355..24662
                     /locus_tag="grh31"
                     /note="similar to human cytomegalovirus UL13"
                     /codon_start=1
                     /product="rh31"
                     /protein_id="YP_068125.1"
                     /db_xref="GeneID:2952732"
                     /translation="MARHRCHKCWLLWLTVILGSWIHLLNALEIVEEYVEEQEIIMQT
                     TRQMALRLAAAPVRGRRSEIDGRPPSIPSWLDVRSPRPPRRHDENTMQRNIRWQHEQM
                     QVLMSLHHSRMQARGWNPDQRTPARLPAHFGRSASGSQPVPNHRIGISTRPTPMAEEA
                     EEPRVTIVRNRRPDNSSPGPRLPHKRRNAITLTGSTDSLDLTRLRLSYERRHRKGYCR
                     WKHHGKHSPTRKAYIPPSRPTISNPMEFRPAPSPVPQRRTLNDRLNDLLRRHSAHENI
                     RHKWHVRPKPDPVWIYNDDESEVTSIGERASLLTRTRSWIQSRMHRTHTWRLGSSGGG
                     NEPLVRSLSTEQPRNNNANQSRPHSPSESVQVNLETGEVVVTCHNTGANEQHVLTSNQ
                     LCNRNSMEVTDACNRETPRRALLGSSIALWLSGVWMRNYRKSS"
     gene            complement(23577..24029)
                     /locus_tag="grh32"
                     /db_xref="GeneID:2952669"
     CDS             complement(23577..24029)
                     /locus_tag="grh32"
                     /codon_start=1
                     /product="rh32"
                     /protein_id="YP_068126.1"
                     /db_xref="GeneID:2952669"
                     /translation="MFSMMFPTTVSFAVTPFVAKAQSCEIQGICGACKSDSIASFVWK
                     TRSGTRIVWTSVSDNCYSRFLGFFCHRCWSCRYTNSVIWNRLRTRSRASKMSWKSGWS
                     TLIRIPASSLHPGVVQAHQNLHLFMLPANVTLHGVFIVASWGSWRPNI"
     gene            24942..25838
                     /locus_tag="grh33"
                     /db_xref="GeneID:2952717"
     CDS             24942..25838
                     /locus_tag="grh33"
                     /note="similar to human cytomegalovirus UL14"
                     /codon_start=1
                     /product="rh33"
                     /protein_id="YP_068127.1"
                     /db_xref="GeneID:2952717"
                     /translation="MYFIIVLLITILTIDCVPPAYWDQFLHPSMDNGEVSAPLMPPYG
                     DRFNLTCDFPTGDWSEAALQIRFCYHPSCRSFLMVTPKDINGEFKNKSDNHLPELQWK
                     LETVGPVQRLTVSFLVVSSVSGIYRCTILTGINIEVLKTVIIIADVELRRRPDTYCDI
                     RFSHLSQLQYLWTPNPDKVRLLNCGEVRERNSLWQKHVHYAVGMSGLEPSCTVNRDMV
                     LCHRYVAESLRDNNCTRAAEEKRAMILRGKPLEEDWFWMCMAGMFTICIVGILTLCLR
                     LRYKRHLDWSHDLERRRLKKRN"
     misc_feature    24942..25835
                     /locus_tag="grh33"
                     /note="Herpes-like virus membrane glycoprotein UL141;
                     Region: UL141; cl27780"
                     /db_xref="CDD:332601"
     gene            complement(26718..27041)
                     /locus_tag="grh34"
                     /db_xref="GeneID:2952737"
     CDS             complement(26718..27041)
                     /locus_tag="grh34"
                     /codon_start=1
                     /product="rh34"
                     /protein_id="YP_068128.1"
                     /db_xref="GeneID:2952737"
                     /translation="MCSWRCCERHLLLFFGYHQSHLQWKEAADVYDVPGCSGRLRYSW
                     RHLRYPRDRGVFFIITLVLGSQQGVPGATYAGASEEVIEQSVLHFPRLVIRLQRLESR
                     PGYGT"
     gene            26778..27101
                     /locus_tag="grh35"
                     /db_xref="GeneID:2952741"
     CDS             26778..27101
                     /locus_tag="grh35"
                     /note="similar to human cytomegalovirus UL17"
                     /codon_start=1
                     /product="rh35"
                     /protein_id="YP_068129.1"
                     /db_xref="GeneID:2952741"
                     /translation="MEHALFDHFFGRPRVSGSRHSLLRAENECDDEEYPPIPRVPQVP
                     PRVSQTTRAAWNIVDVCRLLPLQMRLMVAEEEEKMTLTTSPRTHKKKPRKLVEISPRI
                     RRLFT"
     gene            27826..29172
                     /locus_tag="grh36"
                     /db_xref="GeneID:2952751"
     CDS             27826..29172
                     /locus_tag="grh36"
                     /note="similar to human cytomegalovirus UL20"
                     /codon_start=1
                     /product="rh36"
                     /protein_id="YP_068130.1"
                     /db_xref="GeneID:2952751"
                     /translation="MHCINMPLRTLASCLVFLTLFVYLHSDYVYVSVLTRSHGLTWTS
                     IGGVNDTEISNLSNYSFNQDNATNTNNSSNGNGSVSQLSDGCLTRTETYVSTIWIFNC
                     TKDTSVTDFWYLGNGYNQSDDTCKSSLATYLSSMCNIWANYSNGNESRQDHLNISEVR
                     CVIPETYSVNTTIQQYNDTELENQDQQYHQLFPLRHTCSLVEALAFDIVERYVYISRL
                     CWNIAQILALLCIVTVSLVVWIRFQYCGKIPCMCLLPPNVSAVPTCQDVIVENVNQTE
                     EDNTSLNSPVEPESSEITPILSASEKPCVQKPSVPPKPPTVSSQFKVMHALNKPCMLP
                     KPPPKPASLQSPKPDVFTFDEQDIQRHKEEISKQVKPMRIPVLAHQTSTLTRTTHASR
                     LPPPPRQATFSPRAPTMIPWDRKSQMSPVQYSSWRQQSESLPAELDPWNVNPHRWL"
     misc_feature    <28588..29142
                     /locus_tag="grh36"
                     /note="Atrophin-1 family; Region: Atrophin-1; cl26464"
                     /db_xref="CDD:331285"
     gene            complement(29275..29640)
                     /locus_tag="grh37"
                     /db_xref="GeneID:2952757"
     CDS             complement(29275..29640)
                     /locus_tag="grh37"
                     /codon_start=1
                     /product="rh37"
                     /protein_id="YP_068131.1"
                     /db_xref="GeneID:2952757"
                     /translation="MGGSTDPLLTEAIRGLMPSIRVSFMRVNQPAHRPLGMYAPRARR
                     RLFQNYLQRQQIQIQPLQIPEVAEVVEIPMDLDDDLPLMGEPMILVMEEIRAQVENRN
                     PRPRFVFRLPNANNEEAHA"
     gene            29898..30251
                     /locus_tag="grh38"
                     /db_xref="GeneID:2952760"
     CDS             29898..30251
                     /locus_tag="grh38"
                     /codon_start=1
                     /product="rh38"
                     /protein_id="YP_068132.1"
                     /db_xref="GeneID:2952760"
                     /translation="MPSPGELLNRNTDRHSRVQTWFFVYYTSDVLSFYRYTTQDKDGV
                     TGTDVGNPDGTQGNDDSGVSKVPITLEGDDLPSGDDSTEEGSGDEIPAYDVFIEGEMN
                     DGENSEESDEGSTED"
     gene            complement(29916..30380)
                     /locus_tag="grh39"
                     /db_xref="GeneID:2952762"
     CDS             complement(29916..30380)
                     /locus_tag="grh39"
                     /codon_start=1
                     /product="rh39"
                     /protein_id="YP_068133.1"
                     /db_xref="GeneID:2952762"
                     /translation="MLVRFIFVESRRMKGHDDAYTGITIDVLLGGCHKKRGELAALRL
                     VFCRTFVRFFRVFSIIHFAFNEYIVCRDFISTAFFRTIVPRWEVVTLKRYGNFRYARV
                     VISLGPVWISYICSRYSIFILCGIPVKRQNVTCIVHEKPCLYSGMPVRVTVQ"
     gene            complement(30731..31669)
                     /locus_tag="grh40"
                     /db_xref="GeneID:2952748"
     CDS             complement(30731..31669)
                     /locus_tag="grh40"
                     /note="similar to human cytomegalovirus UL23; US22 family"
                     /codon_start=1
                     /product="rh40"
                     /protein_id="YP_068134.1"
                     /db_xref="GeneID:2952748"
                     /translation="MPAGSFPSVGLGTMFCWYTWGTCCRGSGVNRSKWKSGQRIHLPW
                     PKDRVLVVLRRWRSVRNAEKEEERLSQYLCCPEKLHFVGSICTKAFLKHREGTPPSEL
                     YVGQSGNVYLYVDVVYSDALTWIADDIDDFLVHGLRRCSFMVVPNANVLRKKETRRLV
                     ICENLNDLCEWRNAHASSLMRLGDGNMLCVSLPTSFSRLDLYYWRRIVGTTKVEPVGR
                     IAIADRLISIFADSYLRMYATTENGVCVVADTVMEFAMRGLVRYRWSTVFYGDKKMRK
                     LSGNLVCPYGKTHIYERKSICRRSQRISCSSTHFAT"
     misc_feature    complement(31250..31573)
                     /locus_tag="grh40"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            31416..31796
                     /locus_tag="grh41"
                     /db_xref="GeneID:2952770"
     CDS             31416..31796
                     /locus_tag="grh41"
                     /codon_start=1
                     /product="rh41"
                     /protein_id="YP_068135.1"
                     /db_xref="GeneID:2952770"
                     /translation="MLPTKCSFSGQQRYCDRRSSSFSAFRTERQRRRTTRTRSLGQGR
                     CMRWPDFHLLLLTPLPLQHVPQVYQQNIVPSPTEGKEPAGIVALYKHVRRVPLCNQLT
                     YVSHRCAGGLWDTRAQCRVIHNLQ"
     gene            complement(31726..32652)
                     /locus_tag="grh42"
                     /db_xref="GeneID:2952772"
     CDS             complement(31726..32652)
                     /locus_tag="grh42"
                     /note="similar to human cytomegalovirus UL24; US22 family"
                     /codon_start=1
                     /product="rh42"
                     /protein_id="YP_068136.1"
                     /db_xref="GeneID:2952772"
                     /translation="MACQPMSDIESLAMSVEFGLGCVEAYVRLNSGQKIALPWPRGWY
                     LVLQELEADDDYTAEDIRRLSYYLCCQTRLAFLGRVVGEPVLVHGQRKTTLIILVSEE
                     GQVFCYVEEDFSLYYVAKNLSELQRVGLRAVDVLYCPRHIRSSALKRSFRRIRNAWKS
                     GPEAVSRYVTRNHGNYLQLPYPEGACLRLCNLKCFEVTSTSGFMLRSLRSHFGDQVIC
                     LGTVDLKGEMPSSPCYVRWPVTRVPIVLVDGGRVFCLDLVNLRYIRLADDLTAFMCLG
                     LRQLLNNRRFTGDCELHDTVPECPRGRQHNDD"
     misc_feature    complement(31735..32637)
                     /locus_tag="grh42"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     gene            32719..34476
                     /locus_tag="grh43"
                     /db_xref="GeneID:2952769"
     CDS             32719..34476
                     /locus_tag="grh43"
                     /note="similar to human cytomegalovirus UL25; UL25 family"
                     /codon_start=1
                     /product="rh43"
                     /protein_id="YP_068137.1"
                     /db_xref="GeneID:2952769"
                     /translation="MYTKRGQQRRSHEGAGRLYTFDDLDDEVFLDPIPRAPANELDEM
                     DLMEAGLLSSSSQSDNKSSFEVVSETDSGSEAEAERGRRAGMGSRNKPTKPPRRNKTT
                     QCPTGCVASEPVISAISSEDEGATTQSQEEDDDEDDLDEGHETTIGQRTVTIFRQIYF
                     ERSLARNLGFEPTLISPPNTEFLKFLLYDFSVQHITRVNQCIPMPTFLLTSLINPIAK
                     TTSAGERDLTRGIVTHAVLVNYFYQAKAKVRSMQCSLNATIHGQTMNNIATYVTNLTP
                     GGRAAALALHFLMPQKAVMTKQYQACLRRLSEELRKRRVTESPSTLEILETIRDYNLI
                     FPIAPYTNRGALYLYRNNLQKLSNGYRNVLKLLSSEKLNEEHFVNDLAFMLGVQLMLV
                     QFEQTLHVLRAYIMHHLQNLATLIYIIYVQFPSLRGDYIQVTEAIYRATTSHGDEPLF
                     QVNTWLFDYLRAVRNLEAVVCPDYMMCALRQWTTVHEDNPITDYMFHDPAIQDSRIRC
                     GDTQTKLLVRNLCFTRMQGRPTSRQTPVEHVLVPTASLNRPYLRCNSTEEREVNSHRN
                     LTLRSFLETNGNHPMSQLQ"
     misc_feature    32719..34473
                     /locus_tag="grh43"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03249"
                     /db_xref="CDD:223023"
     gene            complement(34537..35283)
                     /locus_tag="grh44"
                     /db_xref="GeneID:2952779"
     CDS             complement(34537..35283)
                     /locus_tag="grh44"
                     /note="similar to human cytomegalovirus UL26"
                     /codon_start=1
                     /product="rh44"
                     /protein_id="YP_068138.1"
                     /db_xref="GeneID:2952779"
                     /translation="MFVVFDHTRWAVVQYEINQKQNDVIGTRTIRMATSREAGCVFNV
                     EDYVRRNRGRHFDLPSPRGYTLFVCDEDDTILTPRDFSYWRLLPLMKGQLRVIGTIGT
                     DEMFTWDRPVAAIGGCGGIFCYEIGEHNYVVKAANSLSELLKEGVREGYFDDVRRARA
                     GALQHSQRRGLRRGSRSESDASASLVTRPCLRRQNAVVEGEDPEELTQEMFASGIMSS
                     SLFTPALDYSLQPESGARKSGVGTSSSSST"
     misc_feature    complement(34837..35157)
                     /locus_tag="grh44"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            34897..35328
                     /locus_tag="grh45"
                     /db_xref="GeneID:2952788"
     CDS             34897..35328
                     /locus_tag="grh45"
                     /codon_start=1
                     /product="rh45"
                     /protein_id="YP_068139.1"
                     /db_xref="GeneID:2952788"
                     /translation="MLTNLITKNATAPTYGGHRSIPSKHLIGANGANHAQLSLHERQK
                     PPVTKVPGGENSVILIADEQRITSRGGQVKVTASIPSHIIFDIKNASSFPAGGHPDCS
                     GANDIILLLIDFILHNRPPRVVENDEHTAGEASQCVPDTAP"
     gene            complement(35237..36976)
                     /locus_tag="grh46"
                     /db_xref="GeneID:2952781"
     CDS             complement(35237..36976)
                     /locus_tag="grh46"
                     /note="similar to human cytomegalovirus UL27"
                     /codon_start=1
                     /product="rh46"
                     /protein_id="YP_068140.1"
                     /db_xref="GeneID:2952781"
                     /translation="MTANPPLDDIYSDQHAAFEFVADCPDDDFCHNFVRTYLTPVRSL
                     REAALAGLFPVDSSSSSLTKKPRDTRVVQNAESAKKSPIIYIRRSFLVNSKFATAHGK
                     YNIRGLSLQTDLAVWGLLRGVPLRPDPGHFHWMNLMQFRRLVAAGPFLPEISKSGKRI
                     ALAVATGQYAVSTLLNYKVFGNKTHYLRQLCVITEELFRRLAGTVCLFLDAGDRDLIQ
                     KCLPPHLCKKLPVNYRVQKNAVFFNPRFALRAEAALHTLYARFCTCGDCHDLFVASSD
                     TQATPSEEEPSPPQPRLEDAELTLLHNAHLGKFHLPAIRHLTAAEQLRVQQSVARDLG
                     FTDWSHTLVDDYFLLPVGLSCGTPCEGYAMYLMSNAVLALKVIRLLYITIRHEHSACV
                     RALCKDVAFLIRMFRYEASIIRKGLAQNATQRMELSRFRRHIHDLKHIHFTVSNFLET
                     FCDFIKIVNKIPDYQCISLTIKRELVLLHLLRLRRVYECPSAETRKGEKLAWYYFRHG
                     DVTLDPGLLMTFDSLLADCELSNNANRCRRKAPFEIPTSATVTVRYQGHIEKLHRLYV
                     RRFRPHEVGGCAI"
     misc_feature    complement(35240..36811)
                     /locus_tag="grh46"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            complement(37064..38077)
                     /locus_tag="grh47"
                     /db_xref="GeneID:2952774"
     CDS             complement(37064..38077)
                     /locus_tag="grh47"
                     /note="similar to human cytomegalovirus UL28; US22 family"
                     /codon_start=1
                     /product="rh47"
                     /protein_id="YP_068141.1"
                     /db_xref="GeneID:2952774"
                     /translation="MVVGHFEPLTALYLRGQPRFTAFWRGLRDAWINTRGRSRERPGG
                     LHLQRFVRANAGRWLPLAWPPLHGILLGDLKYFGVTRDRKTYQRFCCFREASRLYFLG
                     VITVYECSPQAAQSPEVWVSNHGHVFCYMPSEDKVYVLAVSFHELFETGLFAVCSYFE
                     REYVDEIVEGAWYEHNFTSMYDLSQVLHDRKAVVRFCQLHAGTKIRLGGRPACTFTFG
                     SWNVAEANEANRFVIGILERAKYAVIGWIEPVNKAVFLDTNGCVHVLLYGTVMLKLAE
                     TLRGFIRQGSFWFRCSRRFCFSPLGSVSMPVSSQKAQFCDVSEYVYSTRSLLHDESVA
                     AAP"
     misc_feature    complement(37601..37951)
                     /locus_tag="grh47"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(37199..37516)
                     /locus_tag="grh47"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            37289..37786
                     /locus_tag="grh48"
                     /db_xref="GeneID:2952793"
     CDS             37289..37786
                     /locus_tag="grh48"
                     /codon_start=1
                     /product="rh48"
                     /protein_id="YP_068142.1"
                     /db_xref="GeneID:2952793"
                     /translation="MHTAVGVQKNGLIDRLDPANDSVLGPLENPDHKSVGLVRLGHIP
                     GTESESACRPTTQANLGSSMQLTETHDGLAVMQHLRQIIHTGKIVFIPSTLHDLVYIF
                     PFKVATDGKKAGLKEFVERHRQYINLVFRRHVAEHVSMIGNPNLGRLCRLGRTFIDCD
                     DTQEI"
     gene            38190..38588
                     /locus_tag="grh49"
                     /db_xref="GeneID:2952797"
     CDS             38190..38588
                     /locus_tag="grh49"
                     /codon_start=1
                     /product="rh49"
                     /protein_id="YP_068143.1"
                     /db_xref="GeneID:2952797"
                     /translation="MYCFLSLPSLLERQCGTRIELVKRVTIHRSDVFVTIIINQRTQS
                     DTHKGFQVTCYAREALLTHQRHIHNARISAENLNPLEKCFIPFPFNDPQKQNGFTTIA
                     EPLQAPYSDRRHFQILSIGHQHIMVLRPDE"
     gene            complement(38208..39218)
                     /locus_tag="grh50"
                     /db_xref="GeneID:2952806"
     CDS             complement(38208..39218)
                     /locus_tag="grh50"
                     /note="similar to human cytomegalovirus UL29; US22 family"
                     /codon_start=1
                     /product="rh50"
                     /protein_id="YP_068144.1"
                     /db_xref="GeneID:2952806"
                     /translation="MGDESRPRLVRRKRAAAPETFCSRSLSELCMRRDSEGLKRYLMR
                     FEGSCVSLGWPAQCAFVVGGMYSPYAITEIDLEHCQNDFFGESRVLQPLGTVSHYTNK
                     YPVFLDPCGAVIVYDAKEDCLYEVASDLNDFFIRGMIRCDPVHETICRRMQPDVSPLS
                     SAQKVEMCERSRISTRERYLHSLLCFRQLLDCPDNEHRSQYVEEHRNAKLSLIWPENH
                     YVLVANAQDLEMSPIAIRRLQRFSYGREPILLLGVIEGEGNKTFFQRVKVFCGDSGIV
                     YVALVGQERLTRIARDLKTFVRIGLCPLIDDYRYENIGPVDRHTLYELYPGTTLPFKK
                     RR"
     misc_feature    complement(38211..39218)
                     /locus_tag="grh50"
                     /note="single-stranded binding protein UL29; Provisional;
                     Region: PHA03222"
                     /db_xref="CDD:165485"
     misc_feature    complement(38784..39125)
                     /locus_tag="grh50"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(38313..38633)
                     /locus_tag="grh50"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(38351..38755)
                     /locus_tag="grh51"
                     /db_xref="GeneID:2952841"
     CDS             complement(38351..38755)
                     /locus_tag="grh51"
                     /codon_start=1
                     /product="rh51"
                     /protein_id="YP_068145.1"
                     /db_xref="GeneID:2952841"
                     /translation="MFLPCHRRKKSKCVSVLALARASVTCTRCCVSDSFWIAPTTSTG
                     VSMWRNIVTPSCHSSGRRTIMCWWPMLRIWKCRLSLYGACRGSAMVVNPFCFWGSLKG
                     KGIKHFSSGLRFSAEILALCMWRWWVRSASRA"
     gene            38925..39395
                     /locus_tag="grh52"
                     /db_xref="GeneID:2952843"
     CDS             38925..39395
                     /locus_tag="grh52"
                     /codon_start=1
                     /product="rh52"
                     /protein_id="YP_068146.1"
                     /db_xref="GeneID:2952843"
                     /translation="MRHGSQGLQNTRFPEKVILTVLEINFCNGVRRVHAADHKRALSG
                     PAQRHTRALETHKIAFEAFRVTSHTEFRQAARTERFGRRRSLPSNQARSTLVTHIAHA
                     FHLGSLSEKCTPQMSEDPRDTSNLYSPSSSHRGETNNSTLELFRLAFHLYLTLR"
     gene            complement(39548..39979)
                     /locus_tag="grh53"
                     /db_xref="GeneID:2952803"
     CDS             complement(39548..39979)
                     /locus_tag="grh53"
                     /codon_start=1
                     /product="rh53"
                     /protein_id="YP_068147.1"
                     /db_xref="GeneID:2952803"
                     /translation="MKMMMTTMKRQRWMVMRAWATPPRPMIGLRGRHLLGRTSCYLYK
                     IKFQITGSFPTCKRRSKAVSTAARSVQWVYFWEMRVRWCLKPQLDMDGIEAFCEFYST
                     LSIRDQDDFNREVDLGVQHRRLQQLRRARQNLKRECICSGG"
     gene            39865..41487
                     /locus_tag="grh54"
                     /db_xref="GeneID:2952830"
     CDS             39865..41487
                     /locus_tag="grh54"
                     /note="similar to human cytomegalovirus UL31"
                     /codon_start=1
                     /product="rh54"
                     /protein_id="YP_068148.1"
                     /db_xref="GeneID:2952830"
                     /translation="MSVPANVDPATQSSVVEESPKPSSPSTVVVSSSSSSSSSPSPTK
                     IIQPLSQQLLPQAPQPGNIVVVPAPGPDPDYRLPDLRVVRLWLETLKTADRDNFGRCV
                     RHAKTHRTAYHLTAYEPYLIALTDQYNGTPSVTEKASYLHGCLFLSFPVIYNNTQGGT
                     YKHDWSNVSVPRTMLRELFFLLCSTSESPAIFQPIITKGGTCASMVVYPDETASNFTN
                     PQHIGFVYSKLVMIPFVPHAFPSYGVPFLTLPTHMRYCWIEEAPFGHATLTRYNDHML
                     FHVEHLTWTSKRITNHGQKKMSRYTAQFKGMLPDTYLNGTHVWTSSKNIQYEFMGLLF
                     TINIDTLCLDLHHGQCIGSISSSYCHRVADKLTARNMPRSFVFYLLIENQQQCTVQFN
                     RNPYLFFSGDGFNSPLLNEPSPFYLTVHAPYDINFGQNARQTVEIDIRYAHTGGRCFL
                     VANLPYEDSFYTGMCVWQADALKITLWSRLRTTIIPQGTPIAVLYQINETDGNLYAYN
                     HNTVFRQVNHAESTAFYLSDLKLPTNNFLTSP"
     misc_feature    40123..41355
                     /locus_tag="grh54"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            complement(41498..43615)
                     /locus_tag="grh55"
                     /db_xref="GeneID:2952802"
     CDS             complement(41498..43615)
                     /locus_tag="grh55"
                     /note="similar to human cytomegalovirus UL32, pp150"
                     /codon_start=1
                     /product="rh55"
                     /protein_id="YP_068149.1"
                     /db_xref="GeneID:2952802"
                     /translation="MSLKFIGLPPRKVTAITNFLKTLPTKENVDLEQHPKILRKCGEK
                     FLHRRSCLFNQLVLWLAYYRELRYHIPDLSSLLDEFEVNANAVTRRAHMYPFRDPVKA
                     RPHLRTLEATVFGDDSRTDVTVIQNAMVGATALAKLSECQPLGTGEIEFIQLRQKDVM
                     ALEDSLLAISNNMFEIRPVKLHLERHSNSSLVNATNKLIYLGKVIVHVRTSWDILAEK
                     CLIKIKELCKTLMKELRSCRSFESNYCSNIIKHKVIDGESADMLLEMLMEDFAIYEDI
                     FPRSVSQSLGDPFSLEYDDEELHREWQKWLRGGWEGRQTKDDDDDNGQLLTTKKQERK
                     VPDKSERQYAFSLLSPTKQSSQFWDTKPKTPHPVSKRVTFWSDDENQGRAKDETDDVK
                     VDTLVDFDGGLGSLKLDDDDKPSTSTYKFELPKFIQTPILSSPFATQFSNPLFATGSS
                     ETIPGLETPLKEVSGLDSISDYETKTPPASDYSDRESSFSPNKRREVKSEAEISESEY
                     EDIASGDGDEEASDAESVVSVASIPPATPVPPVSDPKAKRRLILKPKTKIIPKPKPSF
                     GPFTSVTSPSTSVLKPRKVIKATPLTVDGSVLKPASFSAPIPGKDVTIVKVPTTIQTF
                     TPGLTTTTSTKAQTASSTEVPGGRAQKMKAEPLTSPRNTPKLSDEAKLKDLLDESSGT
                     IPVPDNVQAIIEKIKEDSRINEE"
     misc_feature    complement(<42728..43615)
                     /locus_tag="grh55"
                     /note="Herpesvirus large structural phosphoprotein UL32;
                     Region: Herpes_UL32; pfam06070"
                     /db_xref="CDD:283680"
     gene            43983..44972
                     /locus_tag="grh56"
                     /db_xref="GeneID:2952832"
     CDS             43983..44972
                     /locus_tag="grh56"
                     /note="similar to human cytomegalovirus UL33, GPCR"
                     /codon_start=1
                     /product="rh56"
                     /protein_id="YP_068150.1"
                     /db_xref="GeneID:2952832"
                     /translation="MTNLYSANFLTLIVLPFIVLSNQHLLPASAVTCKFLSLLYYSSC
                     SVGFATVALIAADRYRVIHRRTQARQSYRNTYMIVGLTWLIGLICATPGGVYTTIVAH
                     RDGESDAQRHNTCIMHFAYDEVYVLMVWKLLIVLVWGIVPVVMMSWFYAFFYNTVQRT
                     AKKQQRTLKFVKVLLLSFIIIQTPYVSIMIFNTYATVGWPMECADLTRRRVINTFSRL
                     VPNLHCMVNPILYALMGNDFVSKVGQCFRGELTNRRTFLRSKQQARNSDDVPTIVSQQ
                     PATPTIVNKPEKNPHVKRGVSFSVSASSELAAAKKAKDKAKRLSMSHQNLRLT"
     misc_feature    43983..44675
                     /locus_tag="grh56"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            45177..45977
                     /locus_tag="grh57"
                     /db_xref="GeneID:2952823"
     CDS             45177..45977
                     /locus_tag="grh57"
                     /note="similar to human cytomegalovirus UL34"
                     /codon_start=1
                     /product="rh57"
                     /protein_id="YP_068151.1"
                     /db_xref="GeneID:2952823"
                     /translation="MTMNIIITTRDFSNDESVVETAELHNSVANSISKAYRGTIRAEG
                     KKKLLIRNLPAAPGCTRRNSNLFIFCHDRDYRKFHQGIVQLKRTRSQVDPSDIVNVTK
                     NIKCRLQPHNQDPPLIAGQLQNTIAHVCTLFNQLVFTAQLRHYCENHERVVLYARDEL
                     TRRCGDKSTLGIHIYQLISLLDQDRHSELCHVLVGLLHQTPHMWARSIRLMGRLRNYL
                     QQRFLHILVESGLQVDSIFESCYHSEAYRLLFQIAQNESNASLSYLFS"
     misc_feature    45183..>45953
                     /locus_tag="grh57"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            45491..45877
                     /locus_tag="grh58"
                     /db_xref="GeneID:2952833"
     CDS             45491..45877
                     /locus_tag="grh58"
                     /note="US22 family"
                     /codon_start=1
                     /product="rh58"
                     /protein_id="YP_068152.1"
                     /db_xref="GeneID:2952833"
                     /translation="MSLTTAQSRSTVNCRTASEHHRARLYPVQPAGIHGPTSTLLREP
                     RASRTVRTRRADPALRRQIHARHTHLSTHLAVGPRPSQRIVPCTRWLAAPNAPHVGPI
                     DTPYGPIKKLLATEVSAHSGGKRTPG"
     gene            46098..47870
                     /locus_tag="grh59"
                     /db_xref="GeneID:2952828"
     CDS             46098..47870
                     /locus_tag="grh59"
                     /note="similar to human cytomegalovirus UL35; UL25 family"
                     /codon_start=1
                     /product="rh59"
                     /protein_id="YP_068153.1"
                     /db_xref="GeneID:2952828"
                     /translation="MSLPPSIPALPVDASLNLRPDLFSDEHRHLLVDILTQGCGGYVG
                     LLCYGLPMPSYVLETLIDFQIKTIYTKIKQIANSVIRICILANYLKNSQDLLVDLQAN
                     LDEINSGANKQRLYRGLHRICRQTNMMDVYRNMSQLLDAGDVTMGVYRQGLTQMRALT
                     EALDLNREPNLQPLYETLTSYNLLYIPPPYLSATAVEIYSENLSDLTKRINRSFNLQT
                     QINRSKRADYVVNDVLFLLSARHLQFRHRLELQILETWIVNKCNYLCNDLYFAYVQVP
                     ECRGTFCNFVSGLQVVRKERHPTFRPLLHNLCSLLNTFHEANVYLCPQYLHSAIFLLL
                     RRVSRVREGDSSDSDSENQEAAEDRDTLLRRFREGDLDLEVDPTSTPLQNFYFAKNPF
                     GNSEIFRIPEQASRYLRRNAWIDRSNLTYISYKLHNGTLSEESFPMRNLYSLIMEGAS
                     RQAGTNARQFMAALQQAPLGHDEPGAADHSDLFADVDIRPAQPSSGSSASLSTPSTSS
                     APSGQPSPSRLGPEQPPRQRRYLSLSNFSPYSVARHHHRRRRPRPPRGPAHTSRQGPD
                     IAASASASGGEDPRDSLAEELEQL"
     misc_feature    46098..47858
                     /locus_tag="grh59"
                     /note="UL35; Provisional; Region: PHA03250"
                     /db_xref="CDD:165509"
     gene            complement(47988..49151)
                     /locus_tag="grh60"
                     /db_xref="GeneID:2952807"
     CDS             complement(47988..49151)
                     /locus_tag="grh60"
                     /note="US22 family"
                     /codon_start=1
                     /product="rh60"
                     /protein_id="YP_068154.1"
                     /db_xref="GeneID:2952807"
                     /translation="MEPFGVVELSKLGFYQLVMMIGRSGAIYCYEETEKCVYCLAPDM
                     KSFIQLGLRRCDYLQKMELYQEPVIDCDEIIKELMIFNWDVDRISDVVAKNGYRVYDI
                     RDPLGEQVDSHFALWSSDSAVANFQDTSFSLMSPSGLRSFEIMVRCVARIVCVNQLLG
                     VLGCFRKEKNEFLVRLYVLVDKFGTIYGFDPALNSIYRLAENMRMFTCMMGKKGYRNH
                     RHDRRRTAIVRLEKVPYCMHGEEPSDPMIMFNDDSEDEKPPKTEADVVVGIYEAIKAD
                     IRFGVDMMMRDSSVTQKFWPQHLEALSDSPLLPSLIYDMEDVRSKMLGNIADMRAFDM
                     SFVGLAEDNDSDREETVRGYLFDDTVCTRCVSSRRLRLFRSGRGMGRARVSYV"
     misc_feature    complement(48021..49151)
                     /locus_tag="grh60"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03244"
                     /db_xref="CDD:177567"
     misc_feature    complement(48978..>49151)
                     /locus_tag="grh60"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(48495..>48680)
                     /locus_tag="grh60"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(49115..49480)
                     /locus_tag="grh61"
                     /db_xref="GeneID:2952837"
     CDS             complement(49115..49480)
                     /locus_tag="grh61"
                     /note="similar to human cytomegalovirus UL36; US22 family"
                     /codon_start=1
                     /product="rh61"
                     /protein_id="YP_068155.1"
                     /db_xref="GeneID:2952837"
                     /translation="MSYRLMSGMDDLRDTLMAYGCIAVRAQDPASLYTFVDQECGTKL
                     HLAWPDNGYIQLRPRTLMGPFSSKYYDVCCQGEDCWLGRVGGVKGDNGKLTVLFCYQE
                     STCAATNSWSRLEWWSFRS"
     misc_feature    complement(<49253..49456)
                     /locus_tag="grh61"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03244"
                     /db_xref="CDD:177567"
     gene            complement(49578..50396)
                     /locus_tag="grh62"
                     /db_xref="GeneID:2952826"
     CDS             complement(49578..50396)
                     /locus_tag="grh62"
                     /note="similar to human cytomegalovirus UL37"
                     /codon_start=1
                     /product="rh62"
                     /protein_id="YP_068156.1"
                     /db_xref="GeneID:2952826"
                     /translation="MKCELNCTYNGTLIYQGPCHLAVNKLRLNMTFPKRRRVWHSMIL
                     NIGLQYYVGGRIMYRLYMLSNLSTSFTGMLQCICNDSSRNVTQGKIVLQSQAWGQHVL
                     SATSADRRNTNCKWQQGNSTEAENSTVKGYVSTWLERHLDTDRYFLSDVCIRLIYRLK
                     KFEASPVNITDQDYADNTTYGVLEWPTWTQVMQLWSSRVVSSKLTLCAWGLFSISSVA
                     LGAFILVALFAGFLGRSQRHIRADIQEMHAARREIRAAQKSKLFYINESADFCD"
     misc_feature    complement(49713..>50396)
                     /locus_tag="grh62"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03171"
                     /db_xref="CDD:165442"
     gene            50598..50981
                     /locus_tag="grh63"
                     /db_xref="GeneID:2952829"
     CDS             50598..50981
                     /locus_tag="grh63"
                     /codon_start=1
                     /product="rh63"
                     /protein_id="YP_068157.1"
                     /db_xref="GeneID:2952829"
                     /translation="MRHMNAGEEQSALLQMQCIMIDSRRVYKQEINSAFYRDAAPSIV
                     RSTIDSSLSESSGCALTFFGLGVGSEHCRVSAFLLSTPLSGSWTLGVGRVTGITLAIR
                     LSLSTNGTGILPSRTRLSASSRART"
     gene            complement(50702..51583)
                     /locus_tag="grh64"
                     /db_xref="GeneID:2952809"
     CDS             complement(50702..51583)
                     /locus_tag="grh64"
                     /note="similar to human cytomegalovirus UL38"
                     /codon_start=1
                     /product="rh64"
                     /protein_id="YP_068158.1"
                     /db_xref="GeneID:2952809"
                     /translation="MATSAEYDQEQRMQQNQMDIGSLIQASVLGKTALRAQVKKLMAR
                     ETHIKHEFGVTVCICDHTYTFLGINLCKISWLERNCPPLSHALTMFGVIEAWDEAAPR
                     PSRQVVLFMSDNYDIYAYDTGILFFMAPTMSEFWTAPIVLEYWNGIFPLEVRHRVRQY
                     AKSVDDLIVIFNQVYHQRDVLEARRQKNQNSPRTFARFLCGYVRALLDAERRVREGKI
                     PVPFVDRDSLMANVIPVTLPTPSVQEPERGVDSKKALTRQCSLPTPNPKKVNAHPDDS
                     DSDESIVDLTMEGAASL"
     misc_feature    complement(51173..51445)
                     /locus_tag="grh64"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            50768..51133
                     /locus_tag="grh65"
                     /db_xref="GeneID:2952835"
     CDS             50768..51133
                     /locus_tag="grh65"
                     /codon_start=1
                     /product="rh65"
                     /protein_id="YP_068159.1"
                     /db_xref="GeneID:2952835"
                     /translation="MCVNLFRIRGRERTLPSQCLFTVHAPLRLLDTRSRKSYGNHVGH
                     QAISIHERHRNLALPNASFGVQQGSHITAEKSGKRPRTVLILLSAGFQHVSLVVHLVE
                     NHNEIVHRFGILPNPVPDF"
     gene            complement(51625..51930)
                     /locus_tag="grh66"
                     /db_xref="GeneID:2952825"
     CDS             complement(51625..51930)
                     /locus_tag="grh66"
                     /note="similar to human cytomegalovirus UL37"
                     /codon_start=1
                     /product="rh66"
                     /protein_id="YP_068160.1"
                     /db_xref="GeneID:2952825"
                     /translation="MLRQAFTMPAIPIQYVNCAGALGMVAFGILSYQWIERKRNQGPP
                     LPPWFKEYLREVKRQRGELEEEQEETVLSPADGIAGLVREAFFALKRSLCRLKRSED"
     misc_feature    complement(<51751..51888)
                     /locus_tag="grh66"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03171"
                     /db_xref="CDD:165442"
     gene            complement(52255..52785)
                     /locus_tag="grh67"
                     /db_xref="GeneID:2952831"
     CDS             complement(52255..52785)
                     /locus_tag="grh67"
                     /codon_start=1
                     /product="rh67"
                     /protein_id="YP_068161.1"
                     /db_xref="GeneID:2952831"
                     /translation="MLLSVAMVMAPRTLLLVVGCLTLLSTVALGVPQPINKYGYVDCM
                     PAYFGSLYIPGVNEPRVLNVPLTGLYCLSGITLESSVTNYTTRNGDRCQNGSLSSAIV
                     SSVRHENGHVPQSTCKGGINLLSCEANSRLLDFIRYLGLYPAASLGFDSLCVYILASL
                     YLGVLKAMTSEMITIP"
     gene            complement(53229..53621)
                     /locus_tag="grh68"
                     /db_xref="GeneID:2952820"
     CDS             complement(53229..53621)
                     /locus_tag="grh68"
                     /note="similar to human cytomegalovirus UL42, gpUL42"
                     /codon_start=1
                     /product="rh68"
                     /protein_id="YP_068162.1"
                     /db_xref="GeneID:2952820"
                     /translation="MSATNESSPRNDSEDVRPPAYDEIVGSPPRPRDLPTQSRRNRRG
                     LTTDAPPDSPPPPYHAVVGEVPPRPDNFRMDMTEFPANMHPPVEAYYDDGWKCTIVVF
                     VVSLLGIILMTVLVSVILVLNKSNNKGT"
     gene            complement(53605..54606)
                     /locus_tag="grh69"
                     /db_xref="GeneID:2952808"
     CDS             complement(53605..54606)
                     /locus_tag="grh69"
                     /note="similar to human cytomegalovirus UL43; US22 family"
                     /codon_start=1
                     /product="rh69"
                     /protein_id="YP_068163.1"
                     /db_xref="GeneID:2952808"
                     /translation="MILSEMERADVLVRHTFICSMSSQKPAKRLIEHVRQMSGTTFPI
                     RWPRGWIFTYRNFLRQGTFGRLNIKDLEKKYLCCDKFLIPVGTVSNGEEALTSGNVFI
                     VLLSEGGRVYVHDKNCDSVQLISRTGFHSLLTEGLMKYPPLREKLGPVRYSFGDSLAL
                     EFEIPTDLMGIWRLCQRNAGKEFSWTCTENIYLAEVVEGERTYENPAHQEWIKDTGSV
                     NVLHIFVLSMLWRQKLIDIPIVVNEQLRVFAVNPDTKRVEYLASSLPAFFRAGVLRLG
                     NQQYFCRQCVRHKKHCNIPPAYLCNTCPREPFCRKQTRNQKQKSRFFCPGSKHVSDE"
     misc_feature    complement(53641..>54573)
                     /locus_tag="grh69"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03175; cl28637"
                     /db_xref="CDD:333457"
     gene            complement(54730..55902)
                     /locus_tag="grh70"
                     /db_xref="GeneID:2952817"
     CDS             complement(54730..55902)
                     /locus_tag="grh70"
                     /note="similar to human cytomegalovirus UL44, DNA
                     polymerase processivity factor"
                     /codon_start=1
                     /product="rh70"
                     /protein_id="YP_068164.1"
                     /db_xref="GeneID:2952817"
                     /translation="MERKARLPEPPTLALRLKPYKSAIQQLRSVIRTLKENTTVTFLP
                     TPALVLQTVRNQFVSKITFNSSCLYITDKSFQAKTINNSTPMLGNFMYLTSSKDLTKF
                     YVQDISDLSAKIHMCAPDFNMEFSSPCVHGQDLMRESDNSAVHVDLDHSVVSELIKWI
                     SPHTRVKRNLKKAPCPTGTVQILVHSAPPAIKFILNSGSELEFTANTRVSFHGVKNMR
                     VHVQLKNLYQTLMNCAVTKLPCTVRIVTEHDTVVHISSHNGLFAVDNFLTEEPFQRSD
                     LSFDKNFKQQRAVAVTNSGAMHDDGCGSGLDSEMMSEPVSRKHERMPPRKSNEHDHNS
                     KEKYEQHKITSYLTTKGAANSGERNSNYFNDAKEESDSEDSVSFEFVPSSKKQKCT"
     misc_feature    complement(54736..55557)
                     /locus_tag="grh70"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            55132..55608
                     /locus_tag="grh71"
                     /db_xref="GeneID:2952838"
     CDS             55132..55608
                     /locus_tag="grh71"
                     /codon_start=1
                     /product="rh71"
                     /protein_id="YP_068165.1"
                     /db_xref="GeneID:2952838"
                     /translation="MTRNVHHRIMLSDDSHRARQLGHRTVHERLVEVLELHVNAHVFY
                     TMKTDARISREFQLTTAVENEFDSRGSRMYQNLNRTGGTRGLFEIALDPCVGGNPLNE
                     LADHTVVQIHMHGRVVALAHQILAVYARRAKLHVKVGRAHVYFCGQVRDVLHIELG"
     gene            complement(56143..58692)
                     /locus_tag="grh72"
                     /db_xref="GeneID:2952816"
     CDS             complement(56143..58692)
                     /locus_tag="grh72"
                     /note="similar to human cytomegalovirus UL45,
                     ribonucleotide reductase-1"
                     /codon_start=1
                     /product="rh72"
                     /protein_id="YP_068166.1"
                     /db_xref="GeneID:2952816"
                     /translation="MAQASLRNTGAGGLEAVMQEGSEGGDGGTEENGVEAMEVATSSP
                     DAEQQQAQQQQQQPQVGVHACWSLADQGTATSCRPDASSSLVQHMPAMNTVQLLMGKK
                     CHCHGRWGKFRFCGVPDPVKHVEDRATLWRDIDSASRQSGIRGAYRLFQMLMRYGPAL
                     IRQIPRSDLLIGRFYLKVNWLRESRNALNYTSSMCEGPLRDFVMRHSEDLPKILADIT
                     RYLDLAGCWGFYGAIVLTDKVSRQIYGQDESLGGIFLRISMAITLAIVSSPCARVYRF
                     HMDCRHECEVLESVVKRCRDGQLSLTPFSMSNIGFVELPQYDYLISCDLYSREVDWLA
                     LHKWLYENLTRGVSLSINVTRFNVEAISVIRCIGGFCDMIREKEVHRPIVRIFVDLWD
                     VAAIRVLNFVLKETDIIGIHYAFNIPSVLMKRYRAQDSHYSLFGRTVSRKLSECGNEF
                     AFEKEYVRYETTVPKVTVKASEFMRNMLFCALKGKCALVFVHHIVKYSVLTGNMPLPP
                     CLGPDMASCHFGESDLPLQRLSINLTRCLFTRTDDDVLCRDNVVLGNTRRYFDMQVLR
                     TLVTEAVVWGNARLDALIRSGDWPLESAICKMRSLNIGVTGLHTVLMRLGFTYFASWD
                     LIERIFENMYYAALRTSVDLCKSGLPPCEWFDRTIYKEGKFIFELYRKPHLSLPVAQW
                     ETLRTEMQEYGVRNAQLLSIAADEETAFLWNVTPSIWAARDRIVDEETVLPVSPPSDE
                     CYFPTVMQKHLKVPIINYAWIEHHDEVKAKSITQGTVQRADVPSCVFQRAAELQADVE
                     MASVNVSMFVDQCVPLPFYYESSMTPDLLMKRMLKWYHLRCKVGVYKYCAS"
     misc_feature    complement(56539..>57294)
                     /locus_tag="grh72"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:299130"
     gene            56404..56829
                     /locus_tag="grh73"
                     /db_xref="GeneID:2952827"
     CDS             56404..56829
                     /locus_tag="grh73"
                     /codon_start=1
                     /product="rh73"
                     /protein_id="YP_068167.1"
                     /db_xref="GeneID:2952827"
                     /translation="MLNPSVINDGNFQVLLHHSWEITFIAGGADRQHGLFVDDAIPGG
                     PDRWRYIPQESRLLIGGDGQQLSVTHPVLLHLSSESLPLRYRERQVRLAIQFKYELAL
                     LVNGAIKPLTWRQSRFTQVYAGAQRRIIHVFKNSLNEVP"
     gene            58181..58483
                     /locus_tag="grh74"
                     /db_xref="GeneID:2952818"
     CDS             58181..58483
                     /locus_tag="grh74"
                     /codon_start=1
                     /product="rh74"
                     /protein_id="YP_068168.1"
                     /db_xref="GeneID:2952818"
                     /translation="MRRSERGICLMSAGPYLISIWKRRYAPLIPDCREAESISRHKVA
                     RSSTCFTGSGTPQKRNLPQRPWQWHFLPISSCTVFMAGMCCTREDDASGLHDVAVP"
     gene            complement(58711..59583)
                     /locus_tag="grh75"
                     /db_xref="GeneID:2952824"
     CDS             complement(58711..59583)
                     /locus_tag="grh75"
                     /note="similar to human cytomegalovirus UL46, minor capsid
                     binding protein"
                     /codon_start=1
                     /product="rh75"
                     /protein_id="YP_068169.1"
                     /db_xref="GeneID:2952824"
                     /translation="MDAREIAKRPRDPNDEDNELVLAVKLKREVNTLAVRYLYEADHQ
                     AITSRFFVPEGLVEFEVHPGSLMFRMETGAESPRYLYISLYLMAIKATNVSMATKCQL
                     EGIYTSGPAKAALAWLDVGSKVLHRRLRTIGCVKSVSLGITSLLTCVLSGYLYNTLKT
                     EIFSLWIPKDMYMTLEETQGRLQNVYLIMVYDYEVLETKVAIYVATSSISNRHTLTDL
                     VRHKFIAERCSFVNKRITRPRQISLCTGVIQKLGWCLADDIHTSVLTHQEVKLSTVRL
                     EHFNVELSEFTEFV"
     misc_feature    complement(58714..59496)
                     /locus_tag="grh75"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            59582..62458
                     /locus_tag="grh76"
                     /db_xref="GeneID:2952819"
     CDS             59582..62458
                     /locus_tag="grh76"
                     /note="similar to human cytomegalovirus UL47, capsid
                     assembly protein"
                     /codon_start=1
                     /product="rh76"
                     /protein_id="YP_068170.1"
                     /db_xref="GeneID:2952819"
                     /translation="MMRKRTVDFQVILNELKQKSTEVQAVLNTLSQIEIGALDVETVN
                     ATKIQQFLQLIPQEGYHFTFIQQNVVYYILSHSTLQTSRDSLSSAQELLKELQKHHQR
                     HAITSPCEYLNNQTTLTHLQTFMDKMQDLQKLFDTNQFLAATVPDRKNQKPRDISDNG
                     TQYLIRSVFTQIEEATEHIRPFSNCRLVAELIDMLYHNTLRWAMGLMQYHAFIEKHDQ
                     ELDTILKMHFFYKYYKAVNSELNTEFQTFITSDKRNLGPFMVSDADGDQQIGAEHIRD
                     LSFKVFNANLNDRDTTGLAFPILLTTLSVLNHMAVLNLFYHPGLVFRLLSEESTPSAS
                     EMQRLDLIAQMCSQVSNEFFRTITKKPVKLRDLMTRIRKFTSLGLNRQTSRTYAQMAL
                     LQPSRTTPKKGSEMWFEIRQQLIVAIYNTYVFFMCLWVYSPTFLFIHRRKIILEQQRS
                     TLIGSRRELQFIWDNVTNNIQHDFYVMFTEDEFNVTTKGATELEKDYLYRDLLNKWGD
                     ILFVMKPKLTPDAQSPSLDNVTTADVIKRCAMINLSEVNVPYETLLPLTHHPSFLDTF
                     VNLVIVPEFSQILAVPHNQFLTMGSPRLLRLTQACRLLVPDQIALYNKLVSLYNLTTF
                     ISEIDAGVFRTIYNLTLEIAALLENLCGEPVSPELDLLVELMAQSLSHNLQTTVNPLI
                     EEVIQNNSTSVAKYLEHTNLCYSFAHTIGQLSADMSTVELTLQSKTLAKLSITQFLKM
                     VQALIQKDQQLSDSFHRIHDRLQQIKQRMKQITEDVIQLNEYSKNHPLAVDVVKCLRK
                     AARQLKSLEERLILIMEQTQKSNRLIIGSLKRIEKTCMVLSSKNIEEHGIRYCIAESR
                     GLLRTHRSVSAIPASAVDYLPDNAESQLRTFLKGFREAGVEHSPLQMSGNTDIQQQIP
                     IPEVLTNRYEPSNQTNDLLNWYITSKDQAENDILTSIYPEARHE"
     misc_feature    59633..62209
                     /locus_tag="grh76"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            complement(62052..62357)
                     /locus_tag="grh77"
                     /db_xref="GeneID:2952814"
     CDS             complement(62052..62357)
                     /locus_tag="grh77"
                     /codon_start=1
                     /product="rh77"
                     /protein_id="YP_068171.1"
                     /db_xref="GeneID:2952814"
                     /translation="MVHNGLSRLRGWGFVVGYPCCRSSEADCVPRRLLGTPSERCVTA
                     TRRCLAGNPRPKRVWRIRTDACATGPEIPRYSIVCRVPRYSCYSAPYRFSRCVSESQ"
     gene            62479..69012
                     /locus_tag="grh78"
                     /db_xref="GeneID:2952834"
     CDS             62479..69012
                     /locus_tag="grh78"
                     /note="similar to human cytomegalovirus UL48, large
                     tegument protein"
                     /codon_start=1
                     /product="rh78"
                     /protein_id="YP_068172.1"
                     /db_xref="GeneID:2952834"
                     /translation="MKIYPARFDQTHSRFGPRAGSQCVSNCFMYLHALHLHGAHTTLS
                     KDTLDLILTEGAQLDSLVETILQQKRPGEKLPVFRLGEEIPNIITSSFGKTAHALSRP
                     FNGTAETRDLDGYTCLGIFDFLMYAYQKTRPVYILVTVNALARAVILLDHDIFVFDPH
                     ASERSRYAAVYQCDSLYDVVMLLTYFGARLGDFYYDALFVYMLDLSIHPVPEADINGV
                     IISSFRDPDIALPASSAPPGSPVQTIPSLPPPESTPKKTPEKRKSTSSASHGGKKKAA
                     EFKDPGSSSSRVSTTAPYNCLEALPALTRYERLIKQAEKEIQNITIKAPPTAGWILFS
                     SSGMPFDEAFLTDRMEQLVMSSIEHASCLHTRWRPTTPMYQQVRQLRGFSESIDRFLT
                     LWLQNDLHLLDMYEALKNVNTSSLTVLQRAMLDKLRAVFAQYSSSQGPKVVQWVKDIL
                     KATEKVNYTHLPIRLMEYVEEHPLDIDETFVCLKQQDFSTIVNAVNSRRQITTQQQEQ
                     VQQALQKLSAAIYGIDSRYLDRVSFDDKETKDTLSKLDNQSRTTLLQRGNTKMNELKD
                     DLKRQISDLLERKHNQIISGTLPVQDMQALQRRLEQAVNLAQEMSELRLCDVNFTIPF
                     RELSNQLDYLITGQASSSNAMSFSDELMQLRSQFTYATQTKEDTESKIHDLMVHIEDT
                     VQNLTSRSSNITMSMIQEQLSELQQLGGGNMPDIAKRLEKVQKTLHGLYQEEQATRIF
                     VHGLKYENLPNDQTMKRYTRLSELLRDDDNLHEVFIEKILDIFNTILERLFDKTFPKA
                     QAFDMINALINQIPHASTIIKDLHTANAAISQLSKQLEALNKVPPDKRLNALTELVQY
                     FVSNGKVFSHLMSMQVGKNTLPTLYENLKMELEDKHKQQAENKWLQDAKKLTVTSAEM
                     VHQFMQTAPSATAAELARPELSAKLQTFLEQEAKKQEEERKTVFKERQGMVTSELARI
                     TDAIKAQTLSVIPSLKLESLQDVIASLGSGARDILEKFDRSLLATLSNLVKLMDERVS
                     LCIQDVLTGQDTHYQQYQEDARAMRQGLTYIGTLMRNQLSQETLRTLSNLVLQSMFVE
                     KCQLRDAMTVFSNSDYLEDYQRYRAGQRQLEMQIQEARMELHRQATTAERALHQPNAR
                     VDAKNLTVGKDLAEKLDLESAGPFQRSVFATVLTQQLETHKKTLKDETELMNTKLKSE
                     NELRQAKMTSLSEQWSDLVTRQKMDAMEVATPDAKHLILNPVAALTELLAKASTQMSY
                     LDAEKTFAWALLFLHEAKNQIENHPGHPCYAQLPNFPVLIQQAQGRLDTVRVHVNNNA
                     SCENFVAQHESGGAITDRETIMTVETVWATLEPKRIAGGEARYQKVQELLLRMKQSLS
                     DVELQDTLATEYYQLLSSIQTFGYSLDFNMQLQKIRDLKARFNELIKQQHLNTSEEVP
                     FPMPPIPGNDITVASPLSFAKGLAALERYVLAGYQYLTECINRQPLICQRIDDIPAVL
                     PPTDIDHKKAALDRLKRLNFSKKNDTYYEVIDAFGLHQLMSRTGTPLHYLLSYGNVLF
                     KYLALHHDEKHLAKKFAQVKNVVTGRYKVVTVTVAVAQTIKSFWTQISQYDLKPLLSG
                     QPLLGLGETNSLVNLKIFIYIVVSAWNLQLDVSQDISGPVIRIPIQDLCITITTFYPE
                     YIYGIVKHPIQNTLSSLVRALKKDIVQEAINNVVQMPPAYNADEIKGFCVNPKIWSSV
                     NLSRVLWDHNLVRQICAVGPRKNGNGKLWQYAVAILIFPQDLLQCLWLELRPKFAEEF
                     ATMFDFFQTLFMLFTHEYDIARESNTNTHLNTGEPIMQTISIRHKEYTEKSLLDIFIE
                     TETALDYALGSWVFGVPVCCAIHVADILGGNRLLLARHLEYTNRDPDFLHVQRAKDLN
                     LNYLVSQTWTNTPLEQCWFQAQIQRIREHLRTPLQLDFIPLIIYNAHDRTIHSILRPP
                     TTAERDVSRIMVENPFPTVPLIDVPESDLISFTRVPINTDFLREDPPPISRPRSHRST
                     ASGVSRGSKAKPSKTTQGGATASKLPSSSSSSERARVHTVGSSVDVPEVVSEGETTSG
                     DETEGEDFTHLPSEEEQQSLPSTRTFVEPVFRQRPLQTIVRREDVTTVSPSAASSSFN
                     NPPITTLTQNVISAIQILSSVRVDLRSMARSVNETINRLRFLYLL"
     misc_feature    62506..63027
                     /locus_tag="grh78"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:309812"
     misc_feature    <64351..>66165
                     /locus_tag="grh78"
                     /note="RecF/RecN/SMC N terminal domain; Region: SMC_N;
                     cl25732"
                     /db_xref="CDD:330553"
     gene            69181..69846
                     /locus_tag="grh79"
                     /db_xref="GeneID:2952810"
     CDS             69181..69846
                     /locus_tag="grh79"
                     /codon_start=1
                     /product="rh79"
                     /protein_id="YP_068173.1"
                     /db_xref="GeneID:2952810"
                     /translation="MVFVTGCSMLSCGKSSTLVHTCRRLSSSLFTVGPVPLELDMTAV
                     TGRLFHQGATPTERGAVLELQAAVSILSGLAARAQESVPVPREPQQPWDVDGAHHHGG
                     VARPRRAGQDNVKSHDVIVHRTRGVEAQHRLPADPQAAMPINGLRHHLVNAFFNDTLT
                     SAKRAVHEFGVGIENDTLFLAVSIIEHGVQGKVLLTLQLLFAQVETVSALTTHHGNQR
                     PGV"
     gene            complement(69295..70764)
                     /locus_tag="grh80"
                     /db_xref="GeneID:2952812"
     CDS             complement(69295..70764)
                     /locus_tag="grh80"
                     /note="similar to human cytomegalovirus UL49"
                     /codon_start=1
                     /product="rh80"
                     /protein_id="YP_068174.1"
                     /db_xref="GeneID:2952812"
                     /translation="MSRDFHRALWRLFAPLCAHDEHFHVQMVIGRGAWQTEEQICALQ
                     LFVTDKRFLNRELGDRFYQRFMHEWLACAPAEREAVTMFFQRMVMTKPYFMFLAYVYS
                     MNCFHGVSRTVAFLRFERYDADYVYIRLQQYPAEKLSALLDGMTSSTLGDFHRFLFGV
                     DLRLPVLNQTSSPCLSLLRAKRFDGRADLAVYHRNEWARHRKSRSAQLEALVAALRRH
                     AGPVPCGNPLYVMARQAIQFFCDTCPRYLVPLRALGLNDEVRAHKQPRPLEPTKIVMH
                     GLAVALRGGLIGSVIELPLWCLCRLKCERHLDSRSLIAVVCRQCGHCLNLGKEKLQCE
                     QNFPLNSMFYYRDRQEKSVIFNTNAELVHCSLCGSQRVIKERVYEVVSETIYGHRCLR
                     VGWKAVLGLNAACAVYDHVVTFDIILPCSARTCDSTVVVRSVNIPRLLRLTWHGHGLL
                     CSRCQSGEYRDSCLELENCATLCRGCTLVKQTACHGSHV"
     misc_feature    complement(69400..70146)
                     /locus_tag="grh80"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     misc_feature    complement(70703..71629)
                     /note="similar to rh81; similar to human cytomegalovirus
                     UL50"
     gene            complement(71655..71990)
                     /locus_tag="grh82"
                     /db_xref="GeneID:2952839"
     CDS             complement(71655..71990)
                     /locus_tag="grh82"
                     /note="similar to human cytomegalovirus UL51"
                     /codon_start=1
                     /product="rh82"
                     /protein_id="YP_068175.1"
                     /db_xref="GeneID:2952839"
                     /translation="MASFRSARAVHGEDPDDDEDGTLDPEDELEVSFEPMLPRVYELM
                     LPSLDARLNFINAGQKYAAFLKYVHGECSSCNHAQILNEKTKLLTAIVNKLMDINGIL
                     EGKEESAGK"
     misc_feature    complement(71682..71900)
                     /locus_tag="grh82"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            72069..73724
                     /locus_tag="grh83"
                     /db_xref="GeneID:2952836"
     CDS             72069..73724
                     /locus_tag="grh83"
                     /note="similar to human cytomegalovirus UL52"
                     /codon_start=1
                     /product="rh83"
                     /protein_id="YP_068176.1"
                     /db_xref="GeneID:2952836"
                     /translation="MNHHPTSRNYAYTGWELDLTQPLNEITNELLWHAHPRQVPEAAA
                     VAAATAAAANVAAGTSQTGSITAGSGGGDRASNNPFLFTQSQCTDQLFGGLGSGQFCD
                     LDSELATFEFSDTERLKKLCTPLNIDTRCNLCAIITICLKQDPDQAWLLDYSLLCFKC
                     SSAPRTALSLLIVMSELTHLLRQHFPDLHIDQLFRQHVLTVFDFHLHFFINRCFEKQL
                     GDAVENENITLSHVAVVKALVMGDEMVPYAKHRCFSHHKQKIVVKIPEAPKQLLQTFT
                     EHSTPTPERFTYLLFYMWAGTGVMATTGLSELTQSKHHLLDSVADADDPEINKDVGPI
                     YLSPVPVFQTKNQTNTVCLLCELMACSHYDNLVLRNLYDRITLYCENNVKMVDRIQLA
                     LADMMRECAVPMHSQFEDISRYTRLPPPANYLSEHPVRPDPIVCIILRQAGVTGIYKH
                     FFCDPQCAGNIRITREEVLFGRLHLEHLTEVKLAICHDNYYISQLPRRVWLYITIFKA
                     FQITKRSYKSKTQLSDFMREFTQLLEACEIKLVDPAFVVDKYV"
     misc_feature    72090..73721
                     /locus_tag="grh83"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            complement(72179..72484)
                     /locus_tag="grh84"
                     /db_xref="GeneID:2952822"
     CDS             complement(72179..72484)
                     /locus_tag="grh84"
                     /codon_start=1
                     /product="rh84"
                     /protein_id="YP_068177.1"
                     /db_xref="GeneID:2952822"
                     /translation="MVMMAQRLHRVSIFSGVHNFLSRSVSENSKVASSESRSQNWPLP
                     RPPNNWSVHWDWVKRKGLLLARSPPPLPAVIDPVCDVPAATLAAAAVAAATAAASGT"
     gene            73717..74583
                     /locus_tag="grh85"
                     /db_xref="GeneID:2952821"
     CDS             73717..74583
                     /locus_tag="grh85"
                     /note="similar to human cytomegalovirus UL53"
                     /codon_start=1
                     /product="rh85"
                     /protein_id="YP_068178.1"
                     /db_xref="GeneID:2952821"
                     /translation="MFNGVRSTERRSALRSLTRKRRPRRGSLLSPPNQKPTSSSPSEI
                     ATPRPRLTLHELHDIFQEHPDLEIKYLNMMKMAITGKESICLPFNFHSHRQHTCLDIS
                     PYGNEQISKIACTSCSENQVFPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLRMS
                     TNQPAIFQIYYIIHASNHDIVPFMSTDRDRLHMHIIFENPDVHIPCECVSQMLLAARD
                     DYHITLDIVKGHVVISVLCQTLTLSSVKIDVTVLQRKIDEMDIPNDVSESFERYKDLL
                     NELCHVNNARSP"
     misc_feature    73822..74547
                     /locus_tag="grh85"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     cl27388"
                     /db_xref="CDD:332209"
     gene            complement(74128..74559)
                     /locus_tag="grh86"
                     /db_xref="GeneID:2952840"
     CDS             complement(74128..74559)
                     /locus_tag="grh86"
                     /codon_start=1
                     /product="rh86"
                     /protein_id="YP_068179.1"
                     /db_xref="GeneID:2952840"
                     /translation="MAEFVQEVLVALERLADVVRDVHFIDLALQNGHIDLHAAEGQGL
                     AQHADDHVAFDDVEGDVVIVARRQQHLRHAFARNVDVGVLENDVHVQPIAVGRHERND
                     IVVRGVNDVVDLENGRLVRRHSQQFAAFTEPIIKISILHNV"
     gene            complement(74561..77668)
                     /locus_tag="grh87"
                     /db_xref="GeneID:2952813"
     CDS             complement(74561..77668)
                     /locus_tag="grh87"
                     /note="similar to human cytomegalovirus UL54, DNA
                     polymerase"
                     /codon_start=1
                     /product="rh87"
                     /protein_id="YP_068180.1"
                     /db_xref="GeneID:2952813"
                     /translation="MFFNPYLSGARKPPNLVAKRSVAKTFLEIVPRGAMHDGQSGLIK
                     HKTGRGAIMFYRDIKHVLENDMAWPCPLPAPPPSIEAFARRLMGPLKFHTYDQVDGVL
                     THDTQECLSPRYRHHITPSGNVLRFFGATEQGHSICVNVFGQRSYFYCEYADGDLLRD
                     LLASVSDLVSEPRMAYALTITPVQKMSIYGYGTSPIPNLFRVSISNWSMAKKIGEYLL
                     ENGIPVYEIRVDPLTRLVIDKKMTTFGWCCVHRYEWRTHKSSTCDFEIDCDVADIMAV
                     SDDTSWPVYRCLSFDIECMSASGGFPAAEQTDDIVIQISCVCYNTGGTGCEENTVFGT
                     SGLHLFTIGSCAPLAGVDVYEFPSEYEMLLGFLIFFQRYSPCFVTGYNINSFDFKYIL
                     TRLEFVYKLSPGPYSKLPAQGRFSMYSPLKKFVTTTTTKVFISGTVVIDMYPVCMAKT
                     SSPNYKLNTMAELYLKQQKEDMSYKDIPVKFISGCEGRAQVGKYCVQDAVLVKDLFNT
                     INFHYEAGAIARLARIPMRRVIFDGQQIRIYTSLLDECACRDFIMPNHKGADNSSEPT
                     DVSYQGATVFEPEVGYYSDPVVVFDFASLYPSIIMAHNLCYSTFVAPGGESPPESDVL
                     TVELESGLSYRFVKNTVRNSVLSELLTKWVSQRRAVRETMRSCHDPVKRMLLDKEQLA
                     LKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLMRTSQFVEENFAEPCFLHNFFN
                     REDYSGDPVAVKVIYGDTDSVFVCYRGVTAAALIERGPSLAHYITQCLFVDPIKLEFE
                     KVFGSLMMICKKRYIGKIVGETELSMKGVDLVRKTSCEFVKNVTRDIIQLLFDDPEVS
                     RAAVQLSRLTLDELKMQGVPPGFGRVIQRLSQARDELYTSRARVEELVLSSVLSKDVS
                     LYKQSNLPHIAVIKRLAARSEELPVVGDRVFYVLTAPVDGRSSGVRNYEIAEDPTYVR
                     EHGVPIHADKYFDQVIKSVTNVLSPVFPPQTLRKDKFLLGILPHRIYLEPSFLPYCVK
                     ASEHC"
     misc_feature    complement(76289..77281)
                     /locus_tag="grh87"
                     /note="DNA polymerase family B, exonuclease domain;
                     Region: DNA_pol_B_exo1; pfam03104"
                     /db_xref="CDD:308626"
     misc_feature    complement(74675..76117)
                     /locus_tag="grh87"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:306614"
     misc_feature    complement(order(75392..75394,75605..75607,75617..75619,
                     75698..75700,75881..75889,75896..75898))
                     /locus_tag="grh87"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(75389..75394,75398..75400))
                     /locus_tag="grh87"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            77489..77866
                     /locus_tag="grh88"
                     /db_xref="GeneID:2952815"
     CDS             77489..77866
                     /locus_tag="grh88"
                     /note="similar to human cytomegalovirus UL53"
                     /codon_start=1
                     /product="rh88"
                     /protein_id="YP_068181.1"
                     /db_xref="GeneID:2952815"
                     /translation="MFNVPIKHNCPTPSLMFNEPRLSIVHRPARHNLQKRLRHGALGD
                     QIRRFSSTTQVRIEEHICSGCQSHLVLVLNLLVAPSPSVAQAVQEAGGLTVRCEIFVI
                     RFCLSAFFLIQFLQSQKHLIGLL"
     gene            complement(77687..80071)
                     /locus_tag="grh89"
                     /db_xref="GeneID:2952811"
     CDS             complement(77687..80071)
                     /locus_tag="grh89"
                     /note="similar to human cytomegalovirus UL55, gB"
                     /codon_start=1
                     /product="rh89"
                     /protein_id="YP_068182.1"
                     /db_xref="GeneID:2952811"
                     /translation="MSKFPYRVCSMAQGTDLLRFEQNINCDSFKPTKEDFEEGIMVVY
                     KRDIRPYTFKVHMYQKILTFRQSYSFIRENHLLGFSQEHLAVPMWEVHYINKLNRCYN
                     SVVRNVAGATYVNYHRDSYVNETMLLVEDDFSNTHSSRFVTVKELWHKPGSTWLYTTS
                     CNVNCMVTVTTARSKYPYDFFVTSDGKVVDISPFYNGSNNKHFGENRDKFSVRKNYSM
                     IAYYGRDNAPEVAHPLVGFFERPDVLMSWDIVEEANNTCEYTFWEQSERTIRSEADDT
                     YHYTSSSMTATFLTSKEELNESDPSFQCIKDKANEQLQLIFNTSYNETYVQSGNVSMY
                     ETTGGLIVFWLPVKEKSILEMEELAVAYNNTNSSTRRKRSTDSASDSNKTSEEVLKSI
                     VYAQLQYTYDTLRNYINRALRQIAEAWCKDQKRTLEVFKELSKINPSAMLSAIYDKPI
                     AARFVGDVISLAQCVEVDQNSVKVLRDMRTKECGVCYSRPVVLYTFKNSSHVQYGQLG
                     EYNEILLGRHRTEACEYPSLKIYIAGNSSYEYVDYLYKRMIPLDSISTVDTMISLDID
                     PLENTDFKALELYSEDELRSSNVFDLEDIMREFNTYKQRMIHVEGKVFDKVPGYLRGL
                     DDMMSGLGSAGKALGVAIGAVGGAVASFVEGVVGFIKNPFGSFTVILFLLAVLGVIYL
                     IYMRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAY
                     QMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV"
     misc_feature    complement(77690..80071)
                     /locus_tag="grh89"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            79376..79822
                     /locus_tag="grh90"
                     /db_xref="GeneID:2952805"
     CDS             79376..79822
                     /locus_tag="grh90"
                     /codon_start=1
                     /product="rh90"
                     /protein_id="YP_068183.1"
                     /db_xref="GeneID:2952805"
                     /translation="MRNFWSIVSSIVRNHRIVLSDGKFVTVFSKMLIVRSIVKRRNVH
                     NFTIRSHKKVIGVLRSSCSYGHHAIYITTCSIQPGTARFVPKFFHSHKAGTMSIGEII
                     LNQKHSFIHITVPVIIYISSTCHIPDHGIVTSIQFINVMNFPHWYG"
     gene            complement(80217..82523)
                     /locus_tag="grh91"
                     /db_xref="GeneID:2952804"
     CDS             complement(80217..82523)
                     /locus_tag="grh91"
                     /note="similar to human cytomegalovirus UL56, capsid
                     assembly protein"
                     /codon_start=1
                     /product="rh91"
                     /protein_id="YP_068184.1"
                     /db_xref="GeneID:2952804"
                     /translation="MNLLQKLCVVCSKCNEYAMELECLKYCDPSVLLAESSPFKKNAL
                     AIAYLYRRIYPELVRQNRTQTSLLSLYMEMILKALYEDTELLDRALKAYSRRQDRAEY
                     YRTVLRLDRCDRHHTVELTFTDNVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEV
                     CSQLLQLLRRLCGVSPVACQEAYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNHI
                     VVHRPSSQCDVNIQTVEQDLTELTQRIPSLSGVLTALKNLFSSSSVYHSYIQEAEEAL
                     REYNLFTDIPARIYSLSDFTYWSRTSEVIVKRVGISMQQLNIYHHLCRVLMNVLSRYL
                     YGEDVEDIFVLGEKLLSREQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKLHES
                     NEMYTKIKCLLDEIRRPVPDGAAAAEGVGAAIHGQDPQSTSSNGGAPDEDNEFLDYMD
                     ARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDF
                     ISRLMNGFIYRTRYRDNPDVVDVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQ
                     LCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEGTVYPSEWMVVKYQ
                     GFFDFSSCGDLNMLQKEMWKHVRELVLSVALYNETFGKQLTIACLRDDFATDHDLILT
                     YNKEWPLILRHEGTLYKSKDLYLLLYRHLARPDEQNNVFREPDSVSVPATIPRRARAS
                     RKRPRDVSVLFDLVRDQDEQELVPASLC"
     misc_feature    complement(80598..82514)
                     /locus_tag="grh91"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            complement(82670..86152)
                     /locus_tag="grh92"
                     /db_xref="GeneID:2952784"
     CDS             complement(82670..86152)
                     /locus_tag="grh92"
                     /note="similar to human cytomegalovirus UL57, major
                     DNA-binding protein; ssDNA binding protein"
                     /codon_start=1
                     /product="rh92"
                     /protein_id="YP_068185.1"
                     /db_xref="GeneID:2952784"
                     /translation="MSNEELSAIAPVGPAAYLYFTKTNPEMNEVLATLSLCDRSTPVV
                     IAPLLMGLTVDQDFCTSVRTPVVCYDGGVLTKVTSFCPFVMYFHNTREIIHFSEPHGE
                     VQRLCDETRQKYSLETYVPEEGRAPTDLAALCTAAGCDPQEVVVHVVVGNGLKEFLYA
                     GQLIPCFEEAVPTRLNDCDAVRVPLYPPTLFGSLQADADSDEVSLDKRNSFVESRGLY
                     VPAVSEALFYYVYTSWCQALRFSETKVLIEAALKQFVHDSQQSVKLAPHKKYFGYTSQ
                     KLSSLEKDQLMLSDAVICELGFSFASVFLDSAYGASDSMVYSEWPVVMNAADHRELIK
                     ALTELKLHLSTHISALLFSCNSILYQNRLVYLTSNKNASGTGASQEALLKSIHFANGL
                     TGLCEDTYNDARKLIKSSGTVVKDERYAPHHLALICGTCPQLFSALVWYLNRVSVYNT
                     GLTGSSTLSNHLIGCSSSLCGACGGTCCHTCYNTAFVRVQTRLPQIPRLPKKEPCVVV
                     MQSRFLNDVDTLGTFGRRYSAESKETNLDTKADEGSAPTSNRSASSSVDRTHRLNRIL
                     DYCKKMRLIDSVTGEDTMTINGRADFINLVSSLNKFVDDEAMSFVSEVRMKSSRDEVS
                     GATQAFNLDLSPYAVAFNPILSYEYYRVILAIIQNVALITATSYIVDNPLTTSLVSRW
                     VTQHFQSIHGAFSTTSSRKGFLFIRNVKSSKNVDHDRLPDFKLYARGTYSVIPMEIKL
                     SRLSVPALLMFRVKNRPISKASKGTTAHVFFRREHVPKKNPVKGCLGFLLYKYHDKLF
                     PDCGFSCLQFWQKVCANALPKNVSIGDMGEFNNFVKFVISVTADYNEHDLIDVAPDCM
                     LNYLEHRFHNKFLCFYGFKDYIGTLHGLTTRLTYQNHAQFPYLLGETPNFASPADFAL
                     RLKDLKAAGVIAPLAATVTRESLMRTIFEQRSLITVSFSVEKYAGVNSNKDIYQFGQI
                     GYFSGNGVERSLNTNSMGGQDYKFMRQRCILATKLSDVLIKRSRRENVLFDEDIIKNR
                     VMAALDSDNLDVDPELMAMYEILSTREEIPERDDVLFFVDGCQVVADSLMEKFSRLRE
                     MGVSDFSLPNLQQVLDSRLEPGGGGEVHDLSALFTAPAVGEAVANSVGVNAGGGEHAF
                     DDDCGLLPAKRGRL"
     misc_feature    complement(82673..86152)
                     /locus_tag="grh92"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            complement(87380..87694)
                     /locus_tag="grh93"
                     /db_xref="GeneID:2952776"
     CDS             complement(87380..87694)
                     /locus_tag="grh93"
                     /codon_start=1
                     /product="rh93"
                     /protein_id="YP_068186.1"
                     /db_xref="GeneID:2952776"
                     /translation="MRGGGWACRPLLELGQGSLQWGMEKGTPDPRKPKEWGLGIENNV
                     PFNYIEVRAPHAHCAVPIFRNPPHTTSENGVHMRTKPDPPHTGERGVWGVRGSRLSLL
                     GF"
     gene            87758..88315
                     /locus_tag="grh94"
                     /db_xref="GeneID:2952801"
     CDS             87758..88315
                     /locus_tag="grh94"
                     /codon_start=1
                     /product="rh94"
                     /protein_id="YP_068187.1"
                     /db_xref="GeneID:2952801"
                     /translation="MMGALPPSLSQHASLYVLQNAQKNADAAVFTGKGRSQNFPELPI
                     SSLKAGLPGARWRSPRRRPGNRQWRPGHSRGLHTAPTPPPTGASQPRWGGGAGSKVDL
                     APPSPTPSPYLPPGRLGDGAAFRWRYPLPPAYPPLLPWSGGWDGVLHAPPPPPRQPHP
                     AAGWILRYGAPGPRAPALLGGPLGA"
     gene            complement(88049..88750)
                     /locus_tag="grh95"
                     /db_xref="GeneID:2952786"
     CDS             complement(88049..88750)
                     /locus_tag="grh95"
                     /codon_start=1
                     /product="rh95"
                     /protein_id="YP_068188.1"
                     /db_xref="GeneID:2952786"
                     /translation="MALVASSSRAAANRNRFGDRWSRHPGTGGFSAASRSCSAAACPD
                     PALRPGLVGASRLPTRRRSARAARTTWSRNRGRPSAAVRAPQGAYPANPGTAQLAGGG
                     VARPSWGAGARFPGRSQASVPPSRAHAPPPARAARPLPGERAWLRPQRAAQKGGGARP
                     RSPIPQDPARGGVGLSRGRGRRMQDAVPSPRPGEQGRVCRGEGVAPAERRPIPQAARG
                     EVGGRGGGRGSEVYF"
     gene            88116..89006
                     /locus_tag="grh96"
                     /db_xref="GeneID:2952800"
     CDS             88116..89006
                     /locus_tag="grh96"
                     /codon_start=1
                     /product="rh96"
                     /protein_id="YP_068189.1"
                     /db_xref="GeneID:2952800"
                     /translation="MGRRSAGATPSPRHTLPCSPGRGDGTASCMRRPLPLDNPTPPRA
                     GSCGMGLLGRAPPPFWAALWGRSHARSPGSGRAALAGGGACARLGGTEAWLRPGNRAP
                     APQLGLATPPPASCAVPGLAGYAPCGARTAALGLPRFRLHVVRAALALRRRVGSRLAP
                     TSPGRSAGSGQAAALHDLDAAENPPVPGCRLQRSPKRLRFAAARDEEATSAIATAVSA
                     ATASAAAAPATTIAVVLSAATATTVDVGRRFGFRPWWRPMSPSHSRRPGGDLDAGRGS
                     RLDVGLDFKSRFGCHIFCIV"
     gene            complement(90525..92858)
                     /locus_tag="grh97"
                     /db_xref="GeneID:2952796"
     CDS             complement(90525..92858)
                     /locus_tag="grh97"
                     /note="similar to human cytomegalovirus UL69"
                     /codon_start=1
                     /product="rh97"
                     /protein_id="YP_068190.1"
                     /db_xref="GeneID:2952796"
                     /translation="MSFEREERAHFRETQTAHERPVATHPEGTRHRAPAPSHIYTVAE
                     TPSRHHVASHPWQDMDLHKRYRGGPALSQLSDRERRAQRARRFCLDHESEHTPPIKRS
                     RYEAACTPHHHQPQQNSPPVRDSPESPPPGPDSGRRPQTTVVMRHHHHHHSHHRQHPA
                     SSNSRGAYIRQHHHQKHRHSGEEAVTVSPATSSNRHMLALINQELDSMDENQLRQLSR
                     MIEKKKEERQRLKGSEVRGDDASQPSSTTSPVYDLQRYTAESLHLTPYPDDLKKPTAF
                     PQDKEQPGRLLMSHEELMSTDYLLNIRQQFDWLPASLLRRLVIEKSFSIFNAPSMHAL
                     LAMVDETLSYMKYHFVHGLPVNPYDPYMATVAGLRQLMFNKLNNLDLACILDNGQEWS
                     DNCQTLKNLVRKPNQMIDECTRDTALELQKRPPEVFENPIHRALAYVCSFSRAILALR
                     RRSRQIQNTPHFLDQYDDNGAISSYRCGMVAELILNALHQHQCQNELCELRIQKALQA
                     YQFMLAYCPFDTKCLVDLTVFQKDDEPQDTPMPSMMAVSTPQHTETAVVAFSPASYQE
                     PVVPNPVVVATTHTATPPRPASGVSPLNRDRTVFENNSENYGNLQAVVTAAPQAASPQ
                     PQQQAILGTSTDMAPAAPAVMCAGHEINFAPSQEMPQQQPPQQPVVWPTPFSTNSPVI
                     DTGGADSMMCAHIEPSGEPDWVAAISALSTLSDSSSPCPSGAQQHQQPQMAPAATTTA
                     IELFADSAALRCQTPEYEDMCYSDEEDDDDDDEEGYL"
     misc_feature    complement(91308..91994)
                     /locus_tag="grh97"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; cl27025"
                     /db_xref="CDD:331846"
     gene            91522..91830
                     /locus_tag="grh98"
                     /db_xref="GeneID:2952799"
     CDS             91522..91830
                     /locus_tag="grh98"
                     /codon_start=1
                     /product="rh98"
                     /protein_id="YP_068191.1"
                     /db_xref="GeneID:2952799"
                     /translation="MALEKEHTYAKARWMGFSNTSGGRFWSSRAVSRVHSSIIWLGFL
                     TKFLSVWQLSDHSWPLSRMQAKSRLLSLLNMSCRSPATVAMYGSYGLTGRPCTKWYFM
                     "
     gene            92073..92855
                     /locus_tag="grh99"
                     /db_xref="GeneID:2952792"
     CDS             92073..92855
                     /locus_tag="grh99"
                     /codon_start=1
                     /product="rh99"
                     /protein_id="YP_068192.1"
                     /db_xref="GeneID:2952792"
                     /translation="MQALGRVPLQVVHWRGGRAGLRGVVSSYLAALQSLALLFLFLNH
                     SAQLTQLVLVHAIKLLIDERQHVSVAARGRRHGHRLLAAVTVFLMMMLPNVSAPGVTG
                     GGMLAVVGVVVMMVSHHHRGLRSASRVWAGRWGFGRVAHRRRVLLRLMMVRRARRLVP
                     GSLDRGRVLAFVVQAEAPCPLSTAFSVAELRERGPTAVSLVQIHVLPGMTGNVVSARG
                     FRHGVYMRRSRGPVTCAFGVRGYWSFVGGLSFTEMCTFFAFE"
     gene            complement(92792..95644)
                     /locus_tag="grh100"
                     /db_xref="GeneID:2952798"
     CDS             complement(92792..95644)
                     /locus_tag="grh100"
                     /note="similar to human cytomegalovirus UL70, DNA
                     helicase-primase component"
                     /codon_start=1
                     /product="rh100"
                     /protein_id="YP_068193.1"
                     /db_xref="GeneID:2952798"
                     /translation="MFTSSLGRRQHIVCPNRSPPLTAEKTPKAPRQVHPSRTMTLVLF
                     ATEYDSAHIVANVLSKSVSEHCVFPLLVKHHASNLVYFCLQTQKCTDSQRVAPVFVVN
                     NDVLNLAHYLHTHQPIPLSALVDSLNEEETKPIYNHLFRTVISPEHGGEVREFKHLVY
                     FHHSAIVRYLNLIFLCPTSPSWFISVFGHTEGQVLLTMSYYLLERQYSTIPTVEEYVR
                     SFSRDLGVIIPTHATMTEFTRMLLGSPFRSRIPQFVQYAMARNQRDYEELVHVDRQIN
                     TFREQARLPDTVCVHYIYLSYRTALSRSRLIKYREVVAYDEGAREEQCRQKPLFLGRH
                     LADDLLSVMDKYFSLPNFLQDYIETRILSTDNYDLRLSGYSHQTTGPALTGFFGTSSQ
                     VMRKLDTINSMSDSVFPVLERSLSGLLRLCASLKTANTYATGSLAQYSQRQFLIPKET
                     RFDGPIPLFRVQLPNDHHVFCAITCENWHQNLFPSDLLKHVPDTEFTDEALTDMIWLH
                     DDDVASSNAETQFYYTRHEIFNERLPTYNFIADFDLRLRDGVTGLSKEVLFEICRGLR
                     RVWVTVWQSLFGNMNPDYHPVYFFKSACKNLTPDFYDDDNPPPSYETRTDYCKCSEKL
                     GLRIICPFPERTLVIRPSVLRSIAQVLNHAICLDTLLHQHLDPISHPESSLDTGIYHH
                     GRSVRLPFMYKMDQEDGYFMYRRLLPIFIVPEGFREHPLGFVRAQLDIRNLLHHHAPH
                     YPPGSPRPPVSYSSSSSLSPDDHPSMSFSCTRIILGVRDKLCPSPDINFMETRSVNVT
                     RYEKRTLSDVIGYHLRGEVSGRPDSDPASDLNDLQRLVVTRVWPLLLENLTQHYEPKV
                     SEQFVPPHTLTFKPHSPHCVSVKRLEGSRTKDFRCLNYTHRNPQETVQVFIDLRTEHS
                     YALWASLWSRCFTKKCHSNAKNVHISVKLRPPTNDQ"
     misc_feature    complement(92816..95530)
                     /locus_tag="grh100"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03139"
                     /db_xref="CDD:165411"
     misc_feature    complement(92843..95410)
                     /locus_tag="grh100"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03146"
                     /db_xref="CDD:177543"
     gene            complement(96316..97347)
                     /locus_tag="grh101"
                     /db_xref="GeneID:2952778"
     CDS             complement(96316..97347)
                     /locus_tag="grh101"
                     /note="similar to human cytomegalovirus UL72, dUTPase"
                     /codon_start=1
                     /product="rh101"
                     /protein_id="YP_068194.1"
                     /db_xref="GeneID:2952778"
                     /translation="MHDCSATLSQSTMLNVLSDRLDQQLSLVKQHKSRFQRLWRRASL
                     IKNDERQEPQDEHSVNLRYCLLFASNLNFQNVFRHPESNIYSPRRNVPYKWIPSSFIV
                     RQQHMQLAFYNKHIIWLSEQPNTSTPLGINLYIPTGYFGITFYKCLDSQFVCMPELIE
                     PGLQNLSMDVINLNYTFQAITPGTIEGDLCIFPCFCPEPWQVMNISPPNENYFFGLRL
                     HQRIIIQPGHTQTVYLDAAFIHAPSTCALIVGTRQMNQLGIIIRPVIWLPGTVATITL
                     VNTSSSAVYISGTTSVAKVVFTTRRFVYLLVHNHPIGQLLVPPTPDTGFTHMPEHHIL
                     QQLLACENE"
     misc_feature    complement(96319..97311)
                     /locus_tag="grh101"
                     /note="dUTPase; Provisional; Region: PHA03128; cl28612"
                     /db_xref="CDD:333432"
     gene            97342..97656
                     /locus_tag="grh102"
                     /db_xref="GeneID:2952787"
     CDS             97342..97656
                     /locus_tag="grh102"
                     /note="similar to human cytomegalovirus UL73, gN"
                     /codon_start=1
                     /product="rh102"
                     /protein_id="YP_068195.1"
                     /db_xref="GeneID:2952787"
                     /translation="MHRKTLMRLFLWACLIVICVANNNTSTASPTSKPTTVTTLKPIR
                     KHAEDDFYTAHCTSHMYQVSLRSFASIWICMNVVILIISFFVVLRHCCFQNFTTTTVA
                     GY"
     misc_feature    97423..97644
                     /locus_tag="grh102"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            complement(97637..98806)
                     /locus_tag="grh103"
                     /db_xref="GeneID:2952794"
     CDS             complement(97637..98806)
                     /locus_tag="grh103"
                     /note="similar to human cytomegalovirus UL74, gO"
                     /codon_start=1
                     /product="rh103"
                     /protein_id="YP_068196.1"
                     /db_xref="GeneID:2952794"
                     /translation="MGSEIKMWCIWLVIISCSYLTCSKKKAKTTTYSPEMIQALKNPT
                     LRSYAYTIPMPKFPDKYRMLAGPINNQSITYFWYDFNALQHRQPSNYIMCKFNHTNSS
                     MLLVPPPCGSIPSMNCLSEMINISLHNDTGEQACDVNTTYNPMLYNVPRWTTRIYVGK
                     NIVILDSQSIYFLGLSEVIFRNLLRYNCSKSFYLTNAMSRNLFKFPHITLWKLKQGMR
                     RLHRRRKPKKNNTQKRSRRSANNTTTNTPTVTTKLYNNSQENVDTSENYTLPIFVKQL
                     QDMVTWLYTTIRYNQEPFCDKSRNRERQSAWANHTRQILYNDTVWSIHGTVNLTTLYE
                     ITPPYSNTTQINSSLFIDPLWDHIDSLAFKEEIKRNTSIERRLRPTNLSLSILPP"
     misc_feature    complement(97685..98665)
                     /locus_tag="grh103"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            complement(99023..101185)
                     /locus_tag="grh104"
                     /db_xref="GeneID:2952725"
     CDS             complement(99023..101185)
                     /locus_tag="grh104"
                     /note="similar to human cytomegalovirus UL75, gH"
                     /codon_start=1
                     /product="rh104"
                     /protein_id="YP_068197.1"
                     /db_xref="GeneID:2952725"
                     /translation="MRRGLALCVLAVWLLACHAETSSEPYSHLTLELTGRPIQFLRHN
                     STKCNNNGTRRNLTLIRENAITFNFYESANHYTVFQLPRCLFTGEFADNLLNQVDLSK
                     TFQQYASTLNTYATVSQDNIQYKYYGQNLSYQNNLKEQASTVPPPENLRLQTTTSYAK
                     PTTVNASKIHAPAFNGTCYLFKDHELLFTTRESCLYQSFYVTEHDYMTIALTEYFVVL
                     TVVIRETPLLLIFGDTKRIMFKAPYRRENFILKQTKRHQLIVLVKKDHIHYHTYIKTT
                     DFADSLLSKNYMDLDVLLSVWNRHAVNVLQNGQCRSTTKATVETVLGYGILLYIASTS
                     PTTPTSIALAVDQQSSILLAEDFISSCMSKIQPRTTLLMYPNAVQLANSTLRTTGHIS
                     SVLTISRLIYILVKQHHQDLVSKHDMEQIRNLILLLHKTHISSFLSRFARQELYLASG
                     IIHSMLHHSAERRAIFAFETGLCSLAELSHWSQLIGSEEHNHVSDLYSPCAGSGRRDH
                     ALEHLQKMFPRATNSRTIKTALSVLETLRPQTLATFPEISCVSTTKSFAAFTVSHATT
                     YLVSTEYIARGTSFPVLTTVVGRSIIITYIPANSTCSPSSSKHDTLPIVMIRNITLEH
                     CEFCQSTLVEYDDSEGIVNAMYIYDTDDLLFALNYDNHVIAKSPKTHYLMFLKNGTVF
                     EVTEAVVDQTDTHIVLIVIYILAAIVGLYLLYRIVKLM"
     misc_feature    complement(99026..101185)
                     /locus_tag="grh104"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            101318..102202
                     /locus_tag="grh105"
                     /db_xref="GeneID:2952785"
     CDS             101318..102202
                     /locus_tag="grh105"
                     /note="similar to human cytomegalovirus UL76"
                     /codon_start=1
                     /product="rh105"
                     /protein_id="YP_068198.1"
                     /db_xref="GeneID:2952785"
                     /translation="MSLGSGAITSLGDLPNFRKRNGQKKHLDIYRRIVRAFPSFVAFN
                     RLLGGLFPTYCKNYRRWLFFEVRLTQRIPDCVVLFVSPEAPRRVLCYVIEFKTTCSDA
                     DGQSVRQHVTHNLQYVQGLKQLKGALTDFEALKVPRGDSWSVIPTIIFFQQQATQPSL
                     ARAFRSAPFTLRTDSVIDYLKRRQDESVATLLSATHRSVRASCRKHSQVSSSRATKAS
                     GRLRRGAAQGGSGGQPGKKALPARRAQRSQPKNPDVLRRPGKSRVRGGGAAQTTVRSR
                     SAAVSGRRRRGNRRKGDL"
     misc_feature    101357..101890
                     /locus_tag="grh105"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; cl27526"
                     /db_xref="CDD:332347"
     gene            101871..103658
                     /locus_tag="grh106"
                     /db_xref="GeneID:2952767"
     CDS             101871..103658
                     /locus_tag="grh106"
                     /note="similar to human cytomegalovirus UL77"
                     /codon_start=1
                     /product="rh106"
                     /protein_id="YP_068199.1"
                     /db_xref="GeneID:2952767"
                     /translation="MSLLQPYYRLPIVLFEPHAENILRCPPHVLQRLVDDSVAGLRKE
                     EVVANQVRKRYLREELSDLNQRIQTYCEDLESRVSEAEALLKQQCEVDPPPCQDVAAA
                     ATAAKEIYSSGGGPEAPPQKVTRSDRGQAATWVAQCSDQEKEVLFFGITKNDPFIRFH
                     TDFRGELINTMFENASTWTFTFGVWYYRLKRSLYTQPRWKKAFRLVQMENFSISQELL
                     VGAVNALENVTVYPIYDCVLSDLEAAMCLLAAYGQNHWDGRDLPTSIQGVLTELPHLL
                     NKLSDEVGREITTWDGTATANYYAYQDPPDLKYYMPLSSGRHYSPGTFDRHVLVRVFH
                     RRQVIQSLPGYGAQTAAVVQERMSGQVRDDGLSVWCRRLLAGKVGRDVPIFVHEQQYL
                     RSGLTCISALLLIWKVVNSESVFAPRAGKFTLADILGNDALPRTSSEDDSYSYGHRVR
                     NFEFLLEHYIVPWYTRDPTVTISQLFPGIMLLAITESVRSGWDPARRNDGQAGDGSGT
                     VLMQISKVNPVADFMFAQSSKQYGELKRLELHDALLFHCEHGLGRLLSVALPRHRVFA
                     LGSSLFNVNDIYECIYFSVLGFLPAVVVM"
     misc_feature    101871..103655
                     /locus_tag="grh106"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            103785..104924
                     /locus_tag="grh107"
                     /db_xref="GeneID:2952783"
     CDS             103785..104924
                     /locus_tag="grh107"
                     /note="similar to human cytomegalovirus UL78, GCR-like
                     protein"
                     /codon_start=1
                     /product="rh107"
                     /protein_id="YP_068200.1"
                     /db_xref="GeneID:2952783"
                     /translation="MITERVLAGILAGMTAAGSLVILLAVVMWLNMLDRAGMPMAVGH
                     YTGNLVLTQVICIFSMLASKIVGMTSAANMGFCGIVVFLEDTGLYVTSLLFMFMILDR
                     MAAFLNGRLFWRQQTTKQNLSTSVYIILFCWVLGMAAAVPSAAVAAPNSRWERCEIPV
                     SYAAIDMIVKLWFVLLAPVVLIMAVIIQSSYHRDRERIWYYARRVFMFYTACFVMMVP
                     YYFVRVMLSDFALVDIKTKTANSDGCDSTFLDYLNMFTHVIYSFKLVVFALFIVLFCS
                     INPMETLEECLERADAERQSRSEASQGERRLPINTCCIKLIELIKQYVSTLSKATRDN
                     SGERANLPENAEDIGTTGSDQLPTEVTVTPNSSAVFSTGGTVSPV"
     gene            complement(105020..105820)
                     /locus_tag="grh108"
                     /db_xref="GeneID:2952773"
     CDS             complement(105020..105820)
                     /locus_tag="grh108"
                     /note="similar to human cytomegalovirus UL79"
                     /codon_start=1
                     /product="rh108"
                     /protein_id="YP_068201.1"
                     /db_xref="GeneID:2952773"
                     /translation="MSSPTDEARVRTGKFSFTCANHLILQISEKMSRGQPLNTLRLEE
                     LKILRLICVLLFNRGLETLLLRETTNNLGVSDNAVLSRKTPTSYWPNLYQELRRTFPQ
                     FDFHVIFHEEQAAQLSQKLSQPQLSTALLSRFVQRHTGLLISFPEDLARNGNLLFSLG
                     TLYGHRLFRLAAFFTRHWGTATYEPLIRIICQKMWYFYLISTGKMTISSEAFEIQRSR
                     HEMGIFTFIIEDYKAFAGTLSLTPRMTLNPEAVASAKALHTPTACGDM"
     misc_feature    complement(105026..105796)
                     /locus_tag="grh108"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03364"
                     /db_xref="CDD:223057"
     gene            105819..107663
                     /locus_tag="grh109"
                     /db_xref="GeneID:2952768"
     CDS             105819..107663
                     /locus_tag="grh109"
                     /note="similar to human cytomegalovirus UL80, capsid
                     assembly protein"
                     /codon_start=1
                     /product="rh109"
                     /protein_id="YP_068202.1"
                     /db_xref="GeneID:2952768"
                     /translation="MAAPVYVGGFLVRYDEAPEEAELVLPSDVVDRWLRESRGPLPLN
                     VNHDESATVGHVAGLKNVRAGLFCLGRVTSPKFLDIVQKASEKSELVSRGPPSQSSLQ
                     PDGVLEFLSGSYSGLSLSSRRDINAADSASGDAKTASFKHVALCSVGRRRGTLAVYGR
                     EPDWVMERFPDLTEADREALRAQLTATAAAAGGEEEDDVVRKKNNNNKSQGPDADPFQ
                     SDSYGLLGNSVDALYIQERLPKLRYDKRLVGVTARESYVKASVSPAEQEACDIKVEKE
                     RPNESQHSRAPSESMSHPMSSVATPAASSVAPSQASLALAHDGVYLPKDAFFSLIGAS
                     RHATDSAGARSVYPAAPPHHAYPVMNYEDPSRGFDYTAWLRRAGYDAGHPQYPPVPFH
                     HLPPYRRRDFSMMDDSDRMAWERGYAHPSNYDSYGNNSGNSWSRGRNGGTGSHNNGNK
                     RRRDRDLSSSDEEDMSFPGEAEHGKARKRLKAHHTRGGGGDHSSDAKGDHRYDEIREA
                     LQELRREMMAVRQIAPPALLGPAQLTVPTSSPTTTSHPSDVVVTSEPPQTSSSPPSAH
                     SSKSADRGVVNASCGVSVQPQDGGPTPPVKDIVDLNRRLFVAALNKME"
     misc_feature    105882..106886
                     /locus_tag="grh109"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            complement(107776..109422)
                     /locus_tag="grh110"
                     /db_xref="GeneID:2952726"
     CDS             complement(107776..109422)
                     /locus_tag="grh110"
                     /note="similar to human cytomegalovirus UL82, pp71"
                     /codon_start=1
                     /product="rh110"
                     /protein_id="YP_068203.1"
                     /db_xref="GeneID:2952726"
                     /translation="MDRPPEEEEEPRPSTSRALAPAVTFERLTCQILRLVCTQHSPLD
                     VDAVQTMNWHTSVEVANRAVICAFQEMKSSRDALQLTDLNLKGHCSSTFRDSLRTDAC
                     NYANRRLSPGSQTSAMLVFALPIVRVPVTGIHLFRGRGNSQNRPPRANARTTIRRAQY
                     TWTVKVNVSAITWTRKRDQYVEGGYTFATDFTFLTGLIPLTLVDAIDQLACSNGDTYV
                     QKVETIGEENLILVSLIHFSLHPPTEVFLQLSVYAHRAEVMWRHNPNPFFERHSENGF
                     LVKCPLHVTIPAHQTYVVQFNNALETQDTCYAVFFPLELPGISMDAGPLPNRMKITIN
                     VQNLTANAITLAHMQMLGFIHLFRRGSVGVLPNKTETPRCSQIRLRAGLFPRDSILRG
                     ISEFAQQPNNSSSSEDEEEEGPPITPPIITEAIFDPFQSEDSSDEDDEPQTTMDRLRR
                     EAHKAKREGTAAPVTHRERLPKTAMLLVVPSWNMYIHPDLLMPLTARIAEEAVKNTSY
                     LRSELDGDICTAADLKTTLQALAQVPGRRSPSGRPQRPRI"
     misc_feature    complement(108343..109350)
                     /locus_tag="grh110"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(109552..111171)
                     /locus_tag="grh111"
                     /db_xref="GeneID:2952754"
     CDS             complement(109552..111171)
                     /locus_tag="grh111"
                     /note="similar to human cytomegalovirus UL83, pp65"
                     /codon_start=1
                     /product="rh111"
                     /protein_id="YP_068204.1"
                     /db_xref="GeneID:2952754"
                     /translation="MDLSQRYRLDYVSELGPIAGKVIQSVFDEAREPVKPHETKIVKT
                     GLRVQVHRPSIIFLTQFARNLKPDPRYEHNTLQIKHMTFEDQELKDVYLHVHNPTDKP
                     ITPADEPMSFFLYALPLRHLVPADLTLHPGGTYNPELPTYDAAVQAFAQGYHTRFNAY
                     HLQWTQRYNRWMPHGVHHTASFYVNTSPMPLWSINVANELVCSLRSTHVRKIQLVDKV
                     KGLVRIFLESFQEETPDDKVFIHLAWEQSSGIITMNRNPKPFLTPQQRNGYTILNPKR
                     LHLKPREHANVMIDTYFESDKYIGFICPKSVPGCSISCNPIMSTQCIFMEIRSLHDSV
                     YIEPFQAIASLHFFDRNLFFTYKKTDHSIFRDQYRITTSFEYHQGKGVPIVQDSSEDD
                     SSSSSESEDMDVFEVASTTPHAGTSSSASKKREKLYKPLVQRKRFTEDDAAKKSSSDD
                     ENDDFFPTLYWGIWQFGVRATELTPMIASVCGDQLPHQEFSWEGDDDLRIFSGLSGSW
                     HMYQAPKRRHYSPSEQLPSTSGESVSKRPCE"
     misc_feature    complement(110113..111129)
                     /locus_tag="grh111"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(111240..112868)
                     /locus_tag="grh112"
                     /db_xref="GeneID:2952777"
     CDS             complement(111240..112868)
                     /locus_tag="grh112"
                     /note="similar to human cytomegalovirus UL83, pp65"
                     /codon_start=1
                     /product="rh112"
                     /protein_id="YP_068205.1"
                     /db_xref="GeneID:2952777"
                     /translation="MASRPHRFPDLVTDLGPTSGHLVKLIFNANKEHLNPHTTYIADT
                     HLNVRVNQPSVILATQFTPESQPCQRYDTNLQIKHTAFEPRSLEPLVVHVHNPTDRPI
                     PTTAEPLSMYVYALPLDPVTPPELILRQGESHKRRTTVADAVVQQIDDKKWHTRLTAS
                     RLVWSRNQSRYTANSVYHTTSFIFNSQQMPLGSMNTASELVCSIPHTHVTNIRKISKD
                     EVKVYLECLQEDTPETKCFVHLAWENGNHDIVMNRNPKPYLRAHDRNGFTILCPQTLH
                     LKPGKTSHLMFDVCFESDKYVAIICPRTIPGISMSCNPLLPLQNLFMEIKAVHESLYI
                     EQYEELGWLYFFDRKMILTKGTATEPAQARLVDQHRLMAKLEYHHVYGDQADDESGSS
                     ASDSDMEVFRHPPSGSSARRPSQPPASSSRKPSSSAASSTMTTRSKHRVTKAETSDES
                     EEDDDDRETLVFSWPNWQCGIKSTSLVPIVASAHGDRLPYQDFPWGEGDDYRTFSGIE
                     IDLQPYQTQRRRRHTRLEPIPESCTVSVPKKHRS"
     misc_feature    complement(111813..112826)
                     /locus_tag="grh112"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            112041..112487
                     /locus_tag="grh113"
                     /db_xref="GeneID:2952775"
     CDS             112041..112487
                     /locus_tag="grh113"
                     /codon_start=1
                     /product="rh113"
                     /protein_id="YP_068206.1"
                     /db_xref="GeneID:2952775"
                     /translation="MKRLRTQNGKSVSVMCPQIRFGVAIHHDVMIAVLPSEMNEAFCF
                     GSIFLKAFQINLNFILAYFPNVRHVCVRYRANELAGCIHRAQRHLLTIENKRCSVINA
                     VGCVSTLISAPHQTGGSESGVPFFVINLLYHGVGDRGAALVTFSLA"
     gene            complement(112990..114528)
                     /locus_tag="grh114"
                     /db_xref="GeneID:2952780"
     CDS             complement(112990..114528)
                     /locus_tag="grh114"
                     /note="similar to human cytomegalovirus UL84"
                     /codon_start=1
                     /product="rh114"
                     /protein_id="YP_068207.1"
                     /db_xref="GeneID:2952780"
                     /translation="MISSTNRSCSRSVTCHPITNPLPAYLKAEPSHSCHQSQTMPRAD
                     KTLRNGPRGRPRKTPPSLLLDETILTLTDQHHVKRPLPRQGTYRLIQLHVDFQPSDLQ
                     HPFQILLSTLLQLEPLSPHRDPEEQGLLCAVANPDSDIFPILSPFPAQAGSCNIIRAI
                     IEEQLTQMSIVRLSLNIFALKTMPPLRHQLPLRRKVTQHNALHDCVSLHLPDLTFVND
                     KISNTSELTIPVKSALCWHTAEGGISGPRGLASRISVRLSDATIQNMGPATFGQLYTD
                     TDCPDLILSSLILYQDNILRFNVTFRSAQHQLPSNPIVSFKLRLRQQTVTRPFFSDTP
                     LPYFLPRKQPGGGLDVCLPYDLSLKTSHLIRIYRRFYGPFLGLFIPHNRQELNMPVTI
                     WLPRTWLEISVIGDNTHIPKNTVLGQLYFISSKHSLNRGRLSALANQVKSSLHGTPHQ
                     VSLLGASFSLQDLAPMRVSNPSPETAQQQQSPTNNNKPVTIAMVCNQRQPQQQQPQNS
                     ASPP"
     misc_feature    complement(113044..114333)
                     /locus_tag="grh114"
                     /note="Cytomegalovirus UL84 protein; Region:
                     Cytomega_UL84; pfam06284"
                     /db_xref="CDD:283854"
     gene            113051..113419
                     /locus_tag="grh115"
                     /db_xref="GeneID:2952771"
     CDS             113051..113419
                     /locus_tag="grh115"
                     /codon_start=1
                     /product="rh115"
                     /protein_id="YP_068208.1"
                     /db_xref="GeneID:2952771"
                     /translation="MAIVTGLLLLVGDCCCCAVSGLGLETRMGARSCRLNEAPKRETW
                     CGVPCSDDLTWLAKAESRPRLRLCLEEIKYSCPSTVFLGMCVLSPMTLISNQVRGSQM
                     VTGMFSSWRLCGMKSPRNGP"
     gene            114270..114728
                     /locus_tag="grh116"
                     /db_xref="GeneID:2952789"
     CDS             114270..114728
                     /locus_tag="grh116"
                     /codon_start=1
                     /product="rh116"
                     /protein_id="YP_068209.1"
                     /db_xref="GeneID:2952789"
                     /translation="MCPGAAAVASHGADLSRSGSSRPAAGKVGSFEGGPEAHSVVFCR
                     RAAWFETDGSCGTAQPLNMQVADLLSGDTSQTVNMTCSWMISSSCLSMTKSAESREIS
                     SSGETWLGRPRRSLLLLLPPVPSSSRFSRIKSSWHLVSSIELSSRASLRT"
     gene            complement(114443..115369)
                     /locus_tag="grh117"
                     /db_xref="GeneID:2952761"
     CDS             complement(114443..115369)
                     /locus_tag="grh117"
                     /note="similar to human cytomegalovirus UL85, minor capsid
                     protein"
                     /codon_start=1
                     /product="rh117"
                     /protein_id="YP_068210.1"
                     /db_xref="GeneID:2952761"
                     /translation="MDSTIFCTFEQKLSLTDVGKLAKLTGAIIPIPQRHHLIKHHHLG
                     LHQYIDSTRGYARLRSLLRNMTPTILRRIEGNQLAMQVPTHGHLYTVLNTGPVLWEKG
                     DALCQLPPLFSGPLVREHPVSVGNWNLVLPWLLPAPLAVEINQRILIMALYSLDRSYE
                     EVKAAVNQLQHVTFRDATFTIPDPVIENHLLLDMKTACLSMSMVANLASDLTVNYVRK
                     LALEDSSMLLTKCQELLMRLNRDDDGTGGNNSNRLLRGRPSHVSPDEEISRLSALFVM
                     LRQLDDIIHEQVMFTVCDVSPDNKSATCIFKG"
     misc_feature    complement(114446..115369)
                     /locus_tag="grh117"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            complement(115430..119461)
                     /locus_tag="grh118"
                     /db_xref="GeneID:2952740"
     CDS             complement(115430..119461)
                     /locus_tag="grh118"
                     /note="similar to human cytomegalovirus UL86, major capsid
                     protein"
                     /codon_start=1
                     /product="rh118"
                     /protein_id="YP_068211.1"
                     /db_xref="GeneID:2952740"
                     /translation="MENWSAVELLPKVGIPADFLTHVKTSAGEEMFDSLRIYFGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLQTALASAAHAIKFDDLNKLTTGKMLFHIQVPRVAS
                     GAGMPTSRQTTIMVTKYSEKSPITIPFELSAACLTHLRETFENTILDKILNIEAIHTV
                     LRVLKNTADAMERGLIHCFIQVLLRKAPPYFVVQTLVENATLCRQALNRIQRSNILQS
                     FKTKMISTIFLLNRTSDRDYILKLLTKMVESTTNSILENPATYVTASGQQLRGVMVST
                     AQVIQTLMTLLKSNISKQGVSAPATYGNFVLSPENAVTAIAHHSILADFNSYTAHLTS
                     GNPDLTGSSLEKAGQNSQTSLPMDILQLGEHAVALEHHRHVYKNTDTKNPLERNIDLT
                     FFFPVGLYIPESRAYTTVENKIKLTETKDNALPTSVYLLNRDRGLERLDFVDALQCLC
                     HPVVHEATPCLQVFTERGVPTDPAVARLTECRFQQESMAGIARRLTHFYRVRREVPRT
                     PNEVKQDYTPSDFYKIGNLSLYTELHPFFDFAHHQENGETATLCTPRIVTGNIPDGLA
                     PSAFQELRASHIAEMVRLRPPPDYEATLQLFKSTVTCPNYPELFYLVDLLVHGNVDAF
                     LVIRPFIARCIVSAFQNRQMLAFAHSYTMIAMIVEHLGDGLLSSQIHTHYRTIMAILR
                     LVTRVSSLPGLNNGQLVEEPLSAYANALHDHRLWPPFVCHLPRNREGVQIIADRQPLN
                     TANIESRHHGVSDVPRMAAMDADEPLFVDDYQATDDEWTLQKIFYLCLLPAMTNNRAC
                     GIGLNLKTLMVDLFYRPAFTMPTEPESVGEMLTQLVDEIATNEDVNLFEACRELFLVL
                     QFVPEHAKILEVRAQLDPAQRHGATDFTSLQHVLYNGCCAITAPKILAEYCIVVPFHR
                     FYSDPTICAALNDDIKRFVTDFPHYHRHDGGFPLATAFAHEYWNWLRSPFSRYTAGCP
                     NTLQSVLTLACMLYKISPVSIALMAKSGVHPGFALTAVRTDTFEVDMLLYSGKSCTSL
                     IINNPQVTKEERDINTTYHVTQNINTVDMGLGYTSATCVAYLNRSRSDMGVRVQNLYR
                     VFPMHVHRHDEVDRWVRHAAGVDRPQFLDTETISMLTFGSMSEKNSAANLHGQKAACE
                     LIITPVSTDINYFKIPNNPRGRTSCMLGVDPYDTDAAIKTLYDHTEPDAQTFASTHNP
                     WASNRGSLADIMYNIKNRERLGYNSQFYSPCAQFFNTEEIINANKTLFKTIDEYLLRA
                     KDCIRGDTDTQYICVEGTEQLIECPCRMMQEALPILSTTTQALMESKLKNPSGSLATS
                     ETHFGNYIIGETIPLHQHMLFNS"
     misc_feature    complement(115451..119425)
                     /locus_tag="grh118"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            115995..116309
                     /locus_tag="grh119"
                     /db_xref="GeneID:2952795"
     CDS             115995..116309
                     /locus_tag="grh119"
                     /codon_start=1
                     /product="rh119"
                     /protein_id="YP_068212.1"
                     /db_xref="GeneID:2952795"
                     /translation="MSVLTGVMMSSHAAFCPCRLAAEFFSDMLPKVNMEMVSVSRNCG
                     LSTPAAWRTQRSTSSCRCTCMGKTRYRFCTRTPMSLRERLRYATQVAEVYPRPMSTVL
                     MF"
     gene            complement(116922..117656)
                     /locus_tag="grh120"
                     /db_xref="GeneID:2952766"
     CDS             complement(116922..117656)
                     /locus_tag="grh120"
                     /codon_start=1
                     /product="rh120"
                     /protein_id="YP_068213.1"
                     /db_xref="GeneID:2952766"
                     /translation="MPQLSRTLLPSRLAGARQRRRLLSYPTVHRQMYRQRVPEPPNAG
                     FRPQLHYDRYDRRTSWRRPPLLPDPYPLPYYYGYPAARHPRVFPTRPQQRPVSRRTPV
                     SLRQRAPRPSSLAAIRVSPASEPRRRADHRRPAAAQHRQHRVSPSWSFGRAPHGGHGR
                     RRTPVRRRLSGHRRRVDAAEDFLPVPSSRHDQQPGLRHRTEPENSNGRSFLSPRLHYA
                     HRTRVSWRNVNPAGRRDRHQRGRQPI"
     gene            117836..118309
                     /locus_tag="grh121"
                     /db_xref="GeneID:2952746"
     CDS             117836..118309
                     /locus_tag="grh121"
                     /codon_start=1
                     /product="rh121"
                     /protein_id="YP_068214.1"
                     /db_xref="GeneID:2952746"
                     /translation="MVRKVKKGVEFGIKGQVSYLVKVRRCVVLLHFVRSARHFSAHAV
                     KVCEASGYPGHALLLKAAFGESGHSRVGRHASLRENLQTGRRFVNDRVAQALQRVHKV
                     EPLEPAVAVEKIHGGGQRIVFGLCEFDFVFHRGVSPALGDVEPYREEESKIDVAF"
     gene            119476..122022
                     /locus_tag="grh122"
                     /db_xref="GeneID:2952738"
     CDS             119476..122022
                     /locus_tag="grh122"
                     /note="similar to human cytomegalovirus UL87"
                     /codon_start=1
                     /product="rh122"
                     /protein_id="YP_068215.1"
                     /db_xref="GeneID:2952738"
                     /translation="MASSPTVFQCRAAQDALIVESTAEPQVVNVPVHVNSYNLTQELS
                     SVEDARFCQTQPVDAERVRGVFGALYRAAAPHLREESDRIKLILGRLLLGPVAVPCYC
                     DEWEANEYMVDAPQFCGGPLLYVHRRCHCPIVGRALAFTVMEGHIATHVFRGLLSLSE
                     WNQHLPDMFCPCGSLDRRDRYSMACLPRDLTLYINDYPYFMMEIGRVLTVSEVDDYVS
                     LMINYLGEAVTPRLQVHYKLLFGVNVRPVAPLALISTCEFFVLELQKMWLGVEYHNEV
                     TADFFGRVFSQLHRDRGRVMMALRLPEQTVCHLSHFTLGRFKRQVLYFKLSITYGKYK
                     AGVAKNVLCYRRLSLAFGEHDTVWRNLFYVYYEIGRLGTVNSESRSSPPPPSSARPVN
                     HSQPPPARWSSASSRGPATTAGVTTHRDSSGDRLKRYVCIISRLMFVRYGQTYRREKH
                     DHVFDFTGRTLREAAQQQRRQKQLAAQRHATSRRKFIGGMEFSEITGVSLDRIAVNAF
                     NTNRVINMKAALSGRVGCRVNRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYTNS
                     LNVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQTVIRSERSK
                     VYWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGCDLEAILLQELSCIKNMRDVCIDY
                     GLHRVFTKMELRNSYQIPFLSKQLILFIRACLLKLHGRDKRLYLDRLVFEAVQRGVFD
                     YSKNITAHTKIKHTCALIGSRLANNVPKILTRNKKIKLDHLGRNANVVTVCRHLEANK
                     ISRARLKVLVDVLATLQGLSETTHTQNVIRQTLLRLCGAVPSSASSSSSV"
     misc_feature    119485..121992
                     /locus_tag="grh122"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     gene            122035..123237
                     /locus_tag="grh123"
                     /db_xref="GeneID:2952782"
     CDS             122035..123237
                     /locus_tag="grh123"
                     /note="similar to human cytomegalovirus UL88"
                     /codon_start=1
                     /product="rh123"
                     /protein_id="YP_068216.1"
                     /db_xref="GeneID:2952782"
                     /translation="MDNDKNKAGVSVSSDEELPGPGWRDAALIMHNGMVREHMFYHPD
                     VAEIVRRMIPPPPDAEEGCVFASELAFYTSGRCNRASSVFSIYWQNNSEIVYAMTGIT
                     HCIKIVVECGQVGSDSVERQFYDSPGIYLIRVSDGTVVPRNVVWPGTSVRWSKEVGIR
                     VVQRRVTVARAFVSLFRNYLFWTKQPFSEDLCPCPPDVEDRLFPLLNLSRGDIEVFDK
                     KVCCAYKRLQKNDLPRAGRRLLDHCVTLAASKKILLLDLPRLENFFLAQVCLYELDED
                     EVGEELLGMLCGKSTESDSTFLLHRKTMKVAACVAFILNCFYKHQERLPEVNNRVDEC
                     DLAVIALRRYYRHHAGIQTRAIAMAQKFLTDYSESFSPFKSFSRMEVQVPLDAAVTRK
                     QLVAVLRS"
     misc_feature    122089..123234
                     /locus_tag="grh123"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:309600"
     misc_feature    complement(join(123234..124181,127845..128768))
                     /note="similar to rh124; similar to human cytomegalovirus
                     UL89, DNA packaging protein"
     gene            123897..124469
                     /locus_tag="grh125"
                     /db_xref="GeneID:2952791"
     CDS             123897..124469
                     /locus_tag="grh125"
                     /codon_start=1
                     /product="rh125"
                     /protein_id="YP_068217.1"
                     /db_xref="GeneID:2952791"
                     /translation="MFLRIHIQGAVAQNVKLVTALVRDQHVTFGDLVGAAYDFVHERT
                     WHKHIGGLPHLRVEADKGGFMQAIAGARRGVALLRKGVQVFLAHVRNHVEHVERGIVE
                     AGEEAGGVASCVGRRDEDDFGGVLRQEAQDGVKGLLLDEVRLVDQQEVEILSANALRD
                     REIKNKAWLAGVEPRPMTLGNARVRCLHKR"
     gene            124501..124803
                     /locus_tag="grh126"
                     /db_xref="GeneID:2952764"
     CDS             124501..124803
                     /locus_tag="grh126"
                     /note="similar to human cytomegalovirus UL91"
                     /codon_start=1
                     /product="rh126"
                     /protein_id="YP_068218.1"
                     /db_xref="GeneID:2952764"
                     /translation="MNALLAELNRLGVSHVTTEDVFTFAENVFHNFGFLFQTEESGPR
                     KIDLVSSLFEHLTVECVNDILDACSHESSPDGNGTSAASPHAQKEQGGGGGRTGHV"
     misc_feature    124697..125413
                     /note="similar to rh127; similar to human cytomegalovirus
                     UL92"
     gene            125367..126932
                     /locus_tag="grh128"
                     /db_xref="GeneID:2952790"
     CDS             125367..126932
                     /locus_tag="grh128"
                     /note="similar to human cytomegalovirus UL93"
                     /codon_start=1
                     /product="rh128"
                     /protein_id="YP_068219.1"
                     /db_xref="GeneID:2952790"
                     /translation="METHLFSDLAFEQVFEEDPQLPLHVVLDPVDLSFAEAETVRYVY
                     YRSDPDPVGRWRRATFRVFLRPFELLTYLRDAGLTVAPTFRVVCHHALFTTLGIRCAE
                     QRLSGAQMLYLRLVWNEERFRDWEFLVRDLLREEMSVCQSTEPADRPDPSLLMTDAML
                     ELAKSSSTTAPFFEMPSSGTGNNNASSASAADESSQVERRVIQFLRGDSELTYHAGPL
                     EPPSKIRGHEIVQPRIEVNPDVIYASGPHEDDRTSKTDEWQKGGVLRLGSVWDVRQRL
                     RLHVLWYAQSFWRSRGLKYEDREEDLRLTLDSYFDRLSVEYQLLREVYREIKAVLRSD
                     RMVAQKFSCHLSIETSWLLIWELFDRALELWRDQADVNSCIIKALAHKLRSKAQSSHG
                     NSVSAGKTNPSETWYADVVRCVRAEVNLGVEVHVETCSQSGLWLVRGRDGHLRKWITQ
                     PQTYVLYATPGLVFHWVLPGGFAISSRVCLDGVGRDHFERFQMSAPVLTKRMLLETGW
                     TRAEASRVPSCGL"
     misc_feature    125367..126806
                     /locus_tag="grh128"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:309621"
     gene            127435..127848
                     /locus_tag="grh129"
                     /db_xref="GeneID:2952695"
     CDS             127435..127848
                     /locus_tag="grh129"
                     /note="similar to human cytomegalovirus UL94"
                     /codon_start=1
                     /product="rh129"
                     /protein_id="YP_068220.1"
                     /db_xref="GeneID:2952695"
                     /translation="MARLMALATACGQVGCTYCKDHGGHVDPTGCYIGPVPDKGNCLC
                     YTLCNSPTMNPITNENPVAFFCDVERASYLCAVGSKTKSKVTLADSLDYHIGAKNETG
                     DWLPLNESAWQLVRVEEPVSRMIVCACPVLKNLVH"
     misc_feature    <127435..127845
                     /locus_tag="grh129"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03352"
                     /db_xref="CDD:223053"
     gene            128767..130047
                     /locus_tag="grh130"
                     /db_xref="GeneID:2952756"
     CDS             128767..130047
                     /locus_tag="grh130"
                     /note="similar to human cytomegalovirus UL95"
                     /codon_start=1
                     /product="rh130"
                     /protein_id="YP_068221.1"
                     /db_xref="GeneID:2952756"
                     /translation="MATYVSPPSAAAASPSPATTTATPLSFSSSPVSVVPDGVPPRSV
                     GLTTAAGIAASTAVSTSLCAVERMVELSTQTPADFEVQETLRFDEAVNMALVACEAVS
                     PYDRFRLIETPDENFLLVTNVIPREPAEMPAVGAEAERTFSTRHHDVLDGFSNLSVPL
                     PPPCGVRDYALHNVDRLTYEGELVYGSYVLYRKNHVELSLSSNKAQYVEAVLRNAYTP
                     GLLDHHNVCDIEGLLYLLYCGPRSFCSRDTCFGREKHGCPFPALLPKLFYEPVRDYMT
                     YMNLAELYVYVWYRGYDFPSASDSSSGGDDDELRLPLKAVSLDRLKEVLKAVRGRFVG
                     REVPTWPASSRTCLLCALYSQNRLCLDLARDEAKTVHYSPIVIQDCPAAVTDVTLSHI
                     LPGQTAVTLFPVYHVGKLLDALTETEAGVVSLNL"
     misc_feature    128968..130020
                     /locus_tag="grh130"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            130044..130433
                     /locus_tag="grh131"
                     /db_xref="GeneID:2952763"
     CDS             130044..130433
                     /locus_tag="grh131"
                     /note="similar to human cytomegalovirus UL96"
                     /codon_start=1
                     /product="rh131"
                     /protein_id="YP_068222.1"
                     /db_xref="GeneID:2952763"
                     /translation="MTSANKNLLKEAMRLSLEKQQNQFLRRVYGARHRVTSHHSLQLM
                     RVAAREQTRYSQAVVGQVTDNVVRDREDLKRELQRARVLQKAADVDNALDSLIELKDT
                     VEDVRDSFVDSVASTCEVDLLEDDDTE"
     misc_feature    130080..130349
                     /locus_tag="grh131"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            130491..132323
                     /locus_tag="grh132"
                     /db_xref="GeneID:2952765"
     CDS             130491..132323
                     /locus_tag="grh132"
                     /note="similar to human cytomegalovirus UL97,
                     phosphotransferase"
                     /codon_start=1
                     /product="rh132"
                     /protein_id="YP_068223.1"
                     /db_xref="GeneID:2952765"
                     /translation="MSTRSKAKSRPRSASAESGRPWQPAPLRRSKTSQRRAWMRQAAM
                     AAAVRESQAAAAAAAAAPAASSTRNVMTVRKRTTPPSPAAMLPPQSSSRGRTTSRQSS
                     IDGPVLYAADPQLQCCEDSHWSFEYDEDAPTQNTGIVQPRAPLRSITSSVHVNDEYDA
                     ASSQVSQVSVDEEHEDVHCTCSNEHVIATSIKGLVCDASLFSRMTQPELCEMAVTYLL
                     VYVPKDENFCKRVCYSVDMTDASRRIGCGSFGEIWPIDRRRVVKIARKHTETILSAYM
                     SGLIRTKAGPEAEEMPGVYHGLLTATGCCLMHNLTVYQRFHSDLFHFENWDLTSVPSY
                     RRAFHHLANAIKFLNHTCKVCHFDISPMNVLINVNPHYHSEILHVALCDYSLSEPYPV
                     CNDRCVVVFQETGTARRIPNCTHRLRECYHPAFRPLPLQKLMICNPHARFPVSNSPRR
                     FCMIELAALGNVLAFCLVRLLDRRGIEGVHNGPESLLFKHAATACHALENNRLTACSD
                     ACLLIMAAQLSYHAGLLGDDGLAVVSQTVGFVEAKMSSCRVRAFRRYYHECLGALPFD
                     YVRNNLERLLAMADGVYLYNSFRLAANISTEEDLDGDCRQLFSD"
     misc_feature    131220..>131726
                     /locus_tag="grh132"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:328722"
     misc_feature    order(131220..131231,131238..131240,131244..131246,
                     131268..131270,131274..131276,131427..131438,
                     131562..131564,131574..131579,131583..131585,
                     131634..131639)
                     /locus_tag="grh132"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    131577..132125
                     /locus_tag="grh132"
                     /note="UL97; Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     gene            complement(131142..131456)
                     /locus_tag="grh133"
                     /db_xref="GeneID:2952745"
     CDS             complement(131142..131456)
                     /locus_tag="grh133"
                     /codon_start=1
                     /product="rh133"
                     /protein_id="YP_068224.1"
                     /db_xref="GeneID:2952745"
                     /translation="MKQVAVETLIHRQVVHETTACGCQQSVIHTRHLLGLRPRFSADQ
                     TRHVGTQNGFSVLSGYLNHAPAIYRPDFSKRATPYASTGISHVYRIAHTFAKVFILWD
                     IH"
     gene            132374..134044
                     /locus_tag="grh134"
                     /db_xref="GeneID:2952744"
     CDS             132374..134044
                     /locus_tag="grh134"
                     /note="similar to human cytomegalovirus UL98, DNase,
                     exonuclease"
                     /codon_start=1
                     /product="rh134"
                     /protein_id="YP_068225.1"
                     /db_xref="GeneID:2952744"
                     /translation="MWDETGDENEDLVRLLSLRDDEPLSMFIMNTFLLKQESFRNLSF
                     SILRLAYAYRLFTKAARTYGLAVAEEFVSAVAALAQDELLRDILTNRYVESREEIHRS
                     LQRVAQCQEREELVDEVSDDYVWLSKLLDLAPNYRQLELYQILERESRGQSRNMVWHL
                     LRLDSVSATKFYEAFVFGCMPNALAQRSRAGASPGIQFGLQHEGVVKTLVEFHVMHGR
                     EPVRDGLGLLIDPTSGLIGASIDLCFGVCKSDSGDARTSLHISPCASVYEIKCRYKYL
                     RKKTDPFVQNVLQHADAASVAKFLLSHPIPGVEFRHDADIPSGREFLLSYDPLFKATL
                     KRGRPIKPPEALRDYIHDLLYLNKTERSEVIVFDAKNLDETINAPHSPAGPVADDAVE
                     TEGGSQRSFHDEDTPDLLGQLTLYEVSRFSLPVFVNPRHQYYFQLLIQQYVLSQYYIK
                     KHPDPERIDFRDLPNAHLVSAIFRERDESEVGRPLYLGGRVFSCDHIPLLIIVTPVVL
                     DPKFTRHVVSTVVDRWSRDLSRKTNLPVWVANAANEYVVSSVPRPASP"
     misc_feature    132431..133999
                     /locus_tag="grh134"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:324346"
     gene            complement(132886..133287)
                     /locus_tag="grh135"
                     /db_xref="GeneID:2952683"
     CDS             complement(132886..133287)
                     /locus_tag="grh135"
                     /codon_start=1
                     /product="rh135"
                     /protein_id="YP_068226.1"
                     /db_xref="GeneID:2952683"
                     /translation="MGCESRNLATDAASACCSTFCTKGSVFLRRYLYRHLISYTLAQG
                     DMCRLVRASPLSDLHTPKHRSIEAPIRPEVGSISRPRPSRTGSRPCMTWNSTRVLTTP
                     SCCKPNWIPGDAPARERCASAFGMHPNTKAS"
     gene            complement(133325..133918)
                     /locus_tag="grh136"
                     /db_xref="GeneID:2952758"
     CDS             complement(133325..133918)
                     /locus_tag="grh136"
                     /note="similar to human cytomegalovirus UL99, pp28"
                     /codon_start=1
                     /product="rh136"
                     /protein_id="YP_068227.1"
                     /db_xref="GeneID:2952758"
                     /translation="MPGKFGIQNHRCDNDQQRNVVATEHPTAQIERTPHFALVPLAED
                     SRNQMCVRQISKIDPLRIRMLLYIVLAQYILLDKQLKVILVTRIDKHGQGKARNLVKG
                     QLSQQIGGVFIVKAALRAALGFHGVVRHRPRRGMRSVNSLIQIFGVENNYFRAFCFVQ
                     VEQIVNVITQSLRRLNRASAFQGGLEKGVVGQQKFPP"
     gene            133981..134436
                     /locus_tag="grh137"
                     /db_xref="GeneID:2952755"
     CDS             133981..134436
                     /locus_tag="grh137"
                     /codon_start=1
                     /product="rh137"
                     /protein_id="YP_068228.1"
                     /db_xref="GeneID:2952755"
                     /translation="MGGQCCKRICCFFGASSGKPLRDTMGRPVCLRSFADIDNTSSEE
                     DEADLISINSDRLSLASQDSMAPAPKPKKKKKKTQSAQHTTQKAQLTLALMEDGDGYH
                     SPPRVTRTYNRPSPPSKAKTPRAEKIAMRPPTPKNQRRSSSRGSYESVY"
     gene            complement(134603..135673)
                     /locus_tag="grh138"
                     /db_xref="GeneID:2952752"
     CDS             complement(134603..135673)
                     /locus_tag="grh138"
                     /note="similar to human cytomegalovirus UL100, gM"
                     /codon_start=1
                     /product="rh138"
                     /protein_id="YP_068229.1"
                     /db_xref="GeneID:2952752"
                     /translation="MATSKVDWMNSRIWGVSVLMVVFTFINLDGHVVMMNIPGVGYPC
                     AYFNVVDYSEMNMSNYNVMHLTTPMLFLDTIQIIMYVAFSMIVFLCVVIYYICCWMKI
                     SYRKEEGLNLNQRTRDIAYMGDSLSTFIFIMVMDTFELFTLAMSFRLPSVIAFMACLH
                     FFCITIYNVNLVTNYQNFKQNLFNLQRIHPKLKGTIQYRTLIVNLVQMLLGFNIAVIS
                     MSLCLGFGNNFFVQTGHMVMAVFFVFAFISIIYFLLLEVVFYRYVKVQFGFHVGTFCG
                     LCGLIYPIIKYELAYTPEYTSSVAVAFAINFLIWAGFTACRCTRYFRNHHSVKYKHLP
                     ATDELASLKEASMATSDAEEMA"
     misc_feature    complement(134651..135673)
                     /locus_tag="grh138"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     cl28128"
                     /db_xref="CDD:332949"
     gene            135862..138036
                     /locus_tag="grh139"
                     /db_xref="GeneID:2952749"
     CDS             135862..138036
                     /locus_tag="grh139"
                     /note="similar to human cytomegalovirus UL102,
                     helicase-primase component"
                     /codon_start=1
                     /product="rh139"
                     /protein_id="YP_068230.1"
                     /db_xref="GeneID:2952749"
                     /translation="MSAGTTFTGVSCHLSWYGIIEDAVPVVQCLFIHIGRNNSEPKLQ
                     TFILRADPLLAADLRVVHRGGYANLAATADGEERQQSLDRRSSVLARVLLEGSALIRV
                     LAHPFSPVQIRTDQHELEILEAAPALDIEAAAVSNALSLFHVAKMVIIGSYPELTEPR
                     SVTVGEERVSEEYGTHANKKMRRGYYAFDVAMSFRVGAHKYVLERDDEALVSRLFEIR
                     EVSFLRTCLRIVTPIGFIAVAVTDEQCCLLLKSAWTRLYEVLFRGFAGQAPLCDYLGP
                     DLFEAGGSRSFFFPGFPPVPVYPVNGLGCLLRETALDAAGEVISWCGLPDIVGSLGKL
                     EIQPSTLSLGVPEDEWRVFGGEDTDPLRINGTAFRQASETLFSHLSTRAGEGEFLSAT
                     VHAKDSTLHHLVIVNLVESVVAKCILARDFNTALRFNNRLHTKNVCKQFIDNLRYRSG
                     RAFWQIQSLLGYISQHVTSACTSAGLFWVLSRGFCEFYVYDGTMPHGPVSAETCVRTV
                     VECYWRKLFGDVPGPVCRLQASAPGIILLWGGMRLVSPFGVDEQDDWWSVVGQVLGRL
                     PTLFRKRPTAQELESVYREVLFRFVSRRNDVDFWLLRCDPGEHEVRPHVGVIDCAPFY
                     GVWSEQSEIIVQSRDSALAAEVGYTVYLKRAFVMLTACIEAMSVCNVALVVPATNSSL
                     SSAVWPGPLEEREEWLRALSGEARQAAERVIAEGSRFFRLNV"
     misc_feature    136501..136719
                     /locus_tag="grh139"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; cl28051"
                     /db_xref="CDD:332872"
     gene            complement(138058..138813)
                     /locus_tag="grh140"
                     /db_xref="GeneID:2952750"
     CDS             complement(138058..138813)
                     /locus_tag="grh140"
                     /note="similar to human cytomegalovirus UL103"
                     /codon_start=1
                     /product="rh140"
                     /protein_id="YP_068231.1"
                     /db_xref="GeneID:2952750"
                     /translation="MQAAPSDPPGMDILMVRGVLEVHTDETSRNVIVTTPQIVDITVS
                     NDRLWVHTDHGMLCSISEYRGEMSLKSSFVGYSTIFLLENEDVMKNVKLTSMRLKHRC
                     GIVRTSNLMHFTLCTILSCVENLTLTRKCLLDLLGYLKVVNIRDQFSTLLRISCQKLI
                     CSTLYLFFDDKTTEIVEQVPKVFILFYESRQSFLHTILRFWFRITRQDESYKVTMKLM
                     ERQTLNGKLVEVALIEVLNSNFPSLPLCDPNML"
     misc_feature    complement(138091..138762)
                     /locus_tag="grh140"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7; cl28121"
                     /db_xref="CDD:332942"
     gene            complement(138740..140707)
                     /locus_tag="grh141"
                     /db_xref="GeneID:2952739"
     CDS             complement(138740..140707)
                     /locus_tag="grh141"
                     /note="similar to human cytomegalovirus UL104"
                     /codon_start=1
                     /product="rh141"
                     /protein_id="YP_068232.1"
                     /db_xref="GeneID:2952739"
                     /translation="MDLNHWYEKSSGSKRTSERDLTLSTIRSILAADERLRIKASSYL
                     TGRDDDTVIDIFPTAQTLSYIRLLHGFIGTCRGKSIHQVLRDPCVLRKQLLYGLCKTI
                     FDTITVRQVADEWKIHSTLFPYQALDDEDLENYLLVWSASVRQSVQTGVLGTLRDILY
                     QFADNDDYGLYVDWYVTVGIIPLMDVKSKPAEIAQRAAFIRAAIHKSTETHPLAQDLL
                     NSNLHLLQQVVTHLCGVRIVNSPELRIFKRIKSEKIEAQLKERTINRYIVTEPLAYER
                     NQLFFTTPISHLHEEILRYDSLCRHQKICQLLNTYPVKAVTTSRHEMNCKRIVDMMEK
                     HDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQSRLMPSRTPGGGP
                     SASAPPVTNATQDRDIRDLFKKQMIKCLEEQIQAQVDEIQDLKSLNQAWESRVRELRD
                     LLSRYARQRSAQTFEREPKLHHLSITEAVRKAQEVAFNPLAIEDNRVVANSFFSQFIP
                     NTEKLENLLTELWENEYFRTFRMKRLVTAQGAEEAIVYSNYTVERVVIPYLFSVLSLS
                     TLEPIPEEYLHLSFGEIVAAAYDDSKFRQYVELICNREKARRRQMTRQPVVHRPSSDA
                     ERPSQQQDAGGPFRSSRHGHPDGARGIGSPY"
     misc_feature    complement(138896..140521)
                     /locus_tag="grh141"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            140544..143123
                     /locus_tag="grh142"
                     /db_xref="GeneID:2952667"
     CDS             140544..143123
                     /locus_tag="grh142"
                     /note="similar to human cytomegalovirus UL105, DNA
                     helicase"
                     /codon_start=1
                     /product="rh142"
                     /protein_id="YP_068233.1"
                     /db_xref="GeneID:2952667"
                     /translation="MSMTVSSSRPVKYEDALILNLSSAAKIERIVDKVKSLSDVRFEP
                     EDFSYQWFKSMSRVERSADQDVRVPCTDQWPFFPFRTLLVTGTAGAGKTSSIQVLAAN
                     LNCVITGTTVIAAQNLSAILNRTRSAQVKTIYRVFGFNSKHVPLAEGGNDILKQYRIC
                     ESRDENTIQRLQVNDLLTYWPVIADIMEKYLNMLERKASLEDVSEMCESNVIIIDECG
                     LLLRHMLQVVVFFYYFYNAVCNTTLYRERRVPCIICVGSPTQTEALESRYDHITQNKN
                     IRKGIDVLSALIQNKVLMEYCDIANNWVMFINNKRCTDLDFSDLLKYMEFGIPLTEEH
                     ITYVDRFVKPPSSIRNPSYASDMTRLFLSHVEVQAYFKRLHEQIRQSERHRLFDLPVY
                     CVVNNRAYQELCDLSDPLSGSPQPVDIWFRQNLTRIINYSQFVDHNLSNEILKETLRA
                     EDTEEALETLLTLRITYIQGSSVGVNSKVRACVVGYHGTFERFVEILQKDTFIERTPC
                     EQAGYAYSLVSGLLFSAMYLFYSSPYTNEEVLRELGRIDLPIISSLCVDEKGVSEAGV
                     SSGTHTQTRVAVSGGGGDDDEAMVLGMDEDTYDIPCMNEEVSDSDLLAQTSLYEDPFF
                     GKYVKPPSISLLSFEETVQIYTTFRDIFLKRYHILQRATGGRFAALPMVTYNRRNVVV
                     KSNCQIVSQTGSFVGMLSHVSPAQTYTLEGYTTDNILSLPGGHRIHQEVAQRGLSRLV
                     LKDALGFLFVLDVNVSRFVESTQGKSLHVCTTVDYGITSRTAMTIAKSQGLSLEKVAV
                     DFGDHPKNLKMSHIYVAMSRVTDPEYLVMNVNPLRLPYEKNTTITPYICRALKDRRTM
                     LIF"
     misc_feature    140547..143120
                     /locus_tag="grh142"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     gene            146491..146958
                     /locus_tag="grh143"
                     /db_xref="GeneID:2952753"
     CDS             146491..146958
                     /locus_tag="grh143"
                     /note="similar to human cytomegalovirus UL111, cmvIL-10"
                     /codon_start=1
                     /product="rh143"
                     /protein_id="YP_068234.1"
                     /db_xref="GeneID:2952753"
                     /translation="MTMNTKKYHRPVTPFTVTWQASSRSCGRPTLPLEKVWYVRQRSS
                     RMSVRIGGVTVCHVMIYCLIFVLQQKKDTVYYTSLFNDRVLHEMLSPMGCRVTNELME
                     HYLDGVLPRASHLDYDNSTLNGLHVFASSMQALYQHMLKCVSVSGSITPRYDT"
     misc_feature    join(147820..148620,148719..149600)
                     /note="similar to rh144; similar to human cytomegalovirus
                     UL112, early phosphoprotein, pp34"
     gene            148719..149600
                     /locus_tag="grh145"
                     /db_xref="GeneID:2952721"
     CDS             148719..149600
                     /locus_tag="grh145"
                     /note="similar to human cytomegalovirus UL113"
                     /codon_start=1
                     /product="rh145"
                     /protein_id="YP_068235.1"
                     /db_xref="GeneID:2952721"
                     /translation="MPMEHNPTSDPVGFLNYSSHAPLTDHPGSDGALLQNETAGFGDA
                     EERPEELGSRAPSPARGNSGTEAGADAGVRASTSATDDGGDDEHVTPSTSSGLSNRHL
                     PPNSQASSAPLSPHPRSPHFEDIIQSLTRLINECGKGDRVDTPAPSRRTPECSDSHAS
                     PAATSTAATAAAATTVPVCEAPRPVCEIRPYMVNTAAAPQPPPEPQQPAANRRTRGGA
                     RPRNGSRGGGGGRRGASTSGRRRRRNQDDESEDEILPGPSRRRSVPPSFAEDGLEIID
                     LAEEAALAAASIASFFD"
     gene            complement(149714..150457)
                     /locus_tag="grh146"
                     /db_xref="GeneID:2952730"
     CDS             complement(149714..150457)
                     /locus_tag="grh146"
                     /note="similar to human cytomegalovirus UL114, uracil
                     N-glycosylase"
                     /codon_start=1
                     /product="rh146"
                     /protein_id="YP_068236.1"
                     /db_xref="GeneID:2952730"
                     /translation="MALKQWMLENIPDNKACMLNHDEQTRLLSVSKEWLVFLNIPSHD
                     LDLLRDTVDAVARARQSDTVYPPPEHVHRWSYLCAPDNVYVVIVGQDPYCDGSASGVA
                     FGTLPGQVAPPSLQNVYRELCRTVAGFQRPIGGCIDDWCRRGVLLLNTVFTVVRGQPG
                     SHRHLGWQVLSERVISRLSECREHLVFMLWGAEAQTLECLINKSRHLILKAWHPSPKN
                     TKSFLGNEHFVLANEYLRKHHEKTIDWRL"
     misc_feature    complement(149717..150457)
                     /locus_tag="grh146"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03200"
                     /db_xref="CDD:165467"
     misc_feature    complement(order(149819..149821,150011..150013,
                     150116..150118,150149..150154,150179..150193))
                     /locus_tag="grh146"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(149807..149815,149819..149824,
                     149882..149887,150116..150124,150179..150181,
                     150185..150190))
                     /locus_tag="grh146"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(149807..149815,149819..149821,
                     149882..149887,149981..149986,150116..150124,
                     150176..150178,150179..150181,150188..150190))
                     /locus_tag="grh146"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(149819..149821,150185..150187))
                     /locus_tag="grh146"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(150420..151196)
                     /locus_tag="grh147"
                     /db_xref="GeneID:2952747"
     CDS             complement(150420..151196)
                     /locus_tag="grh147"
                     /note="similar to human cytomegalovirus UL115, gL"
                     /codon_start=1
                     /product="rh147"
                     /protein_id="YP_068237.1"
                     /db_xref="GeneID:2952747"
                     /translation="MWRLLVSAAVLVTLVFAETLPQNLTCLELTRRCFTGETFSPEDD
                     SWAKPLIKVNHPDGNLSQLLRYTPLTKHAASTIPLDDTFMDFVALLHNNPAQLRTLLT
                     LLKSDGAPTWMKIMQGYSECGDTGSIYTCVDNVCRAYDLRYLTYSNSIFTENVLGFDF
                     GHKGQFAALVVVRHEDIKMHRPVRIPVATRADRNGLQLFYALYNLVRELLVRHDLDTA
                     LIDRLDKYYLDIPDEWKQPLTNNPALLHNGLKAVDVGKHS"
     misc_feature    complement(150456..151196)
                     /locus_tag="grh147"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03302"
                     /db_xref="CDD:223038"
     gene            complement(151207..152277)
                     /locus_tag="grh148"
                     /db_xref="GeneID:2952742"
     CDS             complement(151207..152277)
                     /locus_tag="grh148"
                     /note="similar to human cytomegalovirus UL116"
                     /codon_start=1
                     /product="rh148"
                     /protein_id="YP_068238.1"
                     /db_xref="GeneID:2952742"
                     /translation="MRWLAMRWLLLIVATSAKASSTTAGNTSTPTASTITSTVTTAST
                     TNMSTPSPASSPATTNTTTSSPSPKSSTSSTNTTITTTGTASATTPKSSTSVTSSPAN
                     TTSTSTKPTNVSSPTVSSPASNTSTTTSTTSTVNGTNSTTPKTNTTSLPNTTADMNVT
                     TTEPYNSTGYENVTINITTPSPYEPLQIVDLCNETISIVFKDPGEEDDINESSEYSNE
                     EPETNSEEDTYFPQSPGYTLTYDTEDTIYFQATCDRNDTYQNITSCDYTNKSVNSWST
                     VTSVSFFPPTLTPCHKPLAIIKIGNDSLVVSASATSNLVDAIYKLLGLPDVNSDFLNQ
                     LGRYHPIILQGQIEYRDWYTTE"
     gene            complement(151952..152416)
                     /locus_tag="grh149"
                     /db_xref="GeneID:2952706"
     CDS             complement(151952..152416)
                     /locus_tag="grh149"
                     /codon_start=1
                     /product="rh149"
                     /protein_id="YP_068239.1"
                     /db_xref="GeneID:2952706"
                     /translation="MRRRSARRWPKSSQTYLISIFVPCHIRRSRHRTCRYTIISQSSS
                     HRHAMAGNEVAAVDRRHERQGQQHHRRQYQHPHRFHDHQHRNNRLYHQYVNPLTSFQP
                     SYHEYHYIEPITQIVHFQHQHNNNNHWHRISNHTQEQHIGHLKSRQHYQHKY"
     gene            complement(152259..153407)
                     /locus_tag="grh150"
                     /db_xref="GeneID:2952675"
     CDS             complement(152259..153407)
                     /locus_tag="grh150"
                     /note="similar to human cytomegalovirus UL117"
                     /codon_start=1
                     /product="rh150"
                     /protein_id="YP_068240.1"
                     /db_xref="GeneID:2952675"
                     /translation="MFSNINIVYTSQRVSKSLAPANKRKTHRTIVVVPQQRFLRIPPD
                     NQDVNHVRIIHPPPSYDARQPPTPPKLTKSLYPYGTSLIRRYARDVKQRKRLIVFNTT
                     SPAAEDSHASSGSGKKMDQDVIDDFLADTFQRDVSVANNSSNDDMYIDDLSLSLSPSS
                     SPEPSPSTSTASSETTSIPTIDLMNHRVLLETDRETTDLNATPYLLPNDYRFAPSCVI
                     KYRYIFEELSRVSRVYDSTAIQIQVSAACGNAFQNLKTTLLKLHNITVLSGSQIITQT
                     VPHTPQAVAAFKYCHNSSDNVLDTVRSVIPRAVSYHETGVHQLYVSGATKKDLINAAT
                     LCAAVAEKQPDIFNINICALSYPSIAAPHLPLYNYFTEFQPQACDGWQ"
     misc_feature    complement(152295..152753)
                     /locus_tag="grh150"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(153432..154031)
                     /locus_tag="grh141.1"
                     /db_xref="GeneID:2952704"
     CDS             complement(153432..154031)
                     /locus_tag="grh141.1"
                     /note="similar to human cytomegalovirus UL118"
                     /codon_start=1
                     /product="rh141"
                     /protein_id="YP_068241.1"
                     /db_xref="GeneID:2952704"
                     /translation="MLYNITTQTFTMYRQAPNVTTQYSCRFIATGQTLNKSWEFLVMP
                     IKAVFASPTNDSMIQLRVLVNDHPCTNETVYSSSKAFVYFGNTNHSSHKVQNITRHNQ
                     SLWEYIFHFTNHDLPNTAHMKILLGDRYSVSTHVFIKRDPDEWPIIGTLGYIVLAFLL
                     FMLFALLYITYVLMRQRNPWAYRRLDEEKPYPVPYFKQW"
     gene            complement(154111..154782)
                     /locus_tag="grh152"
                     /db_xref="GeneID:2952735"
     CDS             complement(154111..154782)
                     /locus_tag="grh152"
                     /note="similar to human cytomegalovirus UL119"
                     /codon_start=1
                     /product="rh152"
                     /protein_id="YP_068242.1"
                     /db_xref="GeneID:2952735"
                     /translation="MLGTGHVLALAAAVLIAQQVIGGTSTTTAANTTSTTTAPSTSTV
                     TSSATSVTTSLTSSSAAASSVTSSNAASSSTSGTATSTATSTQKTSTSNSSTDTGTQT
                     TSSNTTTAPATTESATTSSNASDNSTTENSTVTTTADTTSDTSTAATSTTANKPRVPD
                     IYVTCESAYSYNYLVLQTTCQIHNMSHAQNVSRDLISIECFEQVGCDGNLTSIGSVTT
                     SNTCK"
     gene            complement(154260..154577)
                     /locus_tag="grh153"
                     /db_xref="GeneID:2952733"
     CDS             complement(154260..154577)
                     /locus_tag="grh153"
                     /codon_start=1
                     /product="rh153"
                     /protein_id="YP_068243.1"
                     /db_xref="GeneID:2952733"
                     /translation="MQHLAAHRVPQHQPLLVLRKHLLATVQLIPVLKPPVATQQQPQQ
                     RQSQQQPPAMPPIILLLRIAPSLPPLIPPATPAQLQPAPQQTNLEYLISMLHVKVPTA
                     TTT"
     gene            complement(154831..155427)
                     /locus_tag="grh154"
                     /db_xref="GeneID:2952722"
     CDS             complement(154831..155427)
                     /locus_tag="grh154"
                     /note="similar to human cytomegalovirus UL120"
                     /codon_start=1
                     /product="rh154"
                     /protein_id="YP_068244.1"
                     /db_xref="GeneID:2952722"
                     /translation="MLRFYHAIYLGIVCMVIIMTVVYSLPFYSGDPFAPHVKVAYIYY
                     NASNLTIYCNTSARYSRFLAGGIMITTNHNTTFLKGGYYEYTRHPKPFYLQFVKVLDT
                     APYGFYLNSTVTCWGSNGTYGVRSFMVTKITNTSNKDAIVLVNDTDLVETPDAALNWW
                     PRSQQNRVVMIVLLAQLVFVVFIINACLIWSCKFKRHN"
     gene            complement(155429..155977)
                     /locus_tag="grh155"
                     /db_xref="GeneID:2952716"
     CDS             complement(155429..155977)
                     /locus_tag="grh155"
                     /note="similar to human cytomegalovirus UL121"
                     /codon_start=1
                     /product="rh155"
                     /protein_id="YP_068245.1"
                     /db_xref="GeneID:2952716"
                     /translation="MLLGLAIVLLTSVVVSVCGVQTPDMCWDRNHMKVKCLLRQLDTR
                     LYWFMNDTKRVWAFDYDSQTPLSVPYRVEVRGSLWSSESAVILRMPPYPMTTVGLLLK
                     MDEDREGVLCVGVVPKKRYLNPCGWDSDLSLWYCVCVLLTVGVMIAGILKLDYDTTRH
                     LTDYKSWLSRRTRYFEPAVKRW"
     misc_feature    complement(155504..155884)
                     /locus_tag="grh155"
                     /note="Protein of unknown function (DUF2677); Region:
                     DUF2677; pfam10838"
                     /db_xref="CDD:313926"
     exon            complement(156229..157689)
                     /note="Rh156; similar to human cytomegalovirus UL122,
                     immediate-early protein 2, pp80"
                     /number=5
     exon            complement(158214..159383)
                     /note="Rh156; similar to human cytomegalovirus UL123,
                     immediate-early protein 1, pp72"
                     /number=4
     exon            complement(161559..162053)
                     /note="Rh156; similar to human cytomegalovirus UL122/3"
                     /number=3
     exon            complement(161621..161708)
                     /note="Rh156; similar to human cytomegalovirus UL122/3"
                     /number=2
     exon            complement(161778..161902)
                     /note="Rh156; similar to human cytomegalovirus UL122/3"
                     /number=1
     gene            161947..162489
                     /locus_tag="grh157"
                     /db_xref="GeneID:2952689"
     CDS             161947..162489
                     /locus_tag="grh157"
                     /codon_start=1
                     /product="rh157"
                     /protein_id="YP_068246.1"
                     /db_xref="GeneID:2952689"
                     /translation="MPEPPFFIGLMPRSAILFWLGAQAAILNWHESIDAILFWSYSNS
                     IWRLWTHANSTWPIWTPAKTIWLTWHTAKTAICNWHRAKISWHRARSDILIWRRAKKF
                     WQVAKFRFYLAWCQNPDFAFSDSPTLGEHIARHLEVLRSMVFQITRGYVFEKSGKMPS
                     FQILKMRLLRLLSIQFFLLF"
     gene            163705..164166
                     /locus_tag="grh158"
                     /db_xref="GeneID:2952693"
     CDS             163705..164166
                     /locus_tag="grh158"
                     /note="similar to UL147, vCXC-2"
                     /codon_start=1
                     /product="rh158"
                     /protein_id="YP_068247.1"
                     /db_xref="GeneID:2952693"
                     /translation="MTFGGTFMIMKCFVLQLHSLSIILYILLLKCIIIHSGTKTEFCE
                     CANVTLFTSIPNGTLYLQPLPPNENCTKQEVIAVLPNNTRTCLNPHALVVRVFFNRLF
                     LRISKNEEGLYEVVDTQLELPAWNITRKYYKRYLQKKVNSENAKILSRMIL"
     misc_feature    163822..164013
                     /locus_tag="grh158"
                     /note="Chemokine_CXC: 1 of 4 subgroup designations based
                     on the arrangement of the two N-terminal cysteine
                     residues; includes a number of secreted growth factors and
                     interferons involved in mitogenic, chemotactic, and
                     inflammatory activity; many members...; Region:
                     Chemokine_CXC; cd00273"
                     /db_xref="CDD:238171"
     misc_feature    order(163822..163830,163846..163848,163861..163878,
                     163903..163911,163939..163944,163951..163959,
                     163975..163977,163990..163992)
                     /locus_tag="grh158"
                     /note="receptor binding site; other site"
                     /db_xref="CDD:238171"
     misc_feature    163822..163830
                     /locus_tag="grh158"
                     /note="ELR motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163825..163827,163834..163836,163876..163881,
                     163888..163896,163924..163935,163939..163941,
                     163951..163956,163963..163965,163984..163986,
                     163996..163998,164005..164010)
                     /locus_tag="grh158"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238171"
     misc_feature    order(163825..163827,163834..163836,163888..163890,
                     163894..163896,163924..163926,163930..163932,
                     163939..163941,163951..163956)
                     /locus_tag="grh158"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163828..163833,163837..163839)
                     /locus_tag="grh158"
                     /note="RCXC motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163834..163854,163861..163878)
                     /locus_tag="grh158"
                     /note="N-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163840..163845,163849..163851,163861..163863,
                     163873..163875,163930..163932,163939..163941,
                     163951..163953,163957..163959)
                     /locus_tag="grh158"
                     /note="receptor binding cleft; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163864..163866,163870..163872,163972..163974,
                     163981..163983,163987..163998,164002..164004,
                     164011..164013)
                     /locus_tag="grh158"
                     /note="glycosaminoglycan (GAG) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163870..163872,163879..163881,163936..163938,
                     163942..163944,163951..163956)
                     /locus_tag="grh158"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    order(163876..163881,163891..163893,163927..163929,
                     163933..163935,163963..163965,163984..163986,
                     163996..163998,164005..164010)
                     /locus_tag="grh158"
                     /note="dimer interface (I form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238171"
     misc_feature    163903..163911
                     /locus_tag="grh158"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    163903..163911
                     /locus_tag="grh158"
                     /note="GPH motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    163942..163950
                     /locus_tag="grh158"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238171"
     gene            164371..165351
                     /locus_tag="grh159"
                     /db_xref="GeneID:2952701"
     CDS             164371..165351
                     /locus_tag="grh159"
                     /note="similar to UL148"
                     /codon_start=1
                     /product="rh159"
                     /protein_id="YP_068248.1"
                     /db_xref="GeneID:2952701"
                     /translation="MAYNSFLLSCLTIALLLHGLPTSTSAKDMAGYVHVHMLNAPEDA
                     ASTSAPVIQLANGFITCRKFTELGWALCTSWDDMECFPFWRRTFSETKNITVLSDDPY
                     YAGVVLTVRTLLGDSLELTSYLGVRPSIANVGYYVMYLSYAKALPAKFTHNDVDYVRF
                     AIYLHTEIDAQQTPDNNFVFTFATPGTFETPDLMSSFVIGTDDGQNSTLNFTTVGGEK
                     HRYNNVELSSEMKGNCVYHSAIIRNVASSQSWVSFDFSLYWRRTKIAYSYVQYYFPKP
                     LHSPEPIGPAWQRIYHYFSLLTQLRYGTVAITVVLIFLIGALLKRSREAH"
     gene            165417..166082
                     /locus_tag="grh160"
                     /db_xref="GeneID:2952734"
     CDS             165417..166082
                     /locus_tag="grh160"
                     /note="similar to human cytomegalovirus UL132"
                     /codon_start=1
                     /product="rh160"
                     /protein_id="YP_068249.1"
                     /db_xref="GeneID:2952734"
                     /translation="MTNMTANNTTTANSTATVTTTVATSNITSVSTNVTTVLTATTTA
                     EPGSVLTELLGIIIYCASTVALLCLLLVLVAALYSTCHTRNKVKTKYSEQEGAKLIKN
                     SRRSSPSSKKNRPNKGDYQQLWQSQSETDSTSDDDADNNVLYFDKKGNLTSFVNPQYG
                     HRSSMMIESQADDDENIHYYMSIYDELAAEAMADPSESWEMPKMLQVSTREVTLKEPE
                     YDN"
     misc_feature    <165774..166073
                     /locus_tag="grh160"
                     /note="Glycoprotein UL132; Region: gpUL132; pfam11359"
                     /db_xref="CDD:288251"
     gene            complement(167130..167570)
                     /locus_tag="grh161"
                     /db_xref="GeneID:2952692"
     CDS             complement(167130..167570)
                     /locus_tag="grh161"
                     /codon_start=1
                     /product="rh161"
                     /protein_id="YP_068250.1"
                     /db_xref="GeneID:2952692"
                     /translation="MSDHPESLSSTSSINITAAAARTSVYLTFIYLIAMRSLVLCVVI
                     MFLCGTVQGTAREKECPCKGKTKLGFIPPKSDCLWLHQYGSPCGNEAIAHFPQTVMNK
                     NGKPRLPLCLDFQIVNSTIPNGNGIYCVKKTVNGTREYVRNCNQ"
     gene            complement(167655..167960)
                     /locus_tag="grh162"
                     /db_xref="GeneID:2952743"
     CDS             complement(167655..167960)
                     /locus_tag="grh162"
                     /note="similar to UL145"
                     /codon_start=1
                     /product="rh162"
                     /protein_id="YP_068251.1"
                     /db_xref="GeneID:2952743"
                     /translation="MVFYQYHNAVQLLSARSRDGPGRWERLTHHASCADDHGACTVLM
                     ATSQKRSLVLRRHSAITAVTLRLIPSKILKKLEESDWIPGAWIASETFPTSDAVSGL"
     gene            complement(168378..168893)
                     /locus_tag="grh163"
                     /db_xref="GeneID:2952691"
     CDS             complement(168378..168893)
                     /locus_tag="grh163"
                     /note="similar to UL144, TNF receptor-like protein"
                     /codon_start=1
                     /product="rh163"
                     /protein_id="YP_068252.1"
                     /db_xref="GeneID:2952691"
                     /translation="MLLLSVIWAAVLASRSAAPACKQDEYAVGSECCPKCGKGYRVKT
                     NCSETTGTVCEPCPAGSYNDKRETICTQCDTCNSSSIAVNRCNTTHNVRCRLANSSTA
                     SAHVDSGQHQQAGNHSVLPEDDAARDWWFLLIFVIFLFSIILLALGCRLILVNTTYGK
                     MLTAYMYEKIS"
     misc_feature    complement(168519..168833)
                     /locus_tag="grh163"
                     /note="Tumor necrosis factor receptor superfamily member
                     14 (TNFRSF14), also known as herpes virus entry mediator
                     (HVEM); Region: TNFRSF14; cd10582"
                     /db_xref="CDD:276908"
     misc_feature    complement(168732..168833)
                     /locus_tag="grh163"
                     /note="CRD1 [structural motif]; Region: CRD1"
                     /db_xref="CDD:276908"
     misc_feature    complement(order(168699..168701,168726..168728,
                     168732..168746,168750..168755,168765..168767,
                     168774..168776,168783..168785,168789..168794))
                     /locus_tag="grh163"
                     /note="polypeptide ligand binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:276908"
     misc_feature    complement(168612..168725)
                     /locus_tag="grh163"
                     /note="CRD2 [structural motif]; Region: CRD2"
                     /db_xref="CDD:276908"
     misc_feature    complement(168531..168608)
                     /locus_tag="grh163"
                     /note="CRD3 [structural motif]; Region: CRD3"
                     /db_xref="CDD:276908"
     gene            complement(169096..170388)
                     /locus_tag="grh164"
                     /db_xref="GeneID:2952673"
     CDS             complement(169096..170388)
                     /locus_tag="grh164"
                     /note="similar to UL141"
                     /codon_start=1
                     /product="rh164"
                     /protein_id="YP_068253.1"
                     /db_xref="GeneID:2952673"
                     /translation="MSYTVRFRKGFGRVSEEAETVQLLAEGQEGADSADAESASKRTI
                     HDGPLRVKACTPVSAPRAAMWVRRAMVAITIVMVSLTPRVRGGSIDHTMWDECYEHNS
                     PAPLIMPIGSQVTVPCAFLPHSWPMVSIRARFCQSEYGGYELKINATNGTVVDDDLTY
                     RLINASWKFHDLAISHYVTLTMNISDNTTGMFDCVLRNATHGFLMTRFTIVTQIETLH
                     RPGDPDCAPKLGFHADGKKIWSAEYNEWQRHQCGTFYGFDRLYYYLAASNQSNTKPPC
                     PPSEPDRCWPVLQQYVLDGDCFRSQNFRREPPLPTEKTPVPIFVIDWQWVSLGLTMMV
                     IGGVCLGLVLVVRCACGEMCRNRERFQKKMNAYRPMSTHFMRPPGYEELYSVVDDESD
                     SGYFEKEDRSESYNDLVDENVYDEVAVPPLYSKIKRRL"
     misc_feature    complement(169237..170235)
                     /locus_tag="grh164"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            complement(170857..171288)
                     /locus_tag="grh165"
                     /db_xref="GeneID:2952736"
     CDS             complement(170857..171288)
                     /locus_tag="grh165"
                     /codon_start=1
                     /product="rh165"
                     /protein_id="YP_068254.1"
                     /db_xref="GeneID:2952736"
                     /translation="MDPIIQAQLLTAIFVVLLIFNVLASIYLCYYPRHACATLQYVFT
                     CSCFLSWYRYGCNCKDFRSLRVLENDEPETALEIIVRICEEWWYGPKGPPDPVQYYSP
                     PTYESHEQQPHELPRVEITSNSSGDRAAETVVDIENHTPMV"
     gene            complement(171333..171857)
                     /locus_tag="grh166"
                     /db_xref="GeneID:2952674"
     CDS             complement(171333..171857)
                     /locus_tag="grh166"
                     /note="similar to UL133"
                     /codon_start=1
                     /product="rh166"
                     /protein_id="YP_068255.1"
                     /db_xref="GeneID:2952674"
                     /translation="MSSEDTELYALLAVIVICTILTILGIVYICYYPREAKAAIMDML
                     TCACVVSCYRYGCDCQKFRTLTSLNSGELFTIGGWITDRFRRWWHGNAPPTDPVQYYS
                     PPREGDNEGLVPEVQNVQPVDTVVTIEGNQPVTRVVSKQPLLTQAAAPQTPAQTHEEI
                     QECLEVAISSATLE"
     gene            complement(171988..172491)
                     /locus_tag="grh167"
                     /db_xref="GeneID:2952705"
     CDS             complement(171988..172491)
                     /locus_tag="grh167"
                     /codon_start=1
                     /product="rh167"
                     /protein_id="YP_068256.1"
                     /db_xref="GeneID:2952705"
                     /translation="MEMVVVILCAIGVGIMGTGLLILTLVYPMHMMAVCQGVFTCPWL
                     GIILGGCRKRCRSKNSDPDLEIGLLKSYLKGEEIRRQAEGVLMEIDYLKELKTKKPRI
                     SKPPRSRSADGTQEPMSSIQEEQTDALDEDVFEVSSDAAPILGSEAPVAMQTVVSTQP
                     VSDSSQQ"
     gene            complement(172745..173401)
                     /locus_tag="grh168"
                     /db_xref="GeneID:2952700"
     CDS             complement(172745..173401)
                     /locus_tag="grh168"
                     /codon_start=1
                     /product="rh168"
                     /protein_id="YP_068257.1"
                     /db_xref="GeneID:2952700"
                     /translation="MLTNQEDKIIVGLVLSIAIVAILLFLYLLIFHVRRVGSVCKDIF
                     TCYCFRSLATRIRGEKFDSEYRNVYLRENLKRFAQDYKRVLIMCPPASGKKIPTNGVS
                     IEMDEAVNTQSEKIVTAALPTIPTNRSLSHSDTETERIYSNCKKVTLMMDGEYAVITE
                     VPNTTPDPPSSSPYATIFATDMMQIPNVTPEMAAVIETAVRSTLQMLMKMQPQVSSEK
                     "
     gene            complement(173501..174064)
                     /locus_tag="grh169"
                     /db_xref="GeneID:2952694"
     CDS             complement(173501..174064)
                     /locus_tag="grh169"
                     /codon_start=1
                     /product="rh169"
                     /protein_id="YP_068258.1"
                     /db_xref="GeneID:2952694"
                     /translation="MRLLASVRVAFWKLKKCLRGTRGREHEPCPAKPIMVSRAVQTEL
                     TYSTPAAKHTHIEVHVDVSRIPSEKAGAVDLQQLKDRLTSLIDAGLRNVLDGVMLTGT
                     LKTAIYVEVICFSYPIIMTGVIDTDNFSSTMANRFQKITGDAVQIAYDGLPRHARGTP
                     NKFQKHMIDMYCASRPCQIHSKRCHST"
     gene            complement(174198..174764)
                     /locus_tag="grh170"
                     /db_xref="GeneID:2952703"
     CDS             complement(174198..174764)
                     /locus_tag="grh170"
                     /codon_start=1
                     /product="rh170"
                     /protein_id="YP_068259.1"
                     /db_xref="GeneID:2952703"
                     /translation="MTCVTIHDNMNQCQDTACSTLDLQHLEPHPRNEHRCAIVRMLST
                     VCRTLKGWMHRFLSIFRRKRKQSQCTQNTATINSMVKTALSYSTSASGHTMIDMEVDL
                     CAFLTENTYTLQSCTFSEELTTLLAEKVQSVLFSVQAINPYQSSAEAKVLVSNCPAAL
                     AEIMDDEGFSEIMNSKFQAAFEHVLECA"
     gene            complement(174768..175607)
                     /locus_tag="grh171"
                     /db_xref="GeneID:2952702"
     CDS             complement(174768..175607)
                     /locus_tag="grh171"
                     /note="similar to UL133"
                     /codon_start=1
                     /product="rh171"
                     /protein_id="YP_068260.1"
                     /db_xref="GeneID:2952702"
                     /translation="MDTATIVLLSIGIPAAIIFDILIILYRDRVCPYIWNFFSRLCTR
                     FNCSLKKPDEETKRDASTGDEDETMCVCSLWCASLWAGFCQCVSRCVAFTGRCCSQIS
                     ARNKLTKENLEFYFPCCFTCCHWLSAKLYPTEPPQSRRGQPKDKKQTEVEFVTVDLEG
                     FECELPTLDESPRAQTHTDVAEADNAETQALIHKPPSKHSVSETPDTEEEATRTPTPD
                     SVPDSVPEPDSDPEPCPAPAPTPEPNADIPAAAGVTPEVALLIQSAVEAAVKAALLNA
                     PKS"
     misc_feature    complement(<174867..>175172)
                     /locus_tag="grh171"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta2; cl26247"
                     /db_xref="CDD:331068"
     gene            complement(175806..176336)
                     /locus_tag="grh172"
                     /db_xref="GeneID:2952671"
     CDS             complement(175806..176336)
                     /locus_tag="grh172"
                     /codon_start=1
                     /product="rh172"
                     /protein_id="YP_068261.1"
                     /db_xref="GeneID:2952671"
                     /translation="MMTSSYRNMNATSPSTNNSAGSVLDMWPLGVLVCGAGGMTSLVG
                     LIYLIYDWPFTCGLCYEVCCDCGPWCRCRHDCSHCCQKDRYEVRRRSHWSRRHQEDEA
                     NQRVEWEVVNTWDPSANNNQDDKTEVQVAPPKPTVLCGPVCATTEKVFVETELTSSAV
                     YTPQVHKYCAVLVSEL"
     gene            complement(176388..177515)
                     /locus_tag="grh173"
                     /db_xref="GeneID:2952687"
     CDS             complement(176388..177515)
                     /locus_tag="grh173"
                     /codon_start=1
                     /product="rh173"
                     /protein_id="YP_068262.1"
                     /db_xref="GeneID:2952687"
                     /translation="MHFKISYLVTDRTIYIFIAILSRYAASNNTSTVPTTTNATITST
                     ISSPSTTNTIQTSVVTSPQSISTSTQAATSTNTSTSKSNTTFSTAITSTPNNTSYPNT
                     STSPISANTTVGTTYTSSTTTNNISISTLTTNVSISTHTTNTATNVTSFASVTTTRTS
                     TTANATMGFTITFVNATVGQTVNFTANCSDAAHHQTTWLLLYNNTQNKTTEHELCKTS
                     SSHQTKHHWFSLCYNCSKITLMLYNVTHNDSRRYVFKPETSCNTKPQAFELTVIAGNG
                     TSYSNITPEFCRFTSSTPPTSSSAVDVYLQDVAAPATHAVWALALVITVVVVLMFGQG
                     KMKRIKYYRQRHSDDTEQLVVRYRPERKRLTTGYEQMYISS"
     gene            complement(178695..179774)
                     /locus_tag="grh174"
                     /db_xref="GeneID:2952723"
     CDS             complement(178695..179774)
                     /locus_tag="grh174"
                     /codon_start=1
                     /product="rh174"
                     /protein_id="YP_068263.1"
                     /db_xref="GeneID:2952723"
                     /translation="MMQPVSHKHAHALILLMMWPSGTSGEALRCASKDYTSNTDMKYQ
                     LPINMTKVVSGPTKNETLSGPYTVTCIFVSGECTRGIYFTACDQNATTQVYMYKNHAP
                     IFPNDESKTSASNTNGFTMRWPVSPHAPGTYDCFSYDNVTNIMNITQRTQVTPMGITY
                     ASKHSTNQSVYNVSCSFNSTFPGTVTLIVQGAVNATVIHNETVKLCGQDLYWNYLVLT
                     SGGTPTFQCTNKATNCLLSGYSRLWSNTTSTPGPPIPILHNCSTYSHPWWTTARPVTT
                     PSVSTTQLTSLSISASTSFTYNVSLVVYEAQYASRELHGLWILVVLIICAAVACWLRL
                     PQVVVQMFRKCVASLQRKHNVYTNM"
     misc_feature    complement(<179289..179741)
                     /locus_tag="grh174"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03351"
                     /db_xref="CDD:177591"
     gene            180470..180922
                     /locus_tag="grh175"
                     /db_xref="GeneID:2952731"
     CDS             180470..180922
                     /locus_tag="grh175"
                     /codon_start=1
                     /product="rh175"
                     /protein_id="YP_068264.1"
                     /db_xref="GeneID:2952731"
                     /translation="MFIVLGDDGGERSVGGRTGFDGDGPASHAARVGRQQHVRCGKQH
                     EQYHKRYGLFDVVVAVRRGGMRRGGGGRGGRGGREGLAVLRARTWLPSVPPFCWQQLL
                     APAAGVLTPDDCLRQRKLNKRLEREGFLVASLLCLFNSVARSVHCRLA"
     gene            complement(180619..181260)
                     /locus_tag="grh176"
                     /db_xref="GeneID:2952719"
     CDS             complement(180619..181260)
                     /locus_tag="grh176"
                     /codon_start=1
                     /product="rh176"
                     /protein_id="YP_068265.1"
                     /db_xref="GeneID:2952719"
                     /translation="MDTVLWIMDFTSRFFQIALCVVFLLGLFMAFLLFLSTKCCIWLP
                     LRRHRNRKSLWPRRLQRLTAKNPCPSDADAAVAQAASGVSAMSSASPPSPPSSPAVQC
                     DDTQKPTTRVCHANRQCTDLATLLKRHNKEATKKPSLSKRLLSFRCRKQSSGVKTPAA
                     GANNCCQQKGGTEGSQVLALSTARPSLPPRPPRPPPPRRIPPRRTATTTSNSP"
     gene            complement(181226..181669)
                     /locus_tag="grh177"
                     /db_xref="GeneID:2952724"
     CDS             complement(181226..181669)
                     /locus_tag="grh177"
                     /codon_start=1
                     /product="rh177"
                     /protein_id="YP_068266.1"
                     /db_xref="GeneID:2952724"
                     /translation="MQMIIIQPLRKVPIELFAHARFHPEAHAITLFIRTLHTQLRTLP
                     PHRPLSIPCSCIMLPPPPRAAASPALRVRLGTTTTTTARSVARVHAANSLRATAPTIM
                     IPLPALPARLLRRYKVCVLAPHIHPTLLYEQTRQYGHRVMDNGLY"
     gene            complement(181320..182060)
                     /locus_tag="grh178"
                     /db_xref="GeneID:2952709"
     CDS             complement(181320..182060)
                     /locus_tag="grh178"
                     /codon_start=1
                     /product="rh178"
                     /protein_id="YP_068267.1"
                     /db_xref="GeneID:2952709"
                     /translation="MPACAHKLRSGEHFARILTSQGFLLNPAASPRATMLSYMYVMCT
                     FFRFTFAFTVTTLFVAFLLALTNEFCRCCGFSLRQRTRYLAVQRLLPMSATYRLCKRV
                     FRAVSVPVYALISSFSAVSDNPTPSAQLHANDNHTAFTEGPNRALRTRSLSPRSACHH
                     PVHTHTSYTTADSSSSSSTFHSVLLHHATAAAQGSRLSRPPRPPRHHDNNDSALSGTG
                     ARRKLASRHRSDYHDSSPRPARSPPKAL"
     gene            183231..183746
                     /locus_tag="grh179"
                     /db_xref="GeneID:2952666"
     CDS             183231..183746
                     /locus_tag="grh179"
                     /codon_start=1
                     /product="rh179"
                     /protein_id="YP_068268.1"
                     /db_xref="GeneID:2952666"
                     /translation="MPKLTKQPEMPSTIPICTSPEAPPKPPRLHKQRIQSTDCQRPSK
                     AGSDKEESPSNPHSTSNPTPKPPSKPLSHPAPEPTQNPQRKRQKTVLKRPSHPPPPPP
                     TQSAVIPTVCVSPPPSAPPSKPPPVPPKRRPELHLPLKGPRMVSIELPCLTGSGSPTY
                     DYPVNSARTLL"
     misc_feature    <183231..>183512
                     /locus_tag="grh179"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
     gene            complement(183347..183670)
                     /locus_tag="grh180"
                     /db_xref="GeneID:2952718"
     CDS             complement(183347..183670)
                     /locus_tag="grh180"
                     /codon_start=1
                     /product="rh180"
                     /protein_id="YP_068269.1"
                     /db_xref="GeneID:2952718"
                     /translation="METMRGPLRGRCNSGRLLGGTGGGLEGGAEGGGLTHTVGMTADW
                     VGGGGGGWLGRFNTVFWRLRCGFCVGSGAGCDSGFDGGFGVGLDVECGLLGLSSLSEP
                     ALDGR"
     gene            complement(183766..184272)
                     /locus_tag="grh181"
                     /db_xref="GeneID:2952676"
     CDS             complement(183766..184272)
                     /locus_tag="grh181"
                     /note="similar to human cytomegalovirus US1"
                     /codon_start=1
                     /product="rh181"
                     /protein_id="YP_068270.1"
                     /db_xref="GeneID:2952676"
                     /translation="MEPVVSCGLVGHMPMRELAWRRVADDSHDLWCACMDWKAHIEYV
                     VPLAEDILPRPESWPAQVEAQWRLQIKGAHDVWCQCGDWRGHALRSRSLTLDSDSSRS
                     SRSSTCSYVSVASCPAAILEYPGAADEASWWKRVKGRFRMRGWWERWLQRRRQRAAEK
                     ETTQPSSA"
     gene            complement(184502..185092)
                     /locus_tag="grh182"
                     /db_xref="GeneID:2952663"
     CDS             complement(184502..185092)
                     /locus_tag="grh182"
                     /note="similar to human cytomegalovirus US2; US6 family"
                     /codon_start=1
                     /product="rh182"
                     /protein_id="YP_068271.1"
                     /db_xref="GeneID:2952663"
                     /translation="MAVSLAILVLGGVALQLGLTFGWDFPMPVLTEEELAARRALYTV
                     QQTACYLEGGKLFMTGYITGNIDSYFVQVVVYRDKGIEDLQFFEKDMKLSSDKLEYDL
                     RYYEIDWTTTKVEMRFSLNMSDIIWVTCEPHVKPDFLTHNYLWTFCRAIWFRDWWHVC
                     WCTTVCTLHLMICALSIIWHVFPEDTLKIYFPAFMF"
     misc_feature    complement(184556..185080)
                     /locus_tag="grh182"
                     /note="Cytomegalovirus US3 protein; Region: Cytomega_US3;
                     pfam05963"
                     /db_xref="CDD:283588"
     gene            185590..185952
                     /locus_tag="grh183"
                     /db_xref="GeneID:2952696"
     CDS             185590..185952
                     /locus_tag="grh183"
                     /note="similar to human cytomegalovirus US5"
                     /codon_start=1
                     /product="rh183"
                     /protein_id="YP_068272.1"
                     /db_xref="GeneID:2952696"
                     /translation="MIHGKQFTCSHLVVNGHLAEHTNMDAELCCDECYDCASDGNVKC
                     QSRKQDPVIVARYSLGIPKDTGMINFNLDLIHIADKRFSQSMIVIHAQVNAVYGRRDS
                     FVHFPCSGIKRRMCLFLM"
     gene            complement(185617..186159)
                     /locus_tag="grh184"
                     /db_xref="GeneID:2952677"
     CDS             complement(185617..186159)
                     /locus_tag="grh184"
                     /note="similar to human cytomegalovirus US3"
                     /codon_start=1
                     /product="rh184"
                     /protein_id="YP_068273.1"
                     /db_xref="GeneID:2952677"
                     /translation="MKILVTLGLLSLLLAIDASPLPLSSSYELLHSRCHVKGGKMTAT
                     FTVRSDFAKLQSVEIVTHDRDNIRRSHEKQTHSTLNTRTWEVHEAVSPTIYRVDLRMY
                     HDHGLAKTFVCYVNEVQVEIDHTSIFWYAERVSRHNDWILLARLAFYVAVGCAIVTFI
                     AAKFSVHVRMFGEVSINNKV"
     gene            complement(187133..187645)
                     /locus_tag="grh185"
                     /db_xref="GeneID:2952713"
     CDS             complement(187133..187645)
                     /locus_tag="grh185"
                     /note="similar to human cytomegalovirus US6; US6 family"
                     /codon_start=1
                     /product="rh185"
                     /protein_id="YP_068274.1"
                     /db_xref="GeneID:2952713"
                     /translation="MKPLCGSCGSNENVVIGSLLCLLVLSGVASAWRNDSNTLQKQDG
                     NMEKTCDRVPQPDNGLHQKEAGRHCPFTDQGPACDAFMRRYERAIRILGCDPELRFHH
                     GHALNIRGLFGCPKTTPKGIVFLLERYGGATLMLYLLMILLSLMLTALMLYVIEDLDR
                     VRCLRRCGSH"
     gene            complement(187934..188638)
                     /locus_tag="grh186"
                     /db_xref="GeneID:2952699"
     CDS             complement(187934..188638)
                     /locus_tag="grh186"
                     /codon_start=1
                     /product="rh186"
                     /protein_id="YP_068275.1"
                     /db_xref="GeneID:2952699"
                     /translation="MPRSPKMYCYHLPRALLFTCLLLIVPAERCNKICQERRTYKPRS
                     GIPDRRIYGYTELDPECKIEDGRLHVNGIVLGDFPDPTWLHVYLRNYYDGKLMFAFST
                     NLDHPLVIMNDTMYRHSIHPMQLLEEAKTYIRDHDIIHHARLEHASRLRYQFHLPVSY
                     MFKEVVIQVDHYYKPLFIKCVPEHELTQIVNFYLREYQEFHNSYRGKLYWICMGIVYV
                     AVVKLTINFLYNHVQV"
     gene            complement(188879..189559)
                     /locus_tag="grh187"
                     /db_xref="GeneID:2952672"
     CDS             complement(188879..189559)
                     /locus_tag="grh187"
                     /note="similar to human cytomegalovirus US8; US6 family"
                     /codon_start=1
                     /product="rh187"
                     /protein_id="YP_068276.1"
                     /db_xref="GeneID:2952672"
                     /translation="MKLGGNILTGHISRHKLPFISHGQPLKSKASNNPLFNMRLLVVF
                     LLAYFWIQDRALADESDIEDANATCTITGGILDVTWCMMGKALPNETTVFPYYESREN
                     SQRKRCLPMPNTTFSSNDTICLTTRTPAPADLGRILLKECRECACAIPCYPETIASWD
                     FLFNGDFQRLVYEGRYATIAWLWCMDIMLGTAILLVVIAIGCAIGECYWKCFVPRIPY
                     RPLSSKED"
     misc_feature    complement(188933..>189379)
                     /locus_tag="grh187"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(189657..190031)
                     /locus_tag="grh188"
                     /db_xref="GeneID:2952715"
     CDS             complement(189657..190031)
                     /locus_tag="grh188"
                     /codon_start=1
                     /product="rh188"
                     /protein_id="YP_068277.1"
                     /db_xref="GeneID:2952715"
                     /translation="MRLIVLGLLAVLPIVIVADTFYMEDAINSIRAYQNLSAAEKAQY
                     ERELDRWYLKMKLRFYDELDAMDRPNSTECYRWLATRWMFYTYDKLNGAAWSFPRYPC
                     PYADDQSSQSSESYETESSCSA"
     gene            complement(190318..191163)
                     /locus_tag="grh189"
                     /db_xref="GeneID:2952711"
     CDS             complement(190318..191163)
                     /locus_tag="grh189"
                     /note="similar to human cytomegalovirus US11; US6 family"
                     /codon_start=1
                     /product="rh189"
                     /protein_id="YP_068278.1"
                     /db_xref="GeneID:2952711"
                     /translation="MARFLKVHIFWIYDKEACRHQPGHCHVTKLHKNASSWCCCRKQH
                     QDQAIATMKLLNLFVLSGFIMYVAWIDTLILSVSPPPHPPMFEIDPNNMNTDGKVSDS
                     FLMKNVPLPSLSATKLVSDYHLENPRSQCHLINDNYLDAMWTYSGNATAPDLYLSADV
                     ITKFSSEKLPEPQNVSTEYEQRYILKNIQLTKHVTAINLYVHPCAYCDAHLITCEPKL
                     RISWFPFWASIDQLDRLIFEGRLLHAYWGLFLMFIRWSFMLCMLIQMHWSLTGRSYWF
                     YGIWE"
     gene            complement(191367..192149)
                     /locus_tag="grh190"
                     /db_xref="GeneID:2952670"
     CDS             complement(191367..192149)
                     /locus_tag="grh190"
                     /note="similar to human cytomegalovirus US12"
                     /codon_start=1
                     /product="rh190"
                     /protein_id="YP_068279.1"
                     /db_xref="GeneID:2952670"
                     /translation="MCLRSSGSMGYQTTARHQDNDDVEEVMRWMRRFVWLVRVYTAMA
                     IQLAITMGLCLLCIMSSWRIQTPYLKDTLPIWMMIVPTVLRFNLRRKTTYRLSVWPAA
                     VVYTALNTWALVIWSMCLERTVLWQAYVFSLVLELSCTVFACVLASTRPRGRLVVACL
                     VLALPLFCAIVYYQSWTPAQKWIAVLTAVIVDLITLALLHDILMVLCYNPRSLFDRHA
                     IRAALLLYVDQVLVLMMAIVPLTADKWYPEYFSSTFPEQPVV"
     gene            complement(191524..191856)
                     /locus_tag="grh191"
                     /db_xref="GeneID:2952662"
     CDS             complement(191524..191856)
                     /locus_tag="grh191"
                     /codon_start=1
                     /product="rh191"
                     /protein_id="YP_068280.1"
                     /db_xref="GeneID:2952662"
                     /translation="MARCCGLHCLEHMGVGDLEYVFGTHRTVAGLCVFPGVGTQLHRV
                     CLCSGLHPPTRTACCCLPGSRPATFLRDRVLSVMDARSEMDSGAHCCHCGPDYTSSAP
                     RHLDGAVL"
     gene            complement(192207..192971)
                     /locus_tag="grh192"
                     /db_xref="GeneID:2952710"
     CDS             complement(192207..192971)
                     /locus_tag="grh192"
                     /note="similar to human cytomegalovirus US13"
                     /codon_start=1
                     /product="rh192"
                     /protein_id="YP_068281.1"
                     /db_xref="GeneID:2952710"
                     /translation="MESFRFQVRFNESTAWIQRFKILVQVYSYFIFEFTVTAVFTLYI
                     WFSYPQWHNTCQNDPAPILAILLPVICLACLIIRWERQPSDLFTMTVYVVWVTLSITV
                     FGFCGEVSKALAAHVISVALFTLTTTAAFFDNFDENRYDRPVRRYAMILTLGASSLVA
                     LLAIAASNPTTVTHIMLSTYTVFLDLFMILFFWMTQRHRKHLWEKQIIQGSLTLYVSY
                     YALFQVTFLMLIPNIWHVPFNRVFSSFSWNNAQVKT"
     gene            complement(192977..193462)
                     /locus_tag="grh193"
                     /db_xref="GeneID:2952707"
     CDS             complement(192977..193462)
                     /locus_tag="grh193"
                     /codon_start=1
                     /product="rh193"
                     /protein_id="YP_068282.1"
                     /db_xref="GeneID:2952707"
                     /translation="MVFATITFKMSIRCDPREHFSVAPVLLRTAKPLGHAEWAVNHST
                     WQHGNYHLGKHLYHKVQSNHETRGLRLHSVCGHTYCHVLYVRVSSDTEPVDSRSSQNV
                     NGCEPTLEWQFQQDILLALFCLWMIHENQTIICLTSLQTVFPSYSLNSHVPVGDRRLQ
                     I"
     gene            complement(193084..193917)
                     /locus_tag="grh194"
                     /db_xref="GeneID:2952659"
     CDS             complement(193084..193917)
                     /locus_tag="grh194"
                     /note="similar to human cytomegalovirus US14"
                     /codon_start=1
                     /product="rh194"
                     /protein_id="YP_068283.1"
                     /db_xref="GeneID:2952659"
                     /translation="MPFAPRLQPFTVHRPPAPMIQLDLDERSSLSWLRQHLPLASVYL
                     CLLFVIAVCICSYGAFKSQFHCMVFNTEICRMEPAFILIIVPVLLMFVWNMFDHRQDD
                     MIHMGNGLLYIVVFACIGSTLISFCTDGITAGLSLLFTATFFLTCSGLALWSSRPLPS
                     KCRYVATLVSTFLLLLFYFGQLSHSVMRNGLSIILHGSMGIIIWENIYITKFNLTMKH
                     VVSACIVYVDILIVMYYMYVYLLTPSLWTLDPHKMLTGVSQLWNGSFNRTFCSPSSVY
                     G"
     gene            complement(194048..194791)
                     /locus_tag="grh195"
                     /db_xref="GeneID:2952727"
     CDS             complement(194048..194791)
                     /locus_tag="grh195"
                     /note="similar to human cytomegalovirus US14"
                     /codon_start=1
                     /product="rh195"
                     /protein_id="YP_068284.1"
                     /db_xref="GeneID:2952727"
                     /translation="MRSVDMERSSVASISWLQRTNCIFKIYGCFTLAVVATVLVYGLA
                     RFTFPMLYNNATNCRVDPAPSVLFLIPVVLFMVSHLLEESVDQTSSWIYSVTLTCLST
                     SVFHLCTNDHTIWQTFVLSLLLFCTYGIPGICLHWIRPLAGCFITSFAVAFSLIALFS
                     KNLSIILRATGYAIFSLGFVLLIPTQFYLVHRRPERIKSSSLQLYTLFIVLYQVSIFC
                     WTKDIWSANVHNMFSVFRSSTLSAHVPKS"
     gene            complement(194864..195622)
                     /locus_tag="grh196"
                     /db_xref="GeneID:2952708"
     CDS             complement(194864..195622)
                     /locus_tag="grh196"
                     /note="similar to human cytomegalovirus US14"
                     /codon_start=1
                     /product="rh196"
                     /protein_id="YP_068285.1"
                     /db_xref="GeneID:2952708"
                     /translation="MESEYRWHLNMHWLRRFTMIFQVYAWLGMEVAVTVAMYGVYRTA
                     RPYLTVDCVKDPAPLLMMCIPAAILIVENTPKRIAHTIDGLFWELYYMTVSCLLVSTC
                     TDDWTAFQSFLLTALMFILQSAAAVFDNMQMYRRKMLAMLFSMTVLFTMSLIYSFGHL
                     APSHMLFITMYFLFLVLTSIDVYMETVAIRHKHPVDEIRWPSIMLYVNWVLLYEANVL
                     LLTPGLWSARWDGMFSSLIAYFNQYSANTAHVTP"
     misc_feature    complement(<195065..>195211)
                     /locus_tag="grh196"
                     /note="Potassium-transporting ATPase A subunit; Region:
                     KdpA; cl00903"
                     /db_xref="CDD:321240"
     gene            complement(195728..196453)
                     /locus_tag="grh197"
                     /db_xref="GeneID:2952759"
     CDS             complement(195728..196453)
                     /locus_tag="grh197"
                     /note="similar to human cytomegalovirus US14"
                     /codon_start=1
                     /product="rh197"
                     /protein_id="YP_068286.1"
                     /db_xref="GeneID:2952759"
                     /translation="MVSKMVTKLTNHVIWLNRSIHVWSVYGWLAFQVSITVLVYGLVR
                     CQQYLFDTCAQEPVRQIMITSPALVFIQESYINRVIRKVSLWKNCGVALFCVIHIAFS
                     HVWFSGCVATWTVIQSWIATFCLFILMIYVSDGSNWKPFIERQVLSDMLCAGALAANC
                     FVHSVTQPSVTLWWIAQTLYIIGTVGFMNAMCLQLSNVRRQQRSNERAMSISLLLYCI
                     FHLVHYNNVIMWSFPWKAEDPWL"
     gene            complement(196431..197255)
                     /locus_tag="grh198"
                     /db_xref="GeneID:2952664"
     CDS             complement(196431..197255)
                     /locus_tag="grh198"
                     /note="similar to human cytomegalovirus US17"
                     /codon_start=1
                     /product="rh198"
                     /protein_id="YP_068287.1"
                     /db_xref="GeneID:2952664"
                     /translation="MTGHQVMRLIKKTRIQNQSLKLSHRCCLFSLHLYRTVSLQVSCT
                     FVIGGLMILAAPYVKIPQSICQTGFLPALSLLIPNACLTILHAKKQHSNSWTVLTIYT
                     LVTATAVVLANLCVDITLVTWSGLLAGILFVTCTGLACLGDLHYRRWRTLGLIFFLIL
                     TITLVALSLQPLSLPNKILLGYYVIVLAFMLGVTVFDTSQLSKVSSSQETCVLGLCLY
                     EDLIYCYLLVLLILTTESSLERLTSWMQHFSPSSTQNETRPTVNSAAITHGFENGD"
     misc_feature    complement(196560..197156)
                     /locus_tag="grh198"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     misc_feature    complement(197361..198216)
                     /note="similar to rh199; similar to human cytomegalovirus
                     US18"
     gene            complement(198336..199121)
                     /locus_tag="grh200"
                     /db_xref="GeneID:2952660"
     CDS             complement(198336..199121)
                     /locus_tag="grh200"
                     /note="similar to human cytomegalovirus US19"
                     /codon_start=1
                     /product="rh200"
                     /protein_id="YP_068288.1"
                     /db_xref="GeneID:2952660"
                     /translation="MGAVFNNETDMEDELRLLGRRIMFWMQVCMAIVLQLASTVIVSL
                     IIWIVSPSSFREFCNIIPRYSILSLFVPMLSLFILHVWGQCRCMHQLVFIVIYMFPNA
                     TALIMMATCRSFQAIFMASLLPLIIMMFNLGLICFTRLRMGVSRLHRWFFPVMLMNSA
                     LMVLALIALPASDTLWVGGYIALLLTFVIGLSIHDMTIIGKQELFEDATLVLIIRIYV
                     ETLIMYIIGLLIVDPDFWRNTASSPFDLDFSLGRWWAAEVNLN"
     gene            complement(199182..199943)
                     /locus_tag="grh201"
                     /db_xref="GeneID:2952657"
     CDS             complement(199182..199943)
                     /locus_tag="grh201"
                     /note="similar to human cytomegalovirus US20"
                     /codon_start=1
                     /product="rh201"
                     /protein_id="YP_068289.1"
                     /db_xref="GeneID:2952657"
                     /translation="MVEQENAENNMESAPSDSSPLMVTPEEAVVWFKNFVVWLRVYGV
                     YTFALTCTFAIASLIWLGYPQNQNLCVNNHSTVLTLLVPLTCMVTSYLLGARHPSNLT
                     VLFFYICVNLVPTILFNICSEGYVIVTAYIMSVATFIAFTGLTFIAGLNYGRWKWIIG
                     MYIIVLALFLTSTAFQSAPWHTKLTNSISAFSISFFAFILAYDTYVVIYQSSFMYCIR
                     GGIRLYVDTIAIFLVIIFMMSMPKWVEHAKNSTLT"
     misc_feature    complement(199224..199826)
                     /locus_tag="grh201"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(199991..200677)
                     /locus_tag="grh202"
                     /db_xref="GeneID:2952655"
     CDS             complement(199991..200677)
                     /locus_tag="grh202"
                     /note="similar to human cytomegalovirus US21"
                     /codon_start=1
                     /product="rh202"
                     /protein_id="YP_068290.1"
                     /db_xref="GeneID:2952655"
                     /translation="MQLSDEVRVVRSVFLLRVYILLWFQSLLFLSICALCWLVLPDRL
                     EHVVCNMRMMLFCLMLSVICLGILNWAEPQFPKNLFVSLIYTLLTAVAVTTSGFQFGN
                     RSAVYAMLSTVLLFIVLSISTYRFARDVEFYRPLVTASSALIIILASIFYYFPDEVGE
                     MVVMFGGLAVIVASVICDTQDTLHRIEYESYIPAALCLYMDLMYLFVTLLYFVSTPNS
                     QEVSRVVYKS"
     misc_feature    complement(200036..200650)
                     /locus_tag="grh202"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(200797..202521)
                     /locus_tag="grh203"
                     /db_xref="GeneID:2952656"
     CDS             complement(200797..202521)
                     /locus_tag="grh203"
                     /note="similar to human cytomegalovirus US22"
                     /codon_start=1
                     /product="rh203"
                     /protein_id="YP_068291.1"
                     /db_xref="GeneID:2952656"
                     /translation="MTLLSRSAAEAWGTYLKQRDERPEDVIRCDYGVFSLRNLVFQRC
                     LTMLQGVYLRQYDQPCLREYIKKNSGTIIPLRNPCSWFLVLRSGIDIPQVETRSFDEY
                     LCCKEKLEALGILGVQLRDGSDRKKIQETTCVVLLGSYGFVYVYDWDSDGLFQIGTSL
                     KELAHHGLLTCESVYRHPQTPFSTTEPRFQVEKLLCLDPTDARGLAKTAEEFHGVNVV
                     VKTPGRSEADPLLLLGTVEKLRQMYPFAKMRADNFSNLIKYINQRMCCRWYVLGVTGR
                     YANFGILLTCGIILLDECGVCYVLRIDESDVFRLADNIQMLFRCGFLKLRGITRFDRG
                     LRGEARLESECYCYHGARKQDLSWCSMVNTVTAEQLCGAYDWLTRSNRAHDKIPTSCC
                     WGRSDLMPTGVLQENQNWCFPWSSVTVLQGPQSGAWQENDELTEKTSDGTVMFRVDRG
                     FSPRTVKFEGESDDYTEEEEDDDNQSEETPQHQPVVIVSQETNGSVDSYDDESESSLS
                     SDTHDPPPPDIMAIIQKEWQNEEPVTNERELLLRRARRAKHMKKWHCSLERVSIYDPL
                     NANIHCFD"
     misc_feature    complement(<201376..202404)
                     /locus_tag="grh203"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(202680..204548)
                     /locus_tag="grh204"
                     /db_xref="GeneID:2952650"
     CDS             complement(202680..204548)
                     /locus_tag="grh204"
                     /note="similar to human cytomegalovirus US23"
                     /codon_start=1
                     /product="rh204"
                     /protein_id="YP_068292.1"
                     /db_xref="GeneID:2952650"
                     /translation="MWRTRWEDGAPSFTRPDDFPYCHARYDTYLRVMADFKDLFLRQA
                     NIDSVRVWVRERIDHVLCLGIPCNWFVHVRPGSHMPELRDQLLDDITCCRERMAVIGK
                     CIMWVQDRFVETELIMCMASDTKMYIYEPSQDILILAAEHLDELARYGLLHAECVYRQ
                     FYTPYATRVPHDVVSAMLTQAHDADSLAQCVGAYHNRDVNLHTPGRHADTLKLLANFG
                     CLSDLWPFEAIDPYHLAECQMYLSLRLRCRWYIMGAVGTYRLGGFFEVSSVVIFDRFG
                     RIYTVIVRPYTDRTSHVCLAPGNVYRVADTLSEFFKGGLMKLYVRRRHEHHLRTIARL
                     ERGVRCIHLDETYRLHFTAFDHGVSRDFVRQYRWLCRPDRFRADMITTWDGWDAFTIW
                     HTRVLRGDFVDRRRPHENRDEGAPPRRRRALFNPEDLPPPPPPPPPPSPPQQQPQPSP
                     PPPQQQQHEQVPAEEVAAAAVAQQEVPAPQPPEAPAFQVPALPAPALQAPPPPPIPRM
                     QDDFDDVHEDDIEVIGRDNEGFQMEEDEEEDDDWEDLGFDLDEDSMYDLKDIDAWHAE
                     RQAAQADRWRLGQKLLDAYHTEVDVTEPEVEARRVHLNRDLSPDWINSFDLRAFFQ"
     misc_feature    complement(202683..204548)
                     /locus_tag="grh204"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     gene            202743..203504
                     /locus_tag="grh205"
                     /db_xref="GeneID:2952654"
     CDS             202743..203504
                     /locus_tag="grh205"
                     /codon_start=1
                     /product="rh205"
                     /protein_id="YP_068293.1"
                     /db_xref="GeneID:2952654"
                     /translation="MHSTGLHLGFCHINLGVISVQQLLTETPAVRLSGLSFSVPRVNI
                     FQIVHAVFIEVKTKILPVVIFLFVFFHLKTLVITTYDLNIVLVHVVKVVLHSRDGWRR
                     RRLKRGSWQRGHLERGRLGRLWRGHFLLCNSSSRHLLRWHLFMLLLLRRRRRRLWLLL
                     RRGGWWRRRWWWRQILRVEESSATARRSTFVTIFMWTTAIYKVSTKYTRVPDSERIPA
                     VPRSNHVCPKTVRATQPAILTNEIPGDSMIESGKV"
     gene            complement(202979..203326)
                     /locus_tag="grh206"
                     /db_xref="GeneID:2952653"
     CDS             complement(202979..203326)
                     /locus_tag="grh206"
                     /codon_start=1
                     /product="rh206"
                     /protein_id="YP_068294.1"
                     /db_xref="GeneID:2952653"
                     /translation="MKIVTKVLLLAVAELSSTLRICLHHHLRRHHPPRLNSSHSRRLR
                     LRSSNSMNKCQRRRWRLLLLHNKKCPRHNRPRRPRSRCPRCQLPRFKRLRLHPSLECR
                     TTLTTCTRTILRS"
     gene            203175..203504
                     /locus_tag="grh207"
                     /db_xref="GeneID:2952652"
     CDS             203175..203504
                     /locus_tag="grh207"
                     /codon_start=1
                     /product="rh207"
                     /protein_id="YP_068295.1"
                     /db_xref="GeneID:2952652"
                     /translation="MLLLLRRRRRRLWLLLRRGGWWRRRWWWRQILRVEESSATARRS
                     TFVTIFMWTTAIYKVSTKYTRVPDSERIPAVPRSNHVCPKTVRATQPAILTNEIPGDS
                     MIESGKV"
     gene            204333..204650
                     /locus_tag="grh208"
                     /db_xref="GeneID:2952651"
     CDS             204333..204650
                     /locus_tag="grh208"
                     /codon_start=1
                     /product="rh208"
                     /protein_id="YP_068296.1"
                     /db_xref="GeneID:2952651"
                     /translation="MYKPVTGYTEAQHMINTLAHPNTNRVNVRLSEKQVLEISHHAKI
                     RIVSSVTVREIVRASEARSSIFPSGAPHDDNGPAFVQIGTNSLDPVKLLKGKGSVYVT
                     SRD"
     gene            complement(204572..206002)
                     /locus_tag="grh209"
                     /db_xref="GeneID:2952648"
     CDS             complement(204572..206002)
                     /locus_tag="grh209"
                     /codon_start=1
                     /product="rh209"
                     /protein_id="YP_068297.1"
                     /db_xref="GeneID:2952648"
                     /translation="MAEFSDRPVDELQFYRQVLIDFRDLFFCLDAPQIEHYVWRYRGR
                     RLCLGPPQGWYVELQRDQQLVQAQHAARKLICCNEPLCALGYALKLIPEPHRDNDRDY
                     LQTDFVICMGRFCRIYAFDPRENYMVLVAHHLEELAKYGVLRSEFIYRDSVHNQLRRL
                     SPTLIRSGPRSIRTMHILFLNETTPDSFYVTADRIVDHDVKLHTPGYGTVIMRLMKTV
                     TELRTVWPFSSLTETEAKRWWWGIRANLATPWYLLGVTGRPRLGRSFVAEVMVVLDWF
                     GAVYAIQLDEPNHNLRRVANTLTEFFRMGLLKLVFGYRRFEPERQRKIRMEHQCICPH
                     VEEREMDRRHELLAPFEREERRQRFVQQHYDWLCLTERFDPRQGAWERLDPNVLVLHR
                     YDTVQQTYVLESDIVGVEAAEREAASHQEDTGPRLHCLVTTKSSTRERTTERVLAALV
                     YQSRLVTYTDPFPFKSLTGSREFVPI"
     misc_feature    complement(<204878..205960)
                     /locus_tag="grh209"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            205019..205594
                     /locus_tag="grh210"
                     /db_xref="GeneID:2952637"
     CDS             205019..205594
                     /locus_tag="grh210"
                     /codon_start=1
                     /product="rh210"
                     /protein_id="YP_068298.1"
                     /db_xref="GeneID:2952637"
                     /translation="MFHANFSLALRLETAVAEHQFQKPHAKKFSEGVGYTPQIVVGLI
                     ELDGVHRSEPIQHHHDLGHERAPKTRTACYSQEIPGSSQISSNPPPPAFSFSFREAAK
                     GPNGAQLRNGLHEPHNHRSVTGSVKFDIMINDSICRHVKAVRSSFIKKQNVHSAYGAR
                     TGTDEGRRQAAELVVNTVTIDKLRSQHTIFG"
     gene            complement(206363..208156)
                     /locus_tag="grh211"
                     /db_xref="GeneID:2952642"
     CDS             complement(206363..208156)
                     /locus_tag="grh211"
                     /codon_start=1
                     /product="rh211"
                     /protein_id="YP_068299.1"
                     /db_xref="GeneID:2952642"
                     /translation="MLRQSYRYASGPAVRRTLGALKDLFSHQESQSSLRILVSLKAEC
                     RVSVPISAPPGWRMVFATFPSVFGEDTPCQGPGSPWSKLICCEEPLEVLGVLQYWPGR
                     RNEDDGDSSDEDSEDEYCDDSCLYVDDLLPPSKSKRVVLMGRYESLWVLDRDQNVLYF
                     LASGLDDFARHGLLHCESIYSGKFRMPMLTTQPDDVISHLRMNDYSLCQLQRAMARYR
                     GQCIPLRTPGEMTRPMLICAEADDLKSCWPFLCMDNLMFEKLMQFFKDRLCCGVLIFG
                     VVGEVLPSGVFHAEWVILMDAFGELFYFDVYRRDVWRLADDIDSLLTMGLLKIYQAGR
                     RFSLALSDAERLEMPPHCPHRTYQFWDRYLYMDRGMGHKHQETRFQWLVRRDRFCRLN
                     PGGCYSRNSHHEVSGAADGSWEPHVRCDFPQATEVEAAHNFWRRLSDYVHSKEVKQGV
                     RCYSIWNQMNPVLERAIVNLRQSMSAEGHASEPESASASNDAKPAMLYKKPQVPESDD
                     DDLLEIDGGGARAQAASLSSPSRSVETDARPHTDSSSEEGGDEDGGEDVTCDYYTQVL
                     IHRAAKAAILEGCPYPRPAVPRPGSYLPPWL"
     misc_feature    complement(<206990..208144)
                     /locus_tag="grh211"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(206818..207132)
                     /locus_tag="grh212"
                     /db_xref="GeneID:2952859"
     CDS             complement(206818..207132)
                     /locus_tag="grh212"
                     /codon_start=1
                     /product="rh212"
                     /protein_id="YP_068300.1"
                     /db_xref="GeneID:2952859"
                     /translation="MPRGWRCLRIVLIEPISFGTAICTWIGEWAISIRRHDFSGLFGV
                     TVFAASTLVAVTLVTVTMKCPERPTVAGSLMCAATFPKPPRWRPLTTFGAVSQIMYIL
                     KK"
     gene            206909..207424
                     /locus_tag="grh213"
                     /db_xref="GeneID:2952640"
     CDS             206909..207424
                     /locus_tag="grh213"
                     /codon_start=1
                     /product="rh213"
                     /protein_id="YP_068301.1"
                     /db_xref="GeneID:2952640"
                     /translation="MRLPATVGRSGHFMVTVTRVTATRVEAAKTVTPNKPLKSCLLML
                     MAHSPIHVQIAVPKLIGSMRTMRRHLQPLGIGESQAETPAGLIDFQQPHGKKGVYVIG
                     QTPHIAPINIEIEQLAERVHENHPFSMKNSRGQNLTHHTKDQNPTTKTVFKKLHKLLE
                     HQVVHTQKRPT"
     gene            208328..209314
                     /locus_tag="grh214"
                     /db_xref="GeneID:2952856"
     CDS             208328..209314
                     /locus_tag="grh214"
                     /note="similar to human cytomegalovirus US28, chemokine
                     receptor-like protein"
                     /codon_start=1
                     /product="rh214"
                     /protein_id="YP_068302.1"
                     /db_xref="GeneID:2952856"
                     /translation="MNSSQHNISVFLSIGAGPVITGYTCVFLFGILGHFYLYWKNHQR
                     RHRTNSFSDVLFRHLMITEEVFTLTIPVWAYHLTTHGNLPGSWCRSLTFVFYLTVFAR
                     AFFYLLLIWDRYSVIICRHPLPVNLNYSQVIGLSVWLVAVLSASPFSIFNGSVKQCLG
                     NMGSIPSESSAVLNLEVHLCSFWLPLIMSANCYYQAKRRASPDQLHELYRCSLLITII
                     TTYAIVWFPFHLALLIDALISISHVEPSSALHWASIVVTCKSFTFVYAGISPLVYFTC
                     CPTVRRELLMSLRPFFTWISSKTRRGYAPIKTQPLNIPDEPIDNKSPHLLNE"
     misc_feature    208394..209146
                     /locus_tag="grh214"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    208394..208456
                     /locus_tag="grh214"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    208484..208549
                     /locus_tag="grh214"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    208592..208660
                     /locus_tag="grh214"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    208721..208768
                     /locus_tag="grh214"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    208838..208909
                     /locus_tag="grh214"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    208961..209026
                     /locus_tag="grh214"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    209075..209146
                     /locus_tag="grh214"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            209660..210673
                     /locus_tag="grh215"
                     /db_xref="GeneID:2952855"
     CDS             209660..210673
                     /locus_tag="grh215"
                     /note="similar to human cytomegalovirus US28, chemokine
                     receptor-like protein"
                     /codon_start=1
                     /product="rh215"
                     /protein_id="YP_068303.1"
                     /db_xref="GeneID:2952855"
                     /translation="MTNTNNTTCHLNGTFETFKITRPVAISAYTVLVVIGLLGNIVLL
                     SVLVVKRKLKFPNDIYFFNASLADVFAVCMLPAWVNYALDSTQLSKFSCITFTFGFYV
                     SLFIQAWMLILVTLERYGSLVWIAPITRNKAIANCVLFWLVSIFLAAPYYSFRNESNE
                     HQCIMRNYTWSVGETWHIALDFLITLITFIMPVTIVLALSFKMARWSTFGYRNLTSRT
                     SLILILILTVAAGFWGPFHLFMFIENVAGQIYHIQKDCWYLQLRHLCSLMTETLVFLR
                     SVFNPYIYMIISYKFRQQVRSLLKRTQYDALDTTQLAETMQLKAKGVPVSDPAPHDCE
                     CFL"
     misc_feature    209741..210538
                     /locus_tag="grh215"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    209741..209806
                     /locus_tag="grh215"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    209831..209896
                     /locus_tag="grh215"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    209939..210007
                     /locus_tag="grh215"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    210062..210109
                     /locus_tag="grh215"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    210191..210262
                     /locus_tag="grh215"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    210308..210382
                     /locus_tag="grh215"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    210446..210523
                     /locus_tag="grh215"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     misc_feature    210809..211809
                     /note="similar to rh216; similar to human cytomegalovirus
                     US28, chemokine receptor-like protein"
     gene            complement(211704..212006)
                     /locus_tag="grh217"
                     /db_xref="GeneID:2952854"
     CDS             complement(211704..212006)
                     /locus_tag="grh217"
                     /codon_start=1
                     /product="rh217"
                     /protein_id="YP_068304.1"
                     /db_xref="GeneID:2952854"
                     /translation="MHNSRFPTNPIQITMLYIAIAMYRLGADALRVTLKLQDVLFILN
                     GDYQAFPWIRMTFKHRLQSAFFYNTDSYSRGLGSGTLAFLFFKLTMSLACSASSVS"
     gene            211882..212901
                     /locus_tag="grh218"
                     /db_xref="GeneID:2952845"
     CDS             211882..212901
                     /locus_tag="grh218"
                     /note="similar to human cytomegalovirus US28, chemokine
                     receptor-like protein"
                     /codon_start=1
                     /product="rh218"
                     /protein_id="YP_068305.1"
                     /db_xref="GeneID:2952845"
                     /translation="MNNTSCNFNVTLNASAPSRYIAIAMYSIVICIGLVGNLLLCIVL
                     VKKRKLRYSSDVYFFHASMADLVSTVMLPLWLHYVLNFAQLSRGACISFSVTFYVPLF
                     VQAWLLISIAMERYSNLVWMAPISVKTAFKHCIGTWIVSAFVASPYYAYRNSHDEHEC
                     ILGNYTWHINEPLHTCMDVVIIVWTFLAPVLVTIIASVKMRRTTWGNTRLNEKNSDIL
                     IVLVVMTVFFWGPFNIVLVIDNILQRYYDTTNCDVEKIKHIMAMISEAIVYFRGITAP
                     IIYVGISGRFREEIYSLFRRQPYNDLDPDANQFMIELTSQGRSRNRNARQSESNVPQP
                     EECFW"
     misc_feature    211951..212751
                     /locus_tag="grh218"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    211951..212019
                     /locus_tag="grh218"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    212044..212109
                     /locus_tag="grh218"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    212152..212220
                     /locus_tag="grh218"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    212281..212325
                     /locus_tag="grh218"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    212404..212475
                     /locus_tag="grh218"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    212521..212592
                     /locus_tag="grh218"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    212653..212730
                     /locus_tag="grh218"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            complement(212671..212976)
                     /locus_tag="grh219"
                     /db_xref="GeneID:2952850"
     CDS             complement(212671..212976)
                     /locus_tag="grh219"
                     /codon_start=1
                     /product="rh219"
                     /protein_id="YP_068306.1"
                     /db_xref="GeneID:2952850"
                     /translation="MSPPRRMTHRPHVQFYENSLLALNILPEAFFWLRYIAFRLSSIS
                     ISTSSLASEFNHELIGIGVQIVIRLASKQRVNLFAKSATNPYINNRCCNTAKINNGF"
     gene            213046..214497
                     /locus_tag="grh220"
                     /db_xref="GeneID:2952852"
     CDS             213046..214497
                     /locus_tag="grh220"
                     /note="similar to human cytomegalovirus US28, chemokine
                     receptor-like protein"
                     /codon_start=1
                     /product="rh220"
                     /protein_id="YP_068307.1"
                     /db_xref="GeneID:2952852"
                     /translation="MTTTTMSATTNSSTTPQASSTTMTTKTSTPGNTTTGTTSTLTTI
                     STTSNATSITSNLSTTGNQTATTNATTFSSTLTTSTNISSTFSTVSTVASNATCNSTI
                     TTNITTAFTTAANTTASSLTSIVTSLATTIETTSFDYDESAEACNLTDIVHTTRSVTV
                     TFYTIIFILGLLGNFLVLMTIIWNRRISFMVEIYFVNLAISDLMFVCTLPFWIMYLLE
                     HDVMSHASCVAMTAIFYCALFASTVFLLLIVLDRCYAILLGTEKANRRLLRNAVSGCM
                     LMWGLCFILALPHFIFMKKGTNVCVAEYEPGLNNFYVIFINTEVNLCTLVLPAAAIIY
                     WYLKLTKALKTHERLRHRLTSLNIVLAVVIVFALFWLPYNLMLMMYSLVHMQIPWECS
                     SEKILRRSLIITESIALSHCCINPIIYLLFGPRCRSEFCHLLRCCFTRLCPHRSWSSI
                     RAETVSISLSHSQVSASSEDDDNDVHDELQFLI"
     misc_feature    213526..214335
                     /locus_tag="grh220"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    213526..213594
                     /locus_tag="grh220"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    213619..213684
                     /locus_tag="grh220"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    213727..213795
                     /locus_tag="grh220"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    213862..213912
                     /locus_tag="grh220"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    213985..214056
                     /locus_tag="grh220"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    214102..214179
                     /locus_tag="grh220"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    214237..214314
                     /locus_tag="grh220"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            214653..215978
                     /locus_tag="grh221"
                     /db_xref="GeneID:2952647"
     CDS             214653..215978
                     /locus_tag="grh221"
                     /note="similar to human cytomegalovirus US29"
                     /codon_start=1
                     /product="rh221"
                     /protein_id="YP_068308.1"
                     /db_xref="GeneID:2952647"
                     /translation="MLTRPWYIDIWWITLGCAPAVSVTVLLTTATVGAHSIVVHEASP
                     PPPPSSSSLRLPITSPSSTHFNNPSKSSHIERTASAVGPTRQRTNALNRRRRQQQRKP
                     YTCITGTHWTTNLVFTSCENTPSFVKLEGVRKWTLKGQPLGETSYYGGCCRLAHGENA
                     YIILANGYGPAIHGHALRVDYATTNCTQPAIPFPTRLEITSTQGLQSRCGSNRFYFYG
                     LECSTQLAFSTLGVVDVRRCPSVLAVRPLRRSGSFWDEQLRGLSLDILVCLALVMLLF
                     MEIIPGQAFRYPIGTWRRVSAFPSTFRLHRWVKRNLASLFSSETEHQKKPSEAAANRT
                     WTVPFPCSHTVLLAPIPFRLRRTMSFPSLQFPTSSAHNVSQITDNPTHGTYESHNLPP
                     VTLPVTDYIEVIAEHAPIIYRQDANAVQAMLLQAALERDHNRQHDRNRC"
     gene            215128..215451
                     /locus_tag="grh222"
                     /db_xref="GeneID:2952644"
     CDS             215128..215451
                     /locus_tag="grh222"
                     /codon_start=1
                     /product="rh222"
                     /protein_id="YP_068309.1"
                     /db_xref="GeneID:2952644"
                     /translation="MRTSFSLTVMALPSTVMLSVWIMRLLTAHNLRFRFPHGWRLRLR
                     RGFRAGVDRIASIFTVWNVPPSWPFPPSEWWMYAGVPPYSPFDPFDDLGAFGMNNYED
                     YPWTF"
     gene            215896..216717
                     /locus_tag="grh223"
                     /db_xref="GeneID:2952853"
     CDS             215896..216717
                     /locus_tag="grh223"
                     /note="similar to human cytomegalovirus US30"
                     /codon_start=1
                     /product="rh223"
                     /protein_id="YP_068310.1"
                     /db_xref="GeneID:2952853"
                     /translation="MPTPYRRCCFRPLWNAIIIVSTIAIAANACHIEVGEDATVEQEC
                     RQRNVLLATGQLTPHSHRPHVLEFTFSTKDRLGSVQRLQLHITGLQLNNRTVLDQSVY
                     WRLFSRATTVEGGVKQKVKLRLISEQHVPARHCEITVGKDSGLDETEPWGLLNVLSYF
                     VWWVAMCLLAIDIIINAYQWIHKINSKNRTAVSVRAEILRNEREMFWKRRRARHGGIS
                     ESPVSSVPPRYACNEPWSLPSTAAATASNQSAAATPASPTPPEYSSSSVFPPFPQ"
     gene            complement(216579..217196)
                     /locus_tag="grh224"
                     /db_xref="GeneID:2952643"
     CDS             complement(216579..217196)
                     /locus_tag="grh224"
                     /codon_start=1
                     /product="rh224"
                     /protein_id="YP_068311.1"
                     /db_xref="GeneID:2952643"
                     /translation="MVLAPLLLLAVPDPRPQRPFFRKLLNTRVKHDSLLLCLDVLLLV
                     SIAAGRVTREIRFSSRLRACPLQSVQRHHLSWVSRALRIQRMVASSIQLLQATSSELA
                     SSLMIMCAFQCPQIHHRLCEYTMRPRQVSSFSMSPVPDPKGSDPKQGTKTTSIMHNSL
                     YWGKGGNTDDEEYSGGVGDAGVAAADWLLAVAAAVLGRDQGSLQA"
     gene            216793..217278
                     /locus_tag="grh225"
                     /db_xref="GeneID:2952847"
     CDS             216793..217278
                     /locus_tag="grh225"
                     /note="similar to human cytomegalovirus US31"
                     /codon_start=1
                     /product="rh225"
                     /protein_id="YP_068312.1"
                     /db_xref="GeneID:2952847"
                     /translation="MEKEETWRGLMVYSHSLWCICGHWKAHIIMSDEANSEEVACSNW
                     MEDATMRWIRNARETHDKWCRCTDWRGHALSLDENRISLVTLPAAMETKSSTSRHNSR
                     LSCFTRVFKSFRKKGRCGRGSGTASNSSGASTISSHSWQWYRVTPPTPRQAECQRAPH
                     P"
     gene            217405..217965
                     /locus_tag="grh226"
                     /db_xref="GeneID:2952645"
     CDS             217405..217965
                     /locus_tag="grh226"
                     /note="similar to human cytomegalovirus US32"
                     /codon_start=1
                     /product="rh226"
                     /protein_id="YP_068313.1"
                     /db_xref="GeneID:2952645"
                     /translation="MNRPRDLIPTLHDSCTQTELRWRRVLTESHALWCNCGDWTPHVE
                     CVDDAYFQLRWRSRQERTALRWRRQMHRLHNLWCMCGNWREHALYRRGRLTDSSSGSS
                     ASSSGESAENTFVWWKCLRKWNILWRHSYDFFDIPVPPESERETPAYSDSGSEGTPCT
                     SIIETHRPQDCPIVMDVRPWYRETAV"
     gene            complement(217463..217879)
                     /locus_tag="grh227"
                     /db_xref="GeneID:2952646"
     CDS             complement(217463..217879)
                     /locus_tag="grh227"
                     /codon_start=1
                     /product="rh227"
                     /protein_id="YP_068314.1"
                     /db_xref="GeneID:2952646"
                     /translation="MAFPPILSPSTQAFHAQTQAAREYQRSHSCVAIECSTCASISTT
                     RMCFRLIHPMTTLTIRMTSQSSVPGGTARVPASFRTCTRGCATCAFACASAGRCALGD
                     CATAVGNTRRLRTLHVVSSPRSCTTGHETRLKPFAI"
     gene            218098..218403
                     /locus_tag="grh228"
                     /db_xref="GeneID:2952848"
     CDS             218098..218403
                     /locus_tag="grh228"
                     /codon_start=1
                     /product="rh228"
                     /protein_id="YP_068315.1"
                     /db_xref="GeneID:2952848"
                     /translation="MWHAITVHTPSGVASAARAVNNALSDLVCRISMLCARRRRRAVT
                     QETATAGSSEARQAEQKQEQPQTSSSTSFLGRALVLVGQQLLAANQAACPPPAWLWK"
     gene            complement(219051..219506)
                     /locus_tag="grh229"
                     /db_xref="GeneID:2952844"
     CDS             complement(219051..219506)
                     /locus_tag="grh229"
                     /codon_start=1
                     /product="rh229"
                     /protein_id="YP_068316.1"
                     /db_xref="GeneID:2952844"
                     /translation="MPKLLLCQQKPVRNPFRRVTKRLCRAHCALICVIGNFPAVPRKT
                     KILAKTTPLLFCRTAPGRPATTIPIGIPKAYADLIRSCNAASATIALAPIVRSDDLYP
                     FSPVTVTLPSFPSIPAMVFSSSRARDYNYKPTHLSTLHSNLFPLAVVLA"
     gene            complement(219127..221214)
                     /locus_tag="grh230"
                     /db_xref="GeneID:2952638"
     CDS             complement(219127..221214)
                     /locus_tag="grh230"
                     /note="similar to human cytomegalovirus TRS1"
                     /codon_start=1
                     /product="rh230"
                     /protein_id="YP_068317.1"
                     /db_xref="GeneID:2952638"
                     /translation="MRPHRSPHSWQHLRYAGLRTSPDPHSHRLPAPPTHWRPHQPSPL
                     HHMSSLMHALPTPPHQPTSAMHPPTHAPGAPTTLTLPSLDTRTRLASIPPQQHALTKD
                     EFLLMATAWADAFIANTTARATRKWCQRQTGQLLPLGRPANFYAVVTPRSHMRDVGAT
                     DLRQLSPTDDWIVLVATLVHEMSPSPQDPPTLCRHEGLFLAIGCHFRVFLFDLPRHTL
                     HLAATDADDFFRHGIGDLPRVYACPTLPPLTVHPPEPVELLSRTWPNAAAAAAAIGHT
                     AAGQTICLQTPGRPPQPCLLTTCWEEVERWLPFCKWPHAGSIVAAVRNFISERLCCAF
                     HLLGIVTTHPWLEYLSEWAAARANWFDTRSRNPSREHTRLAAYQGSTVKRRPKPNKHS
                     RHNAPASDVPPAATPGPAAAAAAATVTHSPKCHAERKSDERAEVDDDGRLLEKNPLAV
                     MLIIIDELGVVYGYCTYDGLVYPLAEDLSHFLRVGLLAALTAGYAAASPDQAAVRLLP
                     DQDPYVWERPRPDALYLWPRPSGGPRDLASQFAFLTRPGRWRLDTDTSTCQSRDEDGW
                     RVRDAQALALPAEAGQEPIPQSDQALVSRALRFDLRYWKLPSGPEEDEDPGEDDSFTL
                     LPYRTWAAGDYNPHWDPQSVRGPNTVMQRRICNHRARANRPFRRPLPIQPRDRDPSVF
                     PKYSSDGVLIVPC"
     misc_feature    complement(220933..>221211)
                     /locus_tag="grh230"
                     /note="Retinal protein; Region: Retinal; cl25836"
                     /db_xref="CDD:330657"
     misc_feature    complement(<220195..220938)
                     /locus_tag="grh230"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     misc_feature    complement(219760..>219861)
                     /locus_tag="grh230"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
ORIGIN      
        1 cgggggggtg tttgtggcgg gggggtaaaa tttggccagc tgccaagtaa gagcagacgg
       61 agacggggtc cagcacagca gacagacacg gggcactggg aaagcacaga acaacacacg
      121 gagaggacac acagagaccc gcacagaggc gacaccgttc acacacacac acagcagcag
      181 ggccgcagtg acaccgcggc aaacagagag aggcagacgg acaacgaaga acgccgaagc
      241 agtagaagag aagggcgagg gctatccgcg gccccggcga cccccttccc cagtcgccgt
      301 cgtgccgagg ccgcggagga cggctgcccg gggttggcgg tctgccaaga acacgcggcc
      361 cttccccctc cctccacgcg agccgcgcac ggtgaaacac acacaggcag acaccaccgc
      421 cgtccccctg tcggcccgtt ccgggaggct ggaggggggc ccgggggtcg cggcgggggg
      481 cgtcaaaaca cgcgccgtct ctgcggggca ggacgccggc agcctggcgc tgtttgctcg
      541 cgctcgcttt ttctcccccg cgccgcgaaa cccgagccgc ccggctgact cagcgctcgc
      601 ggccacaccg tctacaccgc cggcgcccgg cgcacgctga aataaaaacc ggttccttca
      661 gctcgcttca ctgctcctgc gctgagtcaa caccaacgcg ccccgccaaa ggcagcactg
      721 agagacgggc agaaagggac ttcccccggc ccgcgtgtgg cgctcgctgc gccgcctagc
      781 gtcaggccac cctcgcctgc ctgcgcgccg cctactatca actatccgcg acgttcgccc
      841 attatcaact gcacaccctc gccatgccgc cactcaatcc acaatccgca ctcacacact
      901 cctcatttca ctaccaactc tccgctccct tgaccccaca ctctcccgct tacaccaacc
      961 tcccacattc tgcacccaac cctctccaca acacactcct cgcccgtctc agcgcacctc
     1021 ctccacccca tcacgcacta tgcttctcct catccctccc tccttcgcgt ttcccctaca
     1081 ctccctccag cactcccaac cacgcactct taaaccctcc agccttctcc gcgtcgcgct
     1141 cactctcgca tcacccacca acatgtcaca cactcccggc gcctgcgcca acacctcctc
     1201 gcctttctcg ctctcaccct taacccgctg gcgcgcctgc accatcttcc tacccgcaca
     1261 gcgctgtcca acctgcggcg actggagcac cgccgaacac gaatccggca cctgccgagc
     1321 tccagatgcc gacctcactg actactcagg tggatccacc tccgatgacg aggccgtgac
     1381 tgcctacgcc cacgccctgc gcagcatgcc caccaaccca tcctacgcca aacacctccg
     1441 ctcctactcc gcacgctctc gctcttcacg cgcacgccat cgccaatgcc gccgccaacc
     1501 cccctccgcc gccacccact cacctgcccc ccgtcaccct actccctccc tctcctcatc
     1561 tacctccgcc acacctccac ctcctgcact cacctgtccc ctcactcacc ttcgcacacc
     1621 tccacgcaac cccccacccc cagacacacg ccaacaacac gatcccctcg gcgaccaggc
     1681 cgacgaagcg ctccgcatct acggctaccc catcagccgc tacgatatgc gcaccggcac
     1741 cgcagaccgc ctcagcccag accgcggagg ccccctggaa cccaattgct ggtgcctctg
     1801 gggagtgcac gcacacaaaa atcaccgtcc tatcattcct ttattaacag cgcgcgctcg
     1861 cgacggcccc atcaaaagcg gcggctggga tgttctgtac ggtcgcggct acggttaccg
     1921 cgcattccca ggtcccgaag gcgaatctcg ccccgtctgg acacaacaca tcgtcttcct
     1981 cctcggcggc cacggccctc gcctgcagct gaaccgcgcg tgtgcccgag aagctgaagc
     2041 ccgaggactc ctaccacttt ggcctgtcca ctcacgcaca cctcaaacat ccaccgactc
     2101 cgacagctcc atcgacggca ttccacgctc caacctaccc agactccttc aaaaacacac
     2161 agcacaacac acccgcaacg gcaccagccg ccaggccgaa cgagcagaac gaggtgcttg
     2221 gattgtctca gacaccttca ccgcccctgg tttacggaat acttggaaca cgcgtactca
     2281 tgaggaattc tggcaacgca actataccaa agactacatg gaacacagcg ttttcctccc
     2341 aacttcgccg aaccgcttct acgacccttt ccagagccgc cgcccttgtc gccattcatc
     2401 cactaccagc tctgatactg acagcgacgg cgacgacaac gaaaacaccg tacccatcac
     2461 acctgacagt tacatccctc ccgatggaac ctgcaagcat tctccacccg aaactcactc
     2521 tcatacttct tccaccactc ccgagacaga aaccactcgc ctgtgatcat ataaatagca
     2581 tttattttaa taaatacaaa tcttgaatcc cagtgttatg atctttgtca gttttcttcc
     2641 cccatgcctt ctcgtacgac acatcctcct cgctatctgc ccgccgtcat atacggcagt
     2701 tgtcataatt catccctttc tggtcccttc tcgcccttcg catctccaaa atgccagttc
     2761 caagcttcca acgcgccgtg cctgcgctct gcctcctcct gctgctgagc gctccactgc
     2821 tgcgttggtc gtaccacttc gcccgacgat attgtaccga ctgcttcatc tcggcgacgc
     2881 actggctgct gaacgcaagc ttctggctcg tacctcgctt gctgttcctg tttgcctaca
     2941 ttatggttct ctcttggatc actctgctgt gcatattcct cgcactcaga tgcataggcg
     3001 tttttcgtgg ggcagagata ttcgacgagc caacgggccg cgaagctcag tagtatattg
     3061 ctccactttt cccttttcct agtgtagatg taccgtgtcg cttcccattc catagtgttc
     3121 acgaacgctc gaccgcacgc acgccaccaa ggcgtgtcga acgcgtccac caggtcttcc
     3181 atgcgatcca gcaattcatc gcgttccaca gcgctggaac aaggcacaag tgccatgttt
     3241 gtccgccttc ccgccgagca acaggtctgt aggctgtcag cactatacaa aggagagcgc
     3301 cgctgcctcc aaggaagagg agagcgcacg cactttcctc tgcgcgctcc gattgcaaaa
     3361 cgaggagtgt taaaacgaca ggaatccccg gaggctctca ttcggcaaag tcaggatcgg
     3421 ctcccaagtg tattctccga ggctcgctgg gactgtttat tataaagccc gtgtacgtca
     3481 tttttataca tctatatcga aaccgactgg gaaagcccag cgctatcatg tgtccgggac
     3541 ttttcaccta catcaccctt acaggaatgg tgatgcacac agtgtccggg aatccgcgtc
     3601 agctcctgtg caatgtcacc cgttttccgg gaaacaacgt gtctcaggtg cggctgagca
     3661 cgggcgacaa tgtcaccttt ctgtacaatg tgtcgcaggg ccactctctg tcgtggctgt
     3721 actcgaacct gaccgccaat agcagccgcc acctaagaaa gtacaccttg tgcagtgtta
     3781 cttctaacta cagaatgacc gagacccgca acaacatgtg cctgcactgt aaccgctcga
     3841 gcctgacgct atgctcggcg agaccccagg actcggggct gtatgtgtta cgcgatgaca
     3901 ccaataacac tgatgtgatg cgatgtaatg cgactgtgac cggcaacgga cagctgcctg
     3961 tcacgcacag accgcacagc aggcctacgg tgaccaggat cagcagcgcg cacttgtcgg
     4021 gtatcactct aggtaatcag aaacattccc ccaccacctg gaacacgtgg atggtccaca
     4081 tttcgttcgc caccatggcc ctggcgtgct ttggggtagc ggtggttttg tccggctgcg
     4141 tgtgcctacg gtccgtgcgc gcctggactc agaagtatcg gccgctgaat gaggaccctg
     4201 cgcctcagaa aatcgatttt ccggacggga cgatgaaaga acaccctcat gtgactgtta
     4261 tcgaacctac gaaaagtgca gatggcacgg ttgtgggttt atcggcggtg agcgatgata
     4321 aacccgccac actgtggctg tcgaggtaaa gatgcaaagt gaatgtgtgt atgtttccag
     4381 gaaatgactg ccgttttcca agaaataaag gcgatatgaa acgatgtcag tactcgctgg
     4441 cgtgttgtgt tttctatcat cagtcatgag aatcagaatg cgtatacatg ggagctaagt
     4501 gcgagacgtt tatttgagat atggtgagcc tgtctcagat tgtctacctg actgtaatag
     4561 cggctgatga tttagaaact gatctgttac cactgacttt tttgcttctt cgcaagtggt
     4621 tgctgacatt atgtaaacgt tgccgttctg ccacaatact aacgaaaaaa cgcggataca
     4681 aaaaacagta aacgattatt cggattgtca tggtaataac cattattgtc ctttatttat
     4741 tattagtgaa accctctaat tcaagtacaa acacacatac atatgcagta ccaatcggag
     4801 gtaatgtcac tttgtcagac tttaccaacg acataacaca ttatacatta ggtatatggt
     4861 actttacaag ttcttcagga atgtgccaaa tagatatcag tgataacgat aggcatcgca
     4921 aattgtgcaa tatctattat gcacggacag aatgtgaaac tctaacatta cggagcgcat
     4981 gcaaactagc gatacaacac tcatgtaata tgacaacatt gaccatttac aatgtaaaag
     5041 attatacacc taaagattat acattgaaaa agcgccataa aaattctacg gaaactacac
     5101 aatactatag gattcaactt gtattcccaa ccacacaaat accaaaaacc aatactgttg
     5161 tctacccccc cccccaccag agaacccagg tgctttaact tccgacaatt catcttatac
     5221 aacaaccatc gttgtgaccg gtgtactagc gatgcttttc gccatgattg tgttactgta
     5281 ttgttgccta aacaaatctc gagatcaaca tcaacattag tataatgcgc tgttctagct
     5341 atgtgttgta cagtattacc tttctgttcc gtgaaatgtg ttatacaaaa cacattatat
     5401 acaattactc aacggttgca ggcggtacag taacattttt tgatgtcact ggatacagtg
     5461 gatttactaa aggtacatgg tattttcaac ctgttaatga tagttgtttc aacacatttg
     5521 tgacaaatga tgcatttacg aaactgtgtg gcgtctacta ccaaataaat tacacagatc
     5581 tatctaccat aatagaatcc tgccaaacgt acttcaatca cacatgcaac ctcacgtctt
     5641 taagtctgca caacattacc ccacaggcac caactacata taagctagta aaaaacgctg
     5701 tcactcgcaa acaaaacatt acattttata atttgcagat tatatcaata gagaatgtac
     5761 tcccttctca agctaattat gcatcacgag gttcacttta taacacaccg ataattgcta
     5821 ctgtgatact gataattgtc attaccgtca tagtgtatat gcaatatcac cacaaagatc
     5881 atgaacgcat accatacact cattagctgc ctctgcttct tcatactgta tgcatatatt
     5941 acagaatcta caagggttgt aactttacaa tatgtttata atgtatctat tggcgaaaat
     6001 gttacattat ctaaacccga taacctatcc ttccaactac attcctggtt ctgtaacaac
     6061 agagctagtg catgtaataa tccaataatg aagttatgcg aagaaactgc gggtaataat
     6121 aaaccgaaca gttatactag atttcaaaat aactgccatc cgccgacatt tacgtgcaac
     6181 actacaggat tgtatctgta taatgtacaa gaaaccgatc caaccactta tacactaaca
     6241 caacgcgccg gtaacggcaa tataacagat agaaacacga cttacattat acattttatc
     6301 actagcacca cccccccccc cgttacaaaa ctacatatgc aatttatctt caaccagttg
     6361 cacaaacaca agcaactacc aactatagct acataactat cacattaact gttataacac
     6421 ttatactatt catgttagga gccggatatc taaagcatcg gagatcatta aagcattata
     6481 aacaaaatac acataaatgt acatcattag gtgaaagcag atatcccgaa agctccatat
     6541 aagatgctat acacaaatat gttaccagca atgcagtatg tttttccata tacaaacatt
     6601 aatatacatg ctacttagtt atgtaatttg ccaaaaggaa attaacatta ctgttgttag
     6661 tggaaacaat gtaacattag tgaaacccga caatgcttct tttcaactgg aacaatggtt
     6721 ttttcaatcc cgccttaacg atatttgtcc gaacacacaa ctatgtaacc agtttccgaa
     6781 agacattcgt acgtatgaac caaaaccacc atattgtatg ccactcacat ttatgtgcaa
     6841 tcgtacaggc ttatacttac aaaacgtgcg cacaactgtc ccggtgacat atttcttgat
     6901 acaacaaggc ggtttgtcag aattaccata taggaacata acatacaaca tacttttttc
     6961 caccaccccc cccccactta tcaagcataa caccttataa ttctcaacaa cattctgtat
     7021 ctctgacatc tatatctcaa ccgtatgcta acaaccacat ttacattgta atcgtgtttg
     7081 ttgtaacaat gttttgtata ggattaggat atctacatta tcgtaagcca ttacaaaagc
     7141 gttttcaacg attgtaaaca gtccgctata aaaaaccata catccccaat tttatcgtta
     7201 gatctctctg tagcgtcttt tgatgttatt aatctagctc cttatccaat tatatattga
     7261 aaaatgtcat caagtacaac aaatccaaca tcaccgagtg tgaactccgt acttcttggc
     7321 actgcaccag atgttgacgc aatctatata ctaattgtaa ttctagctat cctatcaatc
     7381 attctggaaa ttcaatgcat tattcatttt tattgctaca caagggcgtc tctgctactg
     7441 ttcaaagcac gtgcataaac aaaagcaaga aatgacatcc actttcccat aaaaaccaag
     7501 ctcagaaact ccacgcgatc acaagatgcc cgggacaagc atagtagttt tcatatccct
     7561 gggcgtcatc ggcggacttt ctctgataat ctttggatcc ttctgccttt ggaaactgta
     7621 cgacagaatg cttcaatact tttacaaata caaaagactg aaccccatgg aggctactgc
     7681 catagaacag tgacttttta aacattgttc gagctgcgac ataccaatat gctcgcaact
     7741 ctttttatct ttgtgtgttt gttcactgcg catctgttaa tgaattttgc atgtgaatgc
     7801 cttgacagat tttgcgagaa gttgcttgaa cgatatgaac agtacgaaag aattgtgtga
     7861 gtgacattgt attaccactg caatgtgaga cgccgtgagc gttataatgg aagcaaaagc
     7921 taccgaaaac aaccgttgaa agcatttatc gagtattgtg caatatcacc aaacgaacat
     7981 ggcgaacttc accatcgtca ttgtggtgtt ctgcttcatg ttcagtttgg tatttgggct
     8041 gctacttatc attttgagca ttatctgctg catctgctac cgattaaaaa gatgggccag
     8101 cgcagtcagt gccgccctcg ctgtgaagca gcaacaatcc cgtatgatta tcatttgata
     8161 cccatacgcg ttacgcacca atatccccca cccactaccg ctatatcaac acgctgttaa
     8221 agattgagtt tccagtatga gccatccgag aatcgcaatt ctcgggattc tcacaatggg
     8281 caacgaggtc gtgttcgctg ttatcgctgt ggtggcctcg tttgtcgccc ttatcatggg
     8341 cattctactg gatctcctgt acctgcatgc atatcagaaa ttttgcaact attactgctg
     8401 ctgccccttt cagagactgt cgatatacga tgcagaggtc ttggaagagc tcgaagtgta
     8461 aaaggctgac tatggaaaca accaacaaaa aagacacacg ggagttcgat tgttttgtga
     8521 tcataactca gcatgctctc tttttattac aaccccggga tcgacatgct gttgcaccga
     8581 gggtgaggag gatgaagaag aggaaggaga tggtggtgat gatgaggacg aagacgacga
     8641 gccgttgcgc gccttgagga gctccttatt gggaactcgg aacgcggcca acggacaccc
     8701 tttgacgttg ctacagacta gagactggat agttgcactc ttgacgatcc caaaccccac
     8761 gtctccgccg aaggtgctgg gtttccagta acccggggag cagatgacgt tcgccatgag
     8821 gcctttgagg gaaaacggag cccccagctc gagaatgctc tcaccgaaga tggcgttggg
     8881 acggggcttt tccaccaaga atccggtgta caactccaca gcctcgatgt ctccgtaaag
     8941 ggccctgagt tcggcagcga tttccttttc tcctgtttta ttaataaaaa taaaatgcca
     9001 cggacacata atcaacacat tttgcattca tattgtatgg acaaaaaaaa taaaaaagac
     9061 tgttgaaaat gtaatagctg tcacctgtaa gttcttcgaa cgactcgtag ggctttaaac
     9121 tgaaccgctt tcggtactgg ttgagggatt gaaacctcat ttcacggcca tgttctatgg
     9181 ccgcccggga gacccttctg agggcggggg gtacgttcct gccgccggag atctaggagg
     9241 ggagaagggt ggatagtgac agacgattaa tttgttacaa aaactacgtg gacagagatg
     9301 attgacagat ttaacggcgc acttactcgg ccagctattt gtttcgtgaa cgattctact
     9361 agctgggtaa tgccgtgggt catgagtatg gaattgttgt aaacgaagtt aatgtagtca
     9421 tactttgttt tatcaatctc aaacgcatcc ggcatgagag aatgccagtg atacaacatg
     9481 ttaaactcgg aaaatatacg attttggtac tggaacgaag taccaaagag cagttcgggc
     9541 ttaaacagca actgaaagtg gtagccgctg agctgctgaa catactgcgt cacgataatg
     9601 ttgattgttt ccccgataat gatgagtcga gtggtctgaa acagttgttc gtcactccat
     9661 tctggatgtt ctcgtttcag aacatcgcac actctgttgt gttccctgag ccagatagta
     9721 gcgtacatca tgagaccagg caccaggcca aaagcctctt gaccgacagc cagacgcata
     9781 ttttcgggca cttcgggagg atagatcatg tgcacctgga catctttgac cgagggggga
     9841 tacatttcac cgtcaataat ctgatactta tctttcgcgt ctctgaagag acgcaacttt
     9901 gactgttttt ctggcgtctc tccatagatg tggttgagat ccacctaggg atatagagac
     9961 gggaaccgtt agaacgagta tcatgacgtt gtgaagcaga tggataattt gacaggacac
    10021 acattgttct taccccatgt cccagtcctt tagtgaaggc cgggcctcgc gccaaatcag
    10081 tcctaaaaaa ctggtgcgtg aaatgttggc caaaaaaggc aaacattaag ttggtgccct
    10141 ggggatcggg agtgaaggtc ctccgaagaa gagttttttc cacaacgtgt gccgcatccg
    10201 gcagattttt tttacctggt gaacgagaac aattagccac cgtgccagcg atgacaacga
    10261 tcgcatggcg ggcacaccga ggaaagtcac ctttgacccc aagaggagtt ggacaatcgt
    10321 gaggaaccgg aggtagaatc cttgcgtaat aggagagatt ggagaaagct tcccagcttg
    10381 ggtattcgta gtccgcgttg tagatgggag ggctgtcaat caaatcggat ctacctgaac
    10441 aagcaaaagt ggcataaagc aaaaattaga atgactgaaa ggcaagggta gcgtaactca
    10501 tctaacccgt cgggataaca ttacttactg gtcagtatgt accgcattac cgcgtggcgg
    10561 aggaaaggaa tattgttgac cagccaccat atcgttgaga agtgagtcaa cgtgtaatac
    10621 acggtgtctg gatctggctt caggaaaagt ttaatgcgag tgaataactc ggctgtaaaa
    10681 agagaatgag gggaacgcca tgataacaat atctaaatgt gtaacctagt aataaacgtt
    10741 atcacattct acaatcttac gagtcgtgca gtcatggtcg tagaaacccg tgtgtgtgca
    10801 atcgcatttg taatgatgga accccacggt catgcagatg cctctttttg acacggatgg
    10861 gagcaacaag ggttggctac gatgcgaaga gagagaataa gagacaatca gtacgatgat
    10921 gtttttactc atagccagaa tgtagtgtct tttaatacgt accggcatga tttagaaaag
    10981 tacaataaga gataaaggag aataagagaa agattctgcg catactagca ccaccaccaa
    11041 ggacccagtc gtctacgact gaaggcacca atattcgtgg tattatatat cggcttcaat
    11101 aaaataaaac acgccaattg tttgttaata gctttatttt gtaaattgct tagtcaacat
    11161 tcattccgga aaaagaattg atataaacac ttgactccga gccacaagat gaggcgagat
    11221 aagcatgcat ttttacataa cattcattat tttgacgttc agtccctgtg gcgagagcgt
    11281 ttctcttctg atcaagaacc acactgtaac atgggatagt tctgtcattc tgaaagacgt
    11341 ggataacaat acaatgaata acttgggtga atgggcagcg tatcttgtca atacgacagt
    11401 gtgtcccaac acaaatgtga cattgtgtat gattaatccg catctcttac caaataagac
    11461 ggataaccga acaaacacta cacgcatatc acaatgctta aacatgacaa cgtttatttg
    11521 taacacaact ttacagatta cgaacattac aaacgaaacc catacagact acatgttgac
    11581 aagatatcgc aattgcacaa acggagacca tagcaatgag aacactgagc ccgagtatac
    11641 acagtttcat ttagaattca caatgacaac gttaccgccc acaactgttc ttctaacaac
    11701 aaccatggaa actactacca gtgaatacac tgcgacatca acaccattag ctttagaact
    11761 aagtgaaagc ttttacatgg cttcaatcgg tattcccgcc atgatatttg tgggaggagg
    11821 gttgcttttt ggactttgtt attatgccta catacaagga tggtgttcct gccgtacaag
    11881 aacgacgtcc tcagcgcaca cagaacgttt gctatcataa accgccgtac acggcggttt
    11941 ccagaccgca ataaccgctc tgtgctcgag aaatatggga ggagttagcg agcaaaagct
    12001 cattttgtgt accactgagc attagaagcg gatcacggaa cgccgttgtg ccttggcgtg
    12061 ctggacgatt gtcaagacgg tgaatgttac gaaaagcgga cagaaaaaca gtgccatgac
    12121 taagtatacg tgcttcagat cgatgtctgc ctgcggcatt tttatgctgc tgataaattt
    12181 ggcattagcg tgtgactccc aatgtgcctg taatagtagc tgtgggtttg catacaacgt
    12241 tacccacgta tccggctacg aacacagcaa cgtaacattg catacaagca tcagtcacag
    12301 taacatatcg catatgaatg tcggttactg gatacgttac aactatccgg taaattcgta
    12361 tacaatatgt accgtttcgg gcaacaatgt tgctagcacc aagcataatg gctgattttt
    12421 cgagtgcaac ggcaccagtc tgacgttgca caacttgaat gccgatcaca cgggaagcta
    12481 tctttttaag aatcttctag gactgatgga gcactatacc gtcaccgtgc tacctattcc
    12541 acagccgccg gcccctcagg tgactaccgt gaccaattgc tcacttacct ttttcagcga
    12601 acacctctgg cgaaacgcaa ctacgagaat aataaccaca acaacacaaa gtacctcaac
    12661 aactaccact agaaccacaa aacccacaac gacaacgcac cgaacgaccg ccggtcgagt
    12721 cagcaccccc acgcccgagg aaagttccac ctcgacaact accgaagaaa gtactactac
    12781 cacatggcca cccggacgac caaagtttat ttccaagtac tctaaactct cggtgtatgc
    12841 agcgtggacg gccgggctct tcggtacggc cctattcatc tttctcgtgg tgtttgtgtg
    12901 tgcgctcagg caccttaata acagacaagg cgccctctac cgaccgccac caggtcttcc
    12961 tgaaaaagac aaggaaaaga agaagacaaa aaccacgcgg tctggcgtgt accatctgct
    13021 cccttcggag aaaaaaaagt cctcaatcaa catcttgcgc tgtgaagtca atgttttcct
    13081 agagtagcta ctcggtccca cccggcattc gaacgtgcgc gcggatcgac aagctaccct
    13141 gagaagccat tgcgagtttt tagacgacga gccacataat aatccagacc aacataatcc
    13201 agatgacaat ccccagcagt acacgcagaa aaacgatcgc gtcccaaacg gtaacggtgc
    13261 caagtggagg cggcggtgtc gtgggaatga cgagcgaaac ggcgtccatc gtaccgcgat
    13321 tgtttcactg aaaaaaaaat gaaaagtgaa actcagcgtt cgcggtgcaa atacggtcat
    13381 tatatctgtc acaaataacg gaaacattcg gaccgaagac aatggcaaca tggattcaat
    13441 gttgtatctc agaagcataa aaccgacttc aggtaaaaaa ctcacacaag ctcgtgcaaa
    13501 acgttgctag aagcacagac cgctatgaag aagcacgttt ccaggcttat gtgctcctat
    13561 ttcgtcatgt tttggccgat tctggcaacg gacaactcga caaatagttc atcgagtgtt
    13621 aatatgacga ctgaattaac tacgctctca acaacaccca gatcgacaaa tagttcatat
    13681 atcaacagca caacatggac aacgacgtat ggatcggcaa gtacttcgca agggaacact
    13741 acgaccccta tgtcaaggac ggttacgagc atctcatata cgtcacaaaa tgcatcttgt
    13801 acttcagatg taactctaac atcatataca aatacgttat caaatgaatc aacgaatgta
    13861 tcaagaaata attcgtatac aacaacaaca acctcttgga caagtacgcc agaaatgaac
    13921 ataaccacac cgcccccatg gccttttgaa atgcatggtc attatttcac actatgggtg
    13981 aataattgtt attgtggata tctgaaggtc ctccctggaa gcaatataac cttcaatgga
    14041 acaaaaaaga atgacaccga ctccatatgg tttttagcaa gatattttaa ttattggctt
    14101 tgcatcttta ctgctgatgc aaattataca atggattata tcaatttaac acatacatgt
    14161 acgtcagaaa ctatgacttt atggaacgta ttggaaggca attcgggaat ctatttccaa
    14221 cgaagaacgg ataatcagaa atatgattct acatatatct gttatatcct aaatgtcaca
    14281 gcagatgctg ctaacaccac gtatcctgaa ataactacca ctaaatgtca ccggccacca
    14341 tggagaaatc gtcccgattt cgcaagcatt gaagctcatc caattacccc cgactatgaa
    14401 gaactaagta ttcaagatat tttggaatcg ttaagtctta agggcggtct aaaaggttcc
    14461 ttgcttaaat ttgtacttag attcggatgg ttatgcggca ttgtagttgg cgtaacggtt
    14521 acgctcatta taattttgaa actccctcaa aaactgtgct tcttatccag ttatgtacca
    14581 caacgtcgag gttacaaaag actgtcatct aatcagattc tttaattgta ttacatcaaa
    14641 tgtctgcaag tgtatatatt gcaatattca ataaatggac tctttggatc aaacgcagct
    14701 gcaaccatgc agatctcaaa gttggtttat gcatccatag ctgtattctg ggctactgca
    14761 tttatacacg gacagacgag cgattcgtct tacaaagcaa caacgactct atgggcaaat
    14821 aggaacagca catcgcaatc aagcacaatg caactaacga ccgaaccgac ggcaagtgga
    14881 tatcgcaata gttcacatcg aaacggcaca acggcaccac catggacaac tattgcagat
    14941 gacaacacaa ccaccttacc tccctggccc atcgaaatac agagcacata cttttcgcta
    15001 tgggttaacg gctgttattg tggatcttta agcgctcttc caggagccaa cgtgacactg
    15061 aatagtacta agaagcagaa taacaccgag acactatggt ttcgattagg aatgtttacc
    15121 aatttactct gcatcttcta ctttgacaac gataatgact caataaaata cgaccatttg
    15181 acatttacat gcacacaaaa caacatcata ctgtggaacg tttcggaaaa atattccgga
    15241 atttactgtg aacgccaaat gtcgttaacc acatataatt ctacatacat ctgttacaat
    15301 ctaacggtga ctgcagacgc taccaatgca acggatcctt caatagtcac gacgaaatgc
    15361 taccgcagca gagaacaata ctattcagtg gaaacttcaa ctacgagtga tagcgctctc
    15421 aacattgacg atattctgaa ctcacgaagg aactttcggg acaatggtca gagaaatctg
    15481 cttggatctg tacttcagtt tggatggttg ggtgtgattg taatcggatc aacaattacc
    15541 ctcgctctag tgtttcgtgt gccacaaaaa ttctgttatt tgttctatga atggaaacat
    15601 aggtatcgtg gctacgaaaa gatatctggt caaattttgt aaacattgac acacagaata
    15661 aactgtacat gtattttcaa taaacattgt attataatta tgaaaatact aattatgctt
    15721 atatttgtaa tatgcgactc acaaaccatt cacttgccta catgtagttt gaaaacatgt
    15781 tgtataggtg atgatgtttc tttaaactcc aatataccaa ctggatgtaa cagaacgacg
    15841 tggtatcgac ataaaaacaa tagtggcata atgttatgta gcttttcggg agggggtatg
    15901 acgtccagtt ctaaagaacg cattaacaga acttgttcac gtcaatcttt tatttttatc
    15961 aacattcaaa tgccatcaac aggaacatac tacgtcgtcg gaaataattg cactacatcg
    16021 ccacttatgt ctacgtgtta caatgtgaca gttgaaccca ggtctaccac tgctatgact
    16081 gttgccgtga acccgagcat aaatataact gctcaattac cacaacgtct tgcgagtcac
    16141 ttcaacgcaa ctagttttga aaatgagact gtaacggtcc acggtgcttg gggacttgtc
    16201 attgtcgcgt tacttttcct gtgggtggct attgagttcc gtttacataa aaaatgtttt
    16261 gcttatttca gaaactatgt aaccacattt taattactat acaatgcaac aatattgtga
    16321 ataaatatgt ataatttcaa tacggcaatg atagtatgta cactgattca caaaacatta
    16381 tcaacatata tcaggtgcaa taatgatttt ggaatttcaa acacttgtac tcaatataat
    16441 gaaacagcca ctgttggaca aaatgttaca ttaggtatat gtatcgaaaa gtataatccc
    16501 gtatcgtggc ataaaaaaac aaacaataaa gcaattatta tgtgtcaata ttcagattcg
    16561 acaaactgta atccacatca cgacatatgt tatcattgct tatccaatta ttctttatta
    16621 cttattgatg ttcaaacaaa ttacaatggt atgtactact tatcgtatct aaaagacaat
    16681 aagtacacag atctgtgcta caatctatca attaatacgc caacattcaa cgtctcacat
    16741 acacagatta atcgtacaac cgtggaatgt atattcaaat caaatataaa taatgtaaag
    16801 aataaaaatg cacacactac tgtaaacgat gcacgaacaa cgaatatcgc gtcgtataca
    16861 aatgatctac caaatatgca acatgcttgg ttattgttac cattcgcaat aaccattaca
    16921 attgtattat tctgggtcta tatgcctaaa aaataccaat ctcgactaaa tactcataga
    16981 gaatatacaa gactacagta ttgatgtttt taatttccgt aagatgatat aaagctgcac
    17041 gtaccacaaa aatgctttat ttcagaacac attacttata tttcataaat atacatatga
    17101 atataaacaa atgtatatta caagcatatc agttgttaca tacgtattca ttcaaataac
    17161 cataaattat aaaacaaaag agacatgttc cgaatatagt atagcactta atagtcacag
    17221 aaaacattgt aacacaacat tatcgtatac aggacaaaat gttaccctgg gtgtacatat
    17281 aggaccatgg actcccgcat tttggaacct acaaataaac aacacagaaa tatcattgtg
    17341 tgaatataca catactgtac tgaaatgtaa tttacataca atatgttacc aatgtttatc
    17401 caattattct ctactactta tcaatgttac aaaacaatat agcggaatat attggttatc
    17461 atacgacatc aataatggta attacaaata tactgaaatg actttgtgtt ataatttaac
    17521 tgttcactca cgaaacgcga catctaacaa actactaaca acgtcagcaa cacatacaac
    17581 gattacacct tatgtaacta ccaatttaca gcataatgaa tccatagtaa atgacacatt
    17641 tcaaacatat tacacagcaa acaatcatac accttggcta gccttaccaa tattaattgt
    17701 tgttctaatt gtactatgct ggttcaatat gcctcaacga tacaaatatc aaccatatac
    17761 atgggcgtca tgtttttaca gagtatgtac tcagacacat tgtcttcaaa aaaaataact
    17821 tgcataccag ttaacagtac cgcaggacgc aacgtaactc tcaatccacc accattcaat
    17881 catcatacta cgtatgttta ctggtatcga caactcggca agggaaagaa cgaattatgc
    17941 cgatacgttc cgaacaaaca agagaggaac gccagaataa agtttcaatg tcttagcaat
    18001 tacagtttac tactgattaa cgtaacgaca tcatacaatg gtaactatac agtaaatcta
    18061 gatttaggac taggaacaac gtccactacc tgttatacac taacagtaaa gacagctacg
    18121 caaattgtaa agactacaac cagaaagcca actacaactc gaaaaacaac taccacgatg
    18181 tcgataacca gcacaaccac cgcgacaacc actacacaaa ccacatgcag cactaaaagt
    18241 cctaatacta atgtacattc agattctgat cctgatatgg tagcgctaaa tgaaacacgc
    18301 gaactgcaga ttcgtgaaca caccaatata catgcgatat ggctgttatt acctgtacta
    18361 atagtaatta tttgtttttt cactgcaaac tcaaaaacta ccgaactgta acactgtttt
    18421 aacagagatg ataatgcaca tcaatgcact aacaatgaac aaaaaagggt cttttgtatg
    18481 gattatgtgg cacattccgc aggtttatat atgttatgtg acaaatacta aatatgaaat
    18541 taatacaaat ggtacgaata ccagcttaga taccccgaca tctgaagcaa ttacagcatc
    18601 caaagcgtat atggcagtac caaatgcaca tactgcacat gccgattcta acccgagtgg
    18661 atatcatgta aaaggacaaa acgacgacga ttacgcaaac acaacgacaa tcatcatatt
    18721 agtaatattg tttattgtaa tcattttact attttttaga attccacaac gatgttggga
    18781 agggtaccaa aaaacaaggg ttaattcacc gtattgaaat cattctatgt atgactaagt
    18841 aacgttgaaa acactgtttg aacgttgaaa atggaggtag gtcagcctgt caatcatgat
    18901 cccaatactg agagaatgtg gctggttcgg atacattggc ataacgtgtc tacttgtggt
    18961 aactcaactt atcgacacat taggtaacaa atgctcaaaa acagaaacaa gaactggaac
    19021 cgtaggtact aacatcactc tcgttactaa ttcaccccct aacaacaaag gattactgta
    19081 ctggtacaaa cccaattgta ccagcaatga tagattgtgc gactactcag ggtttactgg
    19141 taccaatgct gtgtcaaaca gaacgaagtt gaaatttact tgcatgaata attcaacgaa
    19201 actaactctc attaacgtta cggctcacta ttctggtcaa tattgtagta gaaccattac
    19261 atcgaatgga agcgtcgata tctgctttaa tgtaactata catctgcata taaccccagc
    19321 tccatctcct ctacctgttc cttttcaaac aataccagga tggaatcacc gcaccaccgt
    19381 ccttcaggta caaatacctt caagtggcca gccaggtagt tatgaaagtc agcaacaaga
    19441 cgcggcacac attgctagta ttttgatatt acttctacta tttatcgcca tcataatctt
    19501 gttttttttg aagatccctc aaaaactatg ggacaaatac cacaaaagta aacatgcacc
    19561 atctgcctaa caaaacacat ttcgcacata taatgtggaa aacacttcta acattaatat
    19621 ctttaatata tgttaatctg gcagccgaat gtaaatcaac cacccattat agagaaaaag
    19681 aagatgattg tgctttattt aaagtaaaac taccagattc gggactttcc cactattggt
    19741 atcgcccaaa ctgtacgacc cgagacatgt tgtgttacaa aacagctact ggacaaggtg
    19801 atcttaaagc acacaatcca gatttaccgt ttacatgtct cgacaatcat actgaactgc
    19861 tatggtgtaa tatatggcga aatcattccg gaatatactg ccatagtgtt tttacatcaa
    19921 caaacaatgg aataaataga gttgatacat gttttaactt aacagttgtt cccaaaataa
    19981 ccacaacaaa aaaagcaacc acaacaaaga cgacaaccac aactacgcta gcatcaaaat
    20041 tgaagactcg cagcacacca gtgataaaaa acccacatat agatggtaca cccccaccgt
    20101 cacatgaaaa accatcactt aaaaaaccat cattaaaaga tacattgcaa gcacatacaa
    20161 ccctaactac tttactacaa tcatatccac ccttaactac cacaccaggt tacgaagtag
    20221 tgcagcatac tccagaaaaa caggtacaaa atgtcacaca cctcgcaact attgtggtcc
    20281 tcatagttgt gtttgttggc atagtcactc ttttcatatt caaaattcca caaaaactat
    20341 ggggaaagta tcgtaaagct aaaacacatg cacatttttt ggaacgggac tatgattact
    20401 agaatatagg aaagtccaat agcaagcgta cacgaaacga ttatctatca cgtaatcgtt
    20461 tctcttcgtt actaatatca cctgtaccag ccgtgtaatg aatagtacag gtgaagttta
    20521 aagcgcacca taaattacaa attccaatga ctctcacatg gacacgtctt atattattat
    20581 cgaatcaatt acagatgatt tggactttag aatgtacgat aactaaagtt gtcacaacac
    20641 aatctggtgc taatgtgcga cttggagact catcgcgcca aggaaacatt gtttggcaca
    20701 ggccaccatg tggtaacgaa caagacgtgt tatgtaacaa aacatcaaga agcgaggaaa
    20761 tgttttttat taacagatct atttcattta tgtgcgaaca gaagtccaac atgttgaatc
    20821 tacgtagatt aacgcccggt aattcagggc aatactgtaa gacaatatcc actacaagga
    20881 atggtaaaaa agagagttat cgagaatgct ataatttaac ggtcatatct accaccaaat
    20941 caacaccaac aattatgaca acacaacagg aaacatcctc acatagaaca tcaaatgtaa
    21001 caacaccttc aagatttcta ggaagaaccg tcaataacaa acgagataga tacgatgatc
    21061 tcgcacctgc attggaactt gtaggctttc tattttttat cactattgtt gtattatttt
    21121 gcttgcgaac agagctattc gagggtatgt aacatgacaa tatacataca aaaataccta
    21181 attcaatgga tcatagccat atcattagtt catacgcgca ttcaaattgc acatccatgt
    21241 aaaattacat ctctcattaa tgtaacagct tacgaaactg tagttttgaa cgccactcta
    21301 gcactggaca aatgcttcat aatgtggtac aaaagcccaa cagaaggaat gtgccaatac
    21361 aatgcatcac atgcgatgaa agcaagtagc tacaatggta aactaaatta cacctgtaca
    21421 ttttatacat taaccatact caatgcaaac tcatcggcca cagggatgta ttatacgctt
    21481 ggtgcaccta acgatgaatg tgttcgagaa aaaatatgtt ataaagtaca ggtacagttt
    21541 acagtacaac atgaagcacc tattgccaca caaattagcc cattaatcca gaatgaaccc
    21601 tcaatgtctg aatccaccat aatatggtat gtatttttag cttcggggct actcataatc
    21661 atgttttatc tagctaaaaa tgctcattca tactggaaac atggacatta ccacgtgccc
    21721 caaatatggt ggatacaggt ggaggaacct cagctatacc gttccatggt ttcctagagc
    21781 tttccagttg actgtttgac tacatcggtt tttaaaccga agaaaacatg gagaaaactg
    21841 accaccaata attatgttta cacggcgtta ccgtaccaca cacaactttt ggcaacttgt
    21901 gtttatctca atcctggcat ttattataca cttacattat tcgacatctc caagtatacc
    21961 tgttaatgta aggacgggag acaatattac tttaaatgcc accttaaacc taacaaatgg
    22021 tattggatac tggtatcata acgacagtat actttgtgga tgtactccca acaacgcgga
    22081 atccgcttca cgtccactgt tgaaatttat atgtcatcgg aattgcacaa tcactcttct
    22141 gaacgtgagc agccacagtg ctggagacta ctgcctaatg gctaaaccca aaaacgacaa
    22201 accaaaagat agcttatgtt acaacgtaac tgtgttacca actaatcatc atttaagtaa
    22261 aactacccaa cattcagtaa ccacaaccat tactactaac ccaacagccg ttacggtaac
    22321 cgtaccaact accacgataa cgcccgtgtt aactacaacg acagtgcaaa ttacaccact
    22381 cgccaccaat gcaaccacta tgttaccaac gacaaatagc acatttccat caactagtat
    22441 gacaactaat aacgaaacaa ctgtaccaca cataaccact aaagcaaaac ggactaagaa
    22501 aactagaaaa aagaaactcg gttctactaa agcccctacg actgcactac attcaagtaa
    22561 tcctttgcta acgacagtaa ccactactgc tgctaccaca gtaccgttga ctagttcaac
    22621 tactgtaact actactgctc ataccgcatt aactactgtg actactacac gtaacgcatt
    22681 aagcactggc atagtgcaat taactactgt gactactacc gctcagactg catcgcccga
    22741 cagtaaaacg cgttccaata tccaaaatgc tgtaactact agtgtatata ctactgaagg
    22801 gaacactact gccctaacaa ataccaaacc cgcaactacc ttacccacga caacttattc
    22861 tacggtacct cccacaacag tagctaccgc atctacgctt tccacaacac tacccaccac
    22921 taggtggtac accacgtcaa ctagtacctc cacaaaacag cgaaacacac agacctcctc
    22981 ctaccaaaca accacgcctc tcctgaactc tcctacagca accacaatta gtcaaaacga
    23041 aacaaagtct ccacacgtta aacaccataa cgctcatcat caccatgccg tcacacacgc
    23101 tttttgggtt attctgttaa ttgtagttat agtaattata attttgtggt ggaataagat
    23161 tccgcaaaga ctatttcagc actatcagga acaaaagtat ggcggcgtag cgttgagcga
    23221 tgattggcag ttctactaaa tgaccttgaa accaggaact ctaggaaact cgtcaactac
    23281 atattgtcac tccgttaaag aaaccgttct aaaatcaccg tctccacccc gtccaggggc
    23341 cgcctccaag ggcgatggcc aggcacagat gccataaatg ctggctcctg tggctgacgg
    23401 tgattctggg aagctggata cacttgctca atgctctgga aattgtagag gaatacgtgg
    23461 aagaacagga gatcatcatg caaacaacga gacagatggc gttaagattg gcagctgctc
    23521 ctgttcgtgg acgacgatcg gagattgacg gcagaccgcc atccatcccg tcatggctag
    23581 atgttcggtc tccaagaccc ccaagacgcc acgatgaaaa caccatgcaa cgtaacattc
    23641 gctggcaaca tgaacagatg caagttttga tgagcttgca ccactcccgg atgcaagctc
    23701 gaggctggaa tcctgatcaa cgtactccag ccagacttcc agctcatttt ggacgctctg
    23761 cttcgggttc tcagcctgtt ccaaatcaca gaattggtat atcgacaaga ccaacaccga
    23821 tggcagaaga agccgaggaa cctagagtaa caattgtccg aaacagacgt ccagacaatt
    23881 cgagtcccgg accgcgtctt ccacacaaaa gacgcaatgc tatcactctt acaggctcca
    23941 cagattccct ggatctcaca agactgcgcc ttagctacga aaggcgtcac cgcaaaggat
    24001 actgtcgttg gaaacatcat ggaaaacatt cacccacaag aaaggcatac ataccaccgt
    24061 ccagaccaac aatttcaaat cccatggaat tccgaccagc accatcacct gttccacaaa
    24121 gacgcaccct gaatgaccgc ttaaacgact tgcttcgcag acacagcgcc catgagaaca
    24181 tcaggcacaa atggcatgtg cgacctaaac ctgaccccgt ctggatctat aatgacgatg
    24241 aatctgaagt cacatctatc ggagaacgag caagccttct cacaagaacc cgttcatgga
    24301 tccagagccg tatgcaccgc acacacactt ggcgtcttgg aagctcaggg ggcggcaatg
    24361 aacctttggt gaggtcacta tcgacagagc agccacgcaa caacaacgcc aatcaatcaa
    24421 gaccgcattc accatcagaa tccgtgcaag tgaatctcga gaccggagaa gttgtggtta
    24481 catgtcacaa cacgggagcg aatgaacaac atgtgttgac atccaatcaa ctatgcaaca
    24541 gaaactccat ggaagtgacc gatgcatgca acagagaaac tccacgtcga gcactgctgg
    24601 gttccagcat agctctctgg ctctccgggg tgtggatgcg gaactaccgt aagtcgtcct
    24661 aagatcacct tgacattgca tgctcgagag gtgagtgaat cggtgaaggt gggagagggt
    24721 ctcgcatttt tttatctctc tctataacct agtgatccgc accacccagg tgatcgtgct
    24781 aaggacatag ctgccagtaa actctgcata ttagctcatt gggtcccgcc ccagcaccac
    24841 cctaaccttt tggaatagaa tatatatcca acattcaaaa cactaagatt tcaccgaaca
    24901 tagattattt tgtccaccaa ctgcactcaa atacaaccag tatgtacttc attattgtat
    24961 tgctgatcac tatactaact attgattgcg tcccccctgc ctactgggac caattcctgc
    25021 atccatcaat ggacaatggc gaagtatcgg ctcccctgat gccaccgtat ggtgatcgct
    25081 tcaacctaac atgtgacttt ccaaccggtg attggagcga agcggcgttg cagattcgtt
    25141 tttgctatca ccccagctgc cgcagctttc tcatggtaac acccaaggac attaacgggg
    25201 agtttaaaaa caaaagcgac aatcatctgc cggagttgca gtggaaatta gagaccgtcg
    25261 gccccgtaca gagactgact gtgtcatttc tagttgtcag cagtgtatct ggcatttaca
    25321 ggtgtaccat tctaactgga ataaacatag aggtgttgaa gaccgtgatc atcatcgcag
    25381 atgtggagct acgccgacga cctgacacgt actgcgatat caggttcagc catctgtccc
    25441 agttgcaata cctatggacc cccaaccctg ataaggtgag gctgctaaac tgtggagagg
    25501 ttcgcgaaag gaacagtcta tggcaaaaac atgtacatta cgcggtaggt atgtctggct
    25561 tggagccatc ttgtacagtg aacagagata tggtgttgtg tcatcggtat gtggctgaga
    25621 gtctgagaga caataactgc acgagggctg ccgaagagaa acgcgcaatg attctacgcg
    25681 gtaagccgct cgaggaggac tggttttgga tgtgtatggc aggcatgttc accatatgta
    25741 tcgtgggcat cctgacactg tgtttgagac tccggtacaa gaggcatctt gactggagtc
    25801 acgatctgga gagacggagg ttgaaaaaga gaaactgagg agttggcatt ttttttaagt
    25861 tgtgggtatt ggaaagcgaa taaatgaggt agctagaaaa agccatgcgt tgtacaagct
    25921 agtgattttt ttaatgctat gtaaatcatg gtgtcaaagg tgacgggata ttgattataa
    25981 tgtgaaagtg tgaatctaac ctgatcgggg acatggaagg tgggaggggg aagtatgtgt
    26041 tgattatttc ctaaataaaa catttatact gttaaagaaa ctccatgcat gtttgtcgtt
    26101 attttttata ttatgaaaaa gctatcccca cacgatcatg atcctacata aaccttccca
    26161 agacaatttc tcctgggtac acaaatggaa taatatgtca aacgcaggta ataatatcta
    26221 tccgcacatt gacaatctgt catccgagga gcgcataaac ttggtccaag cgccactacc
    26281 gccatgggcg accgaaaacg acagtctcca ggaacgcatc agcatattta tactgtgcgt
    26341 tgccgtggtg ctgttttttt gttttcgaat ccctcagaga atgtggtggt tctttcgttc
    26401 cagacccgtt cgtcattccg ggaactgcta atccctattc cgcgaaacga gtttgcgtaa
    26461 gggatagtgt ttcagaatga gagcgaggcg tgcctgccat ctgatttccc agaaatgccg
    26521 tctccgcgcg agcgcatggc gactatactg accgccatag ggataatgtt aatctttcta
    26581 ttgtggggca tgcgaatccc ccacaccatt ttccggcagt ggaaacgtga tccgggggac
    26641 taccgaatca gcgaccgcca ggaacttggc gattacagcg tgatgcaatc tgatttccga
    26701 agcacgctat aaaaatatta agttccgtaa cctggccgtg attcaagccg ctgcagcctg
    26761 atcaccaaac ggggaaaatg gagcacgctc tgttcgatca cttcttcgga cgcccccgcg
    26821 taagtggctc caggcactcc ctgctgagag ccgagaacga gtgtgatgat gaagaatacc
    26881 ccccgatccc gcgggtaccg caagtgccgc cacgagtatc gcagacgacc cgagcagcct
    26941 ggaacatcgt agacgtctgc cgcctccttc cattgcagat gagattgatg gtagccgaag
    27001 aagaggagaa gatgacgctc acaacatctc caagaacaca taaaaagaaa ccccgaaaat
    27061 tagtcgagat cagtcccaga atacggcgtt tatttactta aatcaaagaa tgattgacag
    27121 gtgaagaagc ggagcgcctt tctgagttta tacaataaat ccgcctgatt caatcatgtt
    27181 ggcattcgtg tgttttattt gggtgtgatt ctagtgtctg aatcagaaaa tgagtgtgat
    27241 tgtaatcgta aatatgcaat cagcacgctc acgctatccg gcggccactc ctacctggtc
    27301 tgatataaat gtaacgtaaa tttcataatc gcctcatatc accgtgcaac gttcatacgg
    27361 cattatcaaa ttaattacta acagaagagt tgcgccacca tcaggtggtt ttgggaatct
    27421 acaggcatca tgtcccagct gctatacgaa tgttttaaac gacagctgcc taggaaacca
    27481 acaaacagtg tggttttcct aaaccgcaga gcactgaccg gcaaaacaga aaatatgacg
    27541 tctatggcaa ccagcacaca ccgaacactg ctagttgtgg atcatggtaa actgaggcta
    27601 gaaagaccca gcacctcgga gaccacccag acggccttgg cattgtcgtt gcagcgattt
    27661 gcactccagt catctgggga tgatccggaa catgacgata tggaccataa tgactgatta
    27721 cggaatgcaa acggcaatgc gatgtgcctt gtcactcatg tgcgtcaatg gacatttcga
    27781 aataccagag acaatgacct ttaaaaacaa aacaccgtca agaagatgca ctgcatcaac
    27841 atgccgctga ggaccttggc cagctgcctt gtgttcctca cgctgttcgt gtacctgcac
    27901 agtgattatg tgtacgtatc tgtgttgacc cgctcgcatg gactaacatg gaccagtatc
    27961 ggcggcgtta acgatacaga gattagcaac ttatccaatt acagcttcaa tcaagataat
    28021 gctacaaaca ccaataattc atccaacgga aatggcagcg tgtcgcaact gtctgacgga
    28081 tgtctcacgc gaactgaaac atacgtgtca acgatctgga tattcaactg cactaaagat
    28141 acatcagtga cggacttttg gtatctagga aatggataca atcaaagcga tgacacatgt
    28201 aaatcatctt tagctacata cttgagcagc atgtgtaaca tttgggctaa ttacagcaat
    28261 ggcaacgaat ctcgtcaaga tcacctgaac atatctgaag tgcggtgcgt tattcctgaa
    28321 acatactccg ttaacaccac tatccaacaa tacaacgata cagaattgga aaatcaagat
    28381 cagcaatatc accagctatt ccctcttcga catacatgca gcttggtgga ggcgctggcc
    28441 tttgacatcg tcgagagata cgtgtacatc tcaagattat gttggaacat tgcccagata
    28501 ctcgcactgc tatgtattgt aactgtcagt cttgtggttt ggatacggtt ccagtattgc
    28561 ggtaaaatcc cttgtatgtg cctgctacct cccaacgttt cagccgttcc tacgtgtcaa
    28621 gacgtcatcg tggagaatgt caatcaaacc gaagaagaca acacatctct aaacagcccc
    28681 gtggaaccag agtcttcaga aatcactccc attctatctg cttctgaaaa accctgcgtg
    28741 cagaaaccat ctgtaccacc aaaaccacca accgtatctt ctcagttcaa agtgatgcat
    28801 gctctcaata aaccatgcat gttgccaaaa ccaccaccaa agcctgcatc gctccagtct
    28861 ccaaaaccag acgtgtttac gtttgacgag caggacattc aaaggcacaa agaagaaata
    28921 tccaaacagg ttaaaccaat gcgtattcct gttttggcac atcaaacatc aacactaacc
    28981 aggactacac atgcttcaag attgccaccg cctcctcggc aagcaacatt ttcaccacga
    29041 gcacctacaa tgattccgtg ggacagaaag agtcaaatgt caccagtaca gtattcctca
    29101 tggagacagc aatctgaatc gctgcctgca gaattggacc catggaatgt aaacccgcac
    29161 aggtggttgt gacctgacat gatcggaacc gcaaaagact gacagtacaa tatattgcaa
    29221 gatagatatg gtgtataatt gtgtaaataa agtttatatt ttataatata caaattaagc
    29281 gtgtgcttct tcattattgg cgttcggcaa acgaaacacg aatcggggtc tgggattgcg
    29341 attctcgact tgggctcgaa tctcttccat gacgaggatc ataggctccc ccataagtgg
    29401 caggtcatca tctaaatcca taggaatttc caccacctca gccacctcgg gaatctgtag
    29461 cggttggatc tggatctgct gtcgctgcag atagttttga aacagccgtc tgcgggcccg
    29521 gggagcgtac atgccgagcg gacgatgagc gggttgattg actcgcataa aagatactcg
    29581 tatagagggc ataagccctc gtatagcctc cgtgaggagc ggatcggtac tgcctcccat
    29641 gatacgccag catggcagcc ctcagaaacc aacgttccta aatactactc taggtctgac
    29701 gtcagggtgg aacatcgcca atttaacctg caaaaccgta cctatacaaa gttacgcccc
    29761 gtcattggtc ccttgacaca aggtatttaa tgggacgaga gccaggaacc gcctcatttg
    29821 acttcagtcc aacagcagca tcatgcagaa catgaagcta atcgcgattc tgctggcgat
    29881 cggtctggtg gcagtgcatg ccctccccag gtgagttact gaaccgtaac acggacaggc
    29941 attccagagt acagacatgg tttttcgtgt actatacaag tgacgttttg tcgttttaca
    30001 ggtataccac acaagataaa gatggagtaa cgggaacaga tgtaggaaat ccagacggga
    30061 cccagggaaa tgacgactct ggcgtatcta aagttcccat aacgcttgag ggtgacgacc
    30121 tcccatcggg ggacgatagt acggaagaag gcagtggaga tgaaatccct gcatacgatg
    30181 tattcattga aggcgaaatg aatgatggag aaaactctga agaatctgac gaaggttcta
    30241 cagaagacta accgcagtgc tgccagttcc cccctttttt tatgacaacc acctaataaa
    30301 acgtctatcg taatgcctgt gtatgcgtcg tcatgtcctt tcatgcgccg gctctctaca
    30361 aatatgaacc gaacaagcat ttaccgtgat tgcaaacaac tatgcctggt tcagcactga
    30421 gcagagctag atcagtgcta gctattatcg caattataat gttagcaata tgcaatcttt
    30481 acaggtgagt aagactgctc tagaatacaa cctgttattg aaaaagcaac gctcatactt
    30541 tactgttctc tattgtgtag ctacggattt ccagttactc gtcccgaccc gccaaatgag
    30601 aggagcccgg aagacattga tgagccacaa atggaatgat tataaaaaat aaatctttat
    30661 tgattacaag tgtgtaccgg ttttgattta ttgcataaaa agatgggtag atagaaatct
    30721 gagaacaagc ttatgtggca aaatgggtgg agctgcagct gatgcgctgg gaacgacgac
    30781 aaatgctctt tcgctcatag atatgcgttt taccataagg gcagaccaaa tttccactga
    30841 gcttgcgcat cttcttatcg ccatagaaca cggtactcca gcggtatcga acaagcccgc
    30901 gcatggcaaa ctccatgacc gtgtcagcca ccacgcacac gccattctct gtggtagcgt
    30961 acatgcgcag gtacgaatcc gcaaagatgc tgattaacct gtccgcgatc gctatgcgac
    31021 ccacgggctc tactttggta gtacccacta tgcgtcgcca gtagtacaga tccagtcgac
    31081 tgaaactggt aggtagagac acacacaaca tgttcccgtc acccagtctc atcaaactgc
    31141 tagcgtgcgc attacgccac tcgcagaggt cattgaggtt ctcacagatg accaaccgtc
    31201 gcgtctcttt cttcctcagc acattggcat taggcacgac catgaagctg catcttctga
    31261 gtccgtgcac cagaaagtcg tctatgtcat cggcgatcca cgtgagagca tcggagtaca
    31321 ccacatccac atagaggtag acgttacccg actgtccgac atacaattcg gaaggcggag
    31381 tgccttcacg atgcttcaaa aaagccttgg tgcagatgct gccgacaaag tgtagttttt
    31441 ccggacagca gagatactgt gacagacgct cttcctcctt ttcagcattt cgaaccgagc
    31501 gccaacgacg cagaactacc agaacacgat ctttaggcca aggcaggtgt atgcgttggc
    31561 ccgatttcca tttgcttctg ttgacgccgc ttcctctgca gcacgtaccc caagtgtacc
    31621 agcaaaacat tgtgccgagc cccacagagg gaaaggagcc agctggcata gttgctttat
    31681 acaagcacgt cagacgtgtc ccattgtgca accagctgac gtatgtcagt catcgttgtg
    31741 ctggcggcct ctgggacact cgggcacagt gtcgtgtaat tcacaatctc cagtgaatcg
    31801 ccgattattc aacagttgcc gtagccccaa acacatgaag gcggtcaaat cgtcggcaag
    31861 acgaatgtag cggagattaa cgaggtcgag gcagaacacg cggccgccat ccaccaggac
    31921 aatgggaact ctggtcacgg gccatctcac atagcatgga gacgagggca tttcaccttt
    31981 cagatccacg gtgcccaaac agatgacctg gtcaccaaaa tggctccgaa gcgagcgcag
    32041 cataaacccg ctggttgagg tcacttcaaa acacttgaga ttgcacagtc tcagacaggc
    32101 cccctcagga taaggcagct gaaggtagtt accgtgattc cgcgttacat aacgcgacac
    32161 ggcctcaggg ccagatttcc aagcatttct aatacgccta aaagagcgct tgagggcgga
    32221 tgagcgtatg tggcgaggac agtaaagaac atccacggcc cggagaccca cccgctgaag
    32281 ctccgagagg ttcttggcta catagtacag cgagaaatct tcttctacat aacagaaaac
    32341 ctgtccctct tctgatacta gaatgatgag ggtggtcttc cgctgtccgt gcaccagcac
    32401 aggttctcca acgacacgcc ccaggaacgc cagacgcgtc tgacagcaga ggtagtagct
    32461 gaggcgcctg atgtcctcgg cagtgtagtc atcatcagcc tccagttctt gcagcaccag
    32521 gtaccagccg cgaggccagg gaagcgcaat cttttgtccc gaattgagcc tcacgtaggc
    32581 ctccacgcaa cccagcccga actcaacact catggcgaga ctttctatat cgctcatggg
    32641 ttggcacgcc atctcaccgc aagactttac actatataac gcctcagacg cttgccacac
    32701 aggaccctgg acgtcgcaat gtacaccaag cgtgggcaac agcgtcgctc gcacgaggga
    32761 gccgggcggc tttatacctt tgatgatttg gacgatgagg tgtttcttga cccaatcccc
    32821 cgcgccccag ccaatgaatt ggacgaaatg gacttgatgg aagccggttt gttatcgtcc
    32881 agcagtcaat ccgataacaa atcatctttt gaagtcgtct cagagacaga cagcggctcc
    32941 gaagcggagg cggagcgcgg tcggcgcgcg gggatgggca gtcgcaataa gcccaccaaa
    33001 ccccccagac ggaataaaac aacacaatgt ccgacggggt gcgtcgccag cgaaccagta
    33061 atcagtgcca tcagcagcga agacgagggg gcgaccacgc agagccagga agaggacgac
    33121 gacgaagacg accttgacga gggtcatgaa acaaccatag ggcagcgtac ggtcactata
    33181 tttcgtcaga tatactttga acgttcatta gcacgtaacc tgggcttcga acccaccttg
    33241 atttcccctc caaacaccga attcctcaag ttcctcttgt atgatttttc cgtgcaacac
    33301 atcacccgag tcaatcaatg catacccatg cccacctttc tactcacgag tctcattaac
    33361 cctattgcga aaacaacttc agctggtgag cgcgatttaa cgcgcggaat cgtcacccat
    33421 gcggtcttgg taaactactt ttaccaagcc aaggccaaag ttcgaagcat gcaatgctct
    33481 ctaaacgcta ccattcatgg gcaaaccatg aataacatag caacttatgt tactaattta
    33541 acaccaggtg gacgtgcggc cgccctagct cttcattttc tcatgcctca aaaagcggtt
    33601 atgacaaaac aataccaagc gtgccttcgg cgactgagcg aggagctccg caaacgacgc
    33661 gtcacagagt cgcccagtac cttagaaatc ctagaaacca ttcgcgacta caatctaata
    33721 tttcccatag ccccatacac taaccggggg gcactgtacc tgtaccgcaa caatttgcag
    33781 aaattatcta acggatacag gaacgtgcta aaattactct cgagcgagaa actaaatgaa
    33841 gaacactttg tgaatgactt ggcattcatg cttggggtcc agttaatgct tgtccagttt
    33901 gaacaaacac ttcacgtcct ccgcgcatac ataatgcacc acctccagaa cctggctact
    33961 ctaatttaca tcatctatgt gcaatttcct tctcttcggg gcgactatat tcaagtgacc
    34021 gaggccatct atcgcgccac tactagccat ggcgatgaac ctctgtttca ggttaacaca
    34081 tggctgtttg attatctcag ggcagtaaga aacttagaag ccgtggtgtg cccagattac
    34141 atgatgtgtg cccttcgtca gtggactaca gtccacgagg acaatccaat cacagactac
    34201 atgtttcatg atccggccat acaagactca cgcatacgtt gcggagacac tcaaaccaaa
    34261 cttttggttc gtaatttgtg ctttacacgc atgcaagggc gccccacctc tcgccagact
    34321 cccgtagagc acgtgctcgt acccaccgcc tccctcaaca ggccctatct aagatgtaat
    34381 tccacggaag agagggaagt aaacagtcac cgcaatctga cattgcgatc gttcctagaa
    34441 actaatggca atcaccccat gagccagctg caataaaaaa tataacaaaa tctttattga
    34501 ttgggcatga ataatataca catatgcata caacatttat gtagatgacg aggatgatgt
    34561 tccaaccccg ctttttcgtg cacccgactc cggctgaaga gaatagtcaa gggctggtgt
    34621 aaataaagat gatgacataa ttccactggc aaacatctct tgcgtgagtt cttctgggtc
    34681 ctccccttct accaccgcgt tctgtcgcct caaacagggt cgggtaacca aagaggccga
    34741 cgcatcgctc tccgaacgac ttccccttct gagtcctctt cgctgagagt gctgcaacgc
    34801 tcccgctcga gctcgcctta cgtcatcaaa gtagccttct cgcacgccct ctttgagcaa
    34861 ctcagataac gagttggccg ccttaaccac atagttatgc tcaccaatct cataacaaaa
    34921 aatgccaccg cacccaccta tggcggccac cggtcgatcc caagtaaaca tctcatcggt
    34981 gccaatggtg ccaatcacgc gcaactgtcc cttcatgagc ggcaaaagcc tccagtaact
    35041 aaagtcccgg ggggtgagaa tagtgtcatc ctcatcgcag acgaacaacg tataacctct
    35101 aggggagggc aagtcaaagt gacggcctct attccgtcgc acataatctt cgacattaaa
    35161 aacgcatcca gcttcccggc tggtggccat cctgattgtt ctggtgccaa tgacatcatt
    35221 ctgcttttga ttgatttcat attgcacaac cgcccacctc gtgtggtcga aaacgacgaa
    35281 catacagccg gtgaagcttc tcaatgtgtc cctgataccg caccgtgacc gtggcgctgg
    35341 tcgggatttc aaaaggcgcc ttgcggcgac aacggttggc gttgttactg agctcgcaat
    35401 ctgccagaag cgagtcgaaa gtcattaaga gacccggatc caaagtcacg tcaccatgac
    35461 gaaaataata ccaagccagt ttttcgccct tccgcgtctc tgcagatgga cactcataaa
    35521 cgcggcgcag tctcaacaga tgcaacagga ccaattcgcg cttgatggtc agtgaaatgc
    35581 actgatagtc aggaatcttg ttaactatct taataaaatc acaaaacgtc tctaagaaat
    35641 tggaaacggt aaaatgaatg tgcttcagat cgtgaatgtg ccgtctaaaa cgggacagct
    35701 ccatgcgctg tgtcgcattt tgtgctaacc ctttacggat gatggacgcc tcgtaacgaa
    35761 acatcctgat aagaaaagcg acatctttac acaaagcacg tacacaagca ctatgttcat
    35821 gacgaatagt gatataaagc agcctgatga ctttgagagc caaaacagca ttagacatca
    35881 agtacatagc ataaccttcg cagggagtac cgcaggacag ccccaccggc aataaaaagt
    35941 aatcgtctac cagagtgtgt gaccagtccg taaagccgag gtccctggcc acactctgct
    36001 gcacacgcag ctgctcagca gctgtcaggt gacgaatagc cgggagatga aactttccca
    36061 aatgagcatt gtgaagcaaa gtgagctcgg cgtcctccag ccgaggctgg ggaggagaag
    36121 gctcttcttc cgatggtgtt gcctgggtat cggatgatgc cacaaacaaa tcatggcagt
    36181 caccgcatgt gcaaaagcgc gcgtaaagag tgtgtagtgc ggcttcggcg cgcagagcaa
    36241 atcgggggtt gaaaaacaca gcattctttt gaacgcggta attaacaggg agtttcttac
    36301 agaggtgagg gggtaaacat ttttgaatta aatccctatc accggcatcc aaaaacaaac
    36361 acacggtacc cgccaggcgc cggaacagtt cttcggtaat gacacaaagc tggcgtagat
    36421 agtgagtttt attgccaaaa actttgtagt ttaggagggt agacacagcg tactgtccag
    36481 tggccacggc tagcgcaatc ctttttccgc tcttgctgat ctctggcaga aacggacccg
    36541 ccgccacgag ccttcgaaac tgcatgaggt tcatccagtg aaagtgccct ggatcgggtc
    36601 taagcggcac gccgcgtaac agaccccaga cggccagatc ggtttgaagg ctcagacctc
    36661 gaatattgta cttgccgtgt gccgtggcaa atttggaatt caccagaaag ctgcgacgta
    36721 tgtagataat gggactcttt ttagcacttt ccgcattctg gaccacccgt gtatcgcgag
    36781 gctttttggt taaagaagac gaagaagagt caacagggaa caagccggcg agagcggcct
    36841 cgcgcagact gcgcaccggc gtgagatagg tccgcacgaa gttgtgacaa aaatcatcat
    36901 ccggacagtc agcgacaaac tcgaaagcgg catgctgatc agagtaaatg tcatctagcg
    36961 gcggattcgc tgtcatgtct gcgcgctcgc agcgtagtga tgaatcttaa ctatataccc
    37021 taagtaactg ggatgtctgc caggccacaa aaaaaaaggc gcttcaaggc gccgcagcta
    37081 cagattcgtc gtgcagcaga ctgcgagtcg agtaaacgta ttcactcacg tcgcagaact
    37141 gtgctttttg actgctgacg ggcatcgaca cggagcccag aggagaaaaa cagaagcgac
    37201 gagagcagcg aaaccagaat gagccctgtc tgataaagcc ccgaagcgtt tcggccaatt
    37261 tcagcatcac cgtgccgtag agcagcacat gcacacagcc gttggtgtcc agaaaaacgg
    37321 ccttattgac cggctcgatc cagccaatga cagcgtactt ggccctctcg agaatcccga
    37381 tcacaaatcg gttggcctcg ttcgcctcgg ccacattcca ggaaccgaaa gtgaaagtgc
    37441 atgccggccg accacccaag cgaatcttgg ttccagcatg caattgacag aaacgcacga
    37501 cggccttgcg gtcatgcaac acttgagaca gatcatacat actggtaaaa ttgtgttcat
    37561 accaagcacc ctccacgatc tcgtctacat attcccgttc aaagtagcta cagacggcaa
    37621 aaaggccggt ctcaaagagt tcgtggaacg acaccgccaa tacataaacc ttgtcttccg
    37681 aaggcatgta gcagaacacg tgtccatgat tggaaaccca aacctcgggc gactgtgccg
    37741 cttggggcga acattcatag actgtgatga cacccaagaa atataaccta gaagcttctc
    37801 gaaaacagca gaagcgttga taggtcttcc tatcgcgcgt caccccaaag tacttgagat
    37861 cacccaggag aatgccgtgc agggggggcc aagcgagagg cagccagcgc cccgcattcg
    37921 cgcggacgaa acgctgaaga tgcaaaccgc cagggcgctc tcgggaccgt ccgcgcgtgt
    37981 tgatccaagc gtcgcgcaga cctcgccaaa acgcggtaaa tctaggctgt cctcgcagat
    38041 agagcgccgt cagtggctca aagtgcccca ccaccatcct gtaggggaca aggaagcaat
    38101 acaagatttc aataaattta gcaaaaacca cacattggat aggatttttt ctttccctgc
    38161 gagatttttg ttaaaaatga aatttaccca tgtattgttt cttgtcccta ccttcgcttc
    38221 ttgaacggca gtgtggtacc cggatagagc tcgtaaagcg tgtgacgatc cacaggtccg
    38281 atgttttcgt aacgataatc atcaatcagc ggacacagtc cgatacgcac aaaggttttc
    38341 aggtcacgtg ctatgcgcgt gaggcgctcc tgacccacca gcgccacata cacaatgcca
    38401 gaatctccgc agaaaacctt aacccgctgg aaaaatgttt tattcccttc cccttcaatg
    38461 acccccagaa gcaaaatggg ttcacgacca tagctgaacc tctgcaagcg ccgtatagcg
    38521 ataggcgaca tttccaaatc ctgagcattg gccaccaaca cataatggtt ctccggccag
    38581 atgagtgaca gcttggcgtt acgatgttcc tccacatact gactcctgtg ctcgttgtcg
    38641 gggcaatcca gaagctgtct gaaacacaac aacgagtgca agtaacgctc gcgcgtgcta
    38701 atgcgagaac gctcacacat ttcgactttt tgcgccgatg acaagggaga aacatccggc
    38761 tgcatgcgcc ggcagatggt ctcgtgcacg ggatcgcatc gaatcatacc cctgataaaa
    38821 aagtcattga gatccgaagc cacctcgtac agacagtcct ctttagcgtc ataaacaatg
    38881 acagccccgc aaggatccag aaacacaggg tacttgttgg tgtaatgcga cacggttccc
    38941 aggggttgca gaacacgaga ttccccgaaa aagtcatttt gacagtgctc gagatcaatt
    39001 tctgtaatgg cgtacggcga gtacatgccg ccgaccacaa acgcgcactg agcgggccag
    39061 cccaacgaca cacacgagcc ctcgaaacgc ataagatagc gtttgaggcc ttccgagtca
    39121 cgtctcatac agagttcaga caagctgcgc gaacagaacg tttcgggcgc cgccgctctc
    39181 ttccgtcgaa ccaagcgcgg tcgactctcg tcacccatat tgcacacgcc tttcacctcg
    39241 gctcgctcag cgaaaagtgt acaccgcaaa tgagcgaaga tccgcgcgac actagcaacc
    39301 tttatagccc atcatcatcc cacagaggcg aaacaaacaa cagcacactt gaactttttc
    39361 gtctagcatt tcatctttat ttaactctgc gttaacctca tgtcgagccg tatcccaaaa
    39421 cacagactgg tcttcggaag ataaagtatc ataatactcg agcattcggg aaacatctgc
    39481 cacggctacg cttccccgca gaaaacgttt caaactttcc atatgccgct gacgctccga
    39541 catcatttca acctccagaa cagatgcatt cgcgcttcag attctgccgc gcccgtctca
    39601 gctgctgtaa acgtcgatgc tgtactccta agtccacctc ccgattgaaa tcgtcttggt
    39661 cgcgaataga cagagtgcta taaaattcgc aaaaggcctc gataccgtcc atatctagct
    39721 ggggtttaag acaccatctc actcgcatct cccagaagta cacccattga acgcttcgag
    39781 cggccgtgct gacagccttg gaacgacgtt tacaggtcgg aaagctaccc gtgatttgga
    39841 acttgatctt atatagataa caggatgtcc gtcccagcaa atgtcgaccc cgcaacccaa
    39901 tcatcggtcg tggaggagtc gcccaagccc tcatcaccat ccaccgttgt cgtttcatcg
    39961 tcgtcatcat catcttcatc tccttcgcct accaaaataa tacagccgct gtctcaacaa
    40021 ctattgcccc aagcaccgca accgggaaac atcgtagttg tccccgcacc tggcccggat
    40081 ccagattata gattacccga ccttcgagtg gtgcggctat ggctagaaac tctcaaaacc
    40141 gcagacaggg acaactttgg tcgctgcgtg cgacatgcga aaacgcaccg caccgcttac
    40201 cacttgacag cgtacgagcc gtacctcatc gctctgaccg atcagtacaa cggcacgcct
    40261 tccgtgacag agaaggcttc gtatctgcac ggctgtctgt ttttgtcatt ccctgtgatt
    40321 tacaacaaca cacaaggagg cacgtacaag catgactgga gtaacgtatc ggttccgcga
    40381 accatgctac gcgaactgtt ttttctgctg tgttctacca gcgaaagccc ggccatcttt
    40441 caacctatca ttaccaaagg aggcacgtgc gcctccatgg tggtgtatcc cgacgagacg
    40501 gccagtaatt tcaccaatcc ccaacacatt ggtttcgtat acagcaaact ggtcatgatt
    40561 ccctttgttc cacacgcatt cccatcgtac ggcgttccct tcctgacctt accgactcac
    40621 atgcgttact gctggatcga agaagcgcct ttcggtcatg ctacgctgac gcgctacaac
    40681 gatcacatgc tgttccacgt agaacactta acgtggacga gcaagaggat tactaatcat
    40741 ggacagaaga aaatgtcacg atacacggct caattcaagg gcatgttacc agacacgtat
    40801 cttaatggga ctcatgtttg gacatcttcc aagaacatcc agtacgaatt catgggattg
    40861 ctttttacca tcaacatcga caccctgtgt ctggatctgc atcacgggca atgcatcgga
    40921 tccatctcaa gttcatactg ccaccgtgtg gcggacaaat taacagccag aaacatgcct
    40981 cgatcattcg ttttttattt actaattgag aatcaacaac aatgtactgt acagttcaat
    41041 cgtaatccgt atttgttttt cagcggcgac gggtttaaca gcccgttgct gaacgaaccc
    41101 agtcccttct atctaacagt tcacgctccc tacgacatca attttggaca gaacgctcgg
    41161 cagacggtgg agatcgacat tcgctacgcg cacacgggcg gacggtgttt tttggtcgcc
    41221 aacctgccgt acgaagactc cttctacacc ggcatgtgcg tgtggcaggc agatgcactg
    41281 aagataactc tctggtcgcg cttacgcacc accattattc cccaaggaac tcccatagcc
    41341 gtgttgtatc aaatcaacga gacggatgga aacctgtacg cgtataatca caacacggtt
    41401 ttccgtcaag taaaccatgc cgaaagcacg gccttttacc ttagcgatct gaagctccct
    41461 acgaataact tcctaacctc gccctaaaat ataaaattta ttcctcattt attctcgagt
    41521 cttctttaat tttttctata atagcttgaa cgttatctgg aacgggtata gtgcctgacg
    41581 attcatctaa caaatctttt aacttagctt catcggaaag ttttggagta tttcttggcg
    41641 aggttaaagg ctccgctttc attttttgcg cacgtccacc tggaacttca gtagacgatg
    41701 cagtttgtgc ttttgtggac gttgtggtag ttaaaccggg tgtaaacgtt tgaattgtcg
    41761 tgggaacctt cacgatagtt acatctttcc cggggattgg cgcagaaaaa ctggcaggtt
    41821 ttaggacact gccatcgaca gtgagaggtg tagccttaat tacttttcta ggtttaagaa
    41881 cactcgtgct tggcgacgtg acagacgtaa acggaccaaa actaggctta ggctttggta
    41941 taatctttgt ttttggcttc aaaattaacc gacgttttgc ttttgggtcc gacacaggag
    42001 ggacgggagt agcaggagga atagatgcca cactaaccac cgattcggca tctgacgcct
    42061 cttcgtcacc atccccagaa gcaatatctt catattcact ctcacttatt tctgcttcgc
    42121 ttttcacctc gcgtcttttg ttaggtgaaa aactactttc acgatcactg taatctgaag
    42181 caggtggtgt ctttgtctca taatctgaga tactatctag acccgaaacc tcttttaacg
    42241 gggtctcaag tccaggtatt gtttctgatg aacccgttgc gaataaagga ttcgaaaact
    42301 gggtagcaaa cggggaactt agtatcggcg tctgaataaa tttcggaagt tcaaacttgt
    42361 atgtagatgt agacggtttg tcatcatcgt caagttttag gcttcctaaa ccaccatcaa
    42421 aatccactaa ggtgtctact tttacatcat cagtttcatc tttcgcgcga ccctgatttt
    42481 catcgtccga ccaaaacgtt acgcgtttac taacagggtg aggagtttta ggctttgtat
    42541 cccagaactg ggacgattgt ttagtaggtg acaaaaggct aaaagcatat tgtctttcac
    42601 tcttatctgg cactttgcgt tcttgtttct tggtggtaag caactgacca ttgtcgtcat
    42661 catcatcttt agtctgtcgc ccttcccaac cacctctcaa ccatttttgc cactcgcgat
    42721 gcagttcttc gtcatcatac tctaaagaaa agggatcacc caagctctga ctgacagatc
    42781 gtgggaaaat atcctcgtag attgcaaaat cttccatcag catctccaac aacatatcgg
    42841 ccgattcacc gtcaataacc ttatgtttga taatgttaga gcagtaatta gattcaaaag
    42901 acctgcaaga tcgcagctcc ttcatcagtg tcttacatag ctccttaatc ttaatgagac
    42961 acttttcggc caagatgtcc caagaggttc tgacatgaac aatcactttt ccgagataga
    43021 tgagtttgtt agtggcattt accagagaac tattggagtg acgctcaaga tgaagcttca
    43081 ctggccgtat ttcgaacata ttgttagata tagctagtaa agaatcttct aaagccatga
    43141 cgtctttctg acgaagttga ataaattcta tctcaccagt acccaaaggc tgacactcag
    43201 acaactttgc caaggccgtt gcacccacca tggcattctg aatcacagta acatccgtcc
    43261 gagaatcgtc accaaaaacg gtggcctcca aagttcgcag gtgaggccga gcctttactg
    43321 gatctcggaa gggatacatg tgtgctcgcc gagtgacagc attagcatta acctcaaact
    43381 catctaaaag cgatgataaa tcaggaatat gatagcgcaa ttctcgatag taggccaacc
    43441 agaggactaa ttggttgaac agacagctcc gtctgtgcaa aaacttttcg ccgcattttc
    43501 tgagaatttt aggatgctgc tctaaatcta cgttctcttt agtcggcagg gtctttaaaa
    43561 agttagtgat ggcagtcact ttacgaggcg gcagcccgat aaactttaaa ctcatgattg
    43621 tcagccacag aaaccggaaa tttcacgaga tacggctgtt tcagcgttct gctatccgtc
    43681 caggcgggtt atggaaacca ttcttcacaa ccgaacggtg agtgacattt aagacagttt
    43741 aatagccaac actcgtaacg tctcggaagc tgataagttt cgtttttcca cagagtgaaa
    43801 ctaattccat tttgcacatc aacaccacct gcaatgtgac cgactcactg tacgccgcca
    43861 aactaggcga agccctcgtg aacagcgcgc tagctttatt cggtaccccc ctcaacgcca
    43921 tcgtcctcgt cacacagcta ttggccaacc gagttcatgg atactccacc ccgattatct
    43981 acatgaccaa tctttactct gccaattttc tcaccttgat agtacttcct tttatcgttt
    44041 taagcaatca acacctttta cctgccagtg cagtaacctg taaatttctc tccctgttgt
    44101 actactctag ctgcagcgta ggttttgcta cagtggcact gatagcggcc gaccgatacc
    44161 gagtgattca tcgccgaact caagctcgcc aatcctaccg taacacatat atgatagtag
    44221 gcttaacgtg gctcattggc ttgatctgcg ctacccccgg gggggtctac acaaccattg
    44281 tagctcaccg cgatggggaa agtgatgctc aaagacacaa tacttgcatt atgcactttg
    44341 cgtatgatga agtttacgtc ctcatggtct ggaaacttct catcgtttta gtctggggca
    44401 tagtgccagt tgtcatgatg agctggtttt acgcgttttt ttacaatact gtacaaagaa
    44461 cagccaaaaa acaacaacgt acgttgaaat tcgtaaaggt attactcctg tcattcatca
    44521 tcatccaaac tccctatgtg tcaatcatga tttttaacac gtatgccacc gtaggatggc
    44581 cgatggaatg cgccgatcta actagacgcc gagtcatcaa cacgttttcc cgtctcgtcc
    44641 ccaatctaca ttgcatggtc aaccccatcc tctacgctct catgggaaat gactttgtgt
    44701 ctaaagtggg ccaatgcttt cggggggaac tcacgaaccg tcgaactttt ctgcgttcca
    44761 agcaacaagc ccgcaactcg gacgatgtac cgacaattgt cagtcaacaa cccgccacac
    44821 ccaccatcgt caataagccc gaaaaaaacc cgcacgtaaa acgcggtgta tctttcagcg
    44881 tcagcgcatc ttccgaactc gcagcggcca aaaaagccaa agacaaagcc aagcggcttt
    44941 ccatgtccca ccaaaaccta cgtctgacgt gaattttcct agaggctgcc tccacgggtt
    45001 tacatacata tctcggtact tgctacactt gatcacttta ctgcggacac cacggccaat
    45061 cgcatcgggt aggagtggcg acacggcatt ataacgaaac gccggctggt gccacacgcc
    45121 actctgatag attgccgtga gtctttttct caaacggtag gatatccgca ttcgagatga
    45181 cgatgaacat aatcattact acccgagact tctccaacga cgaatctgtg gtggagacgg
    45241 cggaactcca caacagcgtc gccaattcca tttccaaagc ttacagaggt acgatccgcg
    45301 cagagggcaa gaagaaattg ctgattcgca acttgccagc cgcacctggg tgcactcgac
    45361 gcaacagtaa tttatttatt ttttgtcatg accgggacta tcgaaaattt caccagggca
    45421 tcgtgcagtt aaagcgcacc cgcagccaag tagacccctc cgacatcgtg aacgtgacta
    45481 agaacataaa atgtcgctta caaccgcaca atcaagatcc accgttaatt gccggacagc
    45541 ttcagaacac catcgcgcac gtctgtaccc tgttcaacca gctggtattc acggcccaac
    45601 ttcgacatta ttgcgagaac cacgagcgag tcgtactgta cgcacgagac gagctgaccc
    45661 ggcgctgcgg agacaaatcc acgctaggca tacacatcta tcaactcatc tcgctgttgg
    45721 accaagaccg tcacagcgaa ttgtgccatg tactcgttgg cttgctgcac caaacgcccc
    45781 acatgtgggc ccgatcgata cgccttatgg gccgattaag aaattacttg caacagaggt
    45841 ttctgcacat tctggtggaa agcggactcc aggttgatag tattttcgag agttgctacc
    45901 acagcgaggc ataccggctg ctgtttcaga tcgcacaaaa cgaatcaaac gcctcgctct
    45961 cttacctatt cagctagcgt tttgcctgtc atcgaaaacg aaactgaagc tacacctgtc
    46021 ccgccgtgta tttaatgaaa taataaaatg tttcctatga ataaataagt tttggtttcg
    46081 tttttgaaag agctaccatg agtctccccc cgtcgatccc agccctgccc gtagacgcca
    46141 gtctaaacct tcgcccggac ttgttttccg atgagcaccg ccacttgttg gtcgatatac
    46201 tgactcaggg ttgcggaggc tacgtgggtc tgttgtgtta cgggcttccc atgcctagct
    46261 atgtactgga aactctgatt gactttcaaa tcaaaacgat atataccaaa attaagcaga
    46321 tcgccaatag cgttatcaga atatgtatct tggctaatta tctaaaaaac agtcaggatc
    46381 tactggtcga tctgcaagct aacctagacg aaataaactc aggtgcaaac aaacaaagat
    46441 tgtatcgcgg actacatagg atatgtcgcc aaacaaacat gatggatgtg tatcgaaaca
    46501 tgagtcaact gctagatgcc ggggacgtaa ccatgggtgt gtacagacag ggcctaacgc
    46561 agatgcgtgc gcttacagaa gcgttggatc taaatcggga acccaattta caaccactat
    46621 acgaaacgct caccagctac aacctcttgt acattccccc gccatatcta agcgctaccg
    46681 ctgtagaaat atacagcgaa aatctcagcg atctaacaaa acgcattaac cgatcgttta
    46741 acttgcaaac gcagattaac agatctaaac gagccgacta tgtggtaaac gatgtactgt
    46801 ttctgctatc ggcccgacat ttacaatttc gccatagact ggaactacag atattggaga
    46861 cctggattgt gaacaaatgc aactacctat gtaatgacct gtatttcgca tacgtccagg
    46921 ttccggaatg tcgcggcacg ttctgtaact ttgtaagcgg tttacaagtc gtccgcaagg
    46981 aacgtcatcc gacattccgt cccttactac acaacctgtg tagccttttg aatacatttc
    47041 acgaagccaa cgtgtacctc tgcccccaat atttacatag cgccatcttt ctactgctgc
    47101 ggagagtgtc cagagttaga gagggcgact cttcagactc ggattctgaa aaccaggaag
    47161 cagcagaaga ccgagacact ctgctaagac gctttcgaga gggagacctc gatctcgaag
    47221 tggatcctac ctccacccct ttacaaaact tttactttgc caaaaaccct tttggaaatt
    47281 cggaaatttt tcgtattcca gaacaagcga gtcgctacct tcgtcgcaac gcgtggatag
    47341 accgcagcaa cttaacatac atatcctata aactccacaa cgggacatta tctgaagagt
    47401 ctttcccgat gcgaaatttg tacagcctta ttatggaagg cgcttcgcga caagcgggta
    47461 ctaacgccag acagtttatg gcagctctac aacaagcacc cttaggacac gatgaacccg
    47521 gagcagcgga tcatagcgat ttgtttgccg atgtggacat tcgacccgca caaccgtcct
    47581 cagggtcctc tgcctcattg tcaacacctt caacgtcttc cgccccctcc ggccaaccct
    47641 ctcccagcag actcggacct gaacaaccgc ctcgtcagag acgttatctc agtttgagca
    47701 acttttcacc ttattcagtg gctcgtcatc atcatcggcg acggcggccg cgtcctcctc
    47761 gaggaccggc tcacacctcg cggcaaggac cagacattgc tgcctcggcc tcagcttctg
    47821 gaggcgagga ccccagagac agtttggcag aagaactgga acaattgtag gtgtgtatat
    47881 agacatgcac ggaaacttta caaacacgtt tgtatgatat gtaataaaaa ctttattttg
    47941 tatatattgt cgttatgtga tttattgcta cacatcaaat aaacatgtta cacataggaa
    48001 actctagcac gacccattcc gcgtccggag cgaaacagtc ggaggcgccg actagacaca
    48061 caccgcgtgc acacagtgtc gtcaaaaaga tatcctcgga ctgtttcttc gcggtctgaa
    48121 tcgttgtcct ctgcgagtcc aacgaacgac atgtcaaaag ctcgcatgtc cgcaatattg
    48181 ccgagcattt ttgatctaac atcttccata tcgtagatca gagaaggtag caaaggtgaa
    48241 tcggaaaggg cttcgagatg ctgaggccag aacttttgag tgacagacga gtcccgcatc
    48301 atcatgtcca cgccaaatct gatatcggct tttatggctt cataaatgcc cacaacgaca
    48361 tcggcctccg ttttgggcgg tttttcgtct tcactgtcat cattgaacat gatcatagga
    48421 tcactgggtt cttcaccgtg catgcaatac gggacctttt ccaacctaac gatagctgtg
    48481 cgtctcctat cgtgtctgtg attccggtaa cccttttttc ccatcatgca ggtaaacatt
    48541 cgcatattct cagctaagcg atagatggag tttagggcgg gatcaaagcc ataaattgta
    48601 ccgaacttgt caactagtac atagagtctg actaggaact catttttttc tttacggaag
    48661 caacctagca ccccgagcaa ttgattaaca cacactatac gagccacgca acgcaccatg
    48721 atttcaaagg agcgcagccc tgaaggtgac atgagactaa aagaagtgtc ttgaaaattg
    48781 gccactgcgc tgtcactgga ccacaaggca aaatgactgt ctacttgttc acccagggga
    48841 tccctaatat cgtagacgcg gtaaccgttc ttcgcaacca cgtccgatat tctgtccaca
    48901 tcccagttga agatcataag ctcctttata atttcatcac agtcaatcac aggttcctga
    48961 tacagctcca ttttttggag atagtcgcaa cgacgtagtc cgagttggat gaaggacttc
    49021 atgtcaggtg ccaaacaata cacgcacttt tcggtttctt cataacagta gatagcaccg
    49081 cttcgaccga tcatcatgac gagctggtag aagcctagct tcgaaagctc caccactcca
    49141 aacggctcca tgagttcgtt gcagcacacg tactttcctg ataacagaaa agtactgtta
    49201 gttttccatt atcaccctta acccccccca ccctccctaa ccaacaatcc tcaccttggc
    49261 agcacacatc gtaatacttg gagctgaatg gtcccatgag agtgcgggga cggagctgga
    49321 tatagccatt gtcgggccaa gcaagatgca atttggttcc acattcctga tccacaaatg
    49381 tgtataagct agcaggatct tgagcgcgca ctgcgatgca gccatatgcc atcaaagtat
    49441 ccctaagatc gtccatgccc gacatcaacc ggtaactcat acgacaaagc tgaggttatg
    49501 tttgttgacg aaccacgttg agttcactga actgtgacca agcgacatct ctcactattt
    49561 atacataatt ctccagctca gtcacaaaaa tctgctgact cattaatgta gaaaagttta
    49621 gatttctgag ccgcgcgaat ctcccgtcgc gcagcatgca tctcctggat atcggctcgt
    49681 atatgccgtt gactgcgtcc caaaaaccca gcaaacagag ccaccaaaat gaaagcaccc
    49741 aacgcgacag aagaaatgct gaataatccc caggcacaca atgtcagttt cgaagagaca
    49801 actctagaag accacagctg catgacttgt gtccacgtgg gccattccaa tacgccgtaa
    49861 gtggtgttat ccgcgtagtc ctgatcagtg atgtttaccg gacttgcttc aaacttcttc
    49921 aggcggtata taagacgtat gcagacgtca ctcaaaaaat accgatcagt gtccagatgt
    49981 ctttccagcc atgtagaaac ataccctttc acagttgaat tttcagcttc tgtagagttc
    50041 ccctgttgcc acttacagtt agtgtttcgg cgatctgcgc ttgtcgccga taacacatgc
    50101 tgtccccagg cttgactttg taacacaatt ttgccctgtg tcacgttacg actggaatcg
    50161 ttacaaatac attgcaacat tcccgtaaaa gatgtagaca gattgctgag catatacagg
    50221 cgatacataa ttcgcccgcc tacataatac tgaagaccaa tgttcagtat catactatgc
    50281 caaacacgac gtctctttgg aaatgtcatg ttgagtctca gtttattcac cgccaagtga
    50341 caaggtcctt gatagatgag cgtcccattg taagtgcagt tcaattcaca tttcatagtg
    50401 tcattcacat cacccccata ctggcattcc agagacaatc ctttgactct ccaccaaagc
    50461 gccaggagag cgaggcaaac ctacacgtca aagaatggag tcaataccac ataacactct
    50521 tcacacacgc atattcatga cacacaaagt gaagattacc tgccaagcgc agtaccttcc
    50581 catcatcact caaaacaatg agacacatga atgcaggtga agaacaaagt gctttattac
    50641 aaatgcagtg cataatgatt gacagcaggc gtgtctacaa gcaagaaata aacagtgcgt
    50701 tttacagaga tgcagcgccc tccatcgtca ggtccacaat agactcatca ctatcagagt
    50761 cgtcaggatg tgcgttaacc tttttcggat taggggtagg gagcgaacac tgccgagtca
    50821 gtgccttttt actgtccacg cccctctcag gctcttggac actcggagtc ggaagagtta
    50881 cgggaatcac gttggccatc aggctatctc tatccacgaa cggcaccgga atcttgccct
    50941 cccgaacgcg tctttcggcg tccagcaggg ctcgcacata accgcagaga aatctggcaa
    51001 acgtccgagg actgttctga ttcttctgtc tgcgggcttc caacacgtct cgctggtggt
    51061 acacctggtt gaaaatcaca atgagatcgt ccacagattt ggcatactgc ctaacccggt
    51121 gcctgacttc taagggaaag atgccattcc agtactccaa aacgatggga gctgtccaaa
    51181 actcggacat ggtaggtgcc atgaagaaca ggattccagt atcataggcg taaatgtcat
    51241 agttatcact cataaacagc accacctgtc tggaaggtcg aggagcagcc tcgtcccaag
    51301 cctcgataac tccaaacata gttaaggcat gactcagggg cggacaattg cgctccagcc
    51361 aactgatttt acaaaggtta attcccaaaa acgtgtacgt atgatcacat atgcacacgg
    51421 taacaccaaa ttcatgctta atatgtgttt cacgcgccat gagcttcttc acttgagccc
    51481 tgagcgccgt cttgcccaac acagaagcct gaatgagact gcctatgtcc atctgattct
    51541 gttgcatcct ctgttcctga tcgtattctg cagaagtagc cataatgatg ttttcttacc
    51601 ggctacttcg tctgtgatgc ggaactaatc ttcactgcgc ttcagccgac agagacttct
    51661 tttcagcgca aaaaatgcct cccggaccag accggcgata ccgtctgcgg gggacagaac
    51721 agtctcttct tgttcttcct ccaattctcc tcgttgccgc ttcacttctc tcagatattc
    51781 tttaaaccag ggaggcaaag gaggaccctg gtttcgcttg cgctcaatcc actggtagct
    51841 gagaatgcca aaagccacca taccaagagc acccgcgcag ttcacatact gaatagggat
    51901 ggcaggcatg gtgaaagcct gtctgagcat tgaacactgt tcatcttata tacacaggtc
    51961 tcgcatcccg gacgtgacgg ccgctgatca caacaaagag gcacatgaca attgacggat
    52021 tggaaaaggt gatgatagaa aagaccctac gtatgacaac cacattattg accgcaaaca
    52081 cgacagtaaa tattcggatt acgtctattt gtatgtagca atggtaagta aagcatgaca
    52141 cacgttttca atgtctcaat ttccccaatc cgtgttaata attttgcgaa taaaacacaa
    52201 taatcacaaa tgttcaaaat catacttgtt ttttattaac aaactctggt tagattatgg
    52261 aatggttatc atttcagaag tcatcgcttt caagacaccc aggtacagtg aggccagtat
    52321 atacacacac agggagtcaa agcccagaga cgcagcagga taaagtccca aatagcgaat
    52381 aaagtccagc agtctggagt ttgcttcaca agaaagcaag ttgatgcccc ccttgcatgt
    52441 agactgagga acatgtccgt tttcatgccg cacactgctg acgatggcac tggacaacga
    52501 cccattctga cagcggtctc cgttccgcgt agtgtagttg gtcaccgaag actccaaagt
    52561 aatacccgat aagcagtaga gtcctgtcag aggcacattg agtacacggg gttcattcac
    52621 tccgggtatg tacagcgatc caaagtacgc cggcatacag tcgacatatc cgtatttatt
    52681 tatcggctgc ggtaccccca aagccaccgt agacagcaga gtcaggcatc ccaccaccag
    52741 aagcagagtc ctaggagcca tcaccatcgc cacgctgagc agcattgctg tgagtgaagg
    52801 gtgccaagta tgagcgctta aaaagtcttg ttccaaaagg ttgcacaaca gtaatgattc
    52861 agaactcaat gtccttagta ctaagcggct tcttttccca cactatgtcc tcttcttcct
    52921 catctgtggt tagtaaatga tgatactttt tccgagacca cacggtcttc atgagacagg
    52981 caaatatcaa aagaaacagc cccaagacaa aacaccccac ccccaccagc caaggacacg
    53041 gtagaaaata gttctgtcga agctcagtga aactggcatt acaccacaaa agcatcatgt
    53101 tgaagagtgg cacgatgact tcagccttcg cattccccag tgacaaaaga cacagagaca
    53161 gtttgtagtg acagttatag tattattgac gcaacaggca agcacagtcc ggtttgattt
    53221 tcaacagctc aagtgccctt attattactt ttgttcaaaa ccaaaataac ggagaccaaa
    53281 acggtcatca agatgatccc taatagagag accacaaaga ccactatagt acatttccat
    53341 ccatcatcgt agtacgcttc caccgggggg tgcatgttag ctggaaactc tgtcatgtcc
    53401 atacgaaaat tatcaggacg cggagggact tccccgacga ccgcatgata cggaggaggg
    53461 gggctatcag ggggtgcatc tgttgtgagt cctcttctat tgcggcgcga ctgagtaggt
    53521 aaatcacgag gacgaggcgg cgagcccacg atttcatcat aagcgggagg tctaacatct
    53581 tcactgtcgt tacggggtga tgattcattc gtcgctgaca tgttttgaac cgggacagaa
    53641 aaatctgctc ttttgctttt ggttgcgagt ttgcttgcgg caaaaaggtt cccgagggca
    53701 cgtgttgcac aggtaagctg gcgggatgtt gcaatgcttc ttgtgacgaa cgcactggcg
    53761 acagaaatat tgctgatttc ccagtcgcag aacgccagcc ctgaagaacg ccgggagact
    53821 gctggctaag tactcaacgc gcttggtgtc tggattgacc gcaaaaactc tcagctgctc
    53881 gttgaccaca atgggaatgt cgatcaattt ctggcgccag agcatagaga gcacgaaaat
    53941 gtgcagcacg ttgactgagc cagtatcttt tatccactcc tggtgcgccg gattttcgta
    54001 ggtacgctct ccctccacca cctcagcgag gtaaatgttc tcggtgcacg tccaggaaaa
    54061 ttcctttccc gcgtttctct ggcagagtcg ccagatgccc ataagatcag taggaatttc
    54121 aaactcaagg gccagcgaat caccaaaact gtaacggacg ggccccagtt tttccctcag
    54181 aggagggtat ttcataagac cctccgtgag aagagaatga aaaccggtgc gcgaaatcag
    54241 ttgcacgctg tcacaatttt tatcgtgcac atacacgcgc cccccctcac tgagcaaaac
    54301 aatgaaaaca ttgccagagg ttaaggcctc ctcgccattg ctcaccgtgc ccacaggtat
    54361 caaaaactta tcgcagcata ggtacttctt ttccaaatct ttaatattga gacgtccaaa
    54421 agttccctgg cgcaggaaat tccgataggt gaagatccat cccctgggcc agcggatagg
    54481 aaaggtggtc ccgctcatct gtcgaacatg ctcaatcagt cgcttggccg gtttctggct
    54541 gctcatagaa catatgaagg tgtgacggac gagaacatcg gcacgctcca tctcagagag
    54601 aatcatggat gatgttgaca aacaaacacc gttggacaga gtcaggaatg gcaaaatgcc
    54661 caggaaaaat atacctgtgt gccaaatgac gcgccgacca caaaatctgc atgttcgtca
    54721 tgtgtttgtc tatgtacatt tctgcttttt gctgctaggt acgaattcga aactgacgga
    54781 atcctcgcta tcgctttctt ctttggcatc attaaagtaa ttagagtttc tttctccaga
    54841 gttggcggct cctttggttg tcaggtagct ggtgatcttg tgttgctcgt acttttcctt
    54901 ggaattgtga tcgtgctcat tggatttccg aggcggcatg cgttcatgct tacgactgac
    54961 aggctcggac atcatctcgg aatccagtcc cgagccgcag ccgtcgtcat gcatggcgcc
    55021 tgaattggtg accgccaccg ccctctgctg tttgaaattt ttatcgaagc tgagatcgct
    55081 gcgctgaaaa ggctcctccg tgagaaagtt atctaccgca aaaagaccgt tatgactaga
    55141 aatgtgcacc accgtatcat gctcagtgac gattcgcacc gtgcacggca gcttggtcac
    55201 cgcacagttc atgagcgttt ggtagaggtt cttgagctgc acgtgaacgc gcatgttttt
    55261 tacaccatga aaactgacgc gcgtattagc cgtgaattcc aactcactac cgctgttgag
    55321 aatgaatttg atagccgggg gagcagaatg taccagaatc tgaaccgtac cggtgggaca
    55381 aggggccttt ttgagattgc gcttgacccg tgtgtggggg gaaatccact taatgagctc
    55441 gctgaccaca ctgtggtcca aatccacatg cacggccgag ttgtcgctct cgcgcatcaa
    55501 atcctggccg tgtacgcacg gagagctaaa ctccatgtta aagtcgggcg cgcacatgtg
    55561 tatttttgcg gacaggtcag agatgtcttg cacatagaac ttggttaagt ccttgctcga
    55621 ggtcaggtac atgaaattgc ccaacatagg agtggagttg ttgatggttt tggcttgaaa
    55681 cgacttgtca gtaatgtaca ggcaggagct gttgaacgtg atttttgaaa caaactgatt
    55741 gcgcacggtt tgcagaacca acgcgggtgt gggcaagaaa gtgacggtgg tattctcttt
    55801 gagggtgcgg atgaccgagc ggagctgctg aatggccgac ttatagggct tgagccgcaa
    55861 agccagcgtc ggaggctcgg gtaaacgcgc tttcctctcc atatctgtta accgcacggg
    55921 aacccgcagc cttgcaagat actcactgct agctcccaga tgcgtcctcg tccgtgccca
    55981 acagtcaaat aagctgaaag gcgttaaata attgactttt atagaggaca cacggcaaca
    56041 caaaaagcgc acgctgaaag tagagccaca gtcgcacaca gcgaggttgt atcacgttta
    56101 atacagctct gcgaatctcg agaccagcat tacaagtccc atctaggagg cacaatactt
    56161 atatactcca accttacacc gcaagtggta ccatttcaac attctcttca ttaaaagatc
    56221 tggagtcatt gaagactcgt aatagaaagg cagggggaca cactgatcca caaacatact
    56281 gacattaaca ctggccattt ccacgtctgc ctgcagttca gccgcccgct gaaagacaca
    56341 gctgggcacg tctgcgcgct gaacggtgcc ctgagttatg cttttggcct tgacctcatc
    56401 gtgatgctca atccaagcgt aattaatgat gggaactttc aggtgcttct gcatcacagt
    56461 tgggaaataa cattcatcgc tgggggggct gacaggcaac acggtctctt cgtcgacgat
    56521 gcgatcccgg gcggcccaga tagatggcgt tacattccac aggaaagccg tctcctcatc
    56581 ggcggcgatg gacaacaact gagcgttacg caccccgtac tcctgcatct cagttcggag
    56641 agtctcccat tgcgctaccg ggagcgacag gtgaggcttg cgatacagtt caaatatgaa
    56701 cttgccctcc ttgtaaatgg tgcgatcaaa ccactcacat ggcggcagtc cagatttaca
    56761 caagtctacg ctggtgcgca acgccgcata atacatgttt tcaaaaattc tctcaatgag
    56821 gtcccatgac gcaaagtatg taaagcccaa cctcattaac accgtgtgca gtcccgtaac
    56881 cccgatattc aggctccgca ttttacatat agccgattcc aagggccagt caccggaacg
    56941 aattaaggcg tctaggcggg cgttacccca aacaaccgcc tcggtgacca gggtgcgaag
    57001 cacctgcata tcaaagtaac gtctcgtgtt ccccaaaacc acattgtccc gacacagcac
    57061 gtcatcgtcg gtgcgcgtga acaaacaccg tgtaaggttg attgacagcc gctgtaaagg
    57121 caggtcagat tctccaaaat ggcacgatgc catgtctgga cccaaacatg gtggcaaggg
    57181 catattgccc gtcaatacag aatacttaac aatgtgatgc acaaacacca gggcacactt
    57241 tcccttcaaa gcgcaaaaca acatgttgcg catgaactcg ctagccttca ccgtgacttt
    57301 cggtaccgtc gtctcatatc gaacatattc tttttcaaat gcaaactcat tgccacactc
    57361 tgataattta cgagacacgg tgcgcccaaa caaggagtaa tggctatcct gagcgcgata
    57421 gcgtttcatt agtacagagg ggatattgaa agcataatgt atcccaataa tgtccgtctc
    57481 ttttaacaca aagttcagaa ctcggatagc cgccacgtcc cacagatcca caaagatgcg
    57541 cactatgggc cgatgaacct ccttttcgcg gatcatgtca caaaatccac caatgcatcg
    57601 aatgacactg atggcttcca cgttgaatcg ggtgacatta attgacagcg acactccccg
    57661 agttaagttc tcatacagcc acttgtgtag agccaaccag tctacctcac gagaatacaa
    57721 atcacatgaa atgaggtagt catactgggg tagctccaca aatccaatat tggacatgga
    57781 aaatggagtc aatgataact gtccatcacg acaccgcttc actacactct ccagaacctc
    57841 acattcgtgc ctacagtcca tgtgaaaacg atacactcga gcacacgggc tgctgactat
    57901 ggccaacgtg attgccatag agatcctgag aaaaattccc cccaaagatt catcctggcc
    57961 gtagatttgc cgagaaacct tatctgtcaa cacaatggcg ccataaaatc cccaacagcc
    58021 ggccaggtct agatatcgag tgatatctgc caggatttta ggtaggtctt cggaatggcg
    58081 catcacaaaa tcgcgtagcg gcccctcgca catagatgag gtatagttca gggcatttcg
    58141 gctttcccgt aaccaattga ccttgagata aaaacggccg atgagaaggt cagaacgggg
    58201 aatttgtcta atgagtgcgg gaccgtatct cataagcatc tggaaaagac gatatgcgcc
    58261 tctgatcccg gactgtcgag aagccgaatc gatatcgcgc cacaaggtag cacgatcctc
    58321 tacatgtttc acgggatccg gcactccaca aaagcgaaat ttgccccaac gaccgtggca
    58381 atggcacttt ttgcccataa gtagctgcac agtgttcatg gccggcatgt gttgcaccag
    58441 ggaagacgat gcatctggcc tgcatgatgt ggcggtaccc tgatcggcga gcgaccaaca
    58501 tgcatgaaca ccgacttgag gttgttgttg ctgctgctgt gcttgttgct gttctgcgtc
    58561 aggcgacgat gtagccactt ccatggcctc cacaccattc tcctccgtac caccatcacc
    58621 accctcggat ccctcctgca tgaccgcctc gagcccgccg gcgccggtgt tcctcaaaga
    58681 cgcctgagcc ataacaacat tcacccgcta ctagacaaac tctgtgaact cggagagttc
    58741 tacgttgaag tgttccaaac gcaccgtgga taatttaacc tcttggtggg ttaaaacgga
    58801 ggtgtgaatg tcatcagcaa gacaccaccc cagtttttga atgaccccag tacataaaga
    58861 aatttgtcgt ggcctggtga ttcttttatt tacaaaactg caccgctccg caatgaattt
    58921 atggcgcacc aagtccgtta aggtgtgccg attagatata ctcgacgtgg ccacataaat
    58981 cgccacctta gtttccaaaa cctcgtagtc gtacaccatg attaaataca cattttgcag
    59041 tcttccctga gtttcctcca aagtcatata catgtccttc ggaatccata acgaaaagat
    59101 ctctgtcttt agcgtgttat aaaggtatcc gctgagcacg caagtgagta acgacgtaat
    59161 gcccaatgac actgacttta cacagccaat ggtgcgcagg cgacgatgca gaactttact
    59221 gcccacgtcc aaccaggcca aagcggcctt tgcaggtccc gaagtataga ttccctccag
    59281 ctgacacttg gtagccatag acacgttggt agctttgatg gccatgagat agaggctaat
    59341 gtagaggtag cgcggcgatt cagcacccgt ctccatgcga aacatgagag aaccgggatg
    59401 aacctcgaat tccacgagtc cttcgggcac gaaaaagcga gacgtgatgg cctgatgatc
    59461 agcctcgtac aggtaacgca ccgctagtgt atttacttcc cgcttcagct tgacagcaag
    59521 aacgagttcg ttatcttcgt catttggatc ccgcggtcgc ttggcgatct cccgcgcgtc
    59581 catgatgcga aaacgcacag tcgactttca ggtgatcctc aatgagctaa aacagaaatc
    59641 aacggaggtt caggccgtgt taaatacctt aagccaaata gagatcggcg cactggatgt
    59701 ggagacagtg aatgcaacta aaatacaaca gtttctgcag cttataccgc aagaaggata
    59761 ccatttcacg tttattcagc aaaatgtggt ttactacata ctgagtcaca gcacgttgca
    59821 aacgtcccgt gattccctca gctccgctca agaattactc aaagaattgc agaaacatca
    59881 tcaacgccat gccataacca gtccgtgcga atacctaaac aaccaaacta cgctcaccca
    59941 cctgcaaact tttatggata aaatgcaaga tcttcaaaag ctctttgata ccaatcaatt
    60001 tctagcagcc accgtcccag accgcaaaaa tcaaaaacca cgagatatca gtgataacgg
    60061 aacccaatat ctcatacgaa gcgtgtttac acagattgaa gaagccacag aacatatacg
    60121 acccttcagt aactgccgcc tagtggcaga acttatagac atgctttatc acaacacact
    60181 acgatgggcc atgggactca tgcaatacca cgcttttata gaaaagcacg atcaggaatt
    60241 agataccatt ctgaaaatgc attttttcta caaatactac aaagctgtca acagcgagct
    60301 aaacaccgaa ttccaaacat tcatcactag cgacaagcga aatctcggac ccttcatggt
    60361 gtctgatgca gatggagatc agcaaattgg agcagaacac attagagatc taagcttcaa
    60421 ggtattcaac gccaacctaa atgaccgcga cacaacagga ctggcattcc ccatactgct
    60481 aaccacatta tcggttctga accacatggc ggtacttaat ctattctatc atccaggatt
    60541 agtttttagg cttcttagcg aagagtcaac accaagtgct agtgaaatgc aacgtctaga
    60601 tctcatagca caaatgtgta gtcaggttag caacgagttt tttcgcacaa ttactaaaaa
    60661 acccgtaaaa ctccgagacc taatgacacg catacgaaaa ttcacatcct tgggattgaa
    60721 ccgccaaacc tccagaacgt acgcccaaat ggcactgctt caacctagcc gaacgacacc
    60781 taaaaaaggc agcgagatgt ggttcgaaat tcgacaacaa cttatcgttg cgatttacaa
    60841 tacatatgta ttttttatgt gtctgtgggt ttatagccca acgtttctct tcatccatcg
    60901 acgaaagatc attctcgaac aacaaagatc cacactcata ggatcgcgcc gcgaacttca
    60961 atttatctgg gacaacgtaa ctaacaacat tcaacacgat ttttatgtaa tgttcactga
    61021 agacgaattc aacgttacta ccaaaggggc cacggagctg gaaaaagatt acctttatcg
    61081 cgatctactg aacaagtggg gtgacattct cttcgtaatg aaacctaaac tcacgcccga
    61141 cgctcaatcc ccttcactag ataacgtaac caccgcagac gtaattaaac gttgcgccat
    61201 gattaatcta tccgaagtta atgtacctta cgagaccctg ctacctctca ctcatcaccc
    61261 cagcttcctt gacacatttg ttaatttagt tatcgtgcct gaattctcgc aaattcttgc
    61321 agtccctcat aaccagtttc tcactatggg atctccccgt ttgttacgtt taactcaagc
    61381 ctgccgcctt ttggtaccag accagattgc attgtataat aaattagttt ccctttataa
    61441 cttgactacc ttcatttcag agattgacgc cggagtattt cgtaccattt ataatctaac
    61501 actggaaatt gccgctttat tggaaaacct ttgcggcgaa ccagtgagtc cagaactgga
    61561 tctactggtc gaactcatgg cacaatcgct gtcacataat ttacaaacca cggtgaaccc
    61621 cctcatcgaa gaagtgatcc aaaacaacag caccagcgtc gccaaatatc tagaacacac
    61681 taatttatgt tactcatttg cacataccat aggccaactc tctgcagaca tgagtactgt
    61741 cgagctcact cttcagtcca aaacacttgc aaaactcagc atcactcaat ttctaaaaat
    61801 ggtacaagcc ctcatccaga aagatcaaca actgtccgac agctttcaca ggatccacga
    61861 tcgactacag cagattaaac agcggatgaa acaaattaca gaagatgtta tccaattgaa
    61921 tgagtattca aagaatcacc ccctggcggt cgacgttgta aagtgcctac gaaaggccgc
    61981 acggcagctg aaaagtttgg aggagcggtt gattttaatt atggaacaga ctcaaaaatc
    62041 gaacagactc atcattggct ctctgaaacg catcgagaaa acctgtatgg tgctgagtag
    62101 caagaatatc gaggaacacg gcatacgata ctgtatcgcg gaatctcggg gcctgttgcg
    62161 cacgcatcgg tccgtatccg ccatacccgc ttcggccgtg gattacctgc cagacaacgc
    62221 cgagtcgcag ttacgcacct ttctgaaggg gttccgagaa gccggcgtgg aacacagtcc
    62281 gcttcagatg agcggcaaca cggatatcca acaacaaatc cccatccccg aagtcttgac
    62341 aaaccgttat gaaccatcca accaaacaaa tgacctatta aactggtata ttacgtcaaa
    62401 agatcaggcg gaaaacgaca tcttgacttc aatctaccca gaggcccggc atgagtaatt
    62461 acccaacgag tgtgaatcat gaaaatctat ccagcgcgct tcgatcaaac ccacagccga
    62521 ttcgggccac gggcggggag ccaatgtgtt tccaactgtt ttatgtatct acacgcccta
    62581 catctgcacg gtgcacacac gacgctcagt aaggatacct tggacttgat attgacagag
    62641 ggcgctcagc tggacagctt ggtggaaacc atcttacagc aaaagcgccc gggtgagaaa
    62701 ctccctgtct tccgtttagg tgaagagatt cccaacatca tcaccagcag ctttggaaag
    62761 accgcccatg ctctctcacg accgttcaac gggaccgcgg agacccggga cctcgatggc
    62821 tacacttgcc tcggcatttt cgactttctc atgtacgcgt atcaaaagac caggcccgtg
    62881 tacatcctag tgactgtgaa cgctctagcc cgcgcggtga ttcttctcga tcacgacatt
    62941 ttcgtgtttg accctcacgc atctgaacgg tctcgctatg ccgcggtgta ccagtgcgac
    63001 tccctctatg atgtggtcat gctcctcacc tacttcggcg cgcgcctggg agatttttat
    63061 tatgacgcat tgtttgtgta catgcttgac ttatccatcc acccggtacc agaagcggac
    63121 attaacggcg tcattatttc gtcgtttcga gacccagaca tcgcgttgcc tgcatccagc
    63181 gcaccaccag gatctcctgt tcagacaatc ccaagtctac cgcctccaga atccacaccc
    63241 aagaaaacac ccgagaaaag aaaatccacc tccagcgcct cccacggcgg caaaaagaag
    63301 gccgctgagt tcaaagaccc aggttcctcc tcgtctcgtg tgtctacgac cgccccttat
    63361 aattgtttag aagccttacc cgccctgacc cgctacgaac gcttgattaa acaagccgag
    63421 aaggaaatcc aaaacatcac tatcaaggcc ccaccaaccg ctggatggat attgttttct
    63481 agttctggaa tgccgtttga cgaagcgttc cttacagacc ggatggaaca acttgtcatg
    63541 tcaagcatcg aacacgcctc ttgtctccac acccgatggc gtccgacaac tcctatgtat
    63601 caacaagtgc gacaacttag aggattttca gagagtattg atcgattctt gactctttgg
    63661 ctgcaaaacg acctccactt actggacatg tacgaagccc tcaaaaatgt taatacgtcg
    63721 tctctaaccg tgttacagag agccatgcta gacaagctgc gcgccgtgtt cgcgcaatac
    63781 agctccagcc aaggtccaaa agtggtccag tgggttaagg atattctaaa ggctacagag
    63841 aaagtcaact atactcacct tccaattcgg ttaatggaat atgttgaaga acacccgctc
    63901 gacatcgacg aaaccttcgt gtgtctgaag caacaagatt tttcgacaat tgtgaacgcc
    63961 gtcaacagtc gccgacagat caccactcag cagcaagaac aggtccagca ggcgctgcaa
    64021 aaactgtcag ccgctatcta cggaatagat agtcgttatc tggacagagt ttcgttcgac
    64081 gacaaggaaa caaaagacac tctatcgaaa ctcgataatc aatcacgcac aacgttattg
    64141 caaaggggca acaccaagat gaatgagctg aaagacgatc taaagcgtca aatcagcgac
    64201 ctgttggagc gcaagcacaa ccagattatc agcggcacgt tgcctgtaca agacatgcaa
    64261 gctctgcagc ggcgactgga acaagctgta aacttggcac aagaaatgtc ggagctacgt
    64321 ctctgcgatg tgaactttac gatacctttc agagagcttt ccaatcaact ggattaccta
    64381 atcacgggac aagcgtcctc gtcgaacgct atgtccttct ccgatgagct gatgcagcta
    64441 cgatcgcaat ttacctacgc cacccagact aaagaagata ccgaaagtaa aattcatgac
    64501 ctgatggttc acatagaaga taccgtacaa aacctcacga gccgcagctc caacatcacc
    64561 atgtccatga tccaggaaca actcagcgag ctacagcaac tcggaggcgg caacatgccg
    64621 gacatagcaa aacgtctgga aaaggtgcag aagacattac atgggctgta tcaagaagaa
    64681 caagcgacca gaatttttgt ccatggcctg aaatacgaaa acttaccgaa cgatcagacg
    64741 atgaagcgat acacccgtct ctcggagtta ctacgcgacg atgacaactt gcacgaagtg
    64801 ttcattgaga agatcctgga cattttcaac accatactgg agcggttatt tgacaagacg
    64861 ttccctaaag cacaagcatt tgacatgatc aacgcactca ttaatcagat tccccatgca
    64921 tctaccataa ttaaagatct ccataccgct aatgcggcaa tcagccaact ttccaaacag
    64981 ctagaggccc taaacaaagt ccctccggac aaacgcctaa acgcactcac cgagctcgtt
    65041 cagtactttg tctcgaacgg caaagttttt agtcacctca tgagcatgca agtaggcaaa
    65101 aacaccctgc caacactgta cgaaaatttg aagatggaac tggaagacaa gcataaacaa
    65161 caagccgaaa acaagtggct gcaagatgca aaaaaactga ccgtgacgtc agccgaaatg
    65221 gttcaccaat tcatgcaaac ggcccccagc gccacggccg ccgagctagc ccgacccgaa
    65281 ctgagcgcca aactgcagac gttcctagaa caggaagcga agaaacaaga agaagaacgc
    65341 aaaactgttt tcaaagaacg acaggggatg gtgacctctg aactcgctcg tataaccgac
    65401 gcgatcaagg cccaaaccct atcggtcata cccagcctga aactggaaag tcttcaagac
    65461 gtgatcgcct ccttgggctc gggagcccga gacatcttag agaagtttga tcgcagtctg
    65521 ctagctacac tttccaatct ggtgaaactg atggacgaac gcgtctcctt atgtatccaa
    65581 gacgtcttaa caggtcagga tacgcactat caacaatatc aggaagacgc cagggcaatg
    65641 cgccaaggac tgacgtacat agggactttg atgaggaacc agctgtctca agaaacccta
    65701 agaacattat caaatctggt tctacaatcc atgtttgtgg aaaagtgcca actgcgcgat
    65761 gctatgacgg tgttttctaa cagcgactat ctcgaagact accaacgcta ccgggccgga
    65821 cagcggcagc tggaaatgca gatccaagaa gccaggatgg agttgcaccg tcaggccacc
    65881 acggcagagc gagcgctgca ccaacctaac gcgcgcgttg atgccaagaa cctaacggtt
    65941 ggcaaagact tggcagagaa gttggacctc gaatccgcgg gccctttcca gcgatccgtg
    66001 tttgccactg tgctgactca gcaactggaa acgcacaaaa aaactctgaa ggacgaaacg
    66061 gagcttatga acactaagct caagtctgaa aatgaattac ggcaagccaa gatgacgtcc
    66121 ctatcggaac aatggagcga cttggtaacg cgccagaaga tggacgctat ggaggtcgcc
    66181 actccagacg ccaaacatct gatcctaaac cccgtggccg ccttaaccga gctcttggcc
    66241 aaagcctcca cgcagatgtc gtatctggac gccgaaaaga cgttcgcatg ggccttgctg
    66301 tttttacacg aagctaaaaa ccaaattgaa aatcatcccg gacacccttg ttacgcgcaa
    66361 ctccccaatt ttcccgttct catccaacaa gcccagggca gactggacac ggtgcgcgtt
    66421 cacgtgaata acaacgcgtc atgcgaaaac ttcgtagcgc aacatgaatc tggaggcgcg
    66481 attacggaca gggaaaccat tatgacggta gagactgtgt gggctaccct cgaacccaaa
    66541 cgcatcgctg gaggagaagc tcggtaccaa aaagtccaag aattgctgct ccgtatgaaa
    66601 caatcgctct cagatgtaga actgcaggac accctagcca cagaatacta tcaactcttg
    66661 agctctatcc aaacgtttgg ctacagcctg gactttaata tgcaattaca aaagattaga
    66721 gacttaaaag cacgttttaa tgaattaatc aaacaacagc acctgaatac gtctgaggaa
    66781 gtgcctttcc ccatgcctcc gattccaggg aacgacatta ccgtagcttc acctctgtct
    66841 ttcgcaaaag gtttagccgc cctggaaaga tatgtactgg ccgggtatca atacctaacg
    66901 gagtgtatca accgccaacc gctcatctgt cagcgaatag atgacattcc ggctgtcttg
    66961 ccacctactg acatcgatca caaaaaagcg gcgttagacc gcttgaaacg tttgaacttt
    67021 agtaaaaaga atgacacgta ctacgaagta attgatgcgt tcggcctcca tcagctcatg
    67081 tcacgaacag gcactccctt gcactacctg ttaagctacg gcaacgtgtt gttcaagtat
    67141 ctggccctgc atcatgacga aaaacaccta gcaaaaaagt ttgcccaagt taaaaatgta
    67201 gtcacaggca gatacaaagt ggtcactgtg actgtagccg tagctcaaac cattaaatct
    67261 ttctggaccc agatctccca atatgaccta aaacccctgt tatcgggcca gccgttactg
    67321 ggtttaggag aaacaaacag tcttgtgaat ttgaaaattt ttatttacat cgttgtttca
    67381 gcgtggaact tgcaactcga cgtgtcccag gatatcagcg gaccagtcat tcgaattccc
    67441 attcaggacc tctgcatcac catcaccacc ttttatccag aatacatcta tggcattgta
    67501 aaacacccca tccagaacac tctatcctcc cttgtgcgtg ctctaaagaa ggatatcgtt
    67561 caggaggcca ttaacaatgt ggtccaaatg ccgccagcgt ataacgctga cgaaatcaaa
    67621 ggattttgcg tgaatcccaa aatttggtca tcggttaatt taagccgcgt cttgtgggac
    67681 cacaacctgg tacgacagat ttgtgcggtg ggcccccgca aaaacggcaa tggaaaactt
    67741 tggcagtatg cggtagctat ccttatcttc ccgcaagatc tcttacaatg cctctggcta
    67801 gaattgcggc ctaaatttgc ggaagagttt gcgaccatgt ttgacttctt ccaaaccctg
    67861 tttatgcttt tcactcacga gtacgacatc gcccgtgagt ctaacaccaa cacacatctg
    67921 aacactggag aacccattat gcagaccatt agcatcagac acaaagaata caccgagaaa
    67981 agtttgttag acatttttat tgagactgaa accgccctgg attacgcgtt aggatcctgg
    68041 gtgttcggcg ttccggtgtg ctgcgccatc cacgtagcag acatcctagg cggcaaccga
    68101 ttactgttgg cacgtcatct agaatataca aatcgcgatc cagattttct ccacgttcag
    68161 agagctaaag atctgaatct gaattacctg gtaagccaaa catggacaaa caccccgctg
    68221 gaacaatgtt ggttccaagc tcaaattcaa cgcattcgag aacacctcag aaccccatta
    68281 caactcgatt ttattcccct gataatctac aacgcccatg acaggaccat ccactctatt
    68341 ctccgtcccc cgaccaccgc cgagcgagac gtgtctcgca ttatggtaga aaatcccttc
    68401 cccaccgtac ccttgataga cgtgcccgag tccgacttga tatcttttac ccgtgttccc
    68461 attaatacgg actttctccg agaagacccg cctcccatat cccgtccccg aagtcaccgc
    68521 agcaccgcta gcggcgtcag cagaggcagt aaagccaaac catctaagac tacacaaggc
    68581 ggcgctacag cctcaaagtt gccatcatcg tcgtcctctt ctgaaagagc tcgagtgcac
    68641 actgtaggtt catccgtaga cgtccccgaa gtagtgtccg aaggcgaaac aacatcgggt
    68701 gatgagacag agggagaaga ctttacccat ttaccttcag aggaagaaca gcaatcgcta
    68761 ccctccacac gaacctttgt ggagccggtg ttccgtcaga gacctctgca aaccatcgtt
    68821 cgcagggaag atgtgaccac cgtgtcccct agcgctgcca gttctagttt taacaatccc
    68881 cccatcacca cactcacaca gaatgttatt agtgccattc aaatcttgtc atcggtacgc
    68941 gtcgacctga gatcaatggc acgctcagtg aatgaaacca tcaaccgact acggttcctc
    69001 tatttattat aaacaggccc aagtagaacg agaaggcaca aaaatcaaaa agaaaatagc
    69061 aacatataca aaaaccacgg ctaacgacga gttctggcta ccgccaacat gcgcaacagg
    69121 tccagtttga acgcatattt gtctgtgaaa tagctggaca tccgaacgta tttagccagc
    69181 atggtgttcg tcacggggtg ttccatgctc tcttgcggca aatccagcac gttggtgcac
    69241 acgtgccgcc gcttgtcttc atctcttttc acggtgggac cggtgccgct cgagctagac
    69301 atgactgccg tgacaggccg tctgtttcac caaggtgcaa ccccgacaga gcgtggcgca
    69361 gttctcgagc tccaggcagc tgtctcgata ctctccggac tggcagcgcg agcacaagag
    69421 tccgtgcccg tgccacgtga gccgcagcaa ccgtgggatg ttgacggagc gcaccaccac
    69481 ggtggagtcg cacgtccgcg ccgagcaggg caagataatg tcaaaagtca cgacgtgatc
    69541 gtacaccgca cacgcggcgt tgaggcccaa caccgccttc cagccgaccc gcaggcagcg
    69601 atgcccataa atggtctcag acaccacctc gtaaacgcgt tctttaatga cacgctgact
    69661 tccgcaaaga gagcagtgca cgagttcggc gttggtattg aaaatgacac tcttttcctg
    69721 gcggtctcta taatagaaca tggagttcaa gggaaagttc tgctcacact gcagcttctc
    69781 tttgcccagg ttgagacagt gtccgcattg acgacacacc acggcaatca gcgacctgga
    69841 gtctagatgg cgctcacact tcaggcgaca taagcaccag agcgggagtt cgatgacgct
    69901 gccaatcaag cctccacgca gcgccaccgc cagtccgtgc atgacaatct tggtaggttc
    69961 tagcggtcgc ggttgtttgt gagcgcgaac ctcgtcgttg agccccagag ctcgcagcgg
    70021 taccaggtac cgcggacagg tgtcacagaa aaattgtatg gcctgtcgag ccataacgta
    70081 tagtgggttg ccgcaaggca cgggtccggc gtgacggcgc agcgccgcca cgagcgcttc
    70141 cagctgcgcc gagcgcgact tgcgatgccg cgcccactca ttacgatggt acacagccaa
    70201 gtcggcgcgg ccgtcgaacc ttttggcacg caacagggaa agacagggag aactggtttg
    70261 gttgagcaca ggaagccgca ggtccacccc gaacagaaag cgatgaaaat cccctaaggt
    70321 agatgaggtc attccatcca gcaaggcgct gagcttttca gcgggatact gttgcaaacg
    70381 aatgtacaca tagtccgcat cgtagcgttc gaaacgcaag aaagcgacag tcctcgaaac
    70441 gccgtgaaaa caattcatgc tgtacacgta ggccaggaac ataaagtagg gcttagtcat
    70501 caccatgcgc tgaaagaaca tggtgaccgc ctctcgctcc gcaggtgcac atgccagcca
    70561 ttcgtgcata aagcgctggt agaagcgatc cccgagctcg cggtttagaa atcgcttgtc
    70621 ggtgacaaag agttgcaggg cgcaaatttg ctcctcagtc tgccaggcgc cacggcctat
    70681 gaccatctgc acatgaaaat gctcatcgtg cgcacacaga ggagcaaaaa gcctccagag
    70741 cgcgcgatga aagtcacgag acatatcggt atatgagaaa tagcaggact cccatcacca
    70801 ctccgatggt gaggtagcgc aggtccacac gaaacgagga ggcccaccgc atgtgcgcca
    70861 gcgagcgcac cccttgcgcc gcactgatac gcggctcctc ctcttgcccg ctgccacggc
    70921 cgccactaca gcagctaggt cccgccgtcc tgcagcgaca tatgccatag aagccacctg
    70981 gcggaggcgg aggaggtgtg ggcggtggaa agggcggcgg agcgatcgtc attcgcggcg
    71041 agtgcagccg cttgcggctg ttgctgtggt ggtgtcgcaa cgccgccaga cgggatcgaa
    71101 tgacggctcc gttggccgcc gcctttttgg cacagagttc ctttagaaga ttctcgtatt
    71161 cggcctcgtt ctcgggtccg aaggcaatga gttcgatatt gaagacagaa ggagagttag
    71221 acttgcgcac cacgcacttg gtgagcaccc cgtaggccga gggcttgatc tcctcaatgt
    71281 ccttgagagt aacaatgagc gagtcgttga ccttgagcac gttgaactcg ccgacgtgcc
    71341 tagacgagac gagtttcaac ggcgctcgaa caaaacagca gagagacacg gcacagccgg
    71401 tgtttttaaa aatgaagcac ggcacgtgat ctgtgcgact ttcccaatag ctcagcagat
    71461 actcaacgca ataaaccgta tcggtcttta acatagcatc acacacagag taattggggt
    71521 ttttgcagat gagccctgcg tcagtcacac gcaactcggt gggtcccagt ttcaaaatcc
    71581 ggcgcgtggc cgaaacgaga tcgtgatgaa gccccttact gatttccatg gcgcgcgcgt
    71641 agtgtacatg cgttttattt acccgctgat tcctcttttc cctccaatat cccgttaatg
    71701 tccatgagct tgttgacgat agccgttaat agtttcgtct tttcgttcag aatctgcgca
    71761 tgattacaag aggaacactc cccgtgcacg tacttgagaa acgccgcgta cttttggccc
    71821 gcgttgatga aatttaacct cgcgtccagt gagggcaaca tcagttcata cacgcgcggc
    71881 agcatcggct cgaaggaaac ctccagctcg tcctctggat ccagagtccc atcctcgtca
    71941 tcgtcaggat cctccccgtg taccgcccgc gccgagcgaa acgacgccat agatagagtg
    72001 tgtgtccgat atagatagat cactagccct ataaaaaacc tttatcactc ctctagcctc
    72061 tcttcaacat gaatcaccac cccacttccc gcaattacgc ttacaccggc tgggaattag
    72121 atctgacaca accgctcaac gaaattacga atgaactgtt atggcacgcg caccctcgtc
    72181 aagtacctga agccgccgct gtagcagcag caactgctgc tgccgctaac gttgctgctg
    72241 gcacgtcgca aactggatcg atcacagctg gtagcggagg aggggaccgt gccagcaaca
    72301 atccctttct cttcacccag tcccaatgta ccgaccagtt gttcggcggc ctcggcagcg
    72361 gccagttctg cgacctagac tcggaactgg ccacttttga attctccgac acagaacgac
    72421 tcaagaagtt atgtacccca ctaaatatcg acacacgatg caacctttgc gccatcatca
    72481 ccatctgcct gaagcaagac cccgatcaag cgtggttgct cgattacagt ctactgtgct
    72541 ttaaatgcag ttcggctcca cgcaccgccc tcagcctact gatcgtcatg tccgaactga
    72601 cccatttgtt gcgtcaacac ttcccggacc tgcacattga ccaacttttt cgacaacacg
    72661 tgttgacggt gtttgatttt catctgcact ttttcatcaa ccgctgtttc gagaagcagc
    72721 ttggtgatgc ggtagaaaat gagaacataa ctttgagtca cgtggccgtg gtgaaagcct
    72781 tagtcatggg cgacgagatg gtaccgtacg ccaaacaccg ctgtttcagc caccacaagc
    72841 aaaaaattgt agtaaaaatc cccgaggccc caaaacaatt gttgcaaaca ttcacagaac
    72901 acagcacacc gactcccgaa cgcttcacct atctattgtt ttacatgtgg gcgggtaccg
    72961 gggtcatggc aaccacggga ctttcggagc tcacgcagag taagcatcat ttgctcgata
    73021 gcgtagcgga cgctgatgat ccagagatta acaaagacgt cggccccatt tacctctccc
    73081 ccgtccccgt gtttcaaacg aaaaaccaga ccaacaccgt gtgtttgctg tgcgaactca
    73141 tggcttgttc acactacgac aatctggtgc tgcgcaacct gtacgaccgc atcaccctgt
    73201 actgcgaaaa caacgtgaaa atggtagatc gaattcaact agcgctggca gacatgatgc
    73261 gggagtgtgc ggtgcccatg cattcccagt tcgaggatat atcacgctac acccgtctcc
    73321 caccccctgc aaactatctc tccgaacacc ccgtgcgccc agatcccatc gtttgtatta
    73381 ttttgcgaca agcaggtgtg accggcatct acaagcattt tttctgcgat ccgcagtgcg
    73441 caggcaatat ccgcatcacc cgcgaagagg ttctgttcgg aagactccat ctggaacact
    73501 tgactgaagt gaaactcgcg atttgtcacg acaattacta tataagccag ctgcccagac
    73561 gcgtgtggct ctacattacc atttttaaag cattccagat tacaaaacgg agctacaaat
    73621 ccaaaaccca gctgtcagat tttatgcgtg aattcacaca gctcctggaa gcttgcgaaa
    73681 taaaactagt agatccagcc tttgtggtcg ataaatatgt ttaacggcgt gcgatccaca
    73741 gagcggcggt ccgctctgcg gtcgttgact cgcaagcggc ggccgcgacg cggaagtctt
    73801 ctgtcccccc ctaatcagaa accaacatcc tcatcgccct cagaaatcgc aaccccccga
    73861 ccacggctga cgctgcacga gttacacgac attttccaag aacaccccga cctcgaaata
    73921 aagtacctga acatgatgaa aatggccatc acgggcaagg aatccatttg cctgcccttc
    73981 aactttcatt cccaccggca acacacgtgt ttggacattt cgccctacgg taacgaacaa
    74041 atctccaaga ttgcctgcac atcgtgtagc gaaaaccaag tattccccac cgcttcagac
    74101 gctatggtcg cattcattaa ccagacttca aacattatga agaatagaaa tttttattat
    74161 gggttctgta aaagcagcga actgctgcga atgtctacga accagccggc cattttccaa
    74221 atctactaca tcattcacgc ctcgaaccac gatatcgttc cgttcatgtc taccgaccgc
    74281 gatcggctgc acatgcacat cattttcgag aaccccgacg tccacattcc gtgcgaatgc
    74341 gtgtcgcaaa tgctgctggc ggcgcgcgac gattaccaca tcaccctcga catcgtcaaa
    74401 ggccacgtgg tcatcagcgt gctgtgccaa accctgaccc tcagcagcgt gaagatcgat
    74461 gtgaccgttc tgcaacgcaa gatcgatgaa atggacatcc cgaacgacgt cagcgagtct
    74521 ttcgagcgct acaaggacct cctgaacgaa ctctgccatg tcaacaatgc tcgctcgcct
    74581 taacgcaata tggcaggaag gagggctcca gatagatgcg atgcggtaaa atgcctagca
    74641 aaaacttgtc ctttcttagc gtctggggag gaaacacggg ggagagaaca ttggttacag
    74701 atttaatgac ctgatcgaaa tacttatcgg catgaatcgg caccccgtgc tcgcgcacgt
    74761 aggtgggatc ctccgcgatc tcgtaattgc gcaccccgct actgcgaccg tcaacaggcg
    74821 ctgtgagcac gtaaaacaca cggtcaccca ccaccggcag ttcctccgag cgggccgcta
    74881 atcgcttaat gaccgcgatg tgtggtaagt tggattgctt gtacagcgaa acgtctttcg
    74941 acaagacaga ggagagaact agctcttcga ctcgcgctcg agacgtataa agctcgtccc
    75001 gagcctggga caggcgctgt ataacgcgcc caaatcccgg aggcacgccc tgcatcttga
    75061 gctcgtctaa agtcaagcgc gagagctgaa ccgccgcccg agaaacttcc ggatcatcaa
    75121 aaaggagctg gataatgtca cgtgtgacat tcttaacgaa ttcgcacgac gttttccgca
    75181 ccagatccac tcccttcatg ctgagctccg tctcccccac tatcttaccg atatatcgtt
    75241 ttttgcaaat catcatgagg gacccgaaca ctttttcgaa ctctaacttg atgggatcca
    75301 caaagagaca ctgggtgata taatgagcca aactggggcc gcgctcaatg agagctgcgg
    75361 ccgtgacacc gcgatagcac acgaaaacgc tatcggtgtc tccatatatc accttcactg
    75421 ctaccggatc ccccgaataa tcctccctat taaaaaaatt gtgtaaaaag cacggctccg
    75481 caaaattttc ttccacaaac tgcgatgtgc gcattagcat atcgcgacct atgcgggtga
    75541 tactggcggc aatgggtaga cagggcatca tgccgttcac cacgccggtg aagccgtaga
    75601 aagcgttgca ggtgaccttg agcgccagct gctccttatc cagcagcatg cgcttcacgg
    75661 gatcgtgaca gctcctcatg gtctcgcgaa ccgctcgccg ctgcgaaacc cattttgtca
    75721 gcagctcgga cagcacagag ttgcgcacgg tgttcttgac aaagcggtaa gacagcccac
    75781 tctccagctc caccgtgagc acatcgctct ccggcggaga ctcgccccca ggcgccacaa
    75841 acgtggaata acagagatta tgtgccatga taattgacgg atacaggctg gcaaagtcaa
    75901 acaccaccac gggatcactg taatacccca cctcgggttc gaacaccgtg gcaccttgat
    75961 aggaaacatc agtgggctct gaagaattgt ctgccccctt gtgattgggc attataaaat
    76021 cccgacaggc acactcatct agcagagacg tgtaaatgcg gatctgctgt ccatcaaaaa
    76081 taacacgacg catagggatt ctcgccaacc gcgcgatggc ccccgcctcg tagtgaaaat
    76141 tgatggtgtt gaacaagtcc ttgacaagta cagcgtcctg aacacaatac ttgcccacct
    76201 gcgcccgtcc ctcgcaccca gaaatgaatt tgacgggaat atccttgtaa gacatgtctt
    76261 ctttttgttg tttcagatac aactcggcca tggtgttgag cttgtaattg ggagaactag
    76321 tcttggccat gcacacggga tacatgtcaa tcaccacagt ccccgagata aacactttag
    76381 tggtggtggt agtgacgaac ttcttaagag gagaatacat gctgaaacgg ccctgtgcag
    76441 gcaacttgct gtacggacct ggactcagct tgtacacaaa ctccagccgt gtcaaaatgt
    76501 acttgaaatc aaaagagttg atgttgtatc ccgtgacaaa acacggtgaa tagcgctgaa
    76561 aaaagatcag aaagcccaaa agcatttcat attcagaggg aaattcgtag acatcaaccc
    76621 ctgctaacgg tgcacagcta cctatggtga acagatgcaa tcccgaagtc ccaaacaccg
    76681 tgttctcctc gcacccagtc ccccccgtgt tatagcaaac acacgaaatc tggatgacaa
    76741 tatcatccgt ttgctcggcc gcggggaatc ccccactggc actcatacac tcaatatcaa
    76801 aggacagaca gcgatagacc ggccacgacg tatcgtcgga cacagccata atatctgcga
    76861 cgtcgcagtc tatttcgaaa tcacaagtgg atgatttatg agtgcgccac tcatagcggt
    76921 gcacgcagca ccatccaaac gttgtcatct tcttatcgat gacaagccgc gtcaagggat
    76981 ccacacgaat ctcgtagacg gggatcccat tttccaaaag gtactcgccg attttcttgg
    77041 ccatgctcca attactgatc gacacccgaa acaaattggg tataggtgac gtcccgtaac
    77101 cgtagatgga catcttttgc accggggtaa tcgtcagagc ataggccatg cgaggttctg
    77161 atactaagtc tgagacactg gccagaagat cccgaagcag gtcaccatct gcatattcac
    77221 agtaaaaata gcttctctgc ccaaacacat tcacgcagat gctgtgccct tgttcagtag
    77281 caccaaaaaa gcgcaaaacg ttccccgatg gtgtgatgtg atgacggtag cgaggagaca
    77341 aacattcctg agtatcgtga gtcaaaaccc catcgacctg atcgtaagtg tgaaacttga
    77401 gcggtcccat caaacgccta gcgaatgcct cgatggatgg cggtggcgca ggtaaaggac
    77461 acggccaggc catgtcattt tcaagtacat gtttaatgtc ccgataaaac ataattgccc
    77521 cacgcccagt cttatgttta atgagccccg attgtccatc gtgcatcgcc ccgcgaggca
    77581 caatctccag aaacgtcttc gccacggagc gcttggcgac cagattcgga ggttttcgag
    77641 caccactcag gtaaggattg aagaacatat ttgcagcggc tgtcaatcac acctcgtact
    77701 cgttctgaat cttttggtag ccccctcgcc gtctgttgcg caagcggtcc aagaagccgg
    77761 cggattgacc gttcgatgcg aaatcttcgt catccgcttc tgcctttctg cgtttttctt
    77821 gatccagttt ttgcaaagcc aaaagcatct gataggcctc ctctaaactg aattccttgg
    77881 ttgcggaggc tgctttctct tttatgtttt catactggct ttgttcatac gaaggcggag
    77941 cttcctttac cgtggttggt ggaacgacat acgggaaaaa gtgctcgaag ggcttctcgt
    78001 acgcgcgctt ttgccgcatg tagatcaagt aaataacacc cagtaccgca agcaaaaaga
    78061 gaatcacagt gaaagaaccg aagggattct tgatgaaacc gacgacacct tccacaaaag
    78121 aagccacagc accaccgaca gctccgatgg ccacacccaa agccttccct gcagaaccta
    78181 gaccgctcat catatcatcc agaccacgaa gatatccagg cactttgtcg aacacctttc
    78241 cttccacgtg aatcattctc tgcttgtacg tattgaactc tcgcatgatg tcttccaaat
    78301 caaacacatt actagaccgt aattcgtcct cagagtacag ttccaaagct ttgaaatcgg
    78361 tgttttccag cggatcaatg tccagagaaa tcatggtgtc tacggtggaa atgctgtcca
    78421 gtggaatcat tcttttgtac agatagtcaa catattcgta agacgaatta ccagcaatat
    78481 aaattttcaa actggggtat tcacacgcct ctgtacgatg gcgtccaagc aaaatttcat
    78541 tatattcacc aagctggcca tactggacat gagaactgtt tttaaaagtg tacagcacaa
    78601 ccggccgaga atagcaaaca ccacattcct ttgtacgcat atcacgtagc actttgacac
    78661 tgttctgatc cacctccaca cactgagcaa gactgataac atctccaaca aatcgagcgg
    78721 caatcggttt atcgtaaatg gcagacagca tagcactggg attgattttg ctgagttctt
    78781 tgaacacttc caatgttctc ttctgatctt tacaccatgc ttcagcgatt tgcctgagag
    78841 cacggttaat gtaatttctc aatgtatcat aagtgtactg caattgagca tacactatgc
    78901 tttttagaac ttcttctgag gttttgttag agtccgatgc ggaatcagta gaacgttttc
    78961 tacgagtact actgttggta ttgttgtaag ctacagccaa ttcctccatc tcaagaatcg
    79021 atttttcttt tacaggtaac caaaacacaa tcaatccacc agtggtttca tacatagaaa
    79081 catttccaga ttgtacatat gtctcgttat aagatgtatt aaaaattagt tgtaactgct
    79141 cattagcttt atccttaata cattgaaaag aaggatcaga ctcatttagt tcctcttttg
    79201 aagttaaaaa ggtggccgtc atactgctag atgtataatg ataggtatca tcagcctccg
    79261 atctaattgt gcgttctgat tgttcccaaa acgtgtattc acaggtatta ttagcttcct
    79321 caacaatatc ccacgacata agcacatctg gccgttcaaa aaaacccaca agcggatgcg
    79381 caacttctgg agcattgtct cttccatagt acgcaatcat agaatagttc tttctgacgg
    79441 aaaatttgtc acggttttct ccaaaatgct tattgttaga tccattgtaa aaaggagaaa
    79501 tgtccacaac tttaccatca gaagtcacaa aaaagtcata ggggtactta gatctagctg
    79561 tagttacggt caccatgcaa tttacattac aacttgtagt atacagccag gtactgccag
    79621 gtttgtgcca aagttctttc acagtcacaa agcgggaact atgagtattg gagaaatcat
    79681 cctcaaccag aagcatagtt tcattcacat aactgtccct gtgataattt acataagtag
    79741 cacctgccac attcctgacc acggaattgt aacatctatt caatttatta atgtaatgaa
    79801 cttcccacat tggtacggct agatgctctt gactaaatcc caacaaatga ttttctctga
    79861 tgaaagaata gctctggcga aatgtcaaaa ttttttgata catatgcact ttgaaagtgt
    79921 atggccgaat atcacgtttg taaaccacca taataccttc ttcaaaatct tctttcgtag
    79981 gtttgaaact atcacaatta atgttctgct caaatcgaag aagatccgtt ccctgggcca
    80041 ttgagcaaac acgatacgga aatttggaca tatttatctt aaaaacctca tgagttctca
    80101 acgttgtatt ttcaattaga ggtcccgtag tattttcagt aggcgaagta ggtgttacgg
    80161 caccagatgc agtgccagta ctgctagatg caattgaaac atacacaacc aacacgctag
    80221 cacagagaag cgggaaccaa ttcttgctca tcttgatccc gtaccaagtc aaacaaaaca
    80281 gaaacgtccc gaggccgttt cctggaagct cgcgctcgcc gaggaatagt cgctggcacg
    80341 ctcacactgt ctggctcgcg aaacacgttg ttctgctcat ccggcctggc cagatgccta
    80401 tagaggagga gatacaggtc ctttgattta taaagtgtgc cttcgtgacg caaaattaga
    80461 ggccactctt tgttatacgt cagaattaaa tcgtgatcgg tggcaaagtc gtcacgcaaa
    80521 cacgcaatcg tgagctgttt tccaaaggtt tcgttatata gtgcgaccga gagaacgagt
    80581 tctcggacat gtttccacat ctccttttgc aacatattca agtccccaca agaactgaaa
    80641 tcaaagaatc cttgatactt gaccaccatc cactcactag gatacacggt gccctccgca
    80701 cattttacca agtcatcttt gatgtgaggt aatactccag cgttatcaca agcataagcc
    80761 atgtccacat tatgagaaag ggggtagcga tccgtacaat gtgtgaacag gggaccgtta
    80821 cacaattggt agatctgctg acctaacaga ggaagggact ccacagggag acttttgtga
    80881 attatgttgt ttactacgta taaatgttcg tcatagctga gcacttgcga aacgtccacc
    80941 acatcggggt tgtctctgta tcgagtgcgg taaatgaacc cattcatgag tctggagata
    81001 aagtccagac acacggtacc gatgaggtta acatcaatta gcttgctggt caatcgctcc
    81061 tgcgatttta tgcagcggat gaccttggcg tagcccacct ctgacacttt ttgcaagtac
    81121 gcgcgcttgc gtatattaac ctcccgagtg acgttgtgaa tccgcgtgcg cgcgtccatg
    81181 tagtccagaa actcgttgtc ttcgtcggga gccccgccgt tactggacgt actctggggg
    81241 tcctgcccat gaatggccgc gcccaccccc tctgccgccg ccgccccatc tggcacggga
    81301 cgcctgatct cgtccaggag gcatttgatt ttggtataca tttcgttgct ttcgtggagt
    81361 ttgttgaaaa ccgggttgtc ctcgaaagct tgaatgctga gggatgtaat taggtcgatg
    81421 atcctgctgg gggcggcaaa gaccgacccc acgaaaagac gctgctcgcg ggaaagcagc
    81481 ttttccccga gcacgaaaat gtcctccacg tcctccccgt acaggtacct gctgaggacg
    81541 ttcatgagga ccctgcacag gtggtgatag atatttagct gctgcatgct tatccccacc
    81601 cgcttgacta taacctccga ggtacgggac cagtaggtaa aatccgacaa ggaatatatt
    81661 cgtgccggta tatccgtaaa caggttgtac tccctcagcg cctcctccgc ctcctggata
    81721 tagctgtggt agaccgaaga agaagagaac aggtttttga gggccgtgag gaccccagaa
    81781 aggctgggga tgcgctgcgt cagctccgtg agatcctgct ccaccgtttg tatattcaca
    81841 tcgcactggc tcgacggccg gtggaccaca atatggttgc agagcaagcc ctgcaggcgc
    81901 ttgttcagcg agcgcccctg gttggggatg atggtcagtt cctcgtagca ttgggcgcac
    81961 gttgttccct ccacgtacgc ctcttggcag gctaccggtg acactccgca caggcgacgc
    82021 agcagctgga ggagttgcga gcagacctcc agcccgctct ccggggacag gatcgcgtat
    82081 acgtagttca tcttgcacag gaagcgctcg atgtcgttga gcgttgctag cgtgacgctg
    82141 aactttacgt tgtccgtgaa cgtaagctcc accgtgtggt gccgatcgca ccgatctaag
    82201 cgaaggactg tacggtagta ctccgcccgg tcctgcctcc tggagtacgc cttgagagcg
    82261 cggtcgagca gctccgtatc ctcgtacaga gccttcaaaa tcatctccat gtacaggctc
    82321 aacagcgaag tctgtgtacg gttctggcgc accagctccg ggtagatcct gcggtacaga
    82381 taggcgatag ccagtgcgtt cttcttgaac ggacttgact ccgccagtaa cacgctcgga
    82441 tcgcagtact ttagacactc cagttccatg gcgtattcgt tgcatttgga acacactacg
    82501 cacagtttct gcaacaaatt catctcccgc accctgctcg tccgcgtaac agacggcgtc
    82561 ctccgttatc tgctcggaga gagacatagg gacggcacac aaataactcg ctcagtccac
    82621 agtctgccgg aacgacgacg ttaatatata acggcgttca cggcgtttat tacagacggc
    82681 ctctcttggc cggcagtaga ccacagtcgt cgtcaaaggc atgctctccc ccgcccgcat
    82741 tcacacccac cgagttggct accgcctccc cgacagcagg ggccgtaaac agcgcagaca
    82801 ggtcgtgtac ctcacccccg ccaccaggtt ccaggcgact gtctaacacc tgctgaagat
    82861 taggcaggga aaagtccgac acccccatct cccgcagccg ggaaaacttc tccatcagag
    82921 agtctgccac cacctggcag ccgtccacaa aaaataacac gtcgtcccgc tcggggatct
    82981 cctcccgagt actcagaatc tcgtacatag ccataagctc gggatcaaca tccaggttgt
    83041 cagagtccaa agccgccatg actctgttct ttatgatgtc ctcatcgaaa agtacgttct
    83101 cgcgccgcga gcgcttgatg agaacatcgg acagcttggt ggccaaaata cagcgctgtc
    83161 gcatgaattt gtaatcttgc cctcccatag agttcgtgtt gaggctccgc tccaccccgt
    83221 tacccgaaaa gtacccaatc tgcccgaact gatagatgtc cttattactg ttgaccccag
    83281 cgtacttctc caccgagaag ctcacagtaa tcagagatct ctgttcaaag atggttcgca
    83341 tcagagactc tcgcgtgact gtggccgcta acggtgcgat gacgccggcc gccttaagat
    83401 ccttcaggcg cagggcgaaa tcagccggtg acgcgaaatt gggtgtctcc cccagcaaat
    83461 aaggaaattg ggcgtgattt tggtacgtga gtctggtagt taggccgtgt aaggtaccta
    83521 tgtagtcctt aaagccatag aaacaaagga acttgttgtg aaaccgatgc tcgagatagt
    83581 tgagcatgca atccggtgcc acgtcaatga gatcgtgctc gttgtaatcg gcggtgaccg
    83641 aaatgacaaa cttcacaaag ttgttaaact cccccatgtc cccgatactc acattcttgg
    83701 gcaatgcgtt ggcacagacc ttttgccaga actgtaagca tgagaagcca caatcaggga
    83761 acaacttatc gtgatacttg tacagcagga agccgagaca gcccttcacc gggttctttt
    83821 tgggcacatg ctcacggcga aaaaacacgt gagccgtggt acctttactg gctttggaga
    83881 tgggcctatt cttaactctg aacatgagaa gggcaggcac agagagccga gagagcttaa
    83941 tctccatggg gatgactgag tacgtcccac gggcatagag tttaaagtcc ggcaggcggt
    84001 cgtgatccac attcttagag gatttcacgt tcctaataaa caaaaaaccc tttctagagg
    84061 aagtggtgga aaaagccccg tgaatggact ggaagtgttg tgtaacccaa cgggaaacca
    84121 gactcgtggt caaggggttg tctacaatgt atgaggtagc cgtgatgaga gccacatttt
    84181 ggatgatagc caaaatgaca cggtaatact cataggacag gatggggttg aaagcaacgg
    84241 catagggact gaggtcaagg ttaaaagcct gcgtggcccc ggacacttcg tcacgactgc
    84301 ttttcatgcg aacctcagag acaaagctca tggcctcatc atctacaaac ttgttgagcg
    84361 atgaaaccaa gttaataaag tcggccctgc cgttgatagt catggtatcc tctcccgtca
    84421 ctgagtctat gagtctcatt ttcttacaat agtccagaat acggttaagt cgatgcgtgc
    84481 ggtccacgct cgaactggca ctgcgattag acgtcggcgc tgacccctcg tccgctttgg
    84541 tgtccaggtt cgtctccttt gactccgcac tgtaccgacg cccaaacgta cccagtgtgt
    84601 ccacatcgtt caaaaagcga gactgcataa ccaccacaca gggctctttt ttaggcagcc
    84661 taggaatttg gggaaggcgg gtttgaaccc gtacaaaggc agtattgtaa cacgtatggc
    84721 aacatgtccc gccgcaagcc ccgcacagac tagatgagca accgattaaa tgattactca
    84781 gagtggatga acccgttaac ccggtattgt aaacagaaac tcgattgagg taccaaacta
    84841 gagcggaaaa gagttggggg cacgtaccgc agatgagggc caggtgatga ggcgcatagc
    84901 gctcgtcctt cacaaccgta ccggaagatt tgataagttt cctagcatcg ttgtaggtgt
    84961 cctcacacaa ccccgtgagc ccgttggcaa aatgaatgga cttgagcagc gcctcttgac
    85021 tggccccggt accactagca tttttgttgg atgtcaggta gactaaccta ttttgataga
    85081 gaatagagtt acagctgaat agtaacgcac taatgtgagt tgagaggtgc agcttgagct
    85141 ccgtgagcgc cttgatgagc tcgcgatggt ccgcggcgtt catcaccacg ggccactcgg
    85201 agtacaccat agagtctgaa gctccgtagg ctgaatccag aaacaccgaa gcgaaactga
    85261 aacccagctc acagatgacc gcatcactta gcataagttg gtccttctcc aaactgctga
    85321 gcttctgact cgtgtaccca aagtatttct tgtgaggcgc cagcttcacc gattgctgac
    85381 tatcgtgcac gaattgcttc aaagctgctt caatgagtac cttggtttcc gaaaaacgta
    85441 gtgcctgaca ccacgaagtg taaacataat agaacagggc ttcgctcaca gcaggcacat
    85501 acagaccccg agactccaca aaggaattac gtttatctag agacacctca tcagaatcgg
    85561 catctgcctg cagagagcca aagagcgttg gagggtacag cggtacacgt acggcgtcac
    85621 agtcattgag tcgagttggt acagcctcct cgaaacacgg gattaactgc cccgcataga
    85681 gaaattcctt aaggccgtta cccaccacca cgtgaactac cacttcttgg ggatcacaac
    85741 cggccgccgt acacagcgcc gccagatcgg tgggcgctcg gccctcctca ggcacgtagg
    85801 tctccaaaga gtatttctgc cgtgtttcgt cacataatcg ctgcacctcc ccgtgcggct
    85861 ccgaaaaatg tattatttct cgcgtgttat ggaagtacat gacgaaaggg cagaaggacg
    85921 tcaccttagt aagcacccca ccgtcataac acacaaccgg tgttcgcacc gaagtgcaaa
    85981 aatcttgatc caccgtgagc cccatcaaga gcggcgcaat caccactggc gtcgaacggt
    86041 cgcacagcga caacgtcgct aacacttcat tcatctccgg gttggttttt gtgaaataca
    86101 ggtaggcggc cggccccacg ggagcaatag cgctaagttc ctcgttgctc atggtggtca
    86161 tgtaacggtc tgcactccta ccaagtgaac tttatactca ggaggactta agacgtcacg
    86221 gttgacgcat tacgtagacc accagcacgg aaatgtgcac cgtgcgcctg gcgcgccgcc
    86281 cccttcgacg gttattcgac cgcttttcga cccaaacaga ctccgcgcca ccctccgcca
    86341 ggccggcgaa ctgttattga taggcgcctt cgaaaatagc gtgatggttc gcggccatcc
    86401 atgcgccacc tggtgtccgc gaaaaacaac gtgtatgcat cggcgcacaa gcagctgtca
    86461 atcatcatga ttgacagatt tcagacaaaa cggcgtttta ttttgaaaac gacgttccgg
    86521 acgctgtttt gtaagtaaag caccgttgtg ttcggtcggg catctaaaaa gcacgcgcga
    86581 cagtttatga atgtataaca gcgtgaataa actcactccc tcgcaacggt gttttgtgtg
    86641 ttctgttctg gtttccacgg cgtttacagt cacattccgc ggcgcgcacc ccagaatcac
    86701 cgtcgaatct gcgcccgacg gcacggttta tccgcgtgcg catgtgtagt aaaaacagcg
    86761 tggttggaat caaccgaaag ctgcgatcga cacgctgaaa gtggctgtcg aaacggcgtt
    86821 tgtgtcacgt gatagcaaaa aacaacgtct cgcgcgcgcg ttatgaataa tgataatcag
    86881 ctatgatgct tacatttgaa tatgtattag ggggtgggct cgtaggtacc gtatatgcgc
    86941 atgtagctgt actgatatga cggcatcata cagctgtatc taatcaagct gggtatatac
    87001 ggtaaatctg ataacgggaa atacggtaag gctcattaga atgcgatacc ttataaggct
    87061 taattaatat ccggtaatta tattcgtatg taaacatatg ctaattaata ttcggatata
    87121 cggaataatt acgtatactt tccccgccca gtttcataag ctttcaggta tcgggggtca
    87181 aaaagggggc gtatccggta gtagaaaata cacaccccct tgatttacat gcatggtcac
    87241 acccacattc aatatggcga tttgatgcca cacacccttt tatgatgacg taggcaccta
    87301 cgtcatcggg aaaggttatg atctcagacc tagtcaatgc agacgtttca tcgacagtgc
    87361 atatataaaa gataaaagat taaaaaccta ataacgataa tctagaaccc ctcacccccc
    87421 aaacccccct ctccccagtg tgggggggat ccggttttgt gcgcatgtgc acaccgtttt
    87481 ctgaagtcgt gtgaggcggg ttccggaaga tgggcaccgc acagtgcgca tgcggtgccc
    87541 ttacttcaat atagttaaat gggacgttgt tttcgatgcc cagcccccac tctttgggtt
    87601 ttcgtgggtc tggggtccct ttttccatcc cccattgtaa ggacccctga cccaattcta
    87661 gaagcggtct gcatgcccag cccccacctc gcatgctgtg ctgtgggagt gcccctcccc
    87721 ccaacggtct gggttatcgg ggctgcattg gttccctatg atgggtgccc ttcccccatc
    87781 gctttcccag catgcatcgc tttacgtttt gcaaaacgct cagaaaaacg ctgacgctgc
    87841 ggtttttaca ggaaaggggc ggagtcagaa ctttccagaa cttccgattt cgtctttaaa
    87901 agccggcctg cccggagctc ggtggcgcag tccgcggcgc cgtccgggca atcgccagtg
    87961 gcgacctggg catagccgtg gcttgcacac tgcgcccacc cccccgccca ccggggcctc
    88021 gcagcctcgg tgggggggcg gagccggttc aaaagtagac ctcgctcccc cttcccccac
    88081 cccttccccc tacctccccc ctggccgcct gggggatggg gcggcgttcc gctggcgcta
    88141 ccccctcccc ccggcatacc ctcccctgct cccctggtcg gggggatggg acggcgtcct
    88201 gcatgcgccg ccccctcccc ctcgacaacc ccaccccgcc gcgggctgga tcctgcggta
    88261 tggggctcct gggccgcgcg cccccgccct tctgggcggc cctctggggg cgtagccatg
    88321 cgcgttctcc agggagcggc cgcgcagccc tggcgggggg cggagcgtgc gctcggctgg
    88381 gcggcacgga agcctggctg cgaccaggga accgcgcccc tgcaccccag ctgggcctcg
    88441 cgacgccccc acctgcgagc tgtgcggtcc ccgggttggc cgggtatgct ccctgcggtg
    88501 cgcggacggc cgcgctgggt ctgccgcggt tccggctcca cgtcgtccgg gccgccctag
    88561 cgctccgacg tcgggtaggc agccggcttg ccccgacgag ccctggacgc agtgctggat
    88621 cgggacaggc ggctgcacta cacgacctgg atgccgccga aaaccccccc gttcccggat
    88681 gccggctcca gcgatcgccg aagcgattgc ggttcgcagc cgcccgggac gaggaggcca
    88741 ccagcgccat agctactgcc gtttctgctg ctactgcttc agcagcagct gctcctgcta
    88801 ccacaatcgc cgtcgttctc agcgctgcta ctgccaccac cgtggacgtt ggacggcgtt
    88861 tcggatttcg tccgtggtgg cggccgatgt cgccgtcgca tagccggcgg cctggaggcg
    88921 acctggatgc gggtcgcggc tccaggttag acgtcggttt agattttaaa tcgcgtttcg
    88981 ggtgtcatat attttgtatt gtgtaaaagc ggaacctaag cgaaactgaa gcaaaagtaa
    89041 caaaagcaac aaaaccagcg ccgttgtttt ccgttctacg ttcgggacac taattaatta
    89101 tgattgactg cactgattta ttggactcgt ataaactgtt tacactacac atctaggata
    89161 gaagctttat taaaaacacg tcagagatct agcttacatc agaacgcgta cctacattat
    89221 ttgttcgacg attctgtcgg actgtttgtc tgtcctccat ttggccggat tgaatcggct
    89281 ccttatgaaa gcgaaataat aaaaaaacag acttgtagtt tgtaaccgcc caaaaaagaa
    89341 aaagaactgg aactgtttaa cgatatattt gtagcaatgt gtctgcacca gtgaaatgtc
    89401 tacgaacctt taaaagccct ttcacaggaa ggccggcttc tcgggatgcc aggagtgtct
    89461 ctctatattg tcttggtcct gggtgccagt ctatttagca aaaaacattc acttcatcta
    89521 gagaaaacat cacgactcaa taattaaatg ataaaagaaa ataaagctaa acaaaagaat
    89581 taataaaaag ccgcgggtcc gagcccgcac gtccatcata cagatattac tacgatatgt
    89641 tagtttgctc gttgttcttg tgtattcttc gttagatcac tgccacagcc gtcgacgatc
    89701 ggtcgcggtg cgctctctct tgggcgtgaa tcaggcgcta ggttgcagac gccgtgtgtg
    89761 actgtgggcg ggccaaccta gcgcctcttt cacggcgcgg agaaagagaa aaacgactat
    89821 agctctctac cgcaatgatg caatccccac tagcatgtgc tttaactgtg tgaacaaatc
    89881 gtctgtctta caaaaatatc gggccaaagc cagtgagtat ttttgatctt tgtatacaag
    89941 acatgatagt attttgtttc taaaatccgc atcgtcatgg ccaccaatca tgataatagc
    90001 aatctatgat aattgtacaa ccaaccagtc gtctcgccat cgtgttgccc ttttgtgcga
    90061 tggcagcgct gcttcttaga tgacatgttg aaatataagt gtgttgttgc ctgtgttgtt
    90121 tccgcctttt ctctaaatgg tcttggatta tgtgcctcat ctgccattcg agatcttcga
    90181 aacatttgag tcatttgtgt agtcattttc ctgaatacta tatttactca gatatattca
    90241 agtgtaagtt catcttcatc cttgtgttat cgacctattt gtttagaagt gtgctgtgaa
    90301 agaaactcac tcgactctcg ccccctgcct ctctttcccc ccatgtgcgc agtcacctat
    90361 tttaacctgt cactcacaca acactcagtt tctcactcat ccagaatagc agtaacaaga
    90421 caaaataaaa accaagctcg ttcacattcc aatagtcgtc tctgacgtct ttttattctc
    90481 gggctcacat acaagataca acagcgccac ttgcagcgac gctcctacaa atatccctct
    90541 tcatcgtcgt catcatcatc ctcttcatcg ctataacaca tgtcctcgta ctctggtgtc
    90601 tggcagcgca acgcggccga gtctgcaaac agttcaatgg ccgttgtcgt cgctgctggc
    90661 gccatctgtg gttgttgatg ctgctgcgcc cccgaagggc aaggggaaga ggagtcagac
    90721 agagtgctca gggcggagat ggccgcgacc cagtcgggct ctcctgaggg ttcaatgtga
    90781 gcacacatca tgctgtcggc gccaccggtg tcaatcaccg gagagttggt cgaaaagggc
    90841 gtgggccaca caacgggttg ctgcggaggc tgctgttgcg gcatttcctg ggatggtgca
    90901 aagttaatct catgtccagc acacatcacc gcgggtgccg caggagccat gtccgtactc
    90961 gtaccgagaa ttgcctgctg ctgtggttgc ggcgaagcag cctggggtgc ggcagtcaca
    91021 acagcctgaa gatttccata attctcactg ttattctcga aaactgttcg gtcccggttg
    91081 agcggagaca cacccgaggc ggggcgagga ggggtggcgg tatgggtagt tgccacaaca
    91141 acagggttgg gaacaacggg ttcctggtat gaggcaggag aaaaggcaac gactgccgtt
    91201 tcggtgtgct gcggtgtcga cactgccatc atcgaaggca tcggtgtatc ctggggctca
    91261 tcgtctttct gaaacaccgt gaggtcgacc aaacacttgg tgtcaaacgg acaataggcc
    91321 aacataaact ggtaggcctg cagcgctttt tgaatgcgca gttcacagag ttcattctga
    91381 cactggtgtt ggtgcagggc gttcaggatc agttcagcca ccataccgca gcggtaggaa
    91441 cttatggcgc cgttgtcgtc gtactgatcc agaaagtgcg gtgtgttctg aatctgtctg
    91501 cttcgccgtc gcagcgccag gatggctctt gaaaaagaac acacatacgc caaggcgcgg
    91561 tggatggggt tctcaaacac ctcgggcggc cgtttctgga gctccagagc ggtgtcgcgc
    91621 gtgcactcgt caatcatctg gttgggtttc ctgaccaaat tcttgagcgt ctggcagttg
    91681 tccgaccatt cttggccgtt atccaggatg caggccaagt ccaggttgtt gagtttgtta
    91741 aacatgagct gccgcagccc ggctacggtg gccatgtacg ggtcgtacgg gttgacaggc
    91801 aggccgtgta caaagtggta tttcatgtag ctcaaagttt cgtccaccat ggccagcagc
    91861 gcgtgcatgc tgggagcgtt gaagatggag aaggatttct caatcaccag acggcgtagc
    91921 agggacgcgg gcaaccagtc aaactgctgg cggatgttta gcagataatc agtgctcatg
    91981 agttcctcgt gcgacatcag tagacgtccc ggctgctcct tgtcctgtgg gaaagccgtg
    92041 ggttttttga gatcatcagg gtagggagta agatgcaagc tctcggccgt gtacctttgc
    92101 aagtcgtaca ctggcgaggt ggtagagctg ggttgcgagg cgtcgtctcc tcttacctcg
    92161 ctgcccttca gtctctggcg ctcctctttc tttttctcaa tcattcggct cagctgacgc
    92221 agctggttct cgtccatgct atcaagctcc tgattgatga gcgccagcat gtgtcggttg
    92281 ctgctcgtgg ccggcgacac ggtcaccgcc tcctcgccgc tgtgacggtg tttctgatga
    92341 tgatgctgcc gaatgtaagc gcccctggag ttactggagg cgggatgctg gcggtggtgg
    92401 gagtggtggt gatgatggtg tcgcatcacc accgtggtct gaggtcggcg tcccgagtct
    92461 gggccgggcg gtggggattc gggcgagtcg cgcaccggcg gcgagttctg ctgcggttga
    92521 tgatggtgcg gcgtgcacgc cgcctcgtac ctggatcgct tgatcggggg cgtgtgctcg
    92581 ctttcgtggt ccaggcagaa gcgccgtgcc cgctgagcac ggcgttctcg gtcgctgagc
    92641 tgcgagagcg cgggcccacc gcggtatctc ttgtgcagat ccatgtcttg ccagggatga
    92701 ctggcaacgt ggtgtctgct cggggtttcc gccacggtgt atatatgcga aggagccggg
    92761 gccctgtgac gtgtgccttc ggggtgcgtg gctactggtc gttcgtgggc ggtctgagtt
    92821 tcacggaaat gtgcacgttc ttcgcgttcg aatgacattt tttggtaaaa cagcggctcc
    92881 aaaggctggc ccacagcgcg taactatgtt cggtgcgtag gtcgatgaac acctgcacag
    92941 tttcctgcgg gttgcggtgg gtatagttca ggcagcggaa gtctttggtg cgtgagcctt
    93001 ccagccgctt gacggaaacg cagtgggggc tatggggctt gaatgttagc gtatgtggcg
    93061 ggacgaactg ctcgctcacc ttgggctcgt agtgttgagt cagattttcc agtagcaagg
    93121 gccacacgcg cgtcactact agcctctgga ggtcgttaag gtcacttgca ggatcggagt
    93181 cggggcgtcc agatacctcg ccacgtaaat ggtatccgat cacgtcagac agggtgcgct
    93241 tttcgtaacg cgtcacattt actgaccgcg tttccataaa gttaatatct ggggaaggac
    93301 acaacttgtc acgcacaccg agtataatgc gggtgcatga gaacgacatg gaggggtggt
    93361 cgtcagggga caaagaggag gaagaagaat acgatactgg tggtctcggt gaccccggtg
    93421 gataatgcgg tgcgtgatgg tgcaacaggt tgcgaatgtc tagctgagca cgcacgaatc
    93481 ccaagggatg ttccctaaac ccctcaggta cgataaaaat cgggaggaga cggcggtaca
    93541 tgaagtaacc gtcctcctga tccatcttgt acataaacgg caggcggacc gagcgtccgt
    93601 ggtgataaat gcccgtatct aaactacttt cagggtgaga aatcggatct aggtgctgat
    93661 gtagcaaggt atctaggcat atggcatggt tcagcacctg tgcaatggac ctcaacaccg
    93721 agggtcgaat aactaaagtg cgctccggaa agggacaaat gatacgaagc cccaacttct
    93781 ctgaacattt acaataatct gttcgggttt cgtaggaagg tggcgggtta tcgtcgtcat
    93841 agaagtcagg ggtgaggttt ttgcaggcac ttttgaaaaa gtacactggg tgatagtcgg
    93901 gattcatgtt gccgaacaga ctttgccaga ccgttaccca cacacgacgg aggccgcggc
    93961 agatttcaaa aagaacctct ttagataatc cagtcacccc atcccgtagt cgcagatcaa
    94021 aatctgcaat aaagttatat gtaggcaggc gttcgttaaa aatttcatgt cgcgtgtagt
    94081 aaaattgagt ctcggcatta gagctagcca catcatcgtc atggagccag atcatgtccg
    94141 tcagggcttc gtcagtgaac tccgtgtcgg ggacgtgttt caggagatcg ctaggaaaca
    94201 ggttctggtg ccagttttcg cacgtaatgg cacaaaatac atgatgatca ttgggcaatt
    94261 gcacacgaaa cagggggatg ggaccgtcaa aacgagtttc tttgggtatc agaaattggc
    94321 gttgcgagta ctgggcgagg gagccggtgg cgtaggtgtt ggcggttttc agggacgcgc
    94381 acagacgtag cagtccggac agggatcttt ctagtacagg gaacacggag tcggacatgc
    94441 tattgatagt gtccaatttg cgcatcactt gggacgaagt gccaaaaaat cctgtgagag
    94501 cgggtccggt ggtctggtgg ctgtagcccg agagtcggag atcgtagtta tcggtagata
    94561 gaatgcgtgt ttcgatgtag tcctgcaaga agttgggcag ggagaagtac ttgtccatga
    94621 cgctcaataa atcatccgcg agatggcggc ccaggaacaa tggtttttgt ctgcattgtt
    94681 cttcgcgcgc gccctcgtcg taagccacca cttcgcggta tttaatcagg cgggacctgg
    94741 aaagtgcagt tctgtaggac agatagatgt aatgcacgca gaccgtgtcg ggtaggcggg
    94801 cctgttcgcg aaaggtgtta atctgcctgt caacgtgcac cagctcttcg tagtctcgct
    94861 ggttgcgcgc catggcgtat tgcacgaatt gcgggatgcg ggagcgaaag ggggatccga
    94921 gcagcatgcg ggtgaattcg gtcatggtgg cgtgagtggg aatgatcacg cccagatctc
    94981 tggagaagct gcgtacgtat tcctcgacgg tgggaatggt gctgtactgg cgctccagca
    95041 gatagtagga catggtcaat agcacttgcc cttcggtgtg cccgaaaacg ctgatgaacc
    95101 atgatgggga agtgggacag agaaagatga ggttcaggta gcgcacgatg gccgagtggt
    95161 ggaaatagac caggtgtttg aattcgcgca cctcgccgcc gtgttcgggc gagatgacag
    95221 tacgaaatag gtggttgtag atgggtttgg tctcctcctc attgagactg tctaccagag
    95281 ccgacagcgg gatgggctgg tgagtgtgca ggtagtgcgc gaggttcagg acgtcgttat
    95341 tgaccacgaa caccggcgcc acgcgctgag agtcagtgca cttttgggtc tgtaaacaga
    95401 agtaaactag gttggaggcg tggtgtttta ccagtaaggg gaacacacag tgctcagaca
    95461 cagattttga aagcacgtta gcgactatat gagcagaatc atactctgtc gcgaacagaa
    95521 ccagcgtcat tgtccgtgaa ggatggacct ggcgcggcgc ctttggggtt ttctcagctg
    95581 tcagcggcgg gcttcggttg gggcagacta tgtgctgcct acggcccagc gaagatgtga
    95641 acatgcagga gatgcagtcc ttttttgagg agaactttgg gacgctgggg atcacacctg
    95701 aggatttgaa ggcgtttgct aatgatcagg aagtgacgaa gcacttactc aagcttattc
    95761 ctctgtatcg gcactgtcag gtcaagtgtc gaatgctgca ggactacctc gcggatagtt
    95821 gtcagccgca tacgcggcct gccgccgaag tagagaatca aaaatcgcag cgtatcatgc
    95881 aggctttgga cgtgatgatc ttaaagttgg tggtgggcga gttctccatg tcggaggacg
    95941 acactctgga ggtgttgctc aataagttct ctacagatca ggtggcactc tgtgaggttc
    96001 agaaggttat gggcctggtg gacatggatt gtgatcagag tacctcaatt ttggatgcgg
    96061 ctgccgccaa cgcagaaaac tgttctgtgg tagctgaagg cggcatcgat gaaaacgttt
    96121 tggcaatgat tccgcacccg cctcaggaag aactgcctgt tgtggaagag gtgtgtctcc
    96181 ctacaccaat gcctcctccc ccaaaaccta agcgaaaaaa atctactgca gtgcatatgt
    96241 ctgtttgatt aacagatgtg aatatgtcgc aatataaata aaaacacgat gaacataatt
    96301 gtgcgtttgt gtcatttatt cgttttcgca cgcaaggagt tgttgtagga tgtggtgttc
    96361 gggcatgtgg gtgaatccgg tgtctggggt tggtggcact aagagttggc caatggggtg
    96421 gttatggact aaaagataca cgaaacggcg ggtggtgaag acaactttag cgacagatgt
    96481 agtgcctgat atatagacgg ctgaactgga ggtattgacc agtgtgattg tggctacggt
    96541 tcccggtaac caaatgacgg gtcgaatgat aattcccaat tgattcatct gacgggtgcc
    96601 cactatgagg gcgcaagtac taggcgcgtg gataaaagca gcgtccagat acaccgtctg
    96661 ggtgtgaccc ggttgaatta taatgcgttg atgtagacgt aggccaaaaa aatagttttc
    96721 gttagggggc gatatgttca tgacttgcca aggttctgga cagaaacaag ggaaaataca
    96781 gagatcaccc tcgatggtgc caggcgtgat ggcttggaac gtgtagttca agttaatcac
    96841 gtccatgctg agattctgga ggccgggttc gatgagttcc ggcatgcaga cgaattgaga
    96901 gtccaggcat ttgtagaatg tgattccaaa gtagccggta ggaatgtaga gattgatgcc
    96961 cagtggagtg gatgtattgg gctgttcgga gagccagata atgtgtttgt tgtaaaaggc
    97021 caattgcata tgctgctgtc gaacgatgaa gctggaagga atccatttat aaggaacgtt
    97081 tctgcgtggg gaatagatgt tggattccgg atgtcgaaac acattttgga agttgaggtt
    97141 gctagcgaac agtagacagt agcggagatt tacgctgtgt tcgtcttgcg gctcttgacg
    97201 ttcgtcattc tttattaaag atgctcttct ccacaagcgt tggaagcggg atttgtgttg
    97261 tttcacgagg ctcagttgtt gatctagcct gtccgagagc acgttgagca ttgtgctctg
    97321 ggatagcgtg gcggagcagt catgcatcgc aagacgttga tgagactgtt tttatgggcg
    97381 tgcttgattg taatatgtgt ggccaacaat aatacatcta cagcgtcacc gacgagtaaa
    97441 cctactactg tgacaacctt aaaacctata aggaagcatg cggaagatga tttttatact
    97501 gcgcattgta cttcgcatat gtatcaagtg tcgttgagat catttgcttc tatttggatc
    97561 tgtatgaacg tagtcatttt gataatttca ttttttgttg ttttacgcca ttgttgtttt
    97621 caaaatttta ctacaactac ggtggcagga tactgagaga caaattggta ggtcgaaggc
    97681 gtctttctat gctggtgtta cgtttaattt cttctttaaa agctagacta tcaatatggt
    97741 cccataaagg atctataaat aaactgctat taatttgggt agtgttgcta tagggtggtg
    97801 ttatttcata caaagtggtg agattcacgg taccgtgaat gctccagaca gtatcgttat
    97861 ataatatttg tcgtgtatgg ttagcccagg ctgattgacg ctctctgttt ctcgatttgt
    97921 cacaaaatgg ttcttgatta tatcttatgg tagtgtacaa ccaggttacc atgtcttgga
    97981 gttgtttaac aaaaattggc agtgtataat tttctgatgt gtctacattt tcctgactgt
    98041 tgttatacag tttagttgtt actgtaggcg tattagttgt ggtattgttt gcagatcttc
    98101 gagatctttt ttgtgtgtta ttcttttttg gttttcgtcg gcggtgtaaa cgtctcattc
    98161 cttgttttag tttccaaagt gtaatatgag ggaatttaaa aagattacgg ctcatggcgt
    98221 tagttaggta aaaacttttg gaacagttgt atctaagtaa gtttcggaat ataacttcac
    98281 taagtcctaa aaagtagatg gactgactat cgaggataac gatgtttttt ccaacataga
    98341 ttcttgtggt ccatcgtgga acgttatata acattggatt ataggtggta ttgacatcac
    98401 atgcttgttc tcctgtgtca ttatgtaatg atatattaat catttcagat agacaattca
    98461 tggacggaat ggaaccgcat gggggtggta ctaggagcat agacgagtta gtatggttga
    98521 acttgcacat aatataatta ctgggttgac gatgctgaag agcgttgaaa tcataccaga
    98581 aatatgtaat actctggttg ttaataggac cagcaagcat tctgtatttg tctggaaatt
    98641 ttggcattgg aattgtgtat gcgtaactac gaagagtggg atttttaagt gcttgtatca
    98701 tttctggact gtatgttgtg gtttttgctt ttttcttact gcaggtaaga taactgcagc
    98761 taataataac taaccagata caccacattt ttatttcaga acccatgacg tctctgacaa
    98821 ctggtatact ggtgtgtttt gtctatgcct tgctgttaac gacgcttcta atggttagtt
    98881 atcgctgcct catcggtttt caagatgaca tcgtgactcg atcctggatg gtgtttaaag
    98941 cgtgccgaca aggcctgtat aatacgtctc gttgaataaa taccagtaca ctacaatata
    99001 cattgtcagt gtttttattt aattacatta gttttacaat gcggtataaa aggtagagtc
    99061 caacaatagc tgccaaaata taaattacaa tcagtacgat atgcgtgtcc gtttggtcga
    99121 ccactgcttc cgtgacttca aacactgtac cgtttttgag gaacatgagg taatgagttt
    99181 ttggagattt tgctataaca tggttatcat aattcagtgc aaatagcagg tcatctgtgt
    99241 cgtagatgta catggcattt actatacctt cagaatcgtc atactccacc agtgtgcttt
    99301 ggcagaattc acagtgttct aaagtgatgt ttcgaatcat tacaatgggt aatgtatcgt
    99361 gtttgctgga actaggtgaa cacgtgctat tggcaggaat gtaagttatg attatgctgc
    99421 gaccgactac ggttgttagc actgggaaag aggttcctct tgcaatgtat tcagtagata
    99481 ctaaatatgt cgttgcatgt gaaaccgtaa aggctgcaaa agatttagta gttgatacgc
    99541 agctaatttc tggaaaggtt gccagtgttt gtggtcgaag agtttctaga acagataaag
    99601 ctgtttttat ggttcgggag ttggttgctc tggggaacat tttttgaaga tgttccaggg
    99661 cgtggtctct gcggccgctg ccagcacatg gactgtaaag atcgcttaca tgattgtgtt
    99721 cttcgctgcc gattagttgt gaccaatgtg acaattcagc tagagagcac agtcctgttt
    99781 caaatgcaaa tatggctctt ctttctgcag aatggtgtaa cattgaatga ataataccgc
    99841 tggcgaggta gagttcttgt cgagcaaatc gggataagaa cgacgatata tgcgttttgt
    99901 gtaggagtag aatgaggtta cggatttgtt ccatgtcgtg tttgctgaca aggtcttggt
    99961 ggtgttgttt aaccaaaata taaattaatc ttgaaattgt caggacgcta gagatgtgtc
   100021 ccgtagttct cagagtggag ttggctagtt gtactgcgtt aggatacatg agaagcgtgg
   100081 ttcgtggttg tatttttgac atgcaactgg agatgaagtc ctcagccagg agaatagaag
   100141 attgttgatc tacggccagt gcgatggaag ttggtgttgt tggagacgta gatgctatgt
   100201 aaagaaggat tccgtagcct agaaccgttt ccactgttgc ctttgttgtg ctacgacact
   100261 gtccattttg aagcacgttt accgcgtgcc tgttccaaac ggaaaggaga acatctaaat
   100321 ccatatagtt ttttgaaagt aaactatctg caaaatctgt tgtcttgata tatgtgtgat
   100381 aatgtatatg atctttttta accaaaacga ttagttgatg acgtttcgtc tgttttaaaa
   100441 taaagttttc ccgtctgtag ggggctttga acattatccg tttagtgtct ccaaagatga
   100501 gaagcagtgg tgtttctctg ataaccacgg ttaagacgac aaagtattct gttaatgcta
   100561 ttgtcatata gtcgtgttca gtgacgtaaa aagattggta taagcatgat tctcgagtgg
   100621 tgaaaagcag ttcatggtct ttaaagaggt aacatgtccc attgaaggct ggtgcatgta
   100681 ttttggatgc atttacagta gttggtttag catatgaggt tgtagtttgg aggcggaggt
   100741 tttccggagg aggtactgtg gatgcttgtt cttttagatt attctggtaa ctcaggtttt
   100801 gtccataata tttgtactga atattgtctt gagaaactgt agcgtatgtg tttagagtac
   100861 tggcatattg ttgaaatgtt tttgatagat ctacttggtt cagtaggttg tcggcaaatt
   100921 caccagtgaa aagacatcta ggtaattgaa atactgtata atggtttgca ctttcataga
   100981 aattgaacgt aatggcattt tctctaatca aagtaaggtt tcgtcttgtg ccgttattgt
   101041 tgcattttgt gctgttgtgt cgcaaaaact gaatgggtct gccggtgagt tccagtgtca
   101101 gatgtgagta aggttcggat gaggtctcgg cgtggcatgc cagcagccac actgccagga
   101161 cacacagtgc caggcctcgg cgcatcgcgg gtctcggcgt tcgatggaca aataaaacca
   101221 ggacgggtct taaagtcgcg acctggccta tttaatacga cgtaatttgc gggcacgtcg
   101281 cgtcgacgag ctcttgtcct gcaatgaaag acgcgtcatg tcgttaggaa gcggggcgat
   101341 cacctctctg ggtgacttac ccaactttcg caagcgaaac ggacagaaaa agcatttaga
   101401 tatttatcgc cgcatcgtgc gggcctttcc gtcctttgtg gcgtttaacc ggcttctggg
   101461 ggggcttttc cccacttact gcaaaaacta tcgtcggtgg ctttttttcg aggtccgctt
   101521 aacgcagcgg attccagact gtgtggtgct ctttgtgtca ccagaggctc ccagacgggt
   101581 cttatgctac gtcatcgagt ttaagaccac ttgctcggac gctgatgggc agtccgtgcg
   101641 gcagcacgtc acgcataact tgcagtatgt gcagggcctc aagcagctca agggtgctct
   101701 gacggacttt gaggctctca aggtgcctcg aggggattcc tggtccgtca tccccaccat
   101761 catctttttc cagcagcaag ccacgcagcc ctctctcgct cgggctttcc gatctgcacc
   101821 ctttactctc cgaacagatt cggtcattga ctacctcaaa cggcggcagg atgagtctgt
   101881 tgcaacccta ctatcggcta cccatcgttc tgttcgagcc tcatgccgaa aacattctca
   101941 ggtgtcctcc tcacgtgcta caaaggctag tggacgactc cgtcgcgggg ctgcgcaagg
   102001 aggaagtggt ggccaaccag gtaagaaagc gttacctgcg cgaagagctc agcgatctca
   102061 accaaagaat ccagacgtac tgcgaagacc tggaaagtcg cgtgtccgag gcggaggcgc
   102121 tgctcaaaca acagtgcgaa gtcgatccgc cgccgtgtca ggacgtcgcc gccgcggcaa
   102181 ccgccgcaaa ggagatttat agttctggcg gtgggcccga agcgccgcct cagaaggtca
   102241 cgcgttcgga ccgcggtcaa gctgcaacct gggtggcgca atgctctgac caagaaaaag
   102301 aggttctatt ttttggaatc actaaaaacg acccctttat ccggtttcat actgattttc
   102361 ggggggagct cattaacacc atgttcgaaa acgcatctac ctggacattt actttcggag
   102421 tctggtacta tcgcttgaag cgcagtctgt acacacaacc gcggtggaaa aaagcattcc
   102481 gcctggtgca gatggaaaac ttctccatct cacaggagtt gctggtgggg gcggtgaacg
   102541 ctttggaaaa cgtaaccgtg tatcccatct acgattgcgt gctctccgat ctcgaggccg
   102601 cgatgtgtct tttagccgct tatggacaga atcactggga cggacgtgat cttccgacct
   102661 ctatccaagg ggtccttacg gaactacctc acttgttgaa taaactctcg gatgaggtgg
   102721 gtcgtgagat caccacttgg gacggtacgg ccaccgcgaa ttactatgcc tatcaagacc
   102781 cccctgatct caagtactac atgcctctga gtagcgggcg tcattattcc ccgggaacat
   102841 tcgatcgtca tgtgttggta cgcgtgtttc accggagaca ggtcatccag agcctgccag
   102901 gatatggggc gcaaactgcg gcagtggtgc aagaacgcat gtcgggacag gtgcgggatg
   102961 acggtctttc cgtgtggtgt aggcgcctac tggcgggcaa ggtgggtcgt gatgtaccta
   103021 ttttcgtgca cgaacaacaa taccttcgtt ctgggttgac gtgcatcagc gctctgctgc
   103081 tcatctggaa ggttgtcaac tctgagagcg tctttgcgcc tcgggccggc aagtttacgc
   103141 tcgctgatat cttgggtaac gacgccctcc cgcggacgag ctcggaggat gacagctaca
   103201 gttacgggca tagggtcagg aactttgagt tcctccttga gcattacatc gtgccgtggt
   103261 atactcggga tcccactgtc acgatttctc aattatttcc cggaatcatg cttttggcca
   103321 tcaccgagag cgtgcgcagt ggctgggatc ctgcgcgacg caatgatgga caggccggtg
   103381 acggcagcgg gaccgtgcta atgcaaatca gtaaggtcaa tccggtggcc gatttcatgt
   103441 ttgcacaaag ttccaagcag tacggggaac tgaagcgttt ggaactgcac gacgcattgc
   103501 tgtttcattg tgaacacggt ttgggacgtc ttctgtcggt ggctttgcct cgtcatcgtg
   103561 tttttgcact gggatcgtca ttattcaacg tcaacgatat ttacgaatgc atatacttta
   103621 gtgtcttagg ttttcttccg gctgttgtag tgatgtaagt acttgtggtt tctgggcagc
   103681 ataaaggacc gttgtcctgc atgtgcgggc tagaaaccac atcagaacac cttctggacg
   103741 ggtcgttgtg aggtgctgcc gctgcttcac attcatctga aaccatgatt acggagcgcg
   103801 tcctcgcagg catcctcgcg ggcatgacgg ccgcggggag tttggtcatt ctcctcgcgg
   103861 ttgttatgtg gttgaacatg ttagatcgcg ctggcatgcc aatggccgtt gggcattaca
   103921 cagggaacct ggtgttgact caggtcatct gtatcttctc catgctggcg tctaaaattg
   103981 ttggcatgac gagtgcggcc aacatgggct tctgcggcat cgtggttttt ctggaagaca
   104041 ctggcctcta tgtcacctcg ctgctcttca tgtttatgat cctggatcgc atggcggctt
   104101 ttcttaacgg gcgtcttttc tggaggcagc agacgacgaa gcagaatctg agtacaagcg
   104161 tgtacattat tctgttttgc tgggtgttgg gaatggccgc ggctgttccc agcgcggctg
   104221 tggctgcacc caattccagg tgggaacgct gcgaaattcc agtgtcatat gccgcaatcg
   104281 acatgattgt gaagctctgg tttgtgctgt tggcacccgt cgtgctgatt atggctgtga
   104341 tcattcaatc ttcctatcat cgtgatcggg agaggatctg gtactatgcc agacgtgtgt
   104401 tcatgttcta cacggcctgc tttgtcatga tggtgcctta ttacttcgtc agagtcatgc
   104461 tgagcgactt tgctttggtt gatataaaaa caaaaacggc gaacagcgac ggttgtgatt
   104521 cgacatttct tgattatctg aacatgttca ctcacgtgat ttacagtttt aagttggtgg
   104581 tgtttgcttt gttcattgtc ctgttttgct ccataaaccc gatggaaacg ctggaagaat
   104641 gcttggagag ggccgatgct gagaggcaaa gtcggtcaga agcatcccag ggtgaaagga
   104701 ggctgccaat caacacatgc tgtataaagt tgattgaatt gataaagcag tatgtaagca
   104761 ctctctctaa agccacgagg gacaattctg gcgaaagggc caatttgcca gagaatgctg
   104821 aagatattgg aacaactggc agtgatcagc taccgactga ggtcaccgtg accccaaatt
   104881 catcggctgt gtttagcact ggaggaacgg tgtctccagt ctaacgtgct cttgtgctgc
   104941 gtgtgtaact gacgggtcag gtggatgatt tatgactctg tatatcggac ggcgaatgtg
   105001 tgcatgtata tcggtgtggt tacatgtcac cacatgccgt gggtgtgtgc agggctttgg
   105061 ctgaggccac ggcctcggga ttcagtgtca ttcgcggggt caatgataat gtacccgcaa
   105121 aagctttgta atcttcaata ataaaagtga aaatgcccat ctcgtgtcga ctcctttgaa
   105181 tttcgaacgc ctcgctgctg attgtcattt tgcctgtact gatcaaataa aagtaccaca
   105241 ttttctgaca gatgatgcgg atcaggggct catacgtggc tgtaccccag tgacgggtaa
   105301 aaaaagcggc caggcggaac aatctgtgcc cgtacagtgt gcccagagag aacagcagat
   105361 tgccgttgcg ggccagatct tcgggaaagg aaatgagcag tcccgtgtgg cgctgcacga
   105421 agcggcttag taacgccgta ctcagttgcg gctggctcag tttctggctc agctgggcgg
   105481 cctgttcctc atggaaaata acgtggaagt cgaactgagg gaatgtgcgt cgcagttctt
   105541 ggtacaagtt gggccagtac gaggtcggtg tttttcggct cagaacggcg ttatcggaca
   105601 cgcctaggtt gttggtggtt tcgcggagta gcaacgtctc caggccgcgg ttaaacagta
   105661 acacgcagat aagcctcaga atcttgagtt cctctagtcg cagagtgttc agcggctggc
   105721 cccgtgacat cttttcgcta atctgtaata ttagatgatt ggcacacgta aaagagaatt
   105781 tgccagttcg cactcgggcc tcatccgtcg ggctggacat ggcagctccc gtctatgtgg
   105841 gaggtttttt ggtgcgctac gacgaggctc ccgaggaggc cgagctggtt ttgccttccg
   105901 acgtggttga cagatggctg cgcgagtcac gcggcccgct gccgctaaat gtcaatcatg
   105961 atgagtcggc taccgtgggt catgtggccg gactcaagaa tgtgcgagct ggtttgttct
   106021 gtttgggtcg cgtcacgtca cctaaattcc tggatattgt ccaaaaggcc tccgagaagt
   106081 ctgagttggt gtcgcgcgga cctccatccc agtcctctct acagcccgac ggcgtgctag
   106141 agtttctcag tggcagttat tccgggctgt cactctccag ccgccgggat ataaacgctg
   106201 cagatagcgc ctcgggcgat gcaaaaacag cgtctttcaa gcatgtggcc ctttgcagcg
   106261 tggggcggag acggggcacg ttggctgttt atggccgcga gccagattgg gtcatggaac
   106321 gcttcccgga tctcacggag gccgataggg aagcgttgcg ggctcagctg acggcaacag
   106381 ccgcggccgc ggggggagag gaggaggacg acgttgtaag gaaaaagaac aacaacaata
   106441 agtcccaggg gcccgacgcg gatccatttc agtccgattc gtacggcctg ttgggcaaca
   106501 gcgtcgatgc gctctacatt caggagcgcc ttcccaagct gcgctacgac aagcgcttgg
   106561 taggggttac cgctcgggag tcgtacgtga aagccagtgt ttcacctgcc gagcaggagg
   106621 cgtgcgatat taaagtggag aaggagcggc cgaacgagtc acagcacagc cgagcaccca
   106681 gcgagtccat gtctcacccc atgagctctg tggccactcc agcggcctcg agcgtcgcgc
   106741 cctctcaagc gtccttggca ctggcccatg acggcgttta tttacctaaa gacgcttttt
   106801 tctcgctcat cggggccagt cggcacgcga ccgactcggc gggagcgcgt tccgtgtatc
   106861 cggctgcacc tccgcatcat gcgtatccgg tgatgaatta tgaggacccc tctcgtggtt
   106921 ttgactacac tgcctggttg cggagggcgg ggtacgacgc gggacatccc caataccctc
   106981 ctgttccctt tcatcatctg ccgccgtatc gtcgacggga tttttccatg atggatgaca
   107041 gtgatcgcat ggcttgggag cgcgggtacg cgcatccttc caactacgac tcttatggca
   107101 ataatagtgg taattcgtgg tcgcgcggcc gaaacggtgg tactggctcg cacaacaacg
   107161 gcaacaagag gcggagggac cgagatttat cttcctctga cgaggaggac atgagttttc
   107221 caggggaagc cgagcacggt aaagctcgga agcggttgaa ggctcaccat acgcgaggtg
   107281 gaggaggaga tcactcctcc gacgccaagg gtgaccaccg ctacgatgaa atcagagaag
   107341 ctttgcaaga acttagacgc gagatgatgg ctgtgcggca gattgcgccg ccggcgcttc
   107401 tcgggcctgc tcaactgacg gtcccaacgt cgtcacccac aacgacgtct cacccgtctg
   107461 atgtggtggt gactagtgaa ccgcctcaaa catcgtcgtc gccaccgtcg gctcacagta
   107521 gcaagtccgc tgatcgcggg gtggtgaacg catcgtgcgg tgtgtctgta caaccacaag
   107581 atggcggtcc aacgccgccc gtgaaggaca ttgtggactt gaaccgccgt ttgtttgtgg
   107641 ccgctttgaa taagatggaa taaatcacac atacacagtg atgtttcttt gttcataaag
   107701 ctcttttttt attatgtaca acaaaatatt attacatggt acgcaattta ttgtctattt
   107761 tcgttatttg tttatttaaa ttcgaggtcg ttgtggtcgg ccgctggggg agcgacggcc
   107821 ggggacttgt gctagggctt gaagggtggt tttgaggtcg gcggcggtgc aaatatctcc
   107881 gtccagttca cttcggagat acgaagtatt tttcaccgcc tcctcggcta ttcgggcagt
   107941 caggggcatt agcagatctg ggtgaatata catattccat gaaggtacaa ctagcagcat
   108001 ggccgttttg ggtaatctct cacgatgagt caccggcgcc gcggtgcctt ctcgtttggc
   108061 tttgtgggct tctcttcgga gtctgtccat ggtggtctgc ggctcatcgt cttcatccga
   108121 ggagtcttcg gattgaaagg ggtcaaagat ggcctccgtg ataataggag gagtaattgg
   108181 aggaccttct tcctcctcgt cttcgctgga agacgaattg ttgggttgct gggcgaattc
   108241 ggagatgccg cgtaaaatgg agtccctggg aaacaagccg gctcgaagac ggatctgaga
   108301 gcatctcggg gtttcggtct tgttgggcaa cacgccgacc gagcctcggc gaaataagtg
   108361 gataaatcca agcatttgca tgtgggccaa ggttatcgcg ttagctgtca gattctgcac
   108421 gttaatggta attttcatgc ggttgggcag gggacccgcg tccatgctaa tccccgggag
   108481 ctccagggga aagaatacgg cgtaacaggt gtcctgagtt tccagcgcgt tgttaaattg
   108541 caccacatac gtctgatgag cgggaatagt gacgtgcagg gggcatttca cgagaaagcc
   108601 gttttctgag tgtctctcga agaaggggtt agggttatgg cgccacatca cctcagcgcg
   108661 gtgagcgtat acagataatt gcaaaaacac ctctgtaggt gggtggagag agaaatggat
   108721 gagcgacact aagatcaaat tctcttcgcc tatggtctcg actttctgaa catacgtgtc
   108781 accgttggaa caggccagtt ggtcgatggc gtctactaag gtgagaggta tgaggccagt
   108841 gaggaacgtg aagtcggtcg caaacgtgta accgccttca acgtactggt ctcgtttacg
   108901 agtccacgtg atagcgctca cgttcacctt cacagtccag gtatactggg ctcgacggat
   108961 ggtggtgcgg gcgttggctc tcggcggccg attctggctg tttcctcggc cgcggaacag
   109021 gtggatgcct gtcacgggaa cgcgtactat agggagcgcg aaaaccagca tagccgatgt
   109081 ctgcgagccg ggtgagaggc gccggttggc gtagttgcac gcgtccgtgc gcagcgagtc
   109141 tcggaacgta gaactgcaat gtcccttgag atttaggtca gtaagctgca acgcgtcgcg
   109201 agaggacttc atttcttgaa aagcgcagat gacggcccga ttggccacct ccacggaggt
   109261 gtgccagttc atcgtctgca cggcatcgac gtccagcggg ctgtgttgcg tgcagacgag
   109321 gcgcaggatt tggcaggtga ggcgttcgaa ggtgacggcc ggggcgaggg ctcgagaggt
   109381 agacggcctg ggctcttctt cttcctcggg agggcgatcc atgatgcgga gaatgtgaga
   109441 gctggtggga ggccggtgtc aatgacgtga tccgcaaata cagcacccac tgcttaccta
   109501 agaaataagt gtgcggtctc gggggattgg ggtttttata taggtatggg tctattcaca
   109561 gggccttttg ctaaccgact cgccactggt agacggtagc tgctcggaag gtgagtagtg
   109621 gcgacgtttg ggggcttgat acatgtgcca agaacccgag aggcctgaga agatccggag
   109681 gtcgtcgtcg ccttcccagg agaattcttg gtgaggtagt tgatcgccgc acacgctggc
   109741 tatcatggga gttaattctg tagcgcggac gccaaattgc catattcccc agtacaaagt
   109801 ggggaaaaag tcgtcatttt cgtcgtcgga gctgcttttc tttgccgcgt cgtcctcggt
   109861 aaaacgtttg cgctggacga gcggtttgta aagtttctcg cgctttttag atgcggagga
   109921 tgatgttccg gcgtgtggtg tggtggatgc gacctcgaag acgtccatat cctccgattc
   109981 ggaggatgag ctggaatcat cttcgctgga gtcttggaca ataggaacgc ctttgccctg
   110041 atggtattca aaactggtcg tgatgcggta ttgatctcta aaaatggaat gatcggtttt
   110101 tttatacgta aaaaacaagt tacgatcgaa aaagtgaagc gaggctatgg cctggaacgg
   110161 ctcgatatac acactgtcgt gcaggcttct gatttccata aagatacact gtgtggacat
   110221 aatcgggttg catgatatac tgcatccggg aacgcttttg gggcaaataa agccaatata
   110281 cttgtctgac tcaaagtatg tatcgatcat gacgttggcg tgttctctgg gtttcaagtg
   110341 gagtcttttg ggatttagaa tagtgtagcc gttcctttgt tgcggcgtaa ggaagggctt
   110401 ggggttgcgg ttcatagtga taataccgct gctttgttcc caggcgagat gaataaacac
   110461 tttgtcgtct ggggtttctt cttggaaaga ttccaagaag attcgtacca gtcctttcac
   110521 tttatcgaca agttggattt ttctaacgtg tgtactgcgc agggagcaca ccagttcatt
   110581 tgcgacgttt atgctccaca gcggcatggg gcttgtattg acataaaatg atgcggtgtg
   110641 gtgcacgccg tgtggcatcc agcggttgta tctttgggtc cattggaggt gatacgcgtt
   110701 gaaacgggta tgataccctt gggcaaacgc ctggacagcg gcatcgtaag tgggtaactc
   110761 gggattatac gtaccgcctg gatggagtgt taggtcggcg ggtacgaggt gtctgagcgg
   110821 cagggcatag agaaaaaagg acatcggttc gtccgcgggc gtaatgggtt tgtcagtagg
   110881 attgtgtaca tgcaaataaa catctttcaa ttcttggtcc tcaaacgtca tgtgtttaat
   110941 ttgaagagta ttgtgttcgt agcgaggatc tggtttcaga tttcgagcga actgtgtgag
   111001 aaagatgatg gacggccgat ggacctggac acgaaggcct gttttgacaa tcttggtttc
   111061 gtgcggtttg acaggttcac gggcttcatc aaacacgctt tggatgactt tgccggcgat
   111121 gggccccaat tcggatacat aatcgagccg gtaacgttgc gatagatcca tgtggactgt
   111181 tgtcgagtgc ttttgcgact gacagctgcc tgcagggtcc acatgacgtc attcacaacc
   111241 taactacggt gctttttagg aaccgaaacc gtgcacgact ctggaatggg ttcaaggcgc
   111301 gtgtggcgac ggcgtctttg tgtttgatag ggctggagat cgatttctat acccgaaaaa
   111361 gtgcgatagt catcgccttc tccccagggg aaatcttggt agggtagtct gtcgccgtgg
   111421 gcgctagcca caatgggaac caagctcgtg gatttgatgc cgcattgcca gtttggccac
   111481 gagaaaacga gtgtttcgcg gtcgtcatcg tcttcttctg actcgtcgct cgtttcggcc
   111541 ttggtgacgc gatgtttgct gcgcgtcgtc atggtggacg atgccgccga ggacgatggt
   111601 tttctgctgc tgctggctgg cggctgagat ggtcgtcgcg cagaactacc actgggcgga
   111661 tggcggaaaa cctccatgtc ggagtctgag gcggaggagc cgctttcatc gtcggcctgg
   111721 tcgccgtaca cgtgatggta ttccagtttg gccattaggc gatgctggtc gaccaaacgc
   111781 gcctgggcag gttctgtggc ggtacccttg gtgagaatca ttttgcgatc gaaaaagtac
   111841 aaccagccaa gttcttcgta ctgttcgatg tacaggctct cgtgaacggc tttaatctcc
   111901 ataaacaagt tttgtagcgg caatagtggg ttacacgaca tgctgattcc cgggatggtt
   111961 ctgggacaga tgatggcgac atacttgtca gactcgaaac aaacgtcgaa catgaggtgt
   112021 gaggttttcc ccggcttcaa atgaagcgtc tgcggacaca gaatggtaaa tccgtttctg
   112081 tcatgtgccc tcagatacgg tttggggttg cgattcatca cgatgtcatg attgccgttc
   112141 tcccaagcga gatgaacgaa gcattttgtt tcgggagtat cttcctgaag gcattccaga
   112201 taaaccttaa cttcatcctt gcttattttc cgaatgttcg tcacgtgtgt gtgcggtatc
   112261 gagcaaacga gctcgctggc tgtattcata gagcccagcg gcatctgttg actattgaaa
   112321 ataaacgatg tagtgtgata aacgctgttg gctgtgtatc gactctgatt tcggctccac
   112381 accagacggg aggcagtgag tcgggtgtgc cattttttgt catcaatctg ttgtaccacg
   112441 gcgtcggcga ccgtggtgcg gcgcttgtga ctttctccct ggcgtaggat gagctcggga
   112501 ggggtgacag gatctagcgg caaggcatac acgtacatag acagcggttc ggcggtggtt
   112561 ggaatgggtc ggtcggttgg gttgtgtaca tgtacgacaa gcggttccaa acttcggggc
   112621 tcgaaggccg tatgtttgat ctgaaggttt gtgtcatagc gctgacaagg ctgcgattcg
   112681 ggcgtaaact gtgtggctag aatgactgat ggctgattga ctctgacatt gagatgtgtg
   112741 tccgcgatgt aggtggtgtg cggattcaag tgttctttgt tggcattgaa aatgagtttg
   112801 acaaggtggc ccgacgtcgg gccgagatcg gttaccaaat cgggaaaccg atgcggtcgc
   112861 gaggccatgt tgtctgactt tggcgacacc gccgactgag ctgcgcaact tggctcatag
   112921 agctatttag atgttatggc gccagaaaaa aataaggata tacaacgtca ttatgtaaaa
   112981 acggttttat tacgggggag aggcggaatt ttgtggctgt tgctgctgtg gttgtcgctg
   113041 attacaaacc atggcgatag tgaccggttt gttgttgttg gtcggtgatt gttgttgttg
   113101 tgccgtttct ggactggggt tagagacgcg catgggggct aggtcctgta ggctgaatga
   113161 ggcgcctaag agggaaactt ggtgcggcgt gccgtgcagt gacgacttga cctggttggc
   113221 caaggcggaa agccggccgc gattgaggct gtgtttggag gagataaagt acagttgccc
   113281 tagtacggtg tttttgggga tgtgtgtgtt gtcgccgatg acgctgattt ctaaccaagt
   113341 ccgtgggagc cagatggtga ctggcatgtt cagttcttgg cggttgtgtg gaatgaagag
   113401 tcccaggaac ggtccgtaaa agcggcggta gatgcggatc aggtgggacg ttttgaggga
   113461 aaggtcgtac ggcaggcaga cgtcgagacc tccgccgggc tgctttctgg ggagaaagta
   113521 gggtagcggc gtgtcggaga agaaggggcg cgtcacggtc tgctgtcgga ggcgcagttt
   113581 gaacgagacg atggggtttg atggcagttg gtgctgcgcg ctgcggaagg tcacgttgaa
   113641 tcgcaaaatg ttatcctgat acaggatcag tgatgaaaga atcaggtccg gacagtcggt
   113701 gtctgtgtac agctgtccga aagtggcggg gcccatgttt tggatggtgg cgtccgacag
   113761 tcggacggag atgcggctgg cgaggccccg cggtcccgaa atgcctccct ctgcggtgtg
   113821 ccagcagagg gcggacttga ccggtatcgt cagctcggag gtgttgctaa tcttgtcgtt
   113881 gacaaaggtt aaatccggca ggtgtagcga cacgcagtcg tgcagcgcat tgtgctgagt
   113941 gactttccgc cgcagcggca gctggtgcct caggggcggc atggttttca gggcgaaaat
   114001 gttgagcgac agtctcacga tagacatttg ggtcagttgt tcttcgataa tggctcgaat
   114061 gatattgcaa ctcccggcct gagcgggaaa cgggctgagg atagggaaga tgtctgagtc
   114121 ggggttggcg acggcgcata gcaagccttg ctcttcgggg tcgcggtgcg ggctgagcgg
   114181 ctcgagctgc agcagagtcg aaagcaggat ctggaacggg tgctggaggt cgctgggctg
   114241 aaagtccacg tgcagctgaa tgagacgata tgtgccctgg cgcggcagcg gtcgcttcac
   114301 atggtgctga tctgtcaagg tcaggatcgt ctcgtccagc agcagggaag gtggggtctt
   114361 tcgagggcgg ccccgaggcc cattccgtag tgttttgtcg gcgcgcggca tggtttgaga
   114421 ctgatggcag ctgtgggacg gctcagcctt taaatatgca ggtagcggat ttgttatcgg
   114481 gtgacacgtc acagaccgtg aacatgacct gttcgtggat gatatcatcg agttgtctca
   114541 gcatgacaaa gagtgccgag agtcgagaaa tctcctcgtc gggcgagaca tggctcggcc
   114601 gccctcggag gagtctgttg ctattgttgc cgccggtacc gtcgtcgtcg cggttcagtc
   114661 gcattaagag ttcttggcac ttggtcagca gcatagagct gtcctccagg gctagcttgc
   114721 ggacgtagtt cacggtgaga tcggaagcga ggttggcgac catggacata gacagacaag
   114781 cggttttcat gtccagtagt aggtggtttt caatgacggg gtcgggaatg gtgaaggtcg
   114841 cgtcacgaaa cgtcacgtgt tgcagttgat taacggcggc tttgacctct tcgtacgagc
   114901 ggtccagcga gtagagcgcc ataattagga tcctttggtt gatttccacg gcgagcgggg
   114961 ctggcagcag ccacggaagg acgagattcc agttacccac ggagaccggg tgctcgcgca
   115021 cgagcgggcc cgaaaagagc gggggtagtt ggcagagcgc atcgcccttt tcccagagca
   115081 caggcccggt attaagaacg gtataaagat gtccgtgggt gggcacttgc atggccagtt
   115141 ggttgccctc gattcgccgt aagatggtcg gcgtcatgtt tcgtagcaga ctgcgaaggc
   115201 gcgcatagcc gcgggtgctg tcgatgtact ggtgcaagcc cagatgatgg tgtttgatga
   115261 ggtgatgtcg ctgcgggatg gggataatgg ctccggtgag ctttgcgagt ttgcccacgt
   115321 ccgtgaggct aagtttttgt tcgaaggtgc agaaaatggt gctgtccatg gcgccggtgg
   115381 ttcgtccggc cccgactagc gtgctctgtc aaatagtcgg atgcgatctt tacgagttaa
   115441 ataacatgtg ttggtgcagt gggatggttt cgcctatgat gtagtttcca aagtgggttt
   115501 ccgacgtcgc aagtgagccc gacgggttct tgagcttact ctccatgaga gcctgcgtgg
   115561 tcgtggagag aatgggcagc gcctcctgca tcatccggca ggggcactct atcagctgtt
   115621 ctgtgccctc cacgcagatg tattgagtgt cagtgtcccc ccggatacag tctttggctc
   115681 ggaggaggta ctcgtcgatg gtcttaaaca acgtcttgtt ggcgttgatt atctcttctg
   115741 tattgaagaa ctgtgcgcac gggctgtaga actgcgagtt gtagcctaaa cgctcgcggt
   115801 ttttaatgtt gtacatgatg tcggcgagcg agccgcggtt ggacgcccaa gggttgtggg
   115861 tggaggcaaa tgtctgcgcg tcgggctctg tgtggtcgta cagagttttg atggccgcgt
   115921 cagtatcgta cggatccaca cccagcatgc aggaggtgcg accgcgcggg ttgtttggga
   115981 ttttgaagta gttaatgtcc gtgctgacgg gtgtaatgat gagttcacac gctgcctttt
   116041 gtccgtgtag attggccgcc gagtttttct cagacatgct gccaaaagtc aacatggaga
   116101 tggtctcggt gtcgaggaat tgcggcctat ccacgccggc tgcgtggcgg acccaacgat
   116161 ccacttcgtc gtgtcgatgt acgtgcatgg gaaagacgcg gtataggttc tgtacgcgca
   116221 cgcccatgtc gctgcgcgaa cggttgagat acgccacgca agtagccgag gtgtatccga
   116281 ggcccatgtc tacggtgttg atgttttgag tgacatggta ggtcgtgttg atgtctcgct
   116341 cttctttggt cacttgcggg ttgttgataa tgagtgacgt gcatgactta ccgctgtaga
   116401 gcagcatgtc gacctcaaac gtgtcagtcc gcacggctgt cagcgcgaaa cctggatgaa
   116461 cgccagattt ggccatcagg gcgatagaca cgggggaaat cttgtagagc atacaggcca
   116521 gggtaaggac ggattgcaag gtgttgggac aaccggccgt gtaacgcgag aagggcgacc
   116581 gcagccagtt ccagtactcg tgtgcgaagg cggtagccag cggaaaaccg ccatcgtgcc
   116641 ggtggtagtg cggaaagtca gtcacgaaac gcttgatatc gtcgttgagt gcagcgcaga
   116701 tcgtaggatc tgagtagaaa cggtggaaag ggacgacgat acagtactcg gcaagaatct
   116761 tgggtgctgt gatggcgcag cagccgttgt acaggacgtg ctgcaaggat gtgaaatcgg
   116821 tcgccccgtg gcgttgggcc gggtccagct gagcgcgtac ttccaaaatc ttggcgtgct
   116881 cgggcacgaa ctgcagaacc aagaagagct ctcggcaggc ttcaaatagg ttgacgtcct
   116941 cgttggtggc gatctcgtcg accagctggg ttaacatttc tccaactgac tctggttcgg
   117001 tgggcatagt gaaggcgggg cgatagaaaa gatcgaccat tagagttttc aggttcagtc
   117061 cgatgccgca ggcccggttg ttggtcatgg cgggaagaag gcacaggtag aaaatcttct
   117121 gcagcgtcca ctcgtcgtcg gtggcctgat agtcgtcgac gaacaggggt tcgtcggcgt
   117181 ccatggccgc catgcggggc acgtccgaaa ctccatgatg gcgagactcg atgttggcgg
   117241 tgttgagcgg ctgccggtcg gcgatgatct gcacgccttc gcggttccga ggcaggtgac
   117301 acacgaatgg cggccagaga cgatggtcgt ggagcgcgtt ggcgtaggct gacaggggtt
   117361 cttcgactaa ctggccgttg ttgaggcctg gtagggaaga cacgcgggtg acgagccgca
   117421 ggatagccat aatagtacgg tagtgggtat ggatctggga ggagaggagg ccgtcgccaa
   117481 gatgttcgac gatcatagcg atcatagtgt agctgtgggc gaaagccagc atttggcggt
   117541 tctggaacgc gctgacgata catctggcga tgaacggtcg gataactaag aaggcgtcga
   117601 cgttgccgtg caccagcaag tcgactaggt agaagagttc gggatagttg gggcatgtca
   117661 cggtgctttt gaacaactgc aaggtggcct cgtagtcggg aggcggtctg agtcggacca
   117721 tttcggctat gtgcgaggca cgtagttctt gaaaggcgct gggcgccaat ccgtccggga
   117781 tgttgccggt cacgattcgg ggggtgcaca gggtggcggt ctcgccattc tcctgatggt
   117841 gcgcaaagtc aaaaaagggg tggagttcgg tataaaggga caagtttcct atcttgtaaa
   117901 agtcagaagg tgtgtagtcc tgcttcactt cgttaggagt gcgcggcact tctcggcgca
   117961 cgcggtaaaa gtgtgtgagg cgtctggcta tcccggccat gctctcctgt tgaaagcggc
   118021 attcggtgag tctggccaca gccgggtcgg tcggcacgcc tcgctccgtg aaaacctgca
   118081 gacagggcgt cgcttcgtga acgaccgggt ggcacaggca ttgcagcgcg tccacaaagt
   118141 cgagccgctc gagcccgcgg tcgcggttga gaagatacac ggaggtgggc agcgcattgt
   118201 ctttggtctc tgtgagtttg attttgtttt ccaccgtggt gtaagccctg ctctcgggga
   118261 tgtagagccc taccgggaag aagaaagtaa gatcgatgtt gcgttctagg gggtttttgg
   118321 tgtcggtgtt tttgtacacg tgcctgtggt gttccagggc tacggcgtgc tctcccagct
   118381 gcagaatgtc catgggcagc gacgtttggc tgttctggcc agctttttct agcgaggagc
   118441 cggtaagatc ggggttgccg gaggtaaggt gagcggtgta ggagttgaaa tcggccagga
   118501 tagagtggtg ggcgatggcg gtaacggcgt tttcgggact gaggacaaag ttaccgtacg
   118561 tggccggggc agagacgcct tgtttactga tgttgctttt caggagcgtc atgagagttt
   118621 ggatcacctg agcggtgctg accatgacac ctcgcagctg ctgcccggag gccgtgacat
   118681 acgtggcggg gttttcgagg atactgttgg tggtagattc caccattttg gtcaacagtt
   118741 tgaggatgta gtcgcggtcc gacgtgcgat tcagcagaaa gatagtgctg atcatctttg
   118801 ttttgaaact ctgtaggatg ttgctgcgct ggatgcggtt caaggcctgt cgacagagcg
   118861 tggcgttctc caccagcgtc tgcaccacga agtaaggagg cgctttgcgc agcagcacct
   118921 ggatgaagca gtggatgagg ccacgctcca tggcgtcggc ggtgtttttg aggacccgca
   118981 gtacggtgtg aatagcctcg atattgagga ttttgtcgag gatggtgttt tcaaaggttt
   119041 ctcgcaggtg cgtgaggcac gccgcgctca gctcgaaggg gatggtgatg gggctttttt
   119101 cactgtattt agtgaccata atggtggttt ggcgtgaggt gggcattccg gcgccgctgg
   119161 ccacgcgcgg cacctggatg tgaaagagca tcttccccgt ggttagtttg ttcaggtcgt
   119221 cgaacttgat ggcgtgcgca gccgaggcca gggccgtctg aaggaagtac acccattcca
   119281 gacggttgca gaaggtgccg aagatggcct cgaagtggat gttgtagcgt tccgggtcgt
   119341 ccccgaagta aatgcgcagg ctgtcgaaca tttcttcccc ggcgctggtt ttgacgtgcg
   119401 tgaggaagtc ggcggggatc ccaaccttgg gaagaagctc gacggccgac cagttttcca
   119461 tgacggcgtg tgaggatggc ttcgtcgcca accgtctttc agtgtcgcgc ggctcaggac
   119521 gctctaatag tggagtcgac cgcggaaccc caggtcgtca atgtccccgt acacgtgaat
   119581 tcgtacaatc tcacccagga gttgtcgtcc gttgaggacg ctcgcttctg ccagacgcag
   119641 ccggtggacg cggagcgcgt tcgcggcgtc tttggcgcgc tctaccgcgc tgcggccccg
   119701 cacctgcgag aggagagtga ccgcatcaaa ctgatcctgg gacgcctgtt actggggccc
   119761 gtcgccgtgc cctgctactg cgacgagtgg gaagcgaatg agtatatggt cgatgcgcct
   119821 cagttttgcg gaggccctct gctgtatgtg caccgtcgct gtcactgtcc gattgtgggg
   119881 cgcgcgctgg ctttcaccgt catggaaggc cacatcgcca cgcacgtatt tcgaggattg
   119941 ttgtcgctca gcgagtggaa ccaacatttg ccggacatgt tttgtccgtg cggttcattg
   120001 gacagacggg atcgctacag catggcctgt ttgccgcggg acctcacgtt gtacattaat
   120061 gattacccct atttcatgat ggagataggg cgcgtgctca ctgtcagtga ggtggacgac
   120121 tacgtgagtt taatgattaa ctacctgggc gaggccgtaa cacctcgcct gcaagtacat
   120181 tacaagctgt tgttcggagt caacgtgagg cccgtggcgc cattagccct gatttcgacg
   120241 tgtgagtttt ttgtgctgga actacaaaag atgtggctcg gggtggaata tcacaacgaa
   120301 gtaacggcgg atttttttgg ccgcgtgttt tcgcagctac accgtgatcg gggacgcgtc
   120361 atgatggccc tacggctgcc cgagcagact gtgtgccacc tcagccattt tacccttggc
   120421 cgctttaagc gccaagtgtt gtactttaag ctgtcaatca cgtacggcaa gtacaaagcg
   120481 ggggtagcga aaaacgtgtt gtgctacagg cgtctaagcc tggcgttcgg tgaacacgat
   120541 accgtgtgga gaaatctttt ttacgtatat tacgaaatcg gtcggctcgg aacagtgaac
   120601 tctgaatccc gttcatcacc cccaccaccg tcgtctgccc gacctgtcaa tcattcacag
   120661 ccgcctcctg ctcgctggtc atcggcgtcg tctcgcggcc cagctacaac ggccggcgtg
   120721 acgacccacc gagattcgag cggtgaccgc ttaaaacgct acgtgtgcat tatctctcgg
   120781 ctcatgtttg tacggtacgg acaaacatac cgcagggaga aacacgatca cgtgtttgat
   120841 tttactggtc gcaccctacg agaagccgcg cagcaacagc gcagacaaaa acagttggcg
   120901 gcgcagcggc acgccactag tcggcgaaag ttcatcgggg gtatggagtt ttcagagatt
   120961 acgggtgtca gtctcgatcg aatcgccgtc aacgcattta acaccaatag ggtgattaac
   121021 atgaaagccg ccttgtcggg acgtgtaggt tgtcgtgtca atcgcttgcc aaaaaatatg
   121081 actcatagtt tcgtgatgta caaacacact ttcaaagaac ccgcctgcac tgtcagtact
   121141 tttgtgtcga acgatgctgt gtacactaac tctctaaacg tcaatattcg cggctcctac
   121201 cccgaattcc tttattcgct gggcgtgtac cgtctacatg tcaatatcga tcatttcttt
   121261 ctccctgcgg tggtttgcaa cagcaattcg tctttggacg tgcacggtct tgaagaccag
   121321 actgtcattc gctcagaacg cagcaaagtg tactggacga caaactttcc atgcatgatt
   121381 tcacacacta acaatgtgaa tgtgggatgg ttcaaggccg ctacggccat tgtgcctcga
   121441 gtgtcgggct gtgacctgga agcgatcttg ctccaggagc tgtcgtgcat taaaaacatg
   121501 cgagacgtgt gtatcgatta tgggttgcat cgtgtgttta ccaagatgga attgcgaaac
   121561 tcctatcaga ttcccttttt gtctaaacaa ctgattcttt ttattcgcgc atgcttgcta
   121621 aaattacacg gtcgcgataa aaggctgtac ttggatcgac tagtatttga ggctgtgcaa
   121681 cggggtgtgt tcgattatag taagaacatt acggcgcaca cgaaaatcaa acacacttgt
   121741 gctttaattg gcagtcgttt ggccaacaac gttccgaaaa ttttgacgag gaacaaaaag
   121801 attaagttgg atcatttggg gcggaatgct aatgtcgtga ctgtgtgtcg tcatttggaa
   121861 gccaacaaaa tatcccgtgc ccgtctcaaa gtgttggtgg acgtgttggc cactcttcag
   121921 ggtttgagcg agacgaccca tacacaaaac gtgatccgtc agactctgtt gcgtctctgt
   121981 ggcgcggtcc cgtcctccgc atcttcctcc tcttctgttt aataaaaatt tgtcatggat
   122041 aacgataaaa acaaagccgg tgtctccgtc tcttccgacg aggaattacc cggacctggg
   122101 tggcgtgatg ccgccctgat catgcataat ggaatggttc gcgaacatat gttttaccac
   122161 cccgatgtgg cagagatagt acggagaatg attcctccgc cgcccgatgc ggaagaggga
   122221 tgtgtgttcg cttcggagct cgctttctac accagtggtc gttgcaatcg cgcttcgtcg
   122281 gtcttttcca tatattggca gaacaacagt gagatagtgt acgcgatgac tggcatcact
   122341 cattgtatca aaatcgtggt tgagtgcggc caggtcggct cggactccgt cgaaagacag
   122401 ttttacgata gccctggaat ttatctgatc cgtgtttcgg acggcacggt agtgccacga
   122461 aacgtggtgt ggccaggaac cagcgttcga tggtcgaaag aagtgggtat tcgggtcgtc
   122521 cagcggcgcg tcaccgtggc tcgggcattt gtcagtttgt tcaggaacta tcttttttgg
   122581 acaaagcaac cgttttccga ggacctgtgc ccttgcccgc cagatgtgga agatcggctg
   122641 tttcctctac taaatctgtc gcgtggcgac attgaggtgt ttgacaaaaa agtgtgctgt
   122701 gcctataaac ggttgcagaa gaacgacctt ccgcgagcgg gacggcgttt attagatcat
   122761 tgtgtgactc tggctgcctc aaaaaagatt ttattactag atctacctcg attggaaaac
   122821 ttttttttag cacaggtgtg tttgtatgaa ctggatgagg acgaggtggg cgaggaactg
   122881 ctgggaatgc tgtgcggaaa atctaccgaa tcggactcca cgtttttgtt acataggaaa
   122941 accatgaagg tggcagcgtg tgtagccttt attctgaact gtttttacaa acatcaggaa
   123001 cgcttgccag aggtcaataa tcgagtggat gaatgtgact tagcggtgat tgccctgcga
   123061 cgctattacc ggcatcacgc cggtatacag acgcgcgcta tagctatggc gcaaaaattt
   123121 ttgactgatt attctgaatc gttttctccg ttcaaaagct tttctcgcat ggaggtccag
   123181 gtgcctctgg acgcggccgt cactcgaaaa cagctcgtag ccgtgttacg atcctaactg
   123241 gccttgaatc gagcggtgta tatgtcatca cacaggtatg tggccatgat aactgcaacc
   123301 accaggtcat ccgagtactt gtggtgcctt ttggcactgt aagtggtatt gccctctgcc
   123361 agggtaatgc gatgtaaatt ctggatttgt tctaagagat attctatggg gtcatgatta
   123421 agctttattg tatatgaaac aatttcttgt gaagctttaa tgtaccctga gttaaatcgg
   123481 gaaataaact gttcaacggc taggcgtttg tcgcgcccca tgaggtagaa aggctgttcg
   123541 atgttgttct gatcgggcgt gtggtaaaac aacacgggga tcagactgtt gcattgcaca
   123601 ttttgacgga tcagacaagc gatacgcacg gcggcggcct ggttggagtt gccttccacc
   123661 gctatgcgca gctcgttgat gtaagggtgg aggttgatga ccgacgtcag catgtgtgct
   123721 gcgcattcgg ctatagcggt ctctgagctt tctgacaagt cacgcagaaa gtagtgttcg
   123781 agaccgtaaa tgatgaattg gtggcgatac agacccaccg cggcaatccc cgtaccagaa
   123841 gccttgcggt tggtggtaaa ggccgggtcg aggtacacgt agattgtttt tccaaaatgt
   123901 tcctgcgcat tcacattcag ggtgctgtag cgcagaatgt caaactcgtc acggctctgg
   123961 tccgtgatca gcacgttact ttcggtgatc ttgttggtgc cgcctatgat ttcgtccatg
   124021 aacgaacctg gcataaacat attggcggtc ttcctcacct gagagttgag gctgataaag
   124081 gtgggtttat gcaggcgata gcaggggcac gccgtggcgt cgcccttctc cgtaaaggtg
   124141 tgcaggtgtt cctcgcacac gtaagaaacc acgttgagca tgtcgaacgg ggcattgttg
   124201 aggcgggtga ggaagcaggt ggcgtcgcta gttgtgttgg tcgacgagat gaagatgatt
   124261 ttggtggtgt tttgcgccag gaagcccagg atggtgttaa aggcctcctt cttgatgaag
   124321 tgcgcctcgt cgaccagcag gaggtggaaa ttctgtccgc gaatgctctg agggatagag
   124381 aaataaaaaa caaggcgtgg ttagcagggg tggaaccgag gcctatgacg ctcggcaacg
   124441 cccgcgtcag gtgtctacat aaaaggtgag gtggcttccg cctggcacga gaacgcggtc
   124501 atgaacgcgc tgttggcgga actaaatcgg ctgggcgtgt cgcatgtaac cacggaagat
   124561 gtgtttactt ttgccgaaaa cgtgtttcac aatttcggtt ttcttttcca gaccgaagag
   124621 tcgggccctc ggaagattga tttagtgtcg tcgctttttg agcacctcac ggtggagtgt
   124681 gtgaacgata tcctcgatgc atgcagtcat gaatcatcac ccgacgggaa cgggacctcc
   124741 gcggcatcac cgcatgcaca aaaagagcaa ggcggcggcg gcgggcgcac tggacatgtg
   124801 tgatgtgtct gggacttgtg acatgaggca cgtgcagaac gtgtttacgg aggagattca
   124861 gctccactcc ctgtacgtgt gtacacggtg tttcaggact cacctgtgcg acctcgggag
   124921 cgggtgtgct ctcgtgtcta ccctcgaggg gtcggtgtgc gtgaaaactg ggctggtgta
   124981 tgaagctctg tacccggtgg ctcgggagca cttgctcgag cccatcgaag agacgtcgct
   125041 ggacgacgtc aatgtcattg gagctgtgct ggctgaggtg tatcggtatc tcatgagcca
   125101 cgcggctcgc tatgccgatg tcattcagga ggtggtggaa cgggatcggc tcaaaaagca
   125161 ggtggaggag aatatctatt tcactttcaa taaagtcttc cgttctatgc agaacgtgaa
   125221 ccggatctct gtgcctgtca ttagtcaatt gtttacccag cttattatcg gtatctattc
   125281 caagcagacc aagtacgatt cctgtgtcat caaagtgagt cgcaaaaagc gggaggacgc
   125341 gctgctcaag cagatgcgtt ccgaatatgg aaacgcacct gttttcggac ttggcgtttg
   125401 agcaggtctt tgaggaggac ccgcagttac ccctgcatgt ggttttggac cctgtagacc
   125461 tctcctttgc agaggcagag accgtgcggt acgtgtacta ccgcagcgac ccggaccccg
   125521 tagggagatg gcggcgcgcc acgtttcgcg tcttcttgcg gccgttcgag ctgctcacct
   125581 atctgcgcga cgccggcctg acggtcgcgc cgacctttcg ggtggtttgc catcacgctt
   125641 tattcaccac cctggggatc cgttgtgcgg aacagaggct atcgggggct cagatgctat
   125701 acctgcgtct ggtctggaac gaggagcgtt ttcgcgattg ggagtttttg gtacgcgatc
   125761 tgctacgaga agagatgagc gtgtgtcagt cgaccgagcc ggcggatcgg cccgatccct
   125821 cgttgctcat gacggatgcg atgcttgagc tggccaaaag cagctcaaca accgctccgt
   125881 tttttgagat gccgtcttct ggcacaggga acaacaacgc atcatcagcc tccgctgctg
   125941 acgagagcag ccaggtagag cgtcgcgtga tacagtttct ccgcggtgat tccgagttaa
   126001 cttatcatgc gggacctttg gaaccgcctt cgaaaatccg agggcatgaa attgtgcaac
   126061 ctcgcataga agtgaaccct gatgttatct acgcatcggg cccgcacgaa gacgaccgca
   126121 cgtctaaaac ggacgagtgg cagaagggtg gtgtgctgcg actcggctcc gtctgggatg
   126181 tgcggcaacg tctgcgcctt cacgtcctct ggtacgcaca atctttttgg aggtcgcgtg
   126241 gcctcaagta cgaagaccgc gaggaggatt tgcggctgac tctggactcg tatttcgatc
   126301 gactctctgt tgagtaccaa ctacttcgcg aggtgtatcg cgaaatcaaa gcggtgctca
   126361 ggtcggatcg catggtggct cagaaattct cctgtcatct gtctatagaa acttcctggc
   126421 ttttaatttg ggaactgttt gaccgggcgt tagaactttg gagggatcag gcggatgtca
   126481 acagctgcat tattaaggca ctagctcata agctgcgcag taaagcacaa tcgagccacg
   126541 ggaacagtgt ttcggcaggt aaaacgaacc cttcagagac ctggtacgcc gatgtggtgc
   126601 gctgtgtgcg agcggaggtg aaccttggcg tagaagtgca tgtggagacg tgcagtcaga
   126661 gcggcttgtg gctcgttcgc ggtcgcgatg gacacttgag aaagtggatc actcagccgc
   126721 agacgtacgt gctgtacgcc actccgggcc tggtttttca ctgggttctg cctggtggct
   126781 ttgccatttc ctctcgagtg tgcctagatg gcgtcgggag ggatcacttc gaacgattcc
   126841 agatgtctgc gccagttctt acaaaaagaa tgttgctgga gacaggttgg acgagggcag
   126901 aagcatcgag agttccaagc tgtggcctgt agatcggcta ttttttcccc acccgggggc
   126961 gatgccagtt gcttggcgtg tcagctgtta ttgttcaaac gaggaggaga aaatctgatc
   127021 tgtttttctt gtaatggcaa ttacatgggg acattttgct gtcctcgaat acagagagtg
   127081 cgacaagatc tcgtaggttt acacacaacg tacaaattag tgtttttggg acagctaggg
   127141 ccggcacgtg ttgattttgt accggccttt tcttctatga cgagcgtggt gccgcgatgt
   127201 tctattactc cctccctcat gtacgaggtg tgtactctgg tgcctccaga agaagctgag
   127261 aagattcgag tgaaaggatg ctcgggttcc tacgaacctg gagttgaaaa ggccatcaat
   127321 ctcggtggag ccggggcttg gctggtgagc aatagcagcg ggtacacgtt gtatttttac
   127381 atactgtgtt ttgatctttt cactgtatgc ggcaatgatc aggaaatgcc ctctatggcc
   127441 agattgatgg ccttagcgac cgcttgcgga caagtgggtt gcacctactg taaggatcat
   127501 ggaggacacg tggatcctac cggttgttac ataggccctg tgccagacaa ggggaattgc
   127561 ttgtgttaca cgttgtgtaa ttctcctact atgaacccaa tcactaatga gaatcctgta
   127621 gcattcttct gcgatgtgga gagagcgagc tatctgtgcg ccgtgggctc aaaaaccaag
   127681 agcaaagtta cgctggcaga tagcctggac tatcatatcg gtgccaagaa tgaaaccgga
   127741 gactggctgc cgctaaatga aagtgcctgg cagttggtga gggtggaaga acccgtttct
   127801 cgaatgattg tgtgtgcctg cccggtactg aagaacttag tgcattaaga aaacaataca
   127861 tgtttgattg acggggacat acttacgttg gtgttataac agctggcgaa gagcgccgtg
   127921 ctcttggcgc ccttgtgatc gatgctgatg acaaagtctt tgttttccac gacgtagtcc
   127981 ttagcgaacg tgtggcggca gcgaaattcc acctctttga gcacaaactg ggacacgtgc
   128041 ttctggtgcg ccacgtagcc gatgctgatg ccaatcatgt gcttgagcaa gaagcagatg
   128101 atggggatga tgaaccaggt cttgccgtgc cgtcggggca cgagaaacac cgtggccttc
   128161 tgcttgaaca cttccacgga agtctgtgac aggaagtcga tctcgaaggc gtggaccaaa
   128221 tattgcagta cgcgattggc cagtacggga atcttggtca ccgctataaa aaagataacg
   128281 tgaatcaata aattcttttg aaatggctcg agtcgaatgg gtttcgcgtc gccttccatg
   128341 gtggcaaagc cgccatctag ccacctcttg aagtccgtca taaagttgtt tatctgtaca
   128401 aactgggggt cgcgatacag ctcggtcagg gcgtcgagct tctgatacga ctgcctctga
   128461 tcttcgggac aggggagaaa gttcaggtta tccaaggccg tcttgaggtt ttcgtggaac
   128521 aggagcgttc gcctgtcctc ttccgagtgg tagtcgcgat agcgaccgca aaacgtcatc
   128581 agggggagga acgcctcgtt acagcagtgt gccagtccca gttcggggtg catcatttgg
   128641 tagcgcttac gacagagggc ggccacattg gtgaacgagg tagagatgca agagctgggg
   128701 tgatttttgc gctttaggag ctcttggtag cgctcctgga tccgcgaagc ggattccccg
   128761 cgcagcatgg ccacgtatgt ttctcccccc tcggcggctg ccgcctctcc ttctcctgct
   128821 acaactactg caactcctct ttctttctct tcttcccctg tgtctgtagt accggatggt
   128881 gttccgccgc ggtcggtggg attgacaact gcagccggta ttgccgcttc cacagcagtc
   128941 tccacgtcgt tatgtgcggt ggagcggatg gtggaacttt ccacccagac accagcagat
   129001 tttgaggtgc aggagacgct acgcttcgat gaggccgtaa atatggcgct agtggcctgc
   129061 gaggctgtgt ctccgtacga tcggtttcgt ttaatcgaaa ctcccgatga gaatttctta
   129121 ttagtaacca atgttatccc acgggaaccc gccgaaatgc ctgcagtcgg ggcagaggcg
   129181 gagcgtacgt tctctacacg tcatcatgat gtgctggatg gattttccaa tctgtccgtg
   129241 cctctaccac caccttgtgg agtgcgagat tatgcattgc acaatgttga taggctgacc
   129301 tacgaaggcg aattggtcta cgggagttat gtattgtacc gcaaaaatca cgtcgagctg
   129361 tccctgtcta gtaacaaggc tcagtatgtg gaggcggtat tgaggaacgc ctacacacct
   129421 gggcttcttg atcatcacaa cgtatgcgat atcgaggggt tgctgtacct gttgtactgt
   129481 ggaccccgca gcttttgctc gcgggacacg tgtttcggtc gggaaaaaca cgggtgtccc
   129541 tttccggcct tgttgcccaa gctcttttac gaacctgttc gcgattatat gacgtatatg
   129601 aatctggcag aactttacgt gtatgtttgg tatcgcggct atgattttcc atcggcttca
   129661 gattcgtcgt cgggaggtga tgacgacgaa ctgcgcttgc ctttaaaggc cgtctcgctc
   129721 gatcgcctca aagaggtgct gaaggctgtg cgtggacgct tcgtggggcg cgaggtccct
   129781 acgtggcccg cctcgtcgcg gacctgcctg ctgtgcgcgc tctatagtca gaaccgtctt
   129841 tgtttggatt tggctaggga cgaggccaaa acagtgcact atagcccgat cgtgatccaa
   129901 gactgtcccg cggccgtgac cgacgtcaca cttagtcaca ttctgccggg acagaccgcg
   129961 gttaccctct tcccggtgta tcacgttggg aagctgttgg acgcgctcac agaaacagaa
   130021 gctggggtcg tgtctctaaa tctatgacgt cggccaataa aaacctcttg aaggaggcga
   130081 tgcgcctgag tctcgagaaa caacagaatc agtttttgag acgcgtttac ggagctcggc
   130141 atcgcgtcac ctctcatcac tccttgcaac tcatgcgagt ggcggcacgt gagcaaactc
   130201 ggtatagtca ggcggtagtt ggacaggtaa ctgataacgt agttagggat cgcgaggatc
   130261 tcaaaaggga gctccagcgt gctagggttt tgcagaaggc tgccgacgtc gacaacgctt
   130321 tggactcttt aattgaattg aaggacacgg tggaggacgt gcgtgacagc tttgtagatt
   130381 ccgtggctag cacctgtgag gtggatctgc tggaggacga cgataccgag taagaaattt
   130441 gtgtctgtct atcatctttg tccgtttgtc ctcacggcta aatttccatc atgtctacac
   130501 ggtccaaggc caaatcccgg cctcggtcgg cgtctgcaga atctggtcgc ccgtggcagc
   130561 ctgcgcccct cagacgttcc aaaacgtcgc agcgacgagc ctggatgcgt caggcggcta
   130621 tggctgcggc ggtgcgagaa agtcaagcgg cggcagcagc agcagcagcg gctcctgctg
   130681 catcatcgac acgaaatgtc atgacagttc gcaagcgcac cactccgcct tcccccgctg
   130741 ctatgctgcc gcctcagtcg tcgtccagag gacgtaccac ttcccggcaa tctagtattg
   130801 acggtcctgt tttatacgca gcagacccac agttgcagtg ctgtgaagat tcgcactggt
   130861 cttttgagta cgacgaggac gctccgacgc aaaatacagg aattgttcag ccccgagcgc
   130921 ctttgcgctc cataacctct tcggtacacg taaatgatga gtatgacgcg gcatcgagcc
   130981 aagtgtctca ggtgtcagtg gacgaagaac acgaggatgt ccattgtacc tgctctaatg
   131041 aacatgttat tgctacctcc atcaagggtt tggtgtgtga tgcctctttg ttttcacgaa
   131101 tgactcagcc ggaactgtgt gagatggcag tcacttatct cctagtgtat gtcccaaagg
   131161 atgaaaactt ttgcaaacgt gtgtgctatt ctgtagacat gactgatgcc agtcgacgca
   131221 tagggtgtgg ctcttttgga gaaatctggc cgatagatcg caggcgcgtg gttaagatag
   131281 ccagaaagca cactgaaacc attttgagtg cctacatgtc gggtctgatc cgcactaaag
   131341 cggggcctga ggccgaggag atgcctggtg tgtatcacgg actgctgaca gccacaggct
   131401 gttgtctcat gcacaacctg acggtgtatc agcgtttcca cagcgacctg tttcattttg
   131461 agaactggga tctgacctcg gttccgagct atcggcgcgc cttccaccac ttggctaatg
   131521 ctattaaatt tctcaaccac acctgtaaag tgtgtcactt tgacatttca cccatgaatg
   131581 tgctgatcaa tgtcaacccg cactaccaca gcgagattct ccatgtagcg ctctgcgact
   131641 acagcctcag tgagccttat cccgtgtgca acgaccgttg cgtggtggtg tttcaagaaa
   131701 ccggtacggc tcggcgcatc cccaactgta cgcatcggtt gcgcgagtgc tatcaccctg
   131761 cctttcgacc cctccctctg caaaaactga tgatctgcaa tccccatgca cgttttcccg
   131821 ttagcaatag tccgcggcgc ttttgtatga tcgaactggc cgctctgggg aacgtgttgg
   131881 ccttttgctt ggtacgactg ttggatcgcc ggggaataga gggtgttcac aatggccctg
   131941 agtcgctgct gttcaaacac gccgcgactg cctgtcacgc gttggaaaac aaccgcctga
   132001 cggcttgctc cgacgcctgt ttactcatta tggccgcgca gctgtcttat cacgccggcc
   132061 tgttgggcga cgacggcctt gccgtcgtga gccagacggt tggctttgtg gaagccaaga
   132121 tgtcgtcctg tcgggtcagg gctttcagac gttactatca cgagtgtcta ggtgctttgc
   132181 cttttgatta cgtcagaaat aatctggaac ggctactggc catggcggac ggtgtgtatt
   132241 tatacaattc gttccgactg gcggcgaaca ttagtaccga ggaggatttg gacggcgatt
   132301 gtcggcagct ctttagcgac taggtttgcg gaggaggaac gctcggaaag cgggcctttc
   132361 cccaaccgca agtatgtggg acgagacggg ggatgagaac gaggacctgg tacgattact
   132421 atccctgcgg gacgatgagc ccttgagcat gtttatcatg aacactttct tgttgaaaca
   132481 ggagagtttt cgcaatctat ctttttccat cctgcgcctg gcgtacgcct accgcttgtt
   132541 taccaaggcg gctcggacct atgggctggc ggtggccgag gagtttgtct ccgcggtcgc
   132601 ggctctggcc caggacgagc tgcttcgtga tattctcacg aatcggtacg tggagtctcg
   132661 ggaagagatt caccgttcgc ttcagagggt ggcccagtgc caagagcgag aggagctggt
   132721 ggacgaggtc tctgacgact acgtgtggct gagcaaactg ctagacttgg ctcccaatta
   132781 ccgtcagttg gagctgtatc agattttaga gagggagtcg cgaggccagt ctcggaacat
   132841 ggtgtggcac ctgttgcgtc tggattcggt gtcggccacc aagttttacg aggcctttgt
   132901 atttggatgc atgccaaatg cgctggcgca acgctctcga gcgggggcgt cgcccggtat
   132961 ccagtttggt ttacagcacg agggtgtggt caagaccctg gttgagttcc acgtcatgca
   133021 cggccgggaa ccggtacgcg atggtcttgg cctgctgatt gaccctacct ctggcctgat
   133081 cggcgcctct atcgacctgt gctttggggt gtgcaagtct gatagcggag acgcgcggac
   133141 gagcctgcac atatcgccct gcgccagtgt gtacgaaatc aagtgtcggt acaagtatct
   133201 tcgcaagaag acggacccct ttgtgcaaaa cgtgctgcag catgctgacg ccgcgtcggt
   133261 ggccaagttc ctactctcac atcccattcc tggtgtggaa tttcgtcacg atgccgatat
   133321 tccctcaggg cgggaatttc tgctgtccta cgaccccctt ttcaaggcca ccctgaaacg
   133381 cggacgcccg attaagcctc cggaggcttt gcgtgattac attcacgatt tgctctacct
   133441 gaacaaaaca gaacgctcgg aagtaattgt tttcgacgcc aaaaatctgg atgagactat
   133501 taacgctccg cattcccctg cggggcctgt ggcggacgac gccgtggaaa ccgagggcgg
   133561 ctcgcagcgc agctttcacg atgaagacac ccccgatctg ctgggacagt tgacccttta
   133621 cgaggtttcg cgcttttccc tgcccgtgtt tgtcaatcct cgtcaccaat attactttca
   133681 gctgcttatc cagcagtatg tactgagcca atactatata aagaagcatc cggatcctga
   133741 gaggatcgat tttcgagatt tgcctaacgc acatttggtt tcggctatct tccgcgagcg
   133801 ggacgagagc gaagtggggc gtccgctcta tctgggcggt cgggtgttca gttgcgacca
   133861 cattcctctg ttgatcattg tcacacctgt ggttctggat cccaaattta ccaggcatgt
   133921 ggtttctacc gttgtagatc gctggagtcg tgatctgtcg cggaaaacga acctaccggt
   133981 atgggtggcc aatgctgcaa acgaatatgt tgtttcttcg gtgcctcgtc cggcaagccc
   134041 ttaagagaca ccatgggtag accggtgtgc cttcggtctt ttgccgatat agataacacg
   134101 tcgtcagagg aagatgaggc agatttgatt agtataaact ctgatcgact atcactagct
   134161 tcgcaagact ctatggcgcc ggctcccaaa ccaaaaaaga aaaagaaaaa aacacaatcg
   134221 gcgcaacata ctacccagaa agcacaacta actctggcct taatggaaga tggggatggc
   134281 taccattctc ctcctcgtgt aacacggaca tataatcgtc cttcccctcc ttcgaaggcg
   134341 aaaacacctc gcgctgaaaa gatcgccatg cgtcccccca cgccaaaaaa ccagaggcga
   134401 tcatcaagcc gcggctcata tgagtctgta tattaagcgt ccctgttttc cccccagtac
   134461 ataataacat acaaaagcaa actttgggaa ctttttttct ttggtttttg catatcatct
   134521 ttaataaaat ctttatgata caattttaca tgacttgagt ccgagcagtc tttgtaatgt
   134581 caagtttgct cctcagcgga gactaagcca tctcctccgc gtcggaggtg gccatggaag
   134641 cttctttgag agaagcaagt tcgtctgtag cgggcaaatg cttatacttt acactatgat
   134701 gattgcggaa atagcgggtg cagcgacagg ccgtaaaacc ggcccagatg agaaaattaa
   134761 tggcgaaggc cacagctaca gatgaagtgt actcaggtgt gtaggctaac tcatatttga
   134821 taatgggata gattaaaccg cagagaccgc agaacgtacc gacatgaaac ccaaactgca
   134881 ctttgacgta gcgataaaac actacttcga ggagcaggaa gtaaatgatt gagataaatg
   134941 caaacacgaa aaatacagcc atgaccatgt gtccggtctg gacgaaaaaa ttattaccga
   135001 atccgagaca cagagacatg gagattactg ctatgttgaa tcctagtagc atctgcacta
   135061 agttaacaat gagagtgcgg tactgaatgg tgccttttag tttaggatga attctttgca
   135121 aattaaacaa attctgctta aagttttggt aattggtcac taggttaaca ttgtagatag
   135181 ttatacaaaa aaagtgtaga caggccataa acgcaatgac gctgggaagg cggaagctca
   135241 tggcgagggt gaacaattcg aaggtatcca tcaccatgat gaagatgaag gtggacaggc
   135301 tgtctcccat gtaggcgatg tctcgtgttc gctggttgag attcaaaccc tcctctttgc
   135361 ggtagctgat tttcatccag cagcagatat agtagataac aacacacagg aacacgatca
   135421 tactaaaggc aacgtacatg ataatctgga tggtgtccaa aaacaacatg ggagtagtta
   135481 ggtgcatcac gttgtagttg ctcatgttca tctcagagta atccaccacg ttaaagtacg
   135541 cacagggata gcccactcct gggatgttca tcatgacaac gtgtccatcg aggttgataa
   135601 atgtaaaaac taccattagg acggagacgc cccagatgcg gctgttcatc cagtccacct
   135661 tggaggtcgc catggtgccg ccgcggtggt ggacgtcgag gcggtgccag gcgagtgcgt
   135721 ctcgatgacg aaaaaccggc gagtcgttaa atacttatgg tgcgtgatgc tccttgagtc
   135781 tgtggtcggc gaagtttccg cgcggcgaaa ctgcactact cctgcggatt tcagccccga
   135841 gggtacaaca ccgcgtccga gatgtcagcc ggcacaacct tcacgggtgt cagctgtcat
   135901 ctcagctggt acgggatcat tgaagacgca gtgccagtag ttcagtgttt atttatacac
   135961 attggccgca acaatagcga gccgaagctt cagacgttta ttctacgagc tgatcccttg
   136021 ctggcagcgg atctgcgagt cgtgcatcga ggcggttatg caaacctggc ggccacagct
   136081 gacggtgaag agcgccagca gagtctggac cggcgtagct ccgtgctggc acgcgtgctg
   136141 ctggaaggca gcgctcttat tcgggtgttg gctcacccgt tcagtccggt gcaaattcgc
   136201 accgatcagc acgagctaga gatcctggaa gccgcgccgg cgctagatat cgaggccgcc
   136261 gctgtgtcaa acgcactcag cctgttccat gtagctaaaa tggtcattat aggatcctac
   136321 cctgagttga ccgaaccccg ttcagttacc gtgggcgagg agcgtgtgag tgaggaatat
   136381 gggacgcatg ctaataaaaa aatgcgcaga ggctactatg ccttcgatgt cgccatgtcc
   136441 tttcgggttg gcgctcataa atatgtttta gaacgtgacg acgaggctct agtctcgcgt
   136501 ctgtttgaga ttcgagaagt ttctttcctc cgcacttgtt tgcggattgt cacccccatt
   136561 ggttttatag cggtagcggt gacagacgaa cagtgttgtc ttttattaaa atctgcctgg
   136621 acacgattat acgaagtact gtttcggggc tttgcgggac aggctcccct atgcgactat
   136681 ctagggcctg acctttttga agctggggga agtcgctctt ttttctttcc tggctttccg
   136741 cccgtccccg tgtaccccgt taacggttta gggtgcttat tgcgggaaac ggctctcgat
   136801 gccgcgggcg aagtgatatc ttggtgtggc cttcctgata ttgtggggtc gctgggaaaa
   136861 ctggaaattc agcctagcac gctctcgctc ggggttcccg aggatgagtg gcgcgtgttc
   136921 ggcggagagg acaccgatcc tctgcgcatc aacggaactg cgtttcgaca agccagcgag
   136981 acgctcttta gccatctatc tacacgtgct ggagagggag aattcctttc agctactgtg
   137041 catgctaaag attcgaccct tcatcaccta gtcatcgtaa acttggtgga gtctgtagtg
   137101 gctaagtgta tcctagctcg agactttaat accgctctgc gctttaataa tcgactccac
   137161 accaagaatg tttgcaaaca gtttattgac aacctgcgat atcgatcagg tcgtgccttt
   137221 tggcagattc aaagtttact gggttacata tctcaacatg taacgtctgc gtgcacttcc
   137281 gcgggtctgt tctgggtctt atcgcgaggg ttttgtgaat tttatgttta tgatggaacc
   137341 atgcctcatg gaccggtttc tgccgagacg tgtgtgcgga ccgtggtcga gtgttattgg
   137401 agaaagttgt ttggagacgt gccaggtcct gtgtgtcggt tgcaagccag tgctcctggc
   137461 attatactgc tttggggcgg tatgcgtctt gtgagtcctt tcggggttga cgagcaggac
   137521 gactggtggt cggtggtggg tcaggtgttg ggacgtttac ccacattgtt tcgaaagcgg
   137581 ccaactgcac aggagttgga gtctgtttac cgcgaagtgt tgtttcgctt cgtgtctcgt
   137641 cgcaacgatg tggatttctg gctgctacga tgtgatccag gggaacacga ggtacgaccg
   137701 cacgttggag tgattgactg cgctccgttc tacggcgttt ggtctgagca gagtgaaatt
   137761 attgtacaat ctcgagattc ggcgctggcg gctgaagtag gttacacagt gtacctgaag
   137821 agagcgtttg tgatgctaac cgcgtgcatt gaagctatga gcgtatgtaa cgtggcgctc
   137881 gtagtgcctg caacgaattc ttcattgtct tcggcggttt ggcctgggcc tttggaggag
   137941 cgggaagaat ggctcagggc gctgagtgga gaggcgcggc aggcggcgga acgcgtgatt
   138001 gccgaagggt cgcggttttt ccggctcaat gtgtaattaa caagcacaaa cagctgttca
   138061 caacatattt gggtcacata gaggtaggct tggaaagttg gagttgagca cctcgattag
   138121 agccacttcg actaacttgc cgtttagggt ttgacgttcc attagtttca tagtaacttt
   138181 gtaagattca tcctggcgcg tgatgcggaa ccaaaaccgc aagatggtgt ggagaaatga
   138241 ctggcggctc tcgtaaaaca aaataaacac ttttggaacc tgttctacga tttctgttgt
   138301 cttatcgtca aaaaacaggt acagggtact acagatgagt ttttgacagc taatgcgtaa
   138361 cagtgtgcta aattggtctc ggatgttaac gacctttaag taccccagta agtctagcag
   138421 acactttctg gtaagggtta agttctccac gcaagagaga atagtgcaaa gcgtaaagtg
   138481 catcaggtta ctagtcctca cgatgccgca acggtgtttc aaccgcatcg aggttagttt
   138541 cacgtttttc attacgtcct cattttccaa aagaaaaatg gtagagtagc ccacgaatga
   138601 agatttgagg ctcatttcgc cgcggtactc ggagatggag cacagcatgc catggtcggt
   138661 gtgaacccac aatcgatcgt tactcacggt gatgtccacg atttgtgggg tggtcacgat
   138721 aacgttgcga ctcgtttcat cagtatggac ttccaatacc ccgcgcacca tcaggatgtc
   138781 catgccggga ggatctgaag gggccgcctg catcttgttg ttggctcgga cgttcagcgt
   138841 ctgaggaagg ccgatggaca actggctgcc tggtcatttg gcggcgcctt gccttttcgc
   138901 ggttgcagat gagttccacg tactgtcgga acttactgtc gtcataggcg gccgcaacga
   138961 tttctccaaa agacaagtgg agatactctt caggaatggg ttcgagggtg gacagggaca
   139021 gaacactgaa cagataggga atcaccacgc gctcgacagt gtagttggag taaactatgg
   139081 cttcttcggc accttgagcg gtgactaggc gtttcattcg gaaagtgcga aagtattcgt
   139141 tttcccacag ctcggtgaga aggttttcga gtttttccgt gttcggaata aattgcgaaa
   139201 aaaagctgtt ggccaccaca cggttgtctt ctatcgctag cgggttgaag gccacttctt
   139261 gcgccttgcg aaccgcttcg gtgattgata ggtggtgaag ttttggctca cgttcaaacg
   139321 tctgcgcgga ccgctggcgc gcataccgag agaggagatc gcgcaattcc cgcacccggc
   139381 tctcccacgc ttgattcaag ctttttaggt cttggatctc gtccacctgg gcttgaatct
   139441 gctcttccaa gcattttatc atctgcttct taaacagatc acgaatatca cggtcttgtg
   139501 tggcgtttgt tacgggaggt gcgctggcgg acggtccgcc gcctggggta cgggagggca
   139561 tcaggcgact ttggtccacc agggaagggg tcaggtcttg gaggaaggat tctacactgt
   139621 cctcgatgcc gatacgcgac ttgctgtctg agacgttcaa taaaaatttc ataattgact
   139681 ttttggcgtc gctgccgcgg tcgtgtttct ccatcatgtc cacgattctc ttacagttca
   139741 tctcatggcg gcttgtggtc acggctttga cgggatacgt attgaggagc tgacagatct
   139801 tctgatggcg gcacaggctg tcgtagcgca ggatttcttc gtgaaggtgg gagattggag
   139861 tggtaaagaa cagctgattt cgctcgtacg ccaagggttc tgtcacaatg tatctgttga
   139921 tggtccgttc tttcagctgc gcttcgatct tctcggattt gatgcgcttg aatatgcgta
   139981 attcaggtga gttgacaatg cggacaccac acaggtgtgt gactacctgc tgcaggagat
   140041 gcagattgct gttgagtaga tcttgggcca gagggtgggt ctccgtggac ttgtggatgg
   140101 ccgcacgaat gaaggccgcg cgttgcgcaa tctcggcagg cttggacttg acatccatca
   140161 gcgggatgat gcccaccgtg acgtaccagt ccacgtagag gccgtagtca tcgttgtccg
   140221 cgaattgata taaaatgtca cggagcgttc cgaggactcc ggtctgcacg ctctgtcgca
   140281 cagaggcgct ccacaccaag agatagtttt ccaagtcctc gtcgtctaga gcttggtacg
   140341 gaaacagggt cgagtgaatc ttccattcgt ccgctacctg tcgcacggta atagtatcaa
   140401 agatcgtttt acacagtccg tacagcagct gttttctcaa tacacacgga tcccggagaa
   140461 cctggtgaat gctcttgccg cggcacgtgc cgataaagcc gtgcaagaga cgaatatagc
   140521 tcagtgtctg ggcggtggga aagatgtcga tgaccgtgtc gtcgtcgcgc cccgttaagt
   140581 acgaagatgc tttgattctc aacctctcgt ccgcggctaa gatcgagcgg atcgtcgaca
   140641 aggtcaagtc cctctccgat gttcgcttcg aaccggagga tttctcgtac caatggttca
   140701 aatccatgag tcgtgtggaa cggtccgcgg atcaggacgt tcgcgtgccc tgcacagatc
   140761 agtggccttt cttccccttt cggacgcttc tggtgaccgg cacggccggt gccggcaaga
   140821 cgtccagtat tcaggtgctg gccgcgaacc taaattgcgt cataaccggg accaccgtaa
   140881 tcgccgccca gaacctcagc gcgattctca accgcacgcg ctcggcgcag gtgaagacaa
   140941 tctatcgcgt atttggtttc aacagcaaac atgtgcctct ggccgagggc ggtaacgata
   141001 ttctgaagca gtaccggatc tgcgagtcgc gcgacgaaaa taccattcaa cgtctgcaag
   141061 tgaacgatct cttgacttac tggccggtca ttgccgacat tatggaaaaa tacttaaata
   141121 tgttggaacg aaaggcgtct ctggaagatg tttcggagat gtgcgagagt aatgtcatta
   141181 tcattgacga gtgcggcctg ttgctcaggc acatgttgca ggtggtggtg tttttttact
   141241 acttttacaa cgccgtctgc aataccacgc tctaccgcga gcggcgtgtg ccctgcatca
   141301 tttgtgtggg ctctcccact cagacggagg ctttagagag tcgctacgat cacatcactc
   141361 agaacaaaaa cattcgcaag ggcattgacg tgctctcggc cctcattcag aacaaagtgc
   141421 ttatggagta ttgcgacatc gcaaataact gggtcatgtt catcaataac aagcgttgca
   141481 cagatctaga tttcagtgac ctgctcaagt acatggagtt tggcattcct ctcaccgagg
   141541 aacacataac atatgtagat cggttcgtaa aaccccctag ttccattcgg aacccgtctt
   141601 acgcctctga catgaccaga ttgtttcttt cacatgtaga ggtgcaggca tatttcaaaa
   141661 gattacacga acagattcgt cagagcgaac ggcatcgctt gtttgacctc ccggtttatt
   141721 gcgtggttaa caaccgggcc tatcaggagc tctgcgatct gagtgacccg cttagcggtt
   141781 cgcctcagcc ggtggacatt tggttccgcc agaatttgac gcgcattatc aattactccc
   141841 agtttgtaga tcacaatctt tctaacgaaa tactcaaaga gactttacga gcagaggaca
   141901 cggaggaagc tttagaaact ttattgacat tgcgaatcac atacattcag ggaagttcag
   141961 tgggggtgaa ttcaaaggtt cgggcatgtg ttgtggggta ccacggcact tttgaacgtt
   142021 ttgtagaaat tttgcagaag gacaccttta tcgagcgaac gccttgcgag caggctgggt
   142081 atgcgtactc actggtctca ggcctgctct tttctgccat gtatctcttc tactcctcac
   142141 cgtacacgaa cgaggaggta ttgcgagaat tgggccggat cgatttaccg atcatttctt
   142201 ctctctgtgt ggatgagaaa ggtgtcagtg aggcgggcgt atcgtcggga acgcataccc
   142261 aaacacgggt agcggtaagc gggggcggtg gggacgatga tgaagcaatg gtgctgggga
   142321 tggatgagga tacttacgat attccttgta tgaacgagga ggtgtccgat tccgatctct
   142381 tggcgcagac tagtctgtat gaggatccat tctttggcaa gtatgtcaaa cctccgtcta
   142441 tcagtctctt gtcgttcgaa gagacggtgc agatttacac gacctttcgc gacatctttc
   142501 ttaagcggta tcatattttg caacgtgcca ccggaggccg gttcgccgcc ttgccgatgg
   142561 ttacttacaa tcgccgaaac gtggtggtta agtctaactg tcagatcgtc tcgcagacgg
   142621 gctctttcgt aggtatgttg tcacacgtgt ccccggcaca gacgtatacg ctcgagggtt
   142681 acacgaccga taacattttg agcttgcccg gtggtcaccg cattcaccaa gaggtggcac
   142741 agcgaggact gtcacggctg gtgctcaagg atgcgttagg ctttctgttt gtgttggatg
   142801 ttaacgtgtc ccgattcgtg gagtccacac aaggtaagag tttgcatgtg tgtaccacgg
   142861 tggactacgg catcacgtcc cgcacggcga tgaccatcgc caagagtcag ggactttccc
   142921 tggaaaaggt ggcggtggat tttggcgatc atcccaaaaa cctgaagatg agccacatct
   142981 acgtggccat gtctcgggtg acggatccgg agtatctggt gatgaacgtg aacccgctgc
   143041 gcctgccgta cgagaagaac acgaccatca cgccgtacat ctgccgcgcg ctgaaggacc
   143101 gaaggaccat gttgattttc tagagaatgg gcagggagac aaagaaaaaa aaaagacgcg
   143161 gagagggagc caccctgtct ggcttgcatt ggttgtttag tggaagaggc aaaagcccgg
   143221 agggtggctc cgatgggtct cattctgctc cataatagtt atttcagtat gcactggtaa
   143281 taaagatctg tgatcccgtg tggaagagag agaggataat aaaacatgta ttgaaaactt
   143341 gccaacggct atgtgatctt tctcacgtag cagaacaggg agagaccttt gtactaattt
   143401 tattgttttt gtgttttttt ttttcaaaga atgagatgct ctcttaagag ctgagctgtt
   143461 aacggatgtg gtgatacatt aataagtatt tccttaacag aaaaaaaatg tttcataaat
   143521 gagaggagag aagtatgagg tgtttttctt taacgcaata aatcacagtt aggaagcgta
   143581 gcgtttggcg tgcatccttt gtcttttatg caactgaaac tatccgatag gcagagacga
   143641 agcgagtcta gaaagctcgt tcagatcgtt cgtggcctga ggttttttat ttttgcggcg
   143701 gcgcgccagc agcggcgcct cttctgaagc gattcgtgta tatagcgtgc ggtctgctaa
   143761 tcatatagac caattgacat ggatatccag cttttgatac gggttattat cgtttgttat
   143821 ggaagctttt gaacttcatg attaaggata aaggggccta gcaaaaaaag tttttctcct
   143881 aagagcaatt tttcttaaga gctatatatc atggtaaatt cagaatccta tggtgtcttt
   143941 ttttatctcc aagagaaaaa aatcaacatt atggtctaac ttacgatgat cctttggtca
   144001 ctgctgacca acacctacag ttcttttttt gtacgaatcc taaagtacaa tattgttcgt
   144061 tctcaagtaa ctaacttatc tgctatgttt tgtttttctt tttttttccg tatacgtgag
   144121 gattattacc cgcctgcaag gcgcaagcaa ctctgggcta gatgacacag agaactcaca
   144181 tgagcttggc ttgcatgaca aagacatctc cctcgatggg gatggcgcaa cttactttaa
   144241 atgggcttat ggttacaata caaaaagaga gaaaaggaaa cttaactgag acgactctat
   144301 aatttgtacc ttattgtgac tatatactac gtgattactt gtatataaca ataatgatat
   144361 atgaaaaaag tagcaacaag agacaagaaa cagcttaatc accctgacca gacagaccat
   144421 caggaaatta tatatatctt gagacggcca agaaggactt gagtaacggc ggccaaaaat
   144481 gaactcatca ttcagggctg cggcctaaac gtttgtgatg atgatagtcg atatacattg
   144541 ttaaatcatt catggttgtg ttgactagat gatacagatg aatgtacaca gctaggtgag
   144601 acttacagct atccatccat ttttcgttgt gattagctga gagattagac gtttatttat
   144661 cactatggta tgtgcactat ggagtagccc tataggaatt ggggagcagg gtgtttatcg
   144721 ctatggctct tttatcacta cggttgtcac taatgatttc ctagggagcg gagacacaag
   144781 aacttaaact atttatatac ctaaatgata gcttagctgt taactctaaa attgtcacta
   144841 taccttattg tcctatggtc actatgagaa tatcaacaaa aaaaggtaaa actttataac
   144901 acgcaaacaa caaaagaaag attagcttat tgttaaacaa ctatacggcc tatacataca
   144961 taacaacaaa tatatagcta tgatgatggt tatatcacgc aggcttgtct atcgcttggc
   145021 ggttactggg atggaaacga aaacaagaga gaagcaagtt catcgcggac cggccgcgag
   145081 gcgcataaaa aagcgtagcg gttgcaaact ctgtgcattg gttcttgttg tgggttgaga
   145141 tgcccagcag cacggccaga ctcctcgatc gcgaaccggc gctcaccggg gagttcggtc
   145201 gggggaccct gtagttgttg ttcgttttga tgcttgatta gatatcctgt tggtgagggg
   145261 aggtggcagg ctgagttttt tgcaaggtta gccttcttct accccctaca catgcgtact
   145321 tgtttcttga gttaagtgtt tgtttttttt ttcttaatag ttatcgttac aagtctggct
   145381 tgattgttca gggggggttg catcttttta gtgagtgtga taccacgacg tagggtgtgg
   145441 taaccgtaac aataatatct gttggttagg agaacttaaa tgtgtattag gtattattct
   145501 cttatgctgc taacagaatt gcttctccgt aactattatc gtcttacaga tagattgcgt
   145561 ttgttttttt ttttcaagtt ccccagcaaa aacagggagt ctgtggcttt ttggttcgtg
   145621 tacatccgtg ttcgcgtatc gaatttgatc ttcctgcgat gatgtagggt ccttgatgta
   145681 ggatttcgaa tatcggtatt ttttctttta gcaaagtgag ggttcgtgta agtttctata
   145741 caaacttatg tgaagtttat gacgttcgtt tgttatctcg agagcggctc gaaccttctt
   145801 ctgtagagct ttatttagtg caactttacg gggtgtagaa gctaaatgaa tctctgaagg
   145861 tgctactcat ttacacttcg aagaaacatc cagttcgtga aaaaaacaag tgtcttcgaa
   145921 atcatgtttc cactattttt gcaattacat ctgtgaaagt aggcagtaga taccagattc
   145981 ttttttattt ttgtttgtct cttatacaat ggactacgat gtttctcgag agtatgtcgt
   146041 aagcttgtcc gtggtgtaga tcgagttgct attgttattt ccttttgcac acacagttgt
   146101 ttcaattaga tgtttgaccg tgattttgcc cacccggccc gggagacaag gcaaggagat
   146161 ttgttttttg cgtttgccat ttatcatcgt tatttactat tagtggtgac aatgacctgt
   146221 cagattgttg attatttttt gggctacaga ctataaatct tcaaggatcg aggaaaagca
   146281 aacaaatagg aaaggaaaaa agggaccacc ttacctgtgg cgtctcattc tctgttgcag
   146341 cggcggtcgg tgctgttgtt tagcctggag aaggagacga gaacgacgaa tcggcggtta
   146401 caatgcggag gaggaggagg tctttcggca tcatcgtcgc cggcgctatc ggaacactac
   146461 tcatgatggc ggtggtcgtg ctttcagccc atgaccatga acacaaagaa gtaccaccgg
   146521 cctgtgaccc cgttcacggt aacttggcag gcatcttcaa ggagttgcgg gcgacctacg
   146581 cttccattag agaaggtttg gtatgttagg caacgcagtt ctcggatgtc agtccggatc
   146641 ggaggagtca cagtctgtca tgtgatgata tattgcttaa tttttgtttt gcagcaaaag
   146701 aaggacacgg tgtactacac atcgctgttc aatgaccgcg tgctccatga aatgctgagt
   146761 cctatgggct gtcgcgtgac caatgaactc atggaacatt atttagatgg tgttctgcct
   146821 cgagcaagtc atttagacta cgataatagc actctgaatg gcttacatgt gtttgcttca
   146881 tccatgcagg cgctgtatca gcacatgtta aagtgtgtaa gtgtttcagg ttcgataacc
   146941 ccgcgatatg acacgtaaat agcgatatcg tggcaccaga cgtcagtcac agtcttcccc
   147001 ggtcgagacg catcttatat cgcgatatat cgcggattat cgcagtatgt agcgatatat
   147061 cgtgtcaaag cactccgaac gacattctga tgacggctat cgccttatgt cgcggtatat
   147121 cgcggaatat cgcagtatat cgcggttatg tcgcgacata accgtcatgt cgcgactatc
   147181 gccgcatatc gccactatcg cgacttggca ccgtgccaac gatagtcgac cttagggtgg
   147241 tcgtgtggtg gtggggggct gcttgcggtt tgcaaaccgg agaggtagca cacgctgatt
   147301 gtcggtttgg aagcgttgtt tacacatgtc tttgtcttgg cagcccgcgt tggcatgtac
   147361 tggcaaaacg ccagcttgga tgtacttctt ggaggtggaa cacaaggtca gttaaggttg
   147421 ccaggtaggt taaaacgcag aaaccattgt tctaccggtt tcctaaaacg ccgttcaacg
   147481 tgttttgcag ctcaacccct ggaggggcac ggcaaaagcc gcggccgagg ctgacctttt
   147541 gctgaactac ttggaaacgt tcctgctgca gttctgagcc agctgtcaat caaggcagcc
   147601 aaaagcagcg ttctccggtt tacaattctc ggatcgtttc gctagttaag ctctaataaa
   147661 cgtactgttt aaccacgttg cgtcgtgacg ttgtttatga gtgtcacggg gtgggagtgt
   147721 atcatgttgt ataaatagcg agagcgactc gcggcagctc tctcaagctg cctacgcgcg
   147781 tataactgct tgccgagcgg ccctggatag cctgcaacca tggaagaaac cacgtcaacg
   147841 cgcacttatt ggactttcag gggcgtttct cgcgtgcttc atcagtctgt gaatacgggt
   147901 ttcgatgtgc ggcagtcttc ttttgagagt gccacgctcg tccggtgcct ggacggtgag
   147961 ggcaccacga ctgcgctcgg caaagggtgg ctgtgttgta ccgtggtgca acacggagat
   148021 ggaaatgctc ctaaaggaca gccgcaacag ggatttatgt ctttggacgt tactgtggag
   148081 gacattttgg ataatttgtt tgtgcgtggc atggtggtga ataacaagaa cgtttcttct
   148141 gtggtgggcc aaggaaaaag tggtgacagt tcgttgttaa ctgtgatatc tgaaccagac
   148201 acgctccaag tgacttttat cagacatcat actaaatttt cggactccat tgcacaagca
   148261 tcatcttctg gtgcttcatt gtcctccggc attccatctt cctcatcctc cgtttctgcc
   148321 tctgttccat caacggccgc tttggaggag agacgggccc gtgccgagcg gcatgaacgc
   148381 aaaaagcacc aacatcagca acaacagcag cagcaggcta actctgtgca ggatggcgct
   148441 ggacagatgc gggtgtctgg gggaggtgac cgtgatccgc gcgtcttgaa tcggcccaaa
   148501 gaccgccggt ccgagacgga cggtaagtcg ggccgttccg cgtccgcgga tggtgctggc
   148561 ggtgcggagt ctcatagcag tgggggtgtg tggcactata caggcgggtc acatcattaa
   148621 tttcgttttc gtgcggtgtt cgtctaggct ctcctttaga caaaaggcca aagacgcacc
   148681 acgagccgaa gactgcggcg gaacataccc cgcgtcatat gcctatggaa cataacccca
   148741 catctgaccc tgttggtttc ttaaattatt cttcgcacgc tccattgacg gaccatcccg
   148801 gtagcgacgg tgcgttatta caaaatgaga cagctgggtt tggcgacgcc gaggagcgcc
   148861 ctgaggagct tggctccagg gcgccttctc ccgcacgtgg gaatagcggg accgaggcgg
   148921 gagctgatgc tggggtcagg gcgtccacta gtgctaccga tgatggtggt gatgatgagc
   148981 atgtaacgcc ctctacttct tcgggactgt ctaaccgcca tcttcctccg aattcgcagg
   149041 cctcatccgc gccactctca cctcatcctc gcagccccca ttttgaggac attatacaat
   149101 cgctcaccag gttaattaat gagtgtggta agggagatcg ggttgatact cctgctccct
   149161 ccagacgcac gcccgagtgc agtgactctc atgccagtcc tgctgccacc agtactgctg
   149221 ctaccgccgc tgccgccaca accgtccctg tgtgtgaggc tccccgaccc gtatgcgaga
   149281 ttcgacccta tatggtaaac accgctgctg cccctcagcc tccgccagag cctcagcagc
   149341 cggccgctaa cagacggact cgaggagggg ctcggccccg caacggttcc cgtggaggag
   149401 gcggcgggcg acgaggggct tccacctcgg gtcgtaggcg acggcgcaat caggatgatg
   149461 aatctgagga cgagattttg ccgggcccca gccggaggag aagcgtaccg ccttccttcg
   149521 cggaagatgg acttgaaatt attgatctcg ctgaggaggc agctttggcg gctgcttcca
   149581 tcgcgtcctt ttttgactga ctttttaaat gaccagatat tgaaataaca cactgaacgc
   149641 gtgtatatat gtatataata aagtatatta ttgttgtatt ttatacagtt attgtttgta
   149701 ataaagaata tggttataaa cgccagtcaa ttgttttctc gtgatgtttg cgaagatatt
   149761 cgttagctaa gacaaagtgt tcgttgccga ggaaagactt ggtgttcttg ggtgaagggt
   149821 gccaggcttt aaggatgagg tgacggcttt tattgatcag gcattctagg gtctgggctt
   149881 cagcgcccca gagcatgaac accaagtgct cacggcactc tgacagtctg gagatcactc
   149941 gctcgctcaa cacttgccag cccaagtggc ggtgcgagcc tggctggccg cgaaccaccg
   150001 tgaacactgt gttgagcagc agcacgcctc ggcggcacca gtcgtctatg catccgccga
   150061 tgggtctctg gaagccggcc acggtgcgac acagttcgcg gtacacattt tgcagcgagg
   150121 gcggcgcgac ctgcccgggc agggtgccga acgccacccc gctggcgctc ccgtcacagt
   150181 agggatcctg acccacaatc accacgtaca cattatcagg cgcacacaag taactccagc
   150241 ggtgcacgtg ctcgggcggc gggtacacag tatcgctctg acgagcgcgc gcaacagcat
   150301 ccaccgtatc tcgtagcaag tctaagtcat gggatggtat attcagaaag actagccatt
   150361 ccttactaac agacaagagg cgagtctgct cgtcatggtt aagcatacaa gctttattat
   150421 caggaatgtt ttccaacatc cactgcttta aggccattat gtagtaaagc ggggttgttt
   150481 gttagcggct gtttccactc gtctgggata tcaaggtagt atttatccaa gcggtcgatc
   150541 aaggcggtat caaggtcgtg acgtacgaga agctctctca cgaggttata cagagcatag
   150601 aacagctgaa gtccattacg atccgctcga gtggccacgg gaatgcggac agggcgatgc
   150661 atttttatgt cttcatgacg cacgacaacg agagcggcaa attgtccttt gtgaccaaag
   150721 tcaaacccga gtacattctc ggtaaagatg ctgttgctat atgtgagata tcgaaggtcg
   150781 tacgcgcggc acacattatc tacacacgtg tagatagacc cggtgtctcc acactcactg
   150841 tagccttgca taatcttcat ccaagtcggt gcaccatcgg atttcagaag ggttaacaga
   150901 gttcgcagct gagcggggtt attgtgtagc agagccacaa agtccatgaa ggtgtcgtcc
   150961 aagggtattg tggacgcagc atgtttagtg aggggagtgt agcgaagaag ttgcgagagg
   151021 ttgccatcgg gatgatttac ttttattaaa ggcttggccc agctatcatc ctcgggtgaa
   151081 aacgtttccc cagtaaagca tcgacgggtc agttcgagac aagtgaggtt ctggggtaag
   151141 gtctcggcaa acacgagcgt aaccaaaaca gcagcactca ccagtagtct ccacatcggt
   151201 tgtctcttac tcagtagtat accagtctcg atactctatc tgtccttgca ggattatagg
   151261 gtgatagcgc cctagttgat ttaggaagtc cgagttaacg tctggtaacc ctaaaagttt
   151321 atatattgcg tctaccaggt tggaggtagc cgatgcacta actaccaagc tgtcgttacc
   151381 aattttgatg atggctaacg gcttatgaca gggagtcaac gttggaggaa agaatgaaac
   151441 gctggtcact gttgaccagg agttaactga cttgttagta tagtcacatg aggttatatt
   151501 ctggtatgtg tcattgcggt cgcaagtggc ctgaaagtaa atggtgtctt cagtatcgta
   151561 tgtcagagta taacccggtg attgagggaa atatgtatct tcttctgaat tggtttcagg
   151621 ttcctcatta ctatattcac tagactcatt aatatcgtct tcctctccgg ggtctttgaa
   151681 tacaatggaa atagtctcat tgcacaagtc cacaatctgc agaggttcat acggacttgg
   151741 ggtggtaatg ttaattgtaa cgttttcata tccagtggag ttgtaaggtt ctgtggtagt
   151801 tacattcatg tcagctgtgg tgtttggtaa actagttgtg tttgttttag gagttgtaga
   151861 gttagtacca ttaacagtgg atgtagtact agtagtggta gacgtgttac tagcaggact
   151921 gctaaccgta gggctgctaa cattagtggg tttagtactt gtgctggtag tgttggcggg
   151981 acttgaggtg accgatgtgc tgctcttggg tgtggttgct gatgcggtgc cagtggttgt
   152041 tattgttgtg ttggtgctgg aagtggacga tttgggtgat gggctcgatg tagtggtatt
   152101 cgtggtagct gggctggaag ctggtgaggg ggttgacata ttggtggtag aggcggttgt
   152161 tacggtgctg gtgatcgtgg aagcggtggg ggtgctggta ttgcctgcgg tggtgctgct
   152221 ggccttggcg ctcgtggcga cgatcaacag cagccacctc attgccagcc atcgcatgcc
   152281 tgtggctgga actctgtgaa ataattgtat aacggcaggt gcggtgccgc gatcgacgga
   152341 tatgacaggg cacaaatatt gatattaaat atgtctggct gcttttcggc caccgccgcg
   152401 cagagcgtcg ccgcattaat cagatccttt ttcgtggcgc ctgacacgta cagctggtgt
   152461 actccggttt cgtggtacga cacggctctg gggattaccg atcgtacggt atcaagcacg
   152521 ttgtcggagc tgttgtggca atacttgaag gcggccacgg cctgcggggt gtgcgggact
   152581 gtttgtgtaa tgatctggga tccggacagg acggtgatgt tgtgcaattt caacagcgtg
   152641 gtcttaaggt tctgaaaggc gttgccacac gcggcgctga cttggatttg gatggcggtg
   152701 gaatcataca cacggctgac tcgagacagt tcctcaaaaa tgtatctgta ctttattaca
   152761 cagctagggg caaagcggta atcgttgggt agcaggtaag gcgtggcatt caggtcggtg
   152821 gtttcgcgat cggtctccag caggacgcgg tggttcatta ggtctatagt tggtatggag
   152881 gtggtttcac tcgacgcggt agaggttgaa ggggagggct cgggtgaaga cgatggtgac
   152941 aaggacaagg acaggtcgtc aatgtacatg tcatcgttgc tactgttgtt ggccacagac
   153001 acatcacgtt gaaaagtgtc cgccaagaag tcgtctatga catcttgatc catcttcttg
   153061 ccggacccgc tggacgcgtg actatcctcg gctgcgggcg aagtcgtgtt aaagacgatg
   153121 agccgcttgc gctgctttac atctctggca tacctgcgaa tcagtgaagt gccgtacggg
   153181 tagagactct ttgtgagctt aggtggtgtt ggtggctggc gcgcatcgta cgagggtggg
   153241 ggatggatga tcctaacatg gttcacgtct tggttgtccg gagggatccg cagaaagcgc
   153301 tgctgtggca ccactacaat ggttcggtgt gtctttctct tattagcagg agcgagggac
   153361 ttggagacgc gttgggaggt gtacacgatg ttaatgttgg agaacatcgc ggacggcctt
   153421 ttgagtctgg attaccactg cttaaagtaa ggcacggggt agggcttttc ttcgtccagc
   153481 cgtctgtacg cccatggatt tcgttggcgc atgagaacgt aagtgatgta cagaagggca
   153541 aatagcatga agaggaggaa ggccaagacg atatagccca gtgttccgat gattggccat
   153601 tcatctggat cgcgttttat gaacacgtgc gtagatacac tgtagcggtc tcccaaaaga
   153661 attttcatgt gagccgtatt ggggagatca tgattggtaa agtgaaagat gtactcccac
   153721 aaactctggt tgtgtctggt gatgttttgg actttatgtg aggagtggtt cgtgtttcca
   153781 aagtacacaa aagccttgct gctggaatac acggtttcat ttgtgcatgg gtgatcattc
   153841 acaagtacac ggagctggat catgctgtcg tttgttggag aggcgaatac agctttgatt
   153901 ggcatgacta ggaattccca gctcttatta agagtttgtc ccgttgcaat gaatctgcaa
   153961 ctgtactgtg tggtcacgtt aggtgcctgt ctgtacatgg taaaagtttg cgtggtgatg
   154021 ttgtataaca ttccatgagc tgtaataacg atgaattgat taatcacaca tcttaaaaat
   154081 atacatataa caaatagata tagaatgttt ctacttacat gtgttgctgg tggttactga
   154141 tccaatgctg gtaaggttgc catcgcatcc aacttgttca aagcactcta tagatatcag
   154201 gtctcttgat acattctgag catgtgacat gttgtgaatt tgacatgtag tctgcagtac
   154261 taggtagttg tagctgtagg cactttcaca tgtaacatag atatcaggta ctcgaggttt
   154321 gtttgctgtg gtgctggttg cagctgtgct ggtgtcgctg gtggtatcag cggtggtagt
   154381 gacggtgcta ttctcagtag tagaattatc ggaggcattg ctggaggttg ttgctgactc
   154441 tgtcgttgct ggggctgttg ttgtgttgct actggtggtt tgagtaccgg tatcagttga
   154501 actgttgcta gtagatgttt tctgagtact agtagcggtt gatgttgcgg tacccgatgt
   154561 gctgctagat gctgcattgg aactggtcac agatgatgct gctgcactag aactggttag
   154621 agacgtggta accgaggtag ctgaactggt cacagtcgaa gtagatggag cggttgtagt
   154681 agatgtggta ttcgcagctg ttgtggtact ggtgccaccg atcacttgct gagcgatgag
   154741 cacggcggcc gcgagggcca gaacgtgccc ggtgccaagc attgttgtct gacaatagac
   154801 tttgacagct ctatatgtac atccaccacg tcagttgtga cgcttgaact tacagctcca
   154861 tataaggcat gcgttaataa taaagactac gaatactagt tgcgctaaca gaacaatcat
   154921 cacaactcgg ttctgctgac ttcgaggcca ccagttcaga gctgcatctg gagtttctac
   154981 caaatctgta tcgttgacca gtactattgc atccttatta gaagtattag taatttttgt
   155041 aaccataaaa gagcggaccc cataagtacc attggacccc caacaagtta ctgtactatt
   155101 cagatagaat ccataaggtg cagtatccaa cacctttaca aattgtaaat aaaagggttt
   155161 tgggtgtctg gtatactcat aatatccacc tttaaggaaa gtagtgttgt ggttggttgt
   155221 tatcataatc ccacccgcta ggaacctaga gtatctggct gaggtgttac aataaatagt
   155281 taagttacta gcattataat aaatataagc caccttcaca tggggggcaa aaggatcacc
   155341 tgaataaaag ggaaggctat ataccaccgt cataataatc accatgcaca ctatacccag
   155401 ataaatagcg tggtaaaaac gtaacatctt accacctctt caccgctggt tcaaagtacc
   155461 gtgtgcgcct tgacagccat gatttatagt cagtcaagtg acgtgtagta tcatagtcta
   155521 acttcaagat gcctgcaatc attacaccca ctgtcagcag cacgcacaca cagtaccaca
   155581 gggacaggtc tgaatcccac ccgcagggat tcaggtatct cttcttgggt acaaccccaa
   155641 cgcacaatac accttcacgg tcctcatcca tcttcagcaa cagacctaca gttgtcatgg
   155701 gataaggggg catcctcagg atcacagcag actccgaaga ccacaaggac ccacggacct
   155761 ccactcggta tggtactgat aatggcgtct gactatcata atcaaaagcc cataccctct
   155821 tggtgtcgtt cataaaccaa taaagtctgg tatcaagttg cctcaataaa cacttgactt
   155881 tcatgtggtt cctatcccaa cacatgtctg gggtctgcac accacagaca ctgaccacca
   155941 cacttgttaa aagaacaata gctaaaccta gcaacatgat gatcacacca ggacacaggt
   156001 atacaaatga gcacaatttt attgcataca atcttattta tatacatctg aacactgatt
   156061 aggtaatgct aatgagatga tatggagaat actgatatgg atatgtaatg taacactgca
   156121 gggtatgcta tcatctatgt acaaggtcag gggcacgtcc tccaagtcca ttagtcacag
   156181 tccactgttt attaactgtt cagtgcaatg ttaagtccac tgtgcagttc actgggatga
   156241 ttcctggttc atgtcctcga tggctttctc aatggccatg ctcaggttgg ccaagtcttc
   156301 atccttggtt tcctcgaact ggcccactgc atacatctta gctgcctgat cataaatggg
   156361 cagcatgaag gaattggagt tttcattagt gaagatcctg atggccacct gcttggggaa
   156421 tctctgcaca aggggcacca agacttgcaa ggatcccaag aagtccacgg gggtagctgc
   156481 gtgaacaatc atgttgcggt agtctgaaga ccgagggcac atatcgtgtg gctgcacggc
   156541 tttcagatcc caggcctgct tgattccact ggcacaagcc tctgcagtct tgcggaccac
   156601 ttctgcagga tacacgttag gcatggtgtg ttccaccagg aagggggtag agatgctcag
   156661 gttggggatc ttcccaagtc tcactctagc cacatccact gcttccttca cctcatgggt
   156721 tcgggtgtag gtcaccatga tacccctgtg gttcacctgc atggtcttgc atgcattcac
   156781 agcttcagcc atcagctgat gtacattagt agtcaggaag gggaggttct tgtactccag
   156841 tgacctggtg gtcgctctga acatacggga cacttcatct gcccttactc tcccacgctt
   156901 ggtctccacg gtggggttct tgaagacagt tccagccttc tccttcatag cacttctcac
   156961 cctctcacag tccagggggg tgagcctctt ggtgctcttg gttctgggag ccttgggggt
   157021 cttgcccttg gaagtgctag gtatcatggg ggctggtgga ggtgtgtgga tgggggatac
   157081 tggggatgtg atggtactgg cagaggagaa gtggtcacct gcacactcat cacagcactc
   157141 agagtcactg cttgaggaag aggaactatc cataggtatt tgaccagatg ccccggacat
   157201 cttagtggtt attttcagtt gtacaccttg ctgttcactt gtggcacgtg cagacacccc
   157261 aggctcagtg tcttcctcct cttcactgtc tgagatcaca atacatccag aggtgggttg
   157321 gatgtcttgg cccttgtacc tgatgaaaga ctcaccctcc tgcttaatct ctgatggctt
   157381 tagcatgcac gtgggaggtg agggtggttt aataatgacc ttcatggggt gttgggtctt
   157441 acgtgatttc tttcgctgac tcatactgtc agtgggtttg caaacagctg gcttggtgct
   157501 actggtgctg ccgctggtgg tggtggagga agatggtgct ggggctgcta ttgctgctga
   157561 gggtggtgct gggatcttgg gcttggactt gggtttgggg gtgccctgaa gactggcagt
   157621 gatttgcata ccaggaactt ggatggcagt ggtggtggga gcaatggtgg gagcagtggt
   157681 ggtgatcata cttgatggga tgggggcagt cactcctgct gagctagagt caatccctgc
   157741 ttgactgaca gcttgggcca agatgtcaag aggtgttgga ggtggtggac ctaagttaaa
   157801 gaatacacag gacacactta gtgcttttgt aaacagggac acatttattg atccacaaca
   157861 caagtacact acaacatctt cccaacttgg gttcttctct tactggggtc tcccacctaa
   157921 gttcccacac ttggttccca caataatgag gcatacacca agtatatagt gttatatctg
   157981 gagtatatat tgtataacat agagtataat ataaagtata acatagagta taacatggtt
   158041 tcaataatac aattagtaca gtcagttaat ccagttatat gccagggggt tacagtacag
   158101 ttagtacatc attgggggcc tgactacctg gggacttaca atatcagagt acaatatcag
   158161 gcataaatgc agttataggg accagcccat ataactgtac agagtttaac tctttacttg
   158221 tcagtcttgc ttctggtctg catatggtgc ttgctcttag aagagggtcc agcaccttcc
   158281 tcttccttaa tatgaggctt ggcatactta atgacagtca tctgcaagtc ctctgactcc
   158341 tcatctcctt cctcagtctc ctgaggagtc tcaacttcag tctctccctc agtctgctct
   158401 atctgagtct cactctctgc cttaggctgt gcctcagacc ctatctgagt ctcactctca
   158461 gtgccctcaa tgtctgtatc atctgtccct tcatctgtct cctcagcctg agtctctgtt
   158521 ccctcatctc ctgtctcagt ctcctgttcc tcatcatctg cctcactctc ttgttcttcc
   158581 tctgtgtcag agtgaattat cacagaggcc agtgggatgt cagtaccagg cacattctct
   158641 gggagcacac cagaaacaac tgggaaccta tcctcattga tcttatcatt aacaatctct
   158701 ctaagctcat taaggctgta gaacttcatc ttatctatgc ccatcatcag ggtggcatgg
   158761 aactcattaa taacaattct aactttgggc ttcagaccat ctataagttc atcattgctc
   158821 tggttagagt tggtatggat agcatggaca atttcatcaa tcagatacag tattagcact
   158881 ctaacctggt ctgatagcat ggtaatggga gtgtgcatac ccagcatagc ttcatcattt
   158941 ttctgatgac cttccttata taaggccata cccaaagtag ttaccagatg ggtaaaattg
   159001 ttcacatgga aagcaacctc tttctgttcc ttatccagtt tcttaatcag ttccaagcca
   159061 tcatgatttg catctgtcag gtcatcataa ttagatagtt gtttcaaaaa tagtttggca
   159121 tgctcctcat tattgatggc tttagggcca ccagtaccct gcatggccat gagaaggtac
   159181 ttcatgcagg tgtatgtaac tctgtctttg atatcatctt tctttgtttt aatctttaac
   159241 ataacgaatt tctccagttt gctggatgag ttaactgcat actgaactat ctgtttgagg
   159301 cacaccatga atttttcctt atactgagga ggcacaggag tgtcattaaa ctgttcatta
   159361 gcaacctcaa ataagcatct catgtcttgg aagggggttt taagtttatc cagaagcaaa
   159421 taactgttct gtattccctg ttctagcttt tcaaatttgt ctgagaacac ttttctaata
   159481 tcagtaagtt gttctctgat gatctcatct gcaagtcttc tgtttctttg gactctgagc
   159541 ttaatctgtg tcactgttaa aaaaataaaa tagtgataag tatatgtagt gtgaatgtgg
   159601 tgcaagacaa ataaagacac aggacacaga ctacatactt accaacgagc tgatgagctc
   159661 caactacatc atccccttct tggatgattt cttcaagggt ttttattgga tcatcattag
   159721 ctgattcaaa cagagggtcc cccaggttga attcagtcag cttcttttct tcatctgcaa
   159781 gcatcttctc cagcaggtca acagcgtgct gcagagccat gtccttcctg gtaacacaac
   159841 aaagtaaatg gacatgagac ttgggtttat gtagggaaaa actttattaa gtattgtatg
   159901 tgcatggaga atcaagtgtt cagcataata tacctacttg gcctgctttg gtggagaagg
   159961 cccagtagaa ggtcctccag aagtcccctc ctctggatca ccagcttccc cagtatgggt
   160021 ctcatcctca ggctttctct tcctggaatc catggttaca ggtgtctatt ggaatatgag
   160081 agagagacta agtatctact gcatttgcct ctacctggtg gcccaagcta catttatatt
   160141 atcatcagcc tcccccaccg ggacttcatt atcatcaaca acaaagggga gtgggactga
   160201 accccttacc tcctctgcta caaagctgat tactgctcaa cctgggtctg ctgttgctgt
   160261 tgtattggct gcccaataca aggctgaatc tgcatcatca tcatcggtga tactacccac
   160321 ggtgctggcc gccagtggca tggtggtgct tgtgatactg ttgattggac ttaacctgag
   160381 ctcaaccttc tggagccaac aggtggatga agagagcgag ctggaagagg gccccagccg
   160441 tctacatacg gacaccacct ttataagtgc ttctacagtg gatttatgtg cttaaacagt
   160501 gttagaataa agacctgcag acaaaataag gtgttgtatg cctttattaa caatttggca
   160561 tggagccaaa atttcagatc tggcggacag ccagttggct cagatccaat atttggaaac
   160621 atgccaaaga acaccgtcac catttggcaa agggccagga atagcgtcac cacctggcaa
   160681 ggagccatgc actgcgtcat caattggcat agggccatgg tgggcatagg gccaatagca
   160741 ccgtcaccat agggcatagg gccaagatat agataagcac cgtcaccaat aagggggcag
   160801 ggccaatagc aagcaccgtc accaataggg gcgttcccat taatcaatag caccgcccct
   160861 tatgggggtt gggctatagg accctcctcc catatatagc atgcattata taggctccac
   160921 cccctttata tagacgccta taggccatat atggcgttgg cttattgcca tatgacgtaa
   160981 tggcgccatt acgtcatata tagcctatag attctatagg ccccatttac ttacattact
   161041 tggcacggtg tatccgcgtt ccaatgcacc cttcccggct atggaggctg gatcggtccc
   161101 ggtaccttct atggtgctcc tccgacgtcc ccaggcagaa tggcggttcc ctaaacgtgc
   161161 attgcttata tagaccgccc aatagggcac gcctaccgcc cattaacgtc ataggaccgc
   161221 cccattgacg tcaatgggca tgtacttggc agccattgcg ggccatttac cgccattgac
   161281 gtcaatggga gtactgccaa tgtaccttgg tgtactgcca agtacccatt tacttgccaa
   161341 gttactatta ataggtattg atgtactgcc aagtgggcca tttaccgtca ttgacgtcaa
   161401 tagggggcgt gggaatgggc aatgggccac cccattgacg tcaatgggag gtgggcctat
   161461 tgacgtcaat ggggtggtcc tatacacgtc aatgggcggt attaatgacg tatattaatc
   161521 cctcccattg acgtcaatgg aggcgtatcc atattacgtc aatgggcggt ccatatgacg
   161581 tatataggaa ggcccatata tggtattggt aatggacata agccaatatg gctataggcc
   161641 aatatggaca tatgccaata tggattattg cctatatatt ggctataatc aatactggcc
   161701 cattgccatg ttggccaatg gccatattgg cttatggcca ttctattgaa cctggctatt
   161761 agccatattg gatattggct atatggatca ataacattgg acacatgcca atccaatatg
   161821 tcggacttgg caccatgcca agaccccacc ccaaacttgg cacggtgcca agtcgaccac
   161881 ccctcaattg gcatggtgcc aagttttttt ggctcaatgc caggtccgcc atattgaatt
   161941 ggatggatgc cagaacctcc attttttatt ggcttgatgc ccaggtctgc catattgttt
   162001 tggctgggtg cccaggcagc catattgaat tggcatgagt ccatagacgc catattgttt
   162061 tggagctatt ccaattcaat atggcgttta tggacgcatg ccaattcaac atggccgatc
   162121 tggacaccgg ccaaaacaat atggctgacc tggcacacag ccaagaccgc catttgcaat
   162181 tggcaccgag ccaaaatttc ttggcaccgt gccaggtcgg acattttgat ttggcgccgt
   162241 gccaagaaat tttggcaagt tgccaagttt cgattttact tggcatggtg ccaaaatccc
   162301 gattttgctt tttcggattc cccgacgctc ggggaacaca ttgcgcgaca tttggaggtc
   162361 ctccgatcga tggtttttca gataacccgg gggtatgttt ttgaaaagtc tggcaaaatg
   162421 ccaagttttc agatattgaa aatgcgtctt ttgcgccttc tctcgatcca attttttcta
   162481 cttttttgat ccgttgaacg gccaaaatca catcattttc caagcaattg cgcctgtctc
   162541 tcagaccaat tttgcccgag ttttcaagcc aatttgaccc gtctctcaga ctaattagac
   162601 ccgtctctca gactaatttg acccgtctct cagactaatt tgacccgtct ctcagactaa
   162661 tttgacccgt ctctcagact aatttgaccc gtctctcaga ctaatttgac ccgtctctca
   162721 gactaatttg acccgtctct cagactaatt tgacccgtct ctcagactaa tttgacccgt
   162781 ctctcagact aatttgaccc gtctctcaga ctaatttgac ccgtctctca gactaatttg
   162841 acccgtctct cagactaatt tgacccgtct ctcagactaa tttgacccgt ctctcagact
   162901 aatttgaccc gtctctcaga ctaatttgac ccgtctctca gaccaatttg acccgtctct
   162961 cagaccaatt tgactcgact tttcaagcca attttacccg tctctcagac caattttgcc
   163021 caacttttca agccaatttt actcgtctct tagaccaaat ctacccgtct ctcagaccaa
   163081 ttttacccga cttttcaagc caattctacc cgtctctcaa gccaattcca cccatctctc
   163141 agaccaattt tatccgactc tcaggccaat ttttgcctgt ctttcatgcc aatttttcaa
   163201 caaaaacaca cgaaaaatat actggtttta taaattactt ttttgttgta actaaattag
   163261 ttgtgttgtc tttcttctac ttatagcaat gcgcgtactc tcaaacgaaa tgaatacttt
   163321 tcgtgttact attgctacaa tgctactcat atgccttata ctatcagagt tttcaggttc
   163381 acagggttcg gaattacgtt gcagttgtgt taaatattat tctggtatac catggacagc
   163441 aacatgtgtt tatctaaagc ctaaaagtat tgaatgcaat aattatgaac taatagtata
   163501 tgatggatca ccacataaaa cttgtgtgcg tgttcgtaac ccgtcggtgt ttgatagatt
   163561 ggataagcaa acatggttta cagtaaccaa aaaacccaac agacacataa gtttgaagcc
   163621 gcagcgtact tcgtgtgctg taccgaaatc atgaaactgc aagattacag agtgtaaaag
   163681 acggcatgtt atctacggta cgatatgaca tttggtggta catttatgat aatgaagtgt
   163741 ttcgttttac aactacattc acttagtatt atattgtata tacttttatt aaaatgtata
   163801 ataattcata gcggtactaa aacagaattt tgtgaatgtg ctaacgtcac attgtttaca
   163861 tccatcccca atggcaccct ttatctacaa ccactacccc ctaacgaaaa ttgcaccaaa
   163921 caagaagtga ttgctgtgct cccaaacaac actcgaacct gcttgaatcc ccatgctctg
   163981 gtagttagag ttttctttaa cagacttttc ttacgaatca gtaagaacga agaagggctc
   164041 tatgaagtag ttgacactca gcttgaacta cccgcctgga acataaccag aaaatactat
   164101 aagcgatatt tgcaaaaaaa ggttaattcc gaaaacgcaa agatcctaag ccgcatgata
   164161 ttatgaagac cactatgctt tactttattt gtttactttc catgtcccac gcctcagacg
   164221 tctgtcaagc tggcccttca gactcctcgt ccgtgacgac atcatgcact acttctataa
   164281 actcaagcgg ctgtctggca tatgtagtct tctgccttat ggtcgtttgg ttgtttctca
   164341 cctattgctt ggtactctag cttcagtaag atggcctaca acagcttcct tctcagctgc
   164401 cttaccatcg cacttttact gcacggtctt ccaacatcaa ctagcgctaa agacatggca
   164461 ggctacgtac acgttcatat gcttaacgca cctgaagacg ccgcttctac gtctgcgcca
   164521 gttatccaac tagccaacgg ctttattacc tgcagaaaat ttacagagct cggttgggca
   164581 ctgtgtacta gctgggatga tatggagtgt tttccgtttt ggcgaaggac tttctcggaa
   164641 actaaaaata tcactgtgct ttcagacgat ccatactatg ccggcgttgt gttgacagta
   164701 cggacgcttc ttggtgactc cctagagctt acatcttatc tcggggtcag gccttcgatt
   164761 gccaatgtgg gctactatgt aatgtacctg tcatatgcta aggcgctccc ggcaaaattt
   164821 acccacaacg atgtggacta tgtgaggttt gccatatacc ttcacaccga aattgatgcg
   164881 cagcaaactc ctgacaacaa cttcgtcttt acgttcgcca cacccgggac atttgaaacc
   164941 ccagacctca tgagtagttt tgtgattgga accgatgatg gacaaaatag caccttgaat
   165001 ttcaccactg ttggcggaga aaaacaccgc tacaacaacg tggagctcag ctcagaaatg
   165061 aagggcaatt gtgtgtatca ctcggctatt atccggaacg tcgccagctc gcaatcttgg
   165121 gtgtcgtttg acttctccct atattggcga cgtaccaaaa ttgcatatag ttacgtgcag
   165181 tattatttcc cgaaaccact ccattcacct gaacccatag gtcctgcctg gcagagaatc
   165241 taccattact ttagcctcct gacgcagctt cgctacggaa cagtagcgat caccgtggtg
   165301 ctcattttcc ttataggtgc acttctaaaa cgcagtcgtg aagctcatta ataccgacgc
   165361 gggttcacag taccaccacg tgattgtgtg tttataaact atctcaggga agctctatga
   165421 ccaacatgac tgctaacaat accaccactg ccaacagcac tgctacggtg acgacaaccg
   165481 tcgccacctc gaatatcacg agcgtgagca ctaacgtcac caccgttctt actgcgacaa
   165541 ccaccgccga accaggaagt gtattaacag aactcttggg tatcatcatc tactgtgctt
   165601 ctaccgtcgc cctcctctgt ttattactag ttttagtggc cgcgctatat agcacttgtc
   165661 atactcgcaa caaggttaaa accaaatact cagaacagga gggcgccaaa ctaatcaaga
   165721 acagccggcg aagttcgccc agcagcaaaa agaatcgacc caacaagggt gactaccaac
   165781 agctgtggca atcgcagtcg gaaactgact ccaccagcga cgatgacgcg gataataacg
   165841 ttttgtactt tgataaaaaa ggaaacctca cgtccttcgt caatcctcaa tacggacatc
   165901 gctcgtccat gatgatcgag tctcaggccg atgacgacga gaacatccac tattacatgt
   165961 ccatctacga tgaactcgct gccgaagcca tggccgatcc atccgaatcg tgggaaatgc
   166021 ctaagatgtt gcaagtcagc actcgagaag tgacgttgaa agagcccgaa tatgacaatt
   166081 agctataaat aacgtgctgt caataaagag tttttagaac acaacatggg tgcatgtcgt
   166141 gtgtttatca ctgtcgtcac cgtgtgtatg ttgttttgtg cgttcactgt tcagggatca
   166201 atctgtacta aagaatttgg gaattggaat ccgaactaca ggccggacgg ttactgggat
   166261 atttgttcac gacagattga tgcaccactc cgaaatcaat tgttggaaaa aataattaat
   166321 gcgtcagtct cgtatcatta cgctaccagt cataatcatg acgacgttag tttactaaaa
   166381 cggtaagtta tccatcgctc gttaaacata acagcggtgt tcacaacagc tgtgctttac
   166441 taattgtgtg tatatatatt ctagcatcaa cgtcacagaa gtggcacttg tggtgaacag
   166501 cgttcaggtg agacctggcg agattgatga atgcctgtac cgccagcagc ctgaagaaga
   166561 gataaaaaaa aacacaaaac aaccccatct tactcgtagg attggattaa ttaaagatta
   166621 tatttcagca aagaaactca tcacatttgc cgctagcgga tctcacacat cccaatctag
   166681 aatactcact gttgctattc gcctgccgtt aattggaaag cgatgaaaaa ctataatcaa
   166741 caactctata cctttgtttt gctgatgcta ttgcgttatg gcttcggtga tacttcttct
   166801 atcaaggatc ttaaactcgg caatttttgt cccatgtatc catctcctcg acaaaatttt
   166861 gggttgttta catcttacaa aactcatcca acgggaccgg aatgtggaaa caccagcctt
   166921 tacgtttttc acaataggta taatcaatac cttattgaaa gaccatccgc gtggtcaaac
   166981 aaactggcgt tctacctcag gtgagttttg tatcataacg tataatattc ataatacaga
   167041 ttataccaat acttttgggt gaacatatat ttttataaat cattgtagtg cactacactc
   167101 gcccgtgttc caaaagtttt cgaaaatggc tattggttac aattgcgtac atattcacga
   167161 gttccattaa cagtcttctt tacacagtag attccgttac catttggaat ggtgctattt
   167221 acaatttgaa agtccaagca caggggtaat cgtggtttcc catttttgtt catgactgtc
   167281 tgcgggaaat gtgctattgc ctcgttacca cagggtgagc cgtactggtg aagccagaga
   167341 cagtctgatt ttggaggaat aaatcctagc ttcgttttac ctttgcatgg gcattccttc
   167401 tctctggcgg tgccttgtac cgtaccacaa aggaacataa ttacaacaca caatactaac
   167461 gaccgcatgg cgatcaaata aataaacgta agatacacac tggtccgcgc agccgccgcg
   167521 gtgatgttga tggatgatgt tgatgacaag ctttctggat gatccgacat gatggtaatt
   167581 gtttcctgaa cccaaaccct tgcagcacgc gggatggaac acgaccacgc tttccagcac
   167641 gcatcttact cgccctagag tccgctaacg gcatcagagg taggaaaagt ttccgaagca
   167701 atccaggcac ccggtatcca gtccgactct tcaagttttt tcaggatctt ggagggaatg
   167761 agccgcaggg tcactgcggt aatggcgctg tgcctccgaa ggacgaggga gcgtttctgt
   167821 gaggtagcca tcagtactgt gcaggcccca tggtcgtcgg cgcaggaggc atggtgcgtc
   167881 aagcgctccc atcgtccagg tccgtcgcga gatcgagcgg acagtagctg cacggcgttg
   167941 tggtactgat aaaagaccat atggatgttc gagggggact ttccacagat tcagaccgac
   168001 ttataaagcg tgttagacgg aaatactccg tcaccctttc cgcggattcg gctgacgcgg
   168061 cgtcacatgt tctgcgagtt ctatacaaaa gtgctgttca gaaaggttgc gcaggtaggt
   168121 acgccacgat aaaataaaga cacatgagac tcacaacatc gtgactgaga ctgtttttta
   168181 ttgtgcattg tggttatgca atgtcatcct gcatttatat atacacattt atctgagata
   168241 tctcatttct ttttgtatac aatgaaagag gagtatgaac aaaattaaaa tggacagtcg
   168301 tcggtttctt ggctttctgc atatcagtgc tttggacggg agtcggtgaa aacggagaac
   168361 tctgggcgag gaggcggtta ggaaatcttt tcgtacatgt aggccgtgag catcttgcca
   168421 tatgtagtgt tcactaagat cagtcggcag cctagcgcca ggaggattat agaaaataga
   168481 aagattacga atatcagcaa gaaccaccag tctcgggctg catcatcctc tgggagcacg
   168541 gagtggttgc cggcctgctg gtgttggccc gagtccacgt gcgcagaagc agtggacgag
   168601 ttggctagcc ggcagcgcac gttgtgggtg gtgttgcatc tattcaccgc tatcgaggag
   168661 ctattgcaag tgtcacattg ggtacagatg gtttcgcgct tgtcgttgta ggacccagcc
   168721 gggcacggct cgcacaccgt cccggtggtt tcgctgcagt tcgtctttac cctatatcct
   168781 ttgccgcact ttgggcagca ctccgagccc accgcgtact catcttgctt acacgcgggt
   168841 gcggcggacc gacttgccag gacagcggcc cagatgaccg acagtagcag catgtccctc
   168901 cggggtggct catggtgtct cgcaagtcgc gtcacccttc cgtgcccccg actgacccca
   168961 cggtgatcac gggccagcgg tttgccatcc gaacaccgtc acgtaaatac acaagcccgt
   169021 gccgccatct tgctttttac accactcggc gcacatgcac acgcaacaca caccatagat
   169081 caaattatgt atttactaca agcgtctctt tattttgctg tacagaggcg gtacggcaac
   169141 ttcatcatac acattctcat ccaccaagtc gttgtacgac tcgctgcggt cttccttctc
   169201 aaaataccca ctatcactct catcatccac gaccgagtac agctcttcgt agccaggcgg
   169261 acgcatgaaa tgcgtagaca taggtcgata ggcgttcatc tttttctgga agcgttctcg
   169321 gttcctgcac atctcaccgc acgcacaccg aaccactagc accagcccta ggcacacgcc
   169381 gccaatcacc atcatggtca accccagaga aacccattgc cagtctataa caaaaatagg
   169441 gacaggagtt ttttctgtgg gcagcggggg ttcccgacga aagttctggc tacggaaaca
   169501 gtcaccatcc aaaacatact gttgcagcac gggccaacat cgatcgggct cggacggagg
   169561 gcaaggcggc ttggtgttgg actgattact agctgccaag taatagtaca gtctgtcgaa
   169621 accgtaaaag gttccgcact ggtggcgctg ccactcattg tactctgcgc tccagatttt
   169681 tttaccatcg gcatggaatc ccaacttagg cgcacagtct ggatcaccgg gtcggtgcag
   169741 agtctctatc tgcgttacta tggtgaacct agtcatgaga aaaccgtgag tggcattgcg
   169801 aagcacacaa tcgaacatgc cagtagtgtt atcactaatg ttcatagtca gggtaacata
   169861 atgagatatg gccaaatcgt gaaacttcca gctggcatta atcaggcggt aagtcaaatc
   169921 atcgtccacg accgtcccgt tagtggcatt gatcttcagc tcataaccac catattctga
   169981 ttgacagaac cgcgcgcgga tagacaccat cggccaagag tgaggcagaa aggcacaggg
   170041 cacggtcacc tgggacccaa tcggcataat cagaggtgcc ggcgaattgt gctcgtagca
   170101 ctcgtcccac attgtgtggt ctatgctgcc tcccctcacc ctcggcgtca ggctcaccat
   170161 tacgatggtg atcgccacca tagcgcgtct cacccacata gcggctcgcg gcgccgatac
   170221 cggcgtgcag gctttgactc ggagcggccc gtcatgaata gttcgttttg aagccgattc
   170281 tgcgtccgcg gagtccgcac cttcctgccc ctccgccaaa agctgcacgg tttcggcctc
   170341 ctcgctcacc cggccgaagc cttttcgaaa ccgcacggta tacgacatga taccggcagt
   170401 ttcgacgtgc agtgaccaac aatcccgcga ccgtggctcg tgctcaccgc cgaatgtgag
   170461 cgcggccttt atgacgagat cggttgagcg gtcctggaac tcaagatcat catagtgtcg
   170521 ccgcttgtgg ggtcccaggt cagagaggac tcgtccgcct gttttttgcg atacactata
   170581 gccggcaagg tgaagtatcg cagccgtttc caaggcttag tgcaacagat agaaataatg
   170641 atgagcataa aaatgagaaa agacagaatg gtagctacaa cgattggaat ttccatggcg
   170701 cacgaaactc agagtccatc agacaacgac agtgcacaaa gtagttagat atagaattta
   170761 tttactggct tcacaagctg cgtcacaccg gcccatccca cgtccgctct atcaggtgta
   170821 tcaacccaac cgatcgatcg atcgatcacc cagtctctac accataggtg tatggttctc
   170881 aatgtccacc acagtctctg cggcacgatc accgctgctg ttactggtga tttccacacg
   170941 gggcagttca tggggttgct gttcatggga ttcgtaagtc ggtggcgagt aatactgcac
   171001 ggggtcaggc gggccctttg gtccatacca ccactcctca catattctta ctatgatctc
   171061 cagtgccgtc tccggctcgt cattctccaa aaccctcagg ctgcgaaagt ccttacagtt
   171121 gcagccgtat cggtaccagc tcagaaaaca ggagcaagtg aacacgtatt gcagggttgc
   171181 acaggcgtgt cgcggatagt agcacaggta tatactggcc aagacgttaa agatgagaag
   171241 aaccacaaag atggcagtca acagctgtgc ctgtattatc gggtccatgg tgatagggaa
   171301 gaggtctttt aacagttaat ttttgtttac gctcattcta atgttgcaga tgagatggca
   171361 acttccaagc attcttgtat ttcctcgtga gtctgcgcgg gtgtctgtgg cgcggcggcc
   171421 tgggtaagca gtggttgttt gctgacaact cgagttactg gttggtttcc ttcaatggtc
   171481 accaccgtgt ccacgggctg cacattctgt acttcaggta ctaacccctc gttatctcct
   171541 tcgcggggcg gagagtagta ctgcacagga tcagtcggcg gagcattccc gtgccaccac
   171601 cgtctgaatc ggtctgtaat ccatccgcct atcgtgaaca attctccgct gttcagagat
   171661 gtaagggttc tgaacttttg gcaatcgcag ccgtagcggt aacaactcac gacacatgca
   171721 caggtgagca tgtccatgat ggcagccttg gcttccctcg gatagtagca gatgtacacg
   171781 atccccaata tggtgaggat agtgcatatc acgataacag ccagcagagc atacaattct
   171841 gtgtcctcag aactcatgac ggcggcgaga acgctgacaa gcagtcagtt agccagtcag
   171901 tcaagcacaa aagcagctgc tgcgagccgt ccaggtaaag ccgacggtgt tttttatctg
   171961 ccattcttgc tcgcgtcagt ccatgcgtca ttgctggctg ctgtcgctca cgggctgtgt
   172021 gctaaccacg gtttgcatag cgacgggagc ctcggagccc aggatgggtg ccgcatctga
   172081 cgacacttcg aagacatcct cgtcaagcgc atcggtttgt tcctcctgaa tggaggacat
   172141 gggctcctgc gttccatctg ctgacctgga tctggggggc ttgctgatgc ggggcttttt
   172201 tgttttgagc tctttgagat agtcaatttc cattaacaca ccctctgcct ggcgtctgat
   172261 ctcttcaccc ttcaggtaac ttttcagcag gccgatctcc aaatcgggat cggaattctt
   172321 agaacggcat ctttttcggc aaccgcccag aatgatgccg agccacggac atgtgaacac
   172381 accttggcag acagccatca tgtgcatcgg atacaccaag gttagaatca ataatccagt
   172441 acccatgatg ccgacgccta tggcacacag gatgaccaca accatctcca tctccgctgt
   172501 ggatggtaaa cggcggatcg aggctcacct ggttcgactc gtccggcgcc gcaccgagtc
   172561 ccgcgcgtat ctttcactct ggcacctggc cctctggcat ccagcccttt ggcgagcgca
   172621 tcgcaggagc ctctttttgt agatgtacaa aatgtgcaag gtcattgtgc tgctgatgcg
   172681 ctggaacatg actggagatt acacttatga tgcgcgaaca tgcgcaagtc catacgcact
   172741 tctcctattt ttcagaggac acctgcggtt gcatcttcat caacatctgc agagtgctgc
   172801 gcacagcggt ttcgatgacg gcagccatct ccggtgtcac attggggatt tgcatcatat
   172861 ccgtagcaaa gatagtagca tacggacttg aagagggagg gtcaggagtg gtattgggaa
   172921 cctcagtaat aacagcatac tcgccgtcca tcatcagggt aactttttta cagttgctgt
   172981 agattctttc cgtctcggtg tcggaatggc tgagagaacg gttagtgggt attgtaggca
   173041 aagcagcggt gacaatcttt tcactttgcg tattcactgc ttcatccatc tctatgctca
   173101 ctccgttcgt gggaattttc ttacccgacg ccggtggaca catgatgagc actcgtttgt
   173161 agtcctgagc gaatctttta aggttctcac gcaagtacac gtttcggtac tcgctgtcaa
   173221 acttttcacc tcggattctg gtggcgagtg atcggaaaca gtagcatgta aaaatgtcct
   173281 tgcatacact gccaacgcgt ctcacatgga agatgagaag atacagaaaa agaaggatgg
   173341 caacaattgc tatggaaaga actagtccca caatgatctt gtcctcctgg ttagtcagca
   173401 tattcgcggg ttgtggtggt tagttgtctt cagggcagct cgtgagcaga gcgatgttgg
   173461 cacggagcct tctggtacgt agctttgtct caacatgctt ttatgtagaa tgacaacgct
   173521 tgctgtgaat ctgacatgga cggcttgcgc agtacatgtc aatcatatgc ttctgaaact
   173581 tgttcggtgt tccccttgca tgccgcggca agccgtcgta tgcaatctgc acagcatccc
   173641 ctgttatctt ctgaaatctg ttagccatgg tactggaaaa attatcagta tctatgacac
   173701 ctgtcataat aatcgggtag ctgaaacata tgacttccac atagatggcc gttttcaggg
   173761 ttccggtaag catgacaccg tccagaacat ttctgagtcc cgcgtcaatc agcgatgtga
   173821 gtcggtcctt gagctgctgc aaatccactg caccggcttt ttcagatggt atgcgggaca
   173881 catctacatg tacttcgatg tgtgtatgtt tcgcagcggg agttgagtag gtgagctccg
   173941 tttgcaccgc tctggatacc attatgggtt ttgcgggaca cggttcgtgc tcgcggccgc
   174001 gtgtgcctcg caaacatttc ttcaacttcc agaaagctac acgaacggac gccagcaatc
   174061 tcatcttgat ggatcaaact gtggttagtg taaatgctgt cgtgaggatg ttgattggag
   174121 tttgatatat atagtatatt cagtctaggc tatatcagtg atgtatctct acctccctct
   174181 gtctttcctc tgaggcatta agcacattcc aaaacgtgct cgaaggcggc ctggaacttg
   174241 ctattcatta tttcggaaaa gccttcatca tccatgattt cggccagggc ggcggggcag
   174301 ttgctgacaa gtaccttagc ctctgccgaa gactggtacg gattaattgc ctgtacactg
   174361 aagagaacgc tttgtacctt ctccgcaagc agcgtggtta gttcctccga aaatgtacat
   174421 gactgcaacg tgtatgtgtt ttcggtgagg aaagcacaca ggtccacctc catatcaatc
   174481 atggtgtgtc ccgaggcaga agtagagtag ctcagtgcgg ttttcaccat ggagtttata
   174541 gtggcagtgt tttgagtaca ttggctctgc ttgcgtttgc ggcgaaatat gctgagaaac
   174601 ctgtgcatcc atcccttcaa ggttctgcaa accgtcgata gcatcctcac gatggcgcag
   174661 cggtgctcgt tgcgtggatg tggttctaga tgctgcagat ctagagtgga gcaagcggtg
   174721 tcttggcact ggttcatatt atcatgaatt gtgacacatg tcatggttta gcttttcggt
   174781 gcgtttagaa gcgcggcttt cacggcggcc tcgacggcag attgaatgag cagcgccact
   174841 tctggcgtta cgccagccgc cgcaggtata tcagcattgg gttccggggt cggtgcagga
   174901 gcgggacagg gttcgggatc tgagtcgggt tctggaacgg aatctggaac agaatccggc
   174961 gtgggtgtgc gcgtcgcttc ctcctcggta tcaggcgtct cactcacgct atgtttggat
   175021 ggaggtttgt gaatgagtgc ctgggtttcg gcgttgtctg cctctgcgac atcggtatgt
   175081 gtttgcgcgc gaggagactc gtctagagtt ggcagttcgc actcaaaacc ttctaggtcc
   175141 acggtcacaa actctacctc agtttgtttc ttgtccttgg gttgccctcg gcggctctga
   175201 ggaggctcgg tgggatacag cttggcactg agccagtgac agcaagtaaa gcagcacgga
   175261 aagtagaatt ccaaattttc tttagttagc ttgtttctag ctgaaatctg cgagcaacat
   175321 cttccagtaa aagctacgca tctggaaacg cactgacaaa aacctgccca tagagaagcg
   175381 caccacaaag aacaaacgca catggtttcg tcctcatccc cggtggacgc gtcgcgcttc
   175441 gtttcctcat caggcttctt cagtgaacag ttaaagcgcg tacacagtct actgaagaaa
   175501 ttccaaatgt agggacatac acgatctcgg tagagaatga tcagtatatc aaagattatg
   175561 gctgctggta ttccaataga aagcaaaaca attgtcgcag tatccatctt tatcctaaga
   175621 accgaccacc ccgacaccaa aagaaagcca cagacacgga tcactggaaa agcaaatgcc
   175681 aagcggcctt tttattacta agagtcatgt ggaatggcgc agcctcatag aatagggata
   175741 aagtgcaagt gattaaagca aataacagcg agttacacca acagttttca acatcaccat
   175801 ctgttttaca gctccgaaac caataccgca caatatttat gaacttgagg cgtatacaca
   175861 gcactgctag tcagttcggt ttccacaaac accttttcgg tagttgcgca gacaggacca
   175921 cacaatacag taggcttcgg aggagcgacc tgcacttcag tcttatcatc ctgattgttg
   175981 ttagcactcg gatcccaggt gtttaccacc tcccactcca ctctctggtt cgcttcatct
   176041 tcttggtgtc ttcggctcca atgcgatcgc cgccgtactt cgtaacgatc tttttgacaa
   176101 cagtgactgc agtcgtgtcg gcacctgcac catggtccgc agtcacagca cacctcgtaa
   176161 cacagtccgc aggtaaacgg ccagtcgtaa atcaggtaga tgaggcctac tagcgatgtc
   176221 attccgccgg ctccacatac caacacgcca agaggccaca tgtctaaaac actcccagca
   176281 gaattgttgg tactcggcga tgtagcgttc atgttgcggt agctgctcgt catcatccct
   176341 atatttcggc agtaactcac ttttcgggtt atgttggttt tgaaaaacta ggatgagatg
   176401 tacatttgct cgtaaccagt tgttaacctt tttctctctg gacggtatcg aacaacgagc
   176461 tgttctgtgt cgtctgagtg gcgttgacgg tagtatttta ttcgtttcat ctttccctgt
   176521 ccaaacatta acactacaac aacggtaatt acaagtgcca aagcccacac ggcatgcgta
   176581 gctggggctg caacatcctg gagataaaca tcaacagcag agctagatgt tggtggtgtg
   176641 gaactagtaa acctacagaa ttcaggtgta atgttggaat agctagttcc atttccagca
   176701 ataactgtga gctcaaaagc ttgaggcttt gtattgcaac tagtctctgg tttaaagacg
   176761 tatctgcggc tatcattgtg cgtaacgtta taaagcatta aagtaatttt gctgcaatta
   176821 taacataagc tgaaccagtg atgtttcgtt tgatgagaac tcgaggtttt acataattca
   176881 tgctcagttg ttttattctg agtattgtta taaagcagta gccacgtagt ttgatgatgg
   176941 gcagcatcgc tacaattcgc tgtaaaatta acggtttgtc ctaccgttgc attaacaaat
   177001 gttattgtga agcccatggt agcatttgca gtcgttgaag tacgtgttgt tgtaacactc
   177061 gcaaagctgg tcacgtttgt tgctgtatta gttgtgtgtg ttgatatact aacattagta
   177121 gttaatgtgc taatgctaat attatttgtg gttgtactag atgtataagt agtaccaact
   177181 gtagtgttag cagatatagg actagtagat gtatttggat aacttgtgtt gttgggagta
   177241 cttgttattg ctgtgctaaa ggttgtatta cttttgctag ttgatgtatt tgtactagta
   177301 gcagcttgtg ttgaggtgct tatactttgg ggtgatgtca caacgcttgt ttgaattgtg
   177361 tttgtggtag atggagatga tattgttgaa gtaattgttg cattggtggt agtaggtact
   177421 gttgatgtat tgtttgaagc agcatagcga gaaagtatag cgatgaaaat gtagatggta
   177481 cgatctgtta cgaggtagct tattttgaaa tgcatattgg aatttacgtg ctgtatagtc
   177541 ttgtagttta acagtcgtta tacctaagtg accgtacctc tgtctggaat acctttatag
   177601 gttgttcgta tgctggtgtg cgtcattgtt gcgttgacgt ttccacttaa ctactcttca
   177661 agtacgaagt tgtttagaat atcaaaaatt tcgagtttct agggaacaaa cagtaattag
   177721 ataatgtcat agctaaaaat aataaaaaca tgtagtgaaa cggattacct acgtaattta
   177781 gatgtatatg aaaattattg cagaaactgc gcgttgtacc aatccgcgta ttaaacactt
   177841 agaacgatgc tgctggaatc ataatagtta tgttcacaac actaaatgga gcgtagtcct
   177901 acagtttaaa aatgtcatga ttataactaa attatataaa acataaaaag aacgtactgt
   177961 agtaatgttt ataaacattt caggtgctaa gttcggattc attagtagtt acctatatta
   178021 ctaaaatata gatatataca gttaatatca gcaaaacatt tttatataag gtgtattaag
   178081 ttatattgta tactaaccac ctgtatttgg tgaggacaat gaaaacagta aagatagaca
   178141 attagatttc aaaatgatcc tggaatgatt aaaaaaatta gatattaaca gaaacatgaa
   178201 attacttaga ttgttgggcc atcataatac acacacacac acacacacac agcgaggctc
   178261 atgctaaatc agtttcctaa atgttataaa ttatcgcact ctttcatttg tcccagtata
   178321 agtatgtaca tagcgtatac aacaatgtgc atcataattt gcctaaagat tataatacca
   178381 ataaccatgc aattatatgt gtacttccta attcatacta tgtgtcattt ctaacaggaa
   178441 gtttcgttac cgtattggtc caaactacgg tacctactgt actcactgaa ttgcatacca
   178501 tctgcaacac atatacacac atacacacaa tatatagcaa cacatgtgaa tttcaaaata
   178561 gatctcatgg ttatacaaat taaagtcata aatcatgtca taactttatt tatttacatg
   178621 cataggaaat ctttgtatat gcaacacgtt aggttcttcc gttatcatag atgtacagat
   178681 aattctaact ttttttacat atttgtataa acattgtgtt tccgttgcag tgatgcaacg
   178741 cacttcctaa acatctgcac aacgacttgt ggcagccgga gccagcaagc cacagcggcg
   178801 catatgatca acactacaag tatccaaaga ccatgcagtt ctcgggaagc gtattgagct
   178861 tcatagacga cgagcgaaac attgtatgta aacgatgtgg atgctgatat cgataacgat
   178921 gtgagttgtg ttgtcgacac tgatggtgtt gtaacggggc gcgctgtggt ccaccatgga
   178981 tgagagtagg tactacagtt atggagaatc ggaatgggtg gacctggtgt actggtagta
   179041 ttactccaca aacgggagta accagataat aaacaattgg tagccttgtt agtacattga
   179101 aatgtaggcg tacctccaga cgtcaatact agatagttcc agtataagtc ctgtccacag
   179161 agtttgacag tctcattatg aattaccgtg gcgttcacag caccttgaac aatcaacgtg
   179221 accgttcctg ggaaggtgct gttgaaactg caggatacat tgtacacact ctggttagtg
   179281 gaatgtttag aagcataggt aatacccatg ggagtcacct gggttctttg agtaatgttc
   179341 ataatgttag taacgttgtc atatgagaaa cagtcatatg tcccgggtgc atggggagat
   179401 acaggccatc gcattgtgaa gccatttgta ttactcgcac tagtcttaga ctcgtcattt
   179461 ggaaatattg gtgcatggtt tttatacatg taaacttgtg tggtagcatt ttgatcacat
   179521 gctgtaaaat aaatgcccct agtacattct ccagagacaa atatacacgt taccgtgtat
   179581 ggacctgaca gtgtttcgtt ttttgttgga ccactaacaa ccttggtcat gtttatagga
   179641 agctgatact tcatatctgt attactggta taatctttcg aagcacagcg taacgcttct
   179701 ccagaggtgc cggagggcca catcatgagc agtattaagg catgcgcatg tttgtgagac
   179761 accggctgca tcatggccgt gctcttgacc ttcaagtaag tacccagccc ataatttaaa
   179821 ataacagacg gaaactgtaa ctgttaaaat caataaatac ttttattata aaagctgtaa
   179881 caatcctatt gagttctgtg ttgtctgttg cggcggaggt cgaaccacgg gtttcttcct
   179941 cacgatgccc catatgcaaa acccaaacag gcacagtaaa gtgacggcca ttacggagat
   180001 agttacaatg tccacggtac taagggtcat ctgtattcgt acagttgtgc tgacagggtt
   180061 cgcagaagta atgttcacgc gcgggccata cagcctagga accggcgatt aacagcgcat
   180121 atctgagtct tgtagactcc agaaccgctc cccgagcata tttatccaac acaaccctca
   180181 cgcacatgac gaaacacata ggccgacact actttcgcac atgtccgtcc cagatggcct
   180241 gtttgacact tcggtagcta aaccgtcgcc accttggttt ccgcaggggc ttccgaggcg
   180301 aatatagttc gaaaccgcga atacagcatg aaaacagacg atcgcaccgc cgtggctgtg
   180361 cgaaccgcaa taggcgttgc agtagccatc gggcttgtga gtctactcat agccctcatg
   180421 tggtggctgc tggccaagta acgatccaca ccatgaattg tcgcactaga tgtttattgt
   180481 tttgggagat gatgggggtg agcgtagtgt tggcgggcgt actgggtttg acggcgacgg
   180541 tcctgcttca catgcagcac gtgttggccg ccaacagcac gtgcgctgcg ggaaacaaca
   180601 cgagcaatac cacaaacgtt acgggctgtt cgacgtcgtc gtagccgtgc gacgcggggg
   180661 aatgcggcgc ggtggcggag gacgaggagg acgcgggggt agagagggcc tagcagtact
   180721 gagagctagg acctggctac cttcggttcc tcccttctgt tggcaacagt tattggcgcc
   180781 cgcagccggt gtcttgacgc ccgatgactg tttgcgacaa cgaaagctca ataagcgttt
   180841 ggaaagagaa ggcttcttgg tggcctcttt gttgtgtctc tttaacagcg tggcgagatc
   180901 cgtgcactgt cgattggcgt gacagacgcg tgttgttggt ttctgggtat catcacactg
   180961 aacggcaggc gatgagggag gcgacggagg tgatgcagac gacatagcgg agacacccga
   181021 ggcggcctga gcaacagcgg cgtcggcgtc gctcggacag gggttcttag ctgtcaatct
   181081 ctgcaggcgg cgcggccaca gcgacttgcg gttgcggtga cggcggagag gcagccaaat
   181141 acagcacttg gtcgacagaa acagaaggaa ggccatgaaa agtcctagga gaaacacaac
   181201 gcaaagagca atctgaaaaa agcgactagt aaagtccatt atccataaca cggtgtccat
   181261 actggcgagt ttgttcgtat aaaagtgtcg gatgaatgtg cggcgccaac acgcagacct
   181321 tataacgcct taggaggcga gcgggcaggg cggggagagg aatcatgata gtcggagcgg
   181381 tggcgcgaag cgagtttgcg gcgtgcaccc gtgccactga gcgcgctgtc gttgttgtcg
   181441 tggtgccgag gcggacgcgg agggcgggag aggcggctgc cctgggcggc ggcggtagca
   181501 tgatgcagga gcacggaatg gaaagtggac gatgaggagg aagagtccgc agttgtgtat
   181561 gaagtgtgcg tatgaacagg gtgatggcat gcgcttctgg gtgaaagcga gcgtgtgcga
   181621 agagctcgat tgggaccttc cgtaaaggct gtatgattat catttgcatg cagctgtgcg
   181681 cttggcgtag ggttgtccga tacggcagag aaggacgaga ttaaggcgta cacaggcaca
   181741 gagacggcgc gaaacacgcg tttgcacagc ctgtacgttg cggacatagg aagcaaacgc
   181801 tgcacggcaa ggtagcgagt gcgctggcgg agcgagaagc cgcagcaacg gcagaactcg
   181861 ttggtgagag ctaagagaaa agccacgaag agagtggtga ctgtaaaagc gaaagtaaag
   181921 cgaaagaagg tgcacatgac atacatatag gacagcatgg tggcgcgagg gctagctgca
   181981 ggattgagga gaaagccctg gcttgtcagt atgcgagcaa aatgctcgcc ggagcgaagt
   182041 ttatgagcac aggcgggcat gggcgggaag aggcgtgcga tgactagtca tcagtcaggc
   182101 cgagggagcg aagcagaaag tgtgtcctag cgaagcaggt aaacacaggc gctgacaggc
   182161 agcaagtgta tgcatgtact ggcaggtgaa ggtgagctgc gcaggtaatc ctgacgcacc
   182221 tggacctggg cgggccggtt acccggccgt ctctcaatga cggtgttttt gaggcgaaca
   182281 tgttcggccc gaacccgctg ggcatacgca gcggactgtg taacatgcag ttacaataca
   182341 atcacacagc acacacgagc agtcacagag agtgcagcaa gcccgagcta aacctgatcg
   182401 acaggttggc tgcctgccaa gtctcccggg ggaaaaaaga caaccgcgtg acacggcgac
   182461 cggcggcgag gcataacaaa catgtccccg ctcccgcgaa ccccccgggt gccccccgag
   182521 accccatgct gtgcccggcc tccctcctgt gcgaccaccc gctgcgctcg ctgtcaatca
   182581 taggcctcct gctgggcgct gtcaatcaat gcgctccatt gttctatctg ttggctttgt
   182641 gaccattgtt attttttatt ggcgcgatgc ccgtaacgta tgttttcaat cagtattcac
   182701 atacatgttt actgatcacg tatgtgcaat ctcatctggc cgcacgccaa tgtctcctac
   182761 caaccctcac ggccacttgc cattttcagc cccccgccca aaacaccccc cacccccttc
   182821 gcctcgctgc cactacccgg agcccccgcc gaggcctcat tcgccataca ggggaggaaa
   182881 tgtgctggcg ttctgccact ttgcacgctt tgccagcgtc ccatgctata aagctcgccg
   182941 cttctctccc tcgcctcacg ttctgagctg aacgcctcca cttcttgaga ccctctaccc
   183001 aactctcaaa cagccacctc tccaaccatg gcagactcga ccaccggccc cgactttcgc
   183061 caccccgagg acgaccagct agtgccgcag gtacttgtct ctactttgta ccgctttctc
   183121 gtctgctcgc cattgctacg catctcttta tccctttctt tgtcgctttt tagggccgtc
   183181 cgtcctcgcc cttatgtccc gacgttgccg tggttccact ttcgcctgaa atgcctaagt
   183241 tgaccaaaca gcccgaaatg ccttcgacta ttccaatctg cacttcacct gaagctcctc
   183301 cgaaaccgcc gcgcctgcac aaacaacgga tacaatcgac cgattgtcaa cgcccatcta
   183361 aagccggctc cgacaaagaa gaaagcccca gcaatccgca ctctacatcc aacccaacac
   183421 caaagccacc atcgaaacca ctatcgcacc ccgcaccgga gcccacgcag aatccgcagc
   183481 gcaaacgcca gaagaccgtg ttaaagcgtc ctagccaccc ccctccaccg cctcctaccc
   183541 agtccgccgt cattcccacc gtgtgtgtta gtccccctcc ctcagctccc ccttccaagc
   183601 ctccccccgt tcctcccaaa agacgacccg agttacacct gcccctcaaa ggtccccgca
   183661 tggtttccat tgagctccct tgcctcacgg gtagcggctc acctacctat gactatcctg
   183721 ttaattcggc tcgtaccctg ttataataca atccatccgt agtaatcacg ccgaagaagg
   183781 ctgtgtcgtc tctttctccg cagcccgttg cctgcgccgc tgcaaccacc gctcccacca
   183841 gcctcgcatg cggaaccgac ccttaactct cttccaccac gacgcttcgt cggctgctcc
   183901 tggatactcc aagatggcag cggggcagga cgccactgag acatacgaac aggtggacga
   183961 ccgcgacgaa cgtgacgagt cggagtccag agtcaacgag cgactccgta aggcatgccc
   184021 ccgccagtcc ccgcactgac accacacgtc atgcgccccc ttgatttgca gtctccactg
   184081 cgcctccacc tgcgccggcc aactctccgg ccgtgggaga atgtcctccg cgagcggcac
   184141 cacgtattca atgtgcgcct tccagtccat gcaggcacac cacaaatcgt gggagtcgtc
   184201 agcgactcgg cgccatgcca actcccgcat aggcatgtgt cccacaagcc cgcaagaaac
   184261 gacaggttcc atgttaactg tgcggactgt aactcgaagt gtgtctaaag ttgtatgtta
   184321 tcgtgataac tgtgtagtgc gattgtctaa ctcatccctg ataacccgtg ttgtcattga
   184381 attgcatgct gtcgtctgca ttactcatgt acgttctctc ctaaatgaaa caggcctaga
   184441 tctataaaga aatcgcaaag acattctggt ttctgttttg tttcatttat tcgtgtcgtt
   184501 attaaaacat aaacgcagga aaatatatct ttagcgtatc ttcaggaaac acatgccaga
   184561 taatggacaa tgcgcaaatc attaaatgta gtgtgcacac tgtcgtacac caacatacat
   184621 gccaccagtc gcgaaaccaa atagccctgc agaatgtcca taaatagtta tgtgtcagaa
   184681 agtccggctt aacgtgaggc tcacacgtaa cccatatgat gtcggacatg ttcaacgaaa
   184741 atcgcatttc cactttagtg gtagtccaat ctatttcgta atatcttaaa tcgtattcca
   184801 gtttatctga actgagtttc atgtcttttt caaaaaattg gagatcctca attcctttgt
   184861 cgcggtatac cacaacctgc acaaagtaag agtctatgtt tccagtgatg tatcccgtca
   184921 tgaacagctt gccgccctcc aggtaacatg ctgtctgttg aacggtgtat aacgcgcgtc
   184981 gtgcagctag ctcttcttcg gtaagcactg gcatcgggaa atcccagccg aatgtcagtc
   185041 cgagctgcag cgcaacgccg ccaagcacca atattgctag agaaaccgcc atctcgaacg
   185101 tttggagccg tagcagctaa cattgtgcac ggtgtttctg atttataaca aaaagcgctg
   185161 cacgtaagat gttacgtgta tatcgaatga gagccaactc caacccacta ggcttagtgc
   185221 ccgattgcct aagcaactaa ctatagagtc gcataaaaac acagcactcg ttattcttta
   185281 tggataaaaa cactttattg cacatatttt gatgaacatg ttactgtaac actatcacgg
   185341 tgtcacagcc atgttgtccg ttatgaggta gttgcggtta attgtccaca tgagcaccac
   185401 aagccttgtc tcttctatga cccggcaatt ccaaacatgg tgtcacattg agtgacagat
   185461 catcagtctg cgatgcttcg tatactgtca gccgctccat ctgtaacaca tataaaactc
   185521 gttatggttt tgttccaatg tatgtgagat attacccatc agctatccgc attgtaaaaa
   185581 cactataaca tgatacacgg caaacagttt acctgctcac accttgttgt taatggacac
   185641 ctcgccgaac atacgaacat ggacgctgaa ctttgctgcg atgaatgtta cgattgcgca
   185701 tccgacggca acgtaaaatg ccaatctcgc aagcaggatc cagtcattgt ggcgagatac
   185761 tctctcggca taccaaaaga tactggtatg atcaatttca acttggacct cattcacata
   185821 gcagacaaac gttttagcca atccatgatc gtgatacatg cgcaagtcaa cgcggtatat
   185881 ggtaggagag acagcttcgt gcacttccca tgttctggta ttaagcgtag aatgtgtctg
   185941 tttctcatgt gaccgacgaa tgttatcccg gtcatgagta actatctcca cgctttggag
   186001 tttcgcaaaa tcagaccgaa cagtaaacgt agctgtcatc tttccaccct taacatgaca
   186061 acgtgaatga agcaactcat acgacgatga caatggtaag ggacttgcat cgatggccaa
   186121 caaaagcgat aacagtccca atgtaacaag aatcttcatt tcgatgttag acagtgtatc
   186181 ccagaatata ggggtgaaag tccgcaactg tcctacagaa agagcggtat ggagtgaacg
   186241 gtgtttgcag atatatacac tagcaaacac gcccaggaaa gccacgtcag aatcattgac
   186301 gtagactcca tagtgtcatt ctgtatacta accgaatatg gacacggaac attcgtcgtt
   186361 aagcggtttt aggtacgtca ttagttaaag ttacatgtgc atgtaaccac acccgttata
   186421 gggacgttga cgattgtcca tccgtcacga tgatttccag gttgccgatc atttcgcgtt
   186481 tcactctccc aaaggcttgg tgctatagac tttggagtaa gtatctatgg cgcctggcct
   186541 ctggggaagt ggtacgcgca attcgggacg cccgttcatg gaaaaacgac agggagggat
   186601 catgatacac agatttttta agatccatgc cctttgattt tatcgactgg atcttggcct
   186661 aggtcgttac tctcagctaa gtgcaaagat cctgccgacg aaatcatagg attcatagtt
   186721 gtgttcaagg ataaccaatt attcgaccta gctacgtatc atttacatat gcattatcta
   186781 gaccatatga gcatgctgct gggttacatc tgatgaattt acagacgcac accggaatgc
   186841 ataagcaacc aaacgggata taaaggaaaa cagggcggga gagaacaagt atataatggt
   186901 gcatggtatt atgagcaatg cgtgttatcg ctgactgtcc tgtcgctaat cgggcgtgcg
   186961 acgacctgga cgtgcaaatg gttgtatggt acatatgcct tatgaataac aaccccttgc
   187021 acatccatgc cgaaacatgt tcgaaacaca tcacaaaaca cacaaattag tatggtttat
   187081 ctttttaata caaagaatga ataaaaatat ataacagcat aatctgagtt tattaatgac
   187141 tgccacaacg tctgagacaa cgaacacgat ccaagtcctc aataacatac agcattaatg
   187201 ctgtaagcat aagtgacagc aggatcataa ggagatacag cattagcgta gctcctccat
   187261 accgctccag caagaacacg atgccttttg gtgttgtttt tggacaccca aacagtccgc
   187321 ggatgttgag tgcatgtcca tggtgaaagc gaagctcagg atcacagccc aagatgcgga
   187381 tggctcgttc gtagcgcctc atgaacgcat cacatgcggg accctggtcc gtaaacgggc
   187441 aatggcggcc tgcttccttc tgatgaagac cgttgtctgg ctgaggcaca cggtcgcagg
   187501 ttttctccat gttgccgtct tgtttctgga gcgtatttga gtcattcctc caagcggagg
   187561 cgacaccaga taagaccagc aaacatagca ggctgccaat caccacgttc tcattagaac
   187621 cgcatgagcc gcagagaggc ttcataatgc gtcgatggct cacggacaat ctgacaggtc
   187681 acgttagacg gtgatttata tccatgttga tgtcacgtgc aggaagactg aggcgcgcaa
   187741 accatggact gcactcaacg accgtacgct gtgactccgt ttgctaagca gtcatttcac
   187801 agggccgatg gaggttttcg ccacaccgat ttcgtaagtt gatatcaaac tttatgatcg
   187861 gtgcgacgaa atcttgatcg agaccttttt ttccaccagc agcagcaata aagttcatcg
   187921 tgtctggggc cggtcaaact tgaacatggt tgtataaaaa attaatagtt aatttgacaa
   187981 cagcaacata aacaataccc atacaaatcc aatacaattt accacgatac gagttatgaa
   188041 attcttgata ttcacgtagg tagaaattta caatttgagt taattcatgt tcaggcacac
   188101 attttataaa taaaggtttg taataatgat ccacttgtat aaccacttct ttaaacatat
   188161 aagacaccgg taaatggaac tggtaacgta atctgctggc atgttccaga cgcgcatgat
   188221 gaatgatatc gtgatccctg atgtatgttt tagcttcttc cagaagttgc ataggatgaa
   188281 ttgaatgtct atacatagta tcattcataa tcactaatgg atgatctaaa tttgtagaaa
   188341 aggcaaacat taattttcca tcataatagt ttctcaagta cacatgaagc cacgtaggat
   188401 ccggaaagtc gccaagaaca attccgttta catgaagccg gccatcttca atcttgcatt
   188461 cgggatccaa ttctgtatag ccatatatac gtctatcagg tattcctgat cttggcttat
   188521 atgtacgtct ctcttgacat attttattac aacgttcggc tggaacgatg agtaaaaggc
   188581 aggtgaaaag aagcgctcga ggcaggtggt agcagtacat cttaggagac cgcggcattt
   188641 tggcatagac gtcgcaatct tctgtgagag tgctaacgta gccgtcctaa atatattcaa
   188701 aagaagaagt aaacacagga taagcgtagc tacatttgca ttgacgtgcg ctgcttcgtt
   188761 gggtactgcg tagaaccaca cgcaattgac gaataattaa ccgttaagat gaatttgcaa
   188821 tcgtatacgt caatgcaatg tgtttccatg agttacaagt tctgcaaaaa cacccctgtc
   188881 aatcctcttt tgatgacaga gggcggtacg gtatacgtgg cacgaagcac ttccagtagc
   188941 attccccaat tgcacaacct atggcaatca caacaagtaa gatggccgtt cccaacatga
   189001 tatccatgca ccatagccat gcaatggtcg catatcttcc ttcatacacc agcctttgga
   189061 aatccccatt gaataagaaa tcccaggagg ctattgtttc ggggtaacac gggatggcgc
   189121 acgcgcattc tcgacattct ttcaaaagga tacgacccag gtctgccggc gcaggtgtcc
   189181 gtgttgtaag acagatggtg tcattactgg aaaatgtagt attcggcata ggcaggcatc
   189241 gtttgcgttg agaattttcc cggctctcgt agtacggaaa aacagtggtt tcatttggaa
   189301 gcgcttttcc catcatacac caggtaacgt ccaatatccc tcccgtaatc gtgcaggtag
   189361 cattggcatc ttcgatatcc gactcatctg ctaatgccct atcctgaatc caaaagtagg
   189421 caagcaagaa cacaacgagc aagcgcatat tgaaaagagg gttattgctc gctttgctct
   189481 tgagtggctg accgtgtgag ataaatggta atttgtgtct acttatatgc cctgtgagaa
   189541 tattcccacc cagtttcatt tgtatcacgc gcacccattc tcccaaataa tgacataata
   189601 ctttaattat aattaaacag aggatatact ttttatttca cacaacagtt ttgtaatcag
   189661 gctgagcacg atgactcggt ctcataactc tcagaactct gagagctctg gtcgtcggcg
   189721 tatgggcagg gatatcgtgg gaaagaccag gcagctccgt tcagcttgtc gtaggtatag
   189781 aacatccatc tggtggccag ccatcggtag cactcggtgc tgttgggtct gtccatagca
   189841 tcaagctcat catagaaacg aagcttcatt ttcaggtacc accgatcaag ctcgcgttca
   189901 tactgagcct tttccgctgc actgaggttc tggtacgctc taattgaatt aatggcatct
   189961 tccatataga aagtgtcggc aacaatgacg atagggagca cggccaacag gccaagcaca
   190021 atcagcctca tcgtttcaac gatagatcag cagtcccgct gtctagttag ctgtgtatgc
   190081 ctgtgacagc tccgtcaacc actttcttct gaagcaaatg tttgccaggg cagtttaaac
   190141 tggcgtgtcg aagtgccaac ttggcacggc ttatatgtat cctagatgga tacgtcagtc
   190201 aaagtcccta cgtaaaacat gtccaacctg cgttttacct gacgcacaga ccattgcttc
   190261 atgtcccggt gttttaacac ggaaatccgc ctttctcacg ggtaacagtc cggttcctca
   190321 ttcccatatg ccgtaaaacc agtaggagcg cccggtaagg ctccagtgca tctgaatcag
   190381 catgcaaagc ataaaactcc atcgaataaa catcagaaac agtccccagt aagcatgcag
   190441 gagtcgacct tcaaatatga gccgatccag ttgatcgata gaagcccaaa aggggaacca
   190501 tgagatcctc agcttaggct cacatgtaat gagatgtgca tcacagtatg cacaaggatg
   190561 gacgtacaga tttatagccg ttacatgttt tgtaagttga atgtttttca aaatatatcg
   190621 ttgttcatat tctgtagaca cattttgagg ctcaggcaat ttttctgaag aaaactttgt
   190681 gattacgtcg gcactaagat acagatcagg agcggtagca ttgccagagt atgtccacat
   190741 cgcatccagg tagttatcat taatcagatg acattgactt cgagggtttt ccaagtggta
   190801 gtccgacact agtttcgttg cagacaatga cggtaaagga acattcttca tcaaaaaaga
   190861 atcagacact ttgccgtcag tgttcatatt gttaggatct atctcaaaca tcggtgggtg
   190921 aggcggtggc gacacactca aaattagtgt gtcgatccat gccacataca ttatgaaccc
   190981 cgataacacg aacaagttta gcagtttcat ggttgcgata gcttggtcct ggtgctgttt
   191041 gcggcaacag caccaggacg aagcattctt atgtaattta gtgacgtgac aatgaccggg
   191101 ttggtgcctg cacgcctcct tgtcatagat ccaaaaaatg tgtactttta aaaatcgcgc
   191161 catttccaac ggtcgtgacg gtcaacggta cggtgtgtat cgtaagtgac cggccgtatg
   191221 accttgaacg accttgagtg atggtaacct gtcatttatg atttatggga ttcatgtgaa
   191281 gggctttacg gagacgcaag taaaaaaaac cacaaacact gaggcttatg attaatagct
   191341 tatttcgctg tttttattag gagcactcag acaacaggtt gttcagggaa agtggacgaa
   191401 aagtactcgg gataccattt gtcagcagtg agaggcacaa tagccatcat cagcaccaac
   191461 acctgatcca cgtagagcag gagcgcagcc cgaatagcgt ggcggtcaaa caacgaccga
   191521 gggttataac acagcaccat caagatgtcg tggagcagag ctagtgtaat caggtccaca
   191581 atgacagcag tgagcaccgc tatccatttc tgagcgggcg tccatgactg atagtacacg
   191641 atcgcgcaga aaagtggcag ggcgagaacc aggcaggcaa caacaagccg tccgcgtggg
   191701 cgggtggagg ccagaacaca ggcaaacacg gtgcagctga gttccaacac cagggaaaac
   191761 acataagcct gccacagtac ggtgcgttcc aaacacatac tccaaatcac caacgcccat
   191821 gtgttcaagg cagtgtagac cacagcagcg ggccatacgc tgaggcggta ggttgtcttt
   191881 ctacgaaggt tgaaacgcag aacagtggga acgatcatca tccagatagg cagtgtgtct
   191941 tttaggtaag gtgtctggat tcgccaagaa ctcatgatgc acaaaagaca tagtcccatg
   192001 gtgatggcca gctggatggc catggccgtg tacactctga ccagccacac gaaacgccgc
   192061 atccatcgca tgacttcttc cacatcgtcg ttgtcctgat ggcgagcggt cgtctgatag
   192121 cccatgctcc ccgagcttct gaggcacatc gcatgtgcga gccgggtctt atagactagc
   192181 ttcagttttt acatcttttt agtgttctag gttttaacct gggcattatt ccagctaaaa
   192241 gaactgaaaa cgcgattgaa aggtacatgc caaatattag ggattagcat gagaaacgtg
   192301 acctggaata acgcgtagta tgacacatac aaagtcagtg acccctgtat tatctgcttc
   192361 tcccacaagt gtttgcgatg tcgttgcgtc atccagaaaa acagtatcat gaaaagatcc
   192421 agaaacacag tgtaagtgct caacatgatg tgtgtgaccg tggtcgggtt ggaggccgca
   192481 atcgcaagca atgccactaa actggatgct cctaaggtca gaatcatagc gtagcgacga
   192541 acaggtcgat cgtatctgtt ctcatcaaag ttgtcaaaaa acgcggcagt ggttgtcagt
   192601 gtgaagagtg ctacggagat gacgtgagcg gccaaggctt tagagacttc gccgcagaac
   192661 ccgaagacag tgatgctgag cgtaacccag acaacatata cggtcatggt aaacaggtcg
   192721 ctgggttgtc tttcccatcg gatgattaag caggccagac agatgactgg cagtagtatg
   192781 gccagaatgg gagccgggtc gttttgacac gtgttatgcc actgagggta gctgaaccag
   192841 atgtagagag tgaaaacagc agtgacagtg aactcgaaga tgaaatagct atacacctgc
   192901 acgaggatct taaaccgctg tatccaggcg gtgctttcgt taaaccgaac ttggaatcga
   192961 aaggattcca tgatcctcag atctgaagtc gtctatcccc cacaggtaca tgagagttca
   193021 gagaataaga tggaaagaca gtctgaagcg atgttaaaca gataatagtc tgattttcgt
   193081 gaatcatcca taaacagaag agggcgagca aaatgtcctg ttgaaactgc cattccaaag
   193141 ttggctcaca cccgttaaca ttttgtgagg atctagagtc cacaggctcg gtgtcagaag
   193201 atacacgtac atatagtaca tgacaataag tatgtccaca tacactatgc aggcggagac
   193261 cacgtgtttc atggttagat tgaactttgt gatatagatg ttttcccaga tgataattcc
   193321 catgctgcca tgtagaatga ttgacagccc attccgcatg accgagtggc ttagctgtcc
   193381 gaagtaaaac aggagcaaca gaaaagtgct cacgagggtc gcaacgtatc gacattttga
   193441 aggtaatggt cgcgaagacc atagagctaa gccgctgcag gttaggaaaa aggttgccgt
   193501 gaacagcaga ctcagaccgg ctgtgattcc atcggtgcaa aagctgatga gggtggatcc
   193561 tatacaggca aatacaacga tgtacaataa cccattgccc atatgaatca tgtcgtcttg
   193621 tcgatggtca aacatattcc acacaaacat cagcagcacg gggacgataa tcaggataaa
   193681 cgccggctcc attctgcaaa tttcggtatt aaaaaccatg cagtggaatt gcgatttgaa
   193741 ggctccgtag gaacagatac agacggctat cacgaaaagc aagcacaggt agacgctggc
   193801 gagtggaagg tgttgccgca gccagctaag cgatgatcgc tcgtctagat cgagctggat
   193861 cataggagcg ggtgggcgat ggaccgtgaa gggttgcaag cgaggtgcga aaggcatgct
   193921 gacagtgctg tgaccttgac agtcttatcg caaccaggtg tttcgaaacg tctcgcagag
   193981 aatttaaaga gtatggcgtg gcgtgcatag tgtctggcga agcaaacgtc ataaaggtac
   194041 gcgtggatca cgatttcgga acgtgagccg agagcgtaga tgatcgaaaa acgctaaaca
   194101 tgttgtgaac gttggcggac cagatgtcct tggtccaaca gaaaatggaa acctgataaa
   194161 gcacgatgaa cagggtgtac agctgcaaag agctgctttt aattcgttcg ggtcgcctgt
   194221 gaacgagata aaactgggta gggatgagga gaacaaaacc tagactgaat attgcataac
   194281 cggtagcacg caagatgata ctgagatttt tagaaaacag tgcgatgagg gaaaaagcaa
   194341 ccgcgaaaga agttatgaaa cacccagcta gaggtctgat ccagtggaga caaatacccg
   194401 ggattccgta ggtacaaaat aacaacagac tcagaacaaa agtttgccaa atggtatggt
   194461 cgtttgtaca aagatgaaac acactggtgg acaaacaagt taaagtaaca ctgtagatcc
   194521 aggagctggt ttgatcgaca gattcttcta aaaggtgaga caccatgaac aaaactacag
   194581 gaatcaagaa caaaacggaa ggagcaggat ctacgcgaca attagtggcg ttgttataca
   194641 acatggggaa cgtgaagcgc gcgaggccat acacgagaac ggtggcaacg acggccaagg
   194701 taaagcagcc gtagattttg aagatacagt tcgtccgctg tagccaagag atactggcta
   194761 cactcgagcg ctccatgtcc acactcctca tcctcggaat ggtagataag agtcagcttt
   194821 gcgagttacc cgtggttact tatacgcctc cactgccgca tccttacggc gtaacatgtg
   194881 ctgtgttagc tgagtattga ttgaagtaag ctatgagtga gctgaacatg ccgtcccatc
   194941 gagcagacca gagacccgga gtgaggagca gtacgttagc ctcgtacagt agcacccaat
   195001 tgacataaag catgatagaa ggccacctga tttcatctac ggggtgctta tgtcgaatgg
   195061 ctacggtttc catgtaaacg tctatggagg tcaacactaa aaacaagaaa tacatagtaa
   195121 taaacagcat atgggagggt gctaaatgtc caaaggaata aatgaggctc atggtgaata
   195181 agacggtcat gctaaacagc atggctagca ttttgcgccg atacatctgc atgttgtcaa
   195241 acacagccgc ggcgctctgc aggatgaaca tgagcgcggt cagcaagaaa ctctgaaacg
   195301 ccgtccagtc gtcggtacag gtgctaacca acagacatga cactgtcatg taatagagtt
   195361 cccagaataa accatctata gtgtgggcaa tgcgctttgg ggtattttct acgataagta
   195421 tggcagccgg aatgcacatc atgagtagag gcgcggggtc cttcacacag tctacagtta
   195481 ggtagggcct ggctgttcga tacacgccgt acatggcgac ggtcacagcc acttccattc
   195541 ccagccaggc atagacctgg aaaatcatag taaagcgcct cagccagtgc atgttgaggt
   195601 gccatcggta ctcgctttcc atgctgttcg tgttgagaca ggataggaaa tgatggtaat
   195661 aaatgagcag atacacagtg tttatatatc aagcgttcgt ttaatgaaca ttaaaggagg
   195721 cgtgacctca taaccatggg tcctccgcct tccagggaaa cgaccacata atcacattgt
   195781 tatagtgtac caggtgaaaa atacagtaca gaagaagtga aatactcatg gctcgttcat
   195841 tagagcgttg ctgtcgccgc acattactaa gctgtagaca catggcgttc atgaatccca
   195901 cagtcccaat aatatacagg gtttgtgcta tccaccagag cgtgaccgat ggttgcgtta
   195961 cgctatgtac aaaacaatta gccgccaacg cgccggcaca taacatgtca gaaagcactt
   196021 gccgctcgat gaagggtttc cagttgcttc catcgctcac atagatcatc aggataaaca
   196081 aacaaaaggt agctatccag ctctgaatga cggtccaggt ggcgacgcat ccgctgaacc
   196141 atacgtggga aaaggctatg tgtatgacgc agaataaggc aactccgcaa ttcttccaaa
   196201 gagagacttt tcgtatgacg cggttgatgt aggattcttg aatgaagacg agcgcgggac
   196261 tcgtaatcat aatctgtcgt acgggttcct gtgcacaggt gtcgaatagg tattgttggc
   196321 accgtaccaa tccgtacacg aggacggtga tggagacttg aaaagctaac caaccataaa
   196381 ctgaccacac gtggatgctg cgattcagcc agatcacatg gttggttagt ttagtcacca
   196441 ttttcgaaac catgggtgat agcggcggaa ttgactgttg gacgggtttc gttctgggtg
   196501 ctggatggag aaaagtgttg catccagctc gtgagcctct ctagggagct ctcagtagtg
   196561 agaatgagaa gaactagcag atagcaatag attaagtcct cgtagagaca gagaccaagg
   196621 acacatgtct cttggctgga agagacttta gacaactgcg aagtgtcgaa aaccgtcacc
   196681 cccaacataa aagccaacac aatcacgtag taaccgagta gaattttatt tggtagagac
   196741 aacggttgca acgacaacgc aaccaaggta atagtgagaa tgagaaaaaa gataagaccg
   196801 agagtgcgcc aacggcgata atgcaggtct ccaagacagg ctagccccgt gcaggtgaca
   196861 aataagattc ccgccaacag cccagaccaa gtaaccagtg taatgtcaac acacaagtta
   196921 gccagcacca cagccgtagc cgtaactagc gtgtaaatcg ttaacacggt ccagctgttt
   196981 gagtgctgct ttttggcgtg aaggatagta agacaggcgt tgggaataag caggctcagg
   197041 gctggcagaa atccagtttg gcaaatgctc tggggaatct tcacataagg cgcagccaaa
   197101 atcatgagcc caccgatcac aaacgtacag gatacttgca gagagacagt acgatacaaa
   197161 tgaaggctaa aaagacaaca gcggtgagac agcttcaaag actggttttg tattcgagtc
   197221 tttttgataa gtcgcatgac ttgatggcct gtcatggtga tgatggctaa gacttgtatc
   197281 ggcaagtgaa gataaaaaag gcaaatatat ggaagttact tttatatata caaggttctg
   197341 aatttcttcc tctggtccat tcaaggactg ttctgtagta ggaaccaagc ccaagaaggt
   197401 tcggtgtgat tcatctgttg aatcatgttt cccatccatt gattaacaga gaacatcatg
   197461 ctgatgatgt tgaagagcgc gatgatagcc gtatacacag ccaggctgcg agcaagttca
   197521 gcggcctcgg tgagaatcag ttcagacgat gtgggataga taattagcag caactggtgc
   197581 accagaaggt aggagacagc actatcaggc atagataatt agcagcaact ggtgcaccag
   197641 aaggtaggag acagcactaa tcaggcacat gtacatgacg gtgaagatct tgtaaatgat
   197701 ggccgccttg gcaaaggtca aaaagaaaac aaaacataac atgcaccatc cgtagaccac
   197761 gaaaaacatt ctccagcgca cggcattacg gccggcatag aacacaatgg aattgcagag
   197821 cacgatcacc actgcagtca gagacaagcc caaaccgaga ttttggcgcg ggcaacaaaa
   197881 acctgtcata acgcacgtgc ctgtctcaat cagcatgcac atgaatgtgg cggagcccga
   197941 gcgattgatg agttcttttt ggtaacagca tgccaacccg aggcaaagaa tagggatcag
   198001 catggcgccc gtgggcactg cacagagcag gcatagttct gtcacgctgg gaaagctgaa
   198061 ccaaaaaagc gcacacacgc ttaacgtggc ggtcacttca aacaaagtat tgctgtacac
   198121 cgacacaata ctgcgaaact tgtctatcca ttccaataag ttctggtgca tccagctttc
   198181 ggccaattcg ctatccaaag gctcctggag gctcatggtg cgaagctctt gtttgtggct
   198241 ttctgctctt caaaccccga ggtgttgagc gctctaaata aaacctcggc aaacagtcta
   198301 tcttatgcga acgccgggct tcggagttga cgtcattaat tgagattaac ctccgcggcc
   198361 caccaccgtc ctaggctgaa atccaagtca aagggagatg atgcagtgtt acgccaaaaa
   198421 tcaggatcga cgataagaag gccgataata tacatgatga gggtttctac gtagatgcga
   198481 atgatgagaa ccaaagtcgc atcttcgaag agctcctgct tgccaataat agtcatgtcg
   198541 tgtatggaca atccgataac gaacgttagg agaagcgcga tatagccgcc gacccaaaga
   198601 gtgtccgaag caggaagcgc gattaatgcc agcaccatga gtgcactgtt cattagcatg
   198661 acggggaaaa accatcgatg aagacggcta acccccattc gtaaacgggt aaaacaaatg
   198721 agccccaagt tgaacatcat aataattaat ggaagcagac tggccatgaa aatggcttga
   198781 aaagaacggc aagtggccat cataatgaga gccgttgcgt ttggaaacat gtatatcaca
   198841 atgaatacca gctgatgcat acaacgacac tgtccccaaa catgtaatat gaaaagagat
   198901 aacatgggca caaaaagaga aagtatagag tagcgaggta tgatgttaca gaactcacga
   198961 aatgaactcg gagaaactat ccaaatgatc agactaacga tgacagtgga agccagttgt
   199021 aatacaatag ccatgcaaac ttgcatccag aacataatgc gcctcccgag aaggcgtaat
   199081 tcgtcctcca tgtcggtttc gttattgaag actgcaccca tgaatggatt gtttctttat
   199141 taagtttaca caagaagcta gcgacttttt gtagctgggg attaagtgag ggtgctattt
   199201 ttggcgtgct ccacccactt aggcatggac atcataaaga taatcaccag gaagatggct
   199261 atggtatcta catacaagcg gatacccccc cggatacaat acatgaacga agattggtaa
   199321 atcacaacat atgtgtcata tgccaagatg aaggcaaaga aactgatgga aaaagctgag
   199381 atggaattgg tgagcttcgt gtgccacggc gcggactgaa aggccgtaga tgtcaaaaac
   199441 aaggccaaga cgatgatgta catgccgatg atccatttcc agcgaccgta attcaatccc
   199501 gcgatgaacg tgagtccggt gaaagcgatg aaagtagcca cgctcatgat gtaggcggtg
   199561 acgatgacat agccttccga acatatgttg aacaagatgg tgggcaccag gttcacacag
   199621 atgtagaaga aaagcacggt tagattactg ggatggcgcg cgcccagaag gtagctggta
   199681 accatgcaag tcagcggcac caacaaagtc aacacggtgc tgtggttgtt aacgcacaag
   199741 ttctggtttt gcggatagcc tagccaaatt aagctggcaa tcgcgaaagt gcaggtcaag
   199801 gcaaaggtgt aaacgccgta gacacgcagc cacacgacga agttcttaaa ccacacaacg
   199861 gcttcttcag gcgttaccat caagggggaa ctgtcggaag gagcgctttc catgttgttc
   199921 tcggcgttct cctgctcaac catttcgctt gttgacaaag acaacgtcta gccgctactt
   199981 gctaggcgat ctaactctta tacacaacgc gtgagacttc ctgggagttg ggcgtggaca
   200041 cgaagtagag caaagtgaca aacagataca tcaaatccat gtaaagacaa agcgcagctg
   200101 gaatgtaact ctcgtattcg atacgatgta gagtgtcttg tgtgtcacag atcactgaag
   200161 cgacaatgac cgccaggccg ccaaacatta ccaccatctc accgacctcg tcaggaaaat
   200221 agtagaagat ggatgcgaga atgatgatca gggcactgga cgccgtgacc agtggtcgat
   200281 aaaactcaac atcgcgagcg aagcgatatg tcgaaatgct caaaacgata aacagtaaca
   200341 cggtactcag catagcatag acggcggatc ggtttccgaa ttgaaagcca gaggtggtaa
   200401 cggctacggc cgtgagtaat gtgtaaatga gtgacacgaa gaggttttta ggaaattggg
   200461 gctcagccca atttagaata cccagacaga taacggacag catcaggcag aacagcatca
   200521 tgcgcatatt acacacaacg tgttcgaggc ggtcgggaag caccagccaa cagagcgcac
   200581 agatgcttag aaatagaaga ctttgaaacc ataataaaat gtaaactcgt aacagaaaca
   200641 cagaacgaac gacccggacc tcgtccgaca attgcatgat gttgactcag ctttcacaag
   200701 tgatacgtgt gtctaaatat gtaatgtgtt tcccaccact gcatggagaa atgacacggt
   200761 acaccggaat tagataattg aatacaaatg cattgtttaa tcaaagcagt gaatattagc
   200821 attcaagggg tcataaatgc taaccctttc cagggaacaa tgccactttt tcatatgttt
   200881 agctcgtcgt gcacgccgca gtaacaattc tctttcattg gtaaccggct cttcgttttg
   200941 ccattccttt tggattatgg ccataatgtc tgggggtggt ggatcatggg tatctgagga
   201001 cagagatgac tcactctcat catcataaga atcaacactg ccgtttgttt cttgtgaaac
   201061 aatgacaaca ggctgatgct gaggggtttc ttctgactgg ttatcatcat cttcctcctc
   201121 ttctgtgtag tcatcgcttt caccctcgaa ctttacggtt ctgggagaaa aacctctgtc
   201181 tacacgaaac atcacagtac catcagacgt tttctccgtt aactcatcat tttcttgcca
   201241 cgcaccgctt tggggccctt gtagaaccgt gacactgctc cacggaaagc accaattctg
   201301 attctcttgc aatactccgg taggcatcaa atcactacgt ccccaacaac aactggtagg
   201361 tattttatca tgagcgcgat tactgcgcgt gagccagtcg tacgcaccac agagctgctc
   201421 ggcggtaact gtgttgacca tagagcacca agagagatct tgcttacggg caccgtgata
   201481 gcagtagcac tcactctcca gacgagcctc gccacgcaat ccgcggtcaa atcgcgtaat
   201541 gccacggagc ttaagaaagc cgcatctgaa caacatttgg atgttatcgg ctagacgaaa
   201601 cacgtcgctt tcgtcgattc tcagcacata acacacgccg cactcgtcca acagaattat
   201661 tccacaggtc agcaaaattc caaaattagc gtaacggcca gtaacaccaa gtacgtacca
   201721 tcggcaacac atgcgttgat taatatactt tatgagatta ctaaagttat cagctctcat
   201781 tttagcaaag ggatacattt gacgtagctt ctccacagta cccagaagga gcaagggatc
   201841 ggcctccgat cgcccagggg ttttcactac tacgttaacg ccatgaaact cttctgcggt
   201901 cttagctaga ccacgtgcgt ctgtcggatc gagacacaac aatttctcga cttgaaaacg
   201961 aggctcggtg gtggagaagg gcgtttgcgg atggcgatat accgattcac atgtcagtaa
   202021 accgtggtgc gcgagttctt tgagtgaggt acctatctga aagagtccgt cactgtccca
   202081 gtcatacacg tacacaaatc catagcttcc cagcagaacc acacacgtag tctcctggat
   202141 ttttttgcga tcactgccat cacgcaactg cacccccaat attcccagtg cttccaattt
   202201 ctctttgcag caaagatact cgtcgaacga acgggtttct acctggggaa tatctatacc
   202261 agagcgaagg acgagaaacc agctacaggg gttgcgcaac ggaatgatag taccagaatt
   202321 ctttttaata tattctcgta aacacggttg atcgtattgt cgcagataaa caccctgtaa
   202381 catagtcaga caacgttgga acacgagatt acgcaaactg aagacgccgt agtcgcagcg
   202441 tatcacgtcc tcgggacgct catctcgctg cttcagatat gtaccccagg cttcagcggc
   202501 acttctggaa agcagtgtca tatctacctt cgaaaagact cacaaagtgt tcagcgacaa
   202561 cctcaatcgg gcagtttaaa tcgatatgaa tgaatgagtc tcgatcagag cttaatatac
   202621 aagcgcctca gggctgcccg gatgactgac agatgacgtg aacgcgccga acaattcctt
   202681 tattggaaga atgcccgcag atcaaaactg ttaatccagt caggcgatag atcacgattc
   202741 agatgcactc tacgggcctc cacctcgggt tctgtcacat caacctcggt gtgataagcg
   202801 tccagcaact tttgaccgag acgccagcgg tccgcctgag cggcttgtct ttcagcgtgc
   202861 cacgcgtcaa tatctttcag atcgtacatg ctgtcttcat cgaggtcaaa accaagatcc
   202921 tcccagtcgt catcttcctc ttcgtcttct tccatctgaa aaccctcgtt atcacgacct
   202981 atgacctcaa tatcgtcctc gtgcacgtcg tcaaagtcgt cctgcattcg agggatgggt
   203041 ggaggcggag gcgcttgaag cgcgggagct ggcagcgcgg gcacctggaa cgcgggcgcc
   203101 tcgggcggtt gtggcgcggg cacttcttgt tgtgcaacag cagcagccgc cacctcctcc
   203161 gctggcactt gttcatgctg ttgctgctgc ggaggcggag gcgacggctg tggctgctgt
   203221 tgaggcgggg agggtggtgg cggcggaggt ggtggtggag gcaaatcctc agggttgaag
   203281 agagctcggc gacggcgagg aggagcacct tcgtcacgat tttcatgtgg acgacggcga
   203341 tctacaaagt ctccacgaag tacacgcgtg tgccagatag tgaacgcatc ccagccgtcc
   203401 cacgtagtaa tcatgtctgc ccgaaaacgg tccgggcgac acaaccagcg atactgacga
   203461 acgaaatccc gggagactcc atgatcgaaa gcggtaaagt gtagacgata ggtttcatct
   203521 aggtgaatgc aacgcacccc gcgttccaag cgtgctatag tgcgaagatg gtgctcatgc
   203581 cggcgccgca catacaattt cattaagcct cctttgaaaa actccgaaag ggtgtcagcc
   203641 actcgataca cgttccccgg ggccagacat acatgagatg tgcgatctgt gtacggtcga
   203701 acaatgaccg tgtagatgcg tccgaatcgg tcaaaaataa ctacactgct gacctcaaaa
   203761 aaacctccca gacgataggt acccacggca cccataatgt accagcgaca gcgtagtctc
   203821 agactcaggt acatttgaca ttctgccaaa tggtaggggt cgatggcctc gaaaggccac
   203881 aaatcactca gacaaccaaa attggccagt agctttagtg tatcagcgtg acgcccggga
   203941 gtgtgaagat tgacatctcg attgtggtac gcgcccacgc actgcgctag ggaatcggcg
   204001 tcatgagcct gagttaacat agcagaaact acatcatgag gcacacgagt ggcatagggt
   204061 gtgtaaaact gcctgtaaac acattcggca tgcaaaagcc cgtagcgcgc caactcgtcc
   204121 aggtgctcag ccgccaggat cagaatgtcc tgactgggtt cataaatgta catctttgta
   204181 tctgatgcca tgcacatgat aagctcggtt tccacaaaac gatcctgcac ccacatgata
   204241 catttgccga tcactgccat tcgctcgcga caacaggtaa tgtcgtccag caactgatca
   204301 cgtagttcag gcatgtggct gcccggcctc acatgtacaa accagttaca gggtataccg
   204361 aggcacaaca catgatcaat acgctcgcgc acccaaacac gaaccgagtc aatgttcgcc
   204421 tgtcggagaa acaggtcctt gaaatcagcc atcacgcgaa gatacgtatc gtatctagcg
   204481 tgacagtaag ggaaatcgtc cgggcgagtg aagctcggag ctccatcttc ccatcgggtg
   204541 cgccacatga tgataacggt ccggcgtttg ttcagattgg gacaaattct ctagatcctg
   204601 tcaagctctt aaaagggaaa ggatctgtgt acgtcacaag ccgtgactga tacaccagag
   204661 cagccagaac gcgttcagtc gttctttccc gcgtagatga tttcgtagtc accagacaat
   204721 ggagtctagg gccggtatct tcctgatggc tcgccgcttc gcgctctgcc gcttccactc
   204781 cgacaatgtc cgattcgagc acgtatgtct gctgaaccgt atcgtagcgg tgtagaacca
   204841 gaacattagg gtctagcctc tcccaagccc cctggcgagg gtcaaaacgc tccgttaaac
   204901 agagccagtc gtaatgctgc tgtacgaagc gctgacgacg ctcttcgcgc tcgaagggag
   204961 ctagaagttc gtgccgacga tccatttcac gctcctcaac gtgagggcag atgcactgat
   205021 gttccatgcg aatttttcgc tggcgctcag gctcgaaacg gcggtagccg aacaccagtt
   205081 tcaaaagccc catgcgaaaa aattcagtga gggtgttggc tacacgccgc agattgtggt
   205141 tgggctcatc gagctggatg gcgtacaccg ctccgaacca atccaacacc accatgacct
   205201 cggccacgaa cgagcgccca agacgcggac ggcctgttac tcccaggaga taccagggag
   205261 tagccagatt agctctaatc ccccaccacc agcgtttagc ttcagtttcc gtgaggctgc
   205321 taaagggcca aacggtgcgc agctccgtaa cggtcttcat gagccgcata atcaccgttc
   205381 cgtaaccggg agtgtgaagt ttgacatcat gatcaacgat tcgatctgcc gtcacgtaaa
   205441 agctgtccgg agtagtttca ttaagaaaca aaatgtgcat agtgcgtatg gagcgcggac
   205501 cggaacggat gagggtcgga gacaagcggc ggagctggtt gtgaacactg tcacgataga
   205561 taaactccga tcgcagcaca ccatatttgg ctagctcttc caaatgatgg gctactagaa
   205621 ccatgtagtt ttcacgaggg tcgaaagcat agatgcggca gaaacgaccc atgcagataa
   205681 cgaaatcagt ttgcagatag tcccgatcat tatccctgtg cggttcaggt atgagcttga
   205741 gagcgtaacc taacgcacac agcggttcgt tacagcagat cagtttgcgg gctgcatgtt
   205801 gagcttgtac gagctgctgg tcgcgttgaa gttccacata ccacccctga ggaggtccca
   205861 ggcaaagacg gcgaccccgg tatctccaca catagtgctc gatctggggc gcgtccaaac
   205921 aaaagaacag gtccctaaaa tcaatcaaca cctgccgata gaactgcaat tcatccaccg
   205981 ggcgatctga aaactcggcc atggtgacac aacgatgata actcacctcg gtctgttaac
   206041 cgatctagcg tttggaccga taatttaaaa tctcggtccg agctgccgag cggttcaccg
   206101 accaggcttg agactctcga cactctcgcg tgcggtccaa gaccatgatg gttcactcgt
   206161 ccagcctcgt ggatatatag cgacgctaga gacaatcatt ctttcctaag aaccaatgag
   206221 accacaacgc attcacagtc cacaaaaaca ttataaaaat tttttttatt gaagcacaca
   206281 aagattcgtt tttattccga acgcgaacat atacacatcc aaaacggttt catgctttat
   206341 ttacaaaaag tatttttgtt tattacagcc aaggtggcaa atacgaaccc ggtcggggta
   206401 cggctggacg agggtatggg catccttcta agatggcagc cttagccgct ctgtgaatca
   206461 acacttgagt ataataatcg caggtgacat cttcgccgcc atcttcgtcc cctccctcct
   206521 cgctactact gtctgtatgc ggacgggcat ctgtttccac agatctggaa ggtgatgaaa
   206581 gagatgcggc ctgtgcgcgc gctcctcccc catcaatctc taacagatca tcgtcatcag
   206641 attctggtac ctgaggcttt ttgtacagca tagcgggttt ggcatcattc gacgcagatg
   206701 cagattcagg ttcagaggca tgtccttcgg cagacatact ttgtctgagg tttacaatag
   206761 ctcgttctaa taccgggttc atttgattcc atatggaata acaccgaaca ccctgtttca
   206821 cttctttaga atgtacataa tctgagagac ggcgccaaaa gttgtgagcg gcctccacct
   206881 cggtggcttg gggaaagtcg cagcgcacat gaggctccca gctaccgtcg gccgctccgg
   206941 acacttcatg gtgactgtta cgagagtaac agccaccagg gttgaggcgg caaaaacggt
   207001 cacgccgaac aagccactga aatcgtgtct cctgatgctt atggcccatt cccctatcca
   207061 tgtacagata gcggtcccaa aactgatagg ttcgatgagg acaatgcgga ggcatctcca
   207121 acctctcggc atcggagaga gccaagctga aacgccggcc ggcctgatag attttcaaca
   207181 accccatggt aagaagggag tctatgtcat cggccagacg ccacacatcg cgccgataaa
   207241 catcgaaata gaacagctcg ccgaacgcgt ccatgagaat cacccattca gcatgaaaaa
   207301 ctcccgaggg caaaacctca cccaccacac caaagatcaa aaccccacaa caaagacggt
   207361 ctttaaaaaa ctgcataagc ttctcgaaca tcaagttgtc catacacaaa aaaggccaac
   207421 atgatttcaa gtcgtcggct tccgcacaga ttaacatggg acgagtcatc tctcctgggg
   207481 tacgcagcgg tatgcattga ccgcgataac gcgccatggc acgctgtagc tgacataaag
   207541 aataatcgtt cattcgcaga tgggaaatca cgtcatcagg ctgggtagtc aacatgggca
   207601 tacgaaactt gcccgaatag atgctctcac agtgaagcag tccatgacgc gcgaaatcat
   207661 ccaacccgct ggccaaaaag tagagcacat tctggtctcg gtccaaaacc caaagacttt
   207721 cataccgccc catcagcact acacgcttgc tcttgctggg cggtagaagg tcatccacat
   207781 acagacagct gtcatcacag tattcgtcct cggagtcctc gtccgacgaa tcgccatcat
   207841 cttcattgcg gcggcccggc cagtactgca gaacgcccaa cacttccaaa ggctcttcgc
   207901 aacaaattaa tttactccag ggagagccag gcccctggca cggcgtgtct tccccaaaaa
   207961 cactgggaaa agtggcaaat accatccgcc aaccaggtgg agcagaaata ggcacactca
   208021 cgcggcattc tgccttcagt gataccagaa tgcgcagaga actttgagac tcctgatgac
   208081 taaacagatc tttcaatgct cccagtgtcc gcctaacggc gggccccgag gcgtaacgat
   208141 aggattggcg taacatcctg atgtgcccgg gcacatcaac ccttcacggg ctttattgcc
   208201 cttcatgtca tgacgtcgta cctgtgtgcc agactgacgg cttattagtt atggtcgcta
   208261 tcctgcgaaa cccgctcagt tgctcgcaag ccacccgcca gaacgtcgga aaaacctcgc
   208321 ccgcaacatg aattcgagcc agcacaacat aagcgtgttt ctctccattg gagcagggcc
   208381 cgtcattacc ggatacacgt gcgtttttct gttcgggatt ctgggacact tttacttgta
   208441 ttggaaaaac catcagagac gacaccggac aaacagtttc agtgatgttt tatttcgaca
   208501 tctcatgatc accgaagagg tctttaccct caccattccc gtctgggcgt atcacttaac
   208561 tactcacggc aacttaccgg gctcgtggtg ccgaagtctc accttcgttt tttatctaac
   208621 ggtattcgct cgtgccttct tttacctgct cctcatctgg gaccgataca gcgtaatcat
   208681 ctgcagacac cctctccccg ttaatctgaa ctacagtcag gtcataggcc tgtctgtctg
   208741 gctggttgcc gtactgtcag catcaccgtt ctccattttt aacggaagtg tgaaacaatg
   208801 cctgggcaac atgggcagca tacccagcga atcgtctgcc gttcttaacc tggaagtgca
   208861 cctgtgctcc ttctggttac cgctcatcat gtcggctaac tgttactacc aagcaaaacg
   208921 ccgagcatcg cctgaccaac tccacgaact ttaccgatgc agtttgctaa ttaccattat
   208981 cacaacttac gctatcgtat ggtttccttt ccatctcgct ttactcatag acgccctgat
   209041 tagcataagc catgtagaac cctctagcgc tctccactgg gcatccattg tcgttacctg
   209101 taaatcattt acatttgtat atgcgggcat aagcccacta gtgtatttca catgctgccc
   209161 caccgtacgt cgcgaactgc tgatgtctct acgtccattc ttcacctgga tttccagcaa
   209221 aacgcggcga ggctacgctc cgattaaaac acaaccttta aacatccccg acgagccgat
   209281 agataacaag tcaccgcacc tgttaaacga ataaaaaata aagaataaaa catactcagc
   209341 actctgtctt agtcgcgtat acatttctca ctcaaacgtc gataaaaacg ctcactcaaa
   209401 cattatataa agtgaccgcg ccactttttc cagtgacgtg gttacatttg gcaatgtcac
   209461 gctgttatat tccacatccc aaagcttgtg ctaggcatca tacaactcac agacaaccca
   209521 actgattgtt atctagttaa cgaaatctgc ggaactaggt aagtgcaaat aacccaacag
   209581 cttctcaaca aaacaggagg gttaatcaag taacgtaacg tcgattattt atccgctgct
   209641 acatgtttta acagccgtca tgaccaacac taacaatacg acttgtcatc tcaacggaac
   209701 tttcgaaact tttaaaatca cccgtccagt agccatcagc gcctacactg tactcgtggt
   209761 tatcggactt ttgggaaaca ttgtgctgct cagcgtgctc gtcgtgaaac gcaagctcaa
   209821 gtttccgaat gacatttact ttttcaacgc gtctttggca gacgtttttg ccgtctgcat
   209881 gttgcccgcc tgggttaact atgcactgga ctccacacaa cttagcaagt tctcatgtat
   209941 cacttttacg tttggttttt acgtctccct gttcatccag gcctggatgc tcattctggt
   210001 caccctggag cgatacggat ctctagtctg gatcgccccg atcaccagaa acaaagccat
   210061 agcgaattgt gtactctttt ggcttgtttc catcttcttg gccgcacctt actactcttt
   210121 tagaaacgaa agcaacgaac accaatgcat catgagaaac tatacctgga gcgttggtga
   210181 aacatggcac atagccctgg atttcttaat tacgctcatt acatttatca tgccagtgac
   210241 tattgtgtta gctctgagtt tcaaaatggc cagatggtca acctttggtt acagaaacct
   210301 caccagcaga accagtctta tccttatttt gatactgaca gtagcagcag ggttctgggg
   210361 accttttcac ctatttatgt ttatagaaaa cgtggcaggg cagatttacc acattcaaaa
   210421 ggattgctgg tacttacagc tcagacactt gtgtagcttg atgaccgaaa ccctagtgtt
   210481 tctacgttca gtttttaacc cttatattta tatgataatc agttacaagt ttaggcagca
   210541 ggtgcgcagt ctactcaagc gtactcagta tgatgctttg gacacgactc agttagcaga
   210601 aactatgcag ctgaaagcga aaggtgtgcc ggtgtccgac cccgcgccgc atgactgcga
   210661 atgctttttg taaattatca aacgtgtaaa aacaataaaa gttcatttgg ctcacaaaag
   210721 actcggtttc ctgtggagca tatgcgatga cagaaaataa ccggcgaacg attagcacac
   210781 ggccggcagc aaacacgaca gcttcaacat gaccaacgcc ggacactgtc acataaacga
   210841 aagtctcgcg tcgtatggaa tcgctcccgc agctaccatt accttataca gcattgcggg
   210901 aatctgcggt gtcacgggaa atctgttaat acttttggtt ttgttcacga gacgcataca
   210961 ctggttcgca aatgacatct actatctcaa catgatcttt acagactttc ttgttttcat
   211021 tacattaccc gcctgggttt actacctacc tgctgaatta cacacaactc tcacactatg
   211081 cctgcattgc tctatcattt gttttttacg tttccatttt tattcaagtt tatggtagca
   211141 gtggctatcg agcgttatcg aagcctagtg aaaaacaaac cccttagcgt aaaaaaagcc
   211201 agcgtcagct gcgcgtgcat ctggatcatt gttattatag tgtcttcacc atactacatg
   211261 tttagatcgc aacacgaaac aaattcttgc attctaggaa actacacctg gcatatgaac
   211321 agtccttttc gcaccacaat ggacgcatcc attaacattt ggtcttttgt cgttccggcc
   211381 gtgacgacct tgttaatagc cagacgaatt tatgtatgta cttcaggcaa caaaaaaatg
   211441 aacgccagag ccagtggttt gttagaggcc atggtgatta gcatgttatt cttcggagga
   211501 cttttcaacc tgaacatctt tcgagacata gtttcggaca catcggaaga caataaagac
   211561 tgcacatatc ttaagcagga acactttatt cgcatggtcg gtgtggccct cgtttacggg
   211621 cgcgctatat tcaacccttt tatgtatatg tgtgtgagta ccagattgcg ccaagaaata
   211681 aaatgtttgt ttatgcgaat accttatgaa acactagatg cagaacacgc taaactcatg
   211741 gttaatttaa aaaacagaaa tgctaatgta cccgatccta aacctcgtga atatgaatct
   211801 gtgttataga aaaaagcaga ctgcaatcta tgtttaaaag tcatccgaat ccacggaaat
   211861 gcttgatagt cgccattcaa gatgaataac acatcttgca acttcaacgt cactctcaac
   211921 gcatcggcac caagccgata catagctatt gctatgtaca gcattgttat ctgtatcggg
   211981 ttggttggaa acctgctgtt atgcatcgtg ttagtcaaga aacgcaaact gcgatattcc
   212041 agcgatgttt attttttcca cgcctctatg gccgacctcg tcagcactgt catgctaccg
   212101 ctctggctac attatgtcct caactttgcc caactctctc gaggagcctg tatcagcttt
   212161 tcggtgactt tctatgttcc ccttttcgtt caggcctggt tactcatttc catcgctatg
   212221 gagcgatatt ccaacttagt atggatggca cccattagcg ttaagacggc ctttaaacac
   212281 tgcataggaa cctggatcgt atctgccttc gtggcatcac cctactacgc atacagaaac
   212341 tcacacgacg aacacgaatg cattctagga aactacactt ggcacattaa cgaaccgcta
   212401 cacacgtgta tggatgtggt gatcatagta tggacctttt tggccccagt actggtaacc
   212461 attatagcaa gcgtcaaaat gagacgaacg acctggggca atactaggtt aaacgaaaag
   212521 aacagcgaca ttcttatagt actagttgtc atgacagtgt tcttttgggg accgtttaat
   212581 atcgtgttgg ttattgacaa tattttacag agatactatg ataccacgaa ttgcgatgta
   212641 gaaaagatta aacatatcat ggctatgatc tcagaagcca ttgtttattt tcgcggtatt
   212701 acagcaccta ttatttatgt agggattagt ggcagatttc gcgaagagat ttactctctg
   212761 tttagacgcc agccgtataa cgatttggac cccgatgcca atcaattcat gattgaactc
   212821 actagccagg gaagaagtag aaatagaaat gctagacaat cggaaagcaa tgtaccgcaa
   212881 ccagaagaat gcttctggta aaatgtttaa agccaataaa ctattttcat aaaattgtac
   212941 atgtggtctg tgtgtcattc ttctgggcgg gctcatgatg taaataaaaa gcttctcggg
   213001 gagactgttc agagtacaaa cagccacgca ttaggccgtt gaaagatgac taccaccaca
   213061 atgagtgcta ccacgaattc cagtaccacg cctcaagcaa gcagcaccac gatgacaacg
   213121 aagacaagca ctcctggcaa tacaactact ggcactacgt ccaccctgac aacgatatca
   213181 acaacttcta atgctaccag cataacgtct aatttaagca ctaccggaaa ccaaactgca
   213241 actaccaatg ctactacctt cagttccaca ttaacaacat ctacaaatat aagcagtaca
   213301 ttttcgacag tttctaccgt cgcatccaat gcaacatgta attctacaat cacaacgaat
   213361 attacaactg cttttactac agcagcaaac actaccgcaa gcagcctcac cagcatcgta
   213421 acttcacttg ccactaccat tgaaaccaca tcatttgatt atgatgagtc agcagaagct
   213481 tgcaacttaa cagacatcgt tcatactact agatcagtga cagttacttt ctatactatc
   213541 atattcatac tcggcctttt gggaaacttt ctggttctta tgaccatcat ttggaaccgt
   213601 cgcatttcct ttatggttga aatatatttc gttaatctag caatctccga tcttatgttt
   213661 gtatgtactt taccattttg gataatgtat cttcttgagc acgacgtcat gtcacatgca
   213721 tcctgtgtag caatgacagc cattttttat tgcgcgctgt ttgccagcac tgttttcctc
   213781 ttgctaattg ttttagacag atgttacgct attctattag gtacagaaaa agcaaataga
   213841 cgtttattgc gcaatgctgt ttctggatgc atgctcatgt ggggattgtg tttcatttta
   213901 gcattacctc attttatctt tatgaagaaa ggaaccaacg tatgtgtagc agagtatgaa
   213961 ccaggactta acaatttcta tgttattttt atcaatactg aggtgaacct atgcacccta
   214021 gttttgccag ccgcagccat tatctactgg tatcttaaac taaccaaagc actcaaaacc
   214081 catgaacgac tgcgtcatag gctaacgtct ctaaacatag tgttagctgt tgtcattgta
   214141 tttgctttgt tttggctgcc gtataatctc atgcttatga tgtatagctt agttcacatg
   214201 cagatacctt gggaatgcag ctctgaaaaa atactgagac gaagtttaat tattacagaa
   214261 tccatcgccc tcagtcactg ttgcatcaac cccattatct acttgctctt cggacctcgc
   214321 tgtcgaagcg agttctgtca cctgttgcga tgttgcttta cgcgcttatg tccacacaga
   214381 tcctggagtt ccatacgtgc agagacggtg tccatcagtc tcagtcactc acaggtatct
   214441 gcatcatctg aggatgatga caacgatgtg catgatgaat tgcaattttt aatttgaaac
   214501 acaacatgtt aaaggctcaa taaacacatt tgtcatagct tgcgtatccg tgtctcttct
   214561 tggggaggtg ctaggttatt aaaacgagcc acccgtttgc acatgcaaca caaaaaccgt
   214621 gcacatggaa catatcacag ccgagtgcca acatgctaac ccgaccgtgg tacatcgata
   214681 tctggtggat cacgctggga tgcgccccgg ccgtgagtgt gacagtttta ttgacaacag
   214741 ccacggtcgg ggcacactcc attgtggttc atgaagcatc gccgccacca ccaccatcat
   214801 cgtcgtcgct acgcttgcct atcacatccc cctcctctac acactttaac aacccgtcaa
   214861 aatcatcaca catcgagcgc accgccagcg ccgtggggcc tacccgacag cgaacaaacg
   214921 ctctcaacag gcgacgacgt caacagcaaa gaaaaccata cacctgcatc accggcactc
   214981 attggacaac caacctagtg tttacgagct gcgaaaacac acccagtttc gttaaactcg
   215041 aaggcgttcg aaagtggact ttaaaaggac aacccctggg agaaacctcc tactacggcg
   215101 ggtgctgccg cctcgcgcac ggagagaatg cgtacatcat tctcgctaac ggttatggcc
   215161 ctgccatcca cggtcatgct ctccgtgtgg attatgcgac tactaactgc acacaacctg
   215221 cgattccgtt tcccacacgg ctggagatta cgtctacgca ggggcttcag agccggtgtg
   215281 gatcgaatcg cttctatttt tacggtctgg aatgttccac ccagctggcc ttttccaccc
   215341 tcggagtggt ggatgtacgc cggtgtccct ccgtactcgc cgttcgaccc cttcgacgat
   215401 ctgggagctt ttgggatgaa caactacgag gactatccct ggacattcta gtctgtctgg
   215461 cgctagtcat gctgttgttc atggaaatca ttcccggtca ggcgtttcgc tatcccatag
   215521 ggacgtggcg gcgagtctcc gcatttccct ccacattccg tctccaccgc tgggtaaaac
   215581 ggaatctggc ttctctattt tccagtgaaa ccgaacatca gaaaaagccc tccgaggcgg
   215641 ctgcgaaccg cacatggaca gtgccgtttc catgttctca taccgtcctg ctggccccga
   215701 tcccattccg cctcaggcgc accatgtcat tcccgtctct gcaattcccc acgtcatccg
   215761 cccacaatgt gtcccagatc accgacaatc ccacacacgg tacttatgag agccacaacc
   215821 tgccacctgt cactttgccc gtcactgact acatagaagt gatagcggag catgctccga
   215881 taatctatcg tcaagatgcc aacgccgtac aggcgatgct gcttcaggcc gctctggaac
   215941 gcgatcataa tcgtcagcac gatcgcaatc gctgctaacg cctgtcatat cgaggttggc
   216001 gaggacgcca ccgtggaaca agagtgccga cagcgaaacg tgctacttgc caccggacag
   216061 ctgacgcccc acagccatcg accgcacgta ttggagttca ctttctccac caaggacaga
   216121 ttagggtccg tacaacggct gcagctgcac atcaccggtt tgcagctcaa taacagaacc
   216181 gttctcgacc aatctgtcta ttggcgcctg ttttcgcgag ccacgacggt cgagggtggg
   216241 gtaaagcaaa aagttaagct acgtctcatc tcggaacaac atgtccccgc acgccactgt
   216301 gagatcaccg ttggcaaaga cagcgggctg gacgagacag agccctgggg cctgttaaac
   216361 gtcctcagct attttgtctg gtgggtcgct atgtgcctgt tagcaataga catcattatc
   216421 aacgcctacc agtggattca caagatcaac agcaaaaacc gcacagcggt ctcggtgcgg
   216481 gctgagatcc tgcgcaacga gcgagaaatg ttttggaaaa ggcgacgagc gcgacacggc
   216541 ggcatttcgg agtcgcccgt ctccagcgtt ccgcctcgct atgcctgcaa cgagccctgg
   216601 tccctgccga gcaccgcagc cgccacggcg agcaaccagt cagcagcagc gacccctgca
   216661 tcacccacac ccccagaata ttcctcatca tctgtatttc ctccctttcc ccaataaaga
   216721 gagttgtgca ttatcgaggt ggtctttgtc ccttgtttcg ggtcactgcc tttagggtcc
   216781 ggaacgggag acatggagaa ggaggaaacc tggcggggtc tcatggtgta ctcgcatagc
   216841 ctgtggtgta tctgcggaca ctggaaggcg cacattatca tgagcgacga ggccaactca
   216901 gaagaggtgg cctgcagcaa ctggatggag gacgcgacca tgcgctggat acgcaatgct
   216961 cgcgaaaccc acgacaagtg gtgtcgctgc accgactgga ggggacatgc cctcagtctg
   217021 gacgaaaatc gaatttctct ggttaccctg cccgcggcaa tggagaccaa gagcagcaca
   217081 tccagacaca acagcaggct gtcgtgtttc actcgcgtgt tcaaaagttt tcgaaaaaaa
   217141 gggcgctgcg gtcgcgggtc aggcacggct agcaacagca gtggtgccag caccatcagt
   217201 agtcacagct ggcaatggta ccgcgtaacg ccaccaacgc ctcgacaagc ggaatgtcaa
   217261 cgcgctcccc atccgtaatc aagacgaccc gtgtgtcgat aaaaaagaga acgcgtgtac
   217321 agggcttcat tgtaaccgtg tcgcttcttg ccaataacca agtgcactga aacacatgca
   217381 tagccaaagc gctttgaaac aatcatgaac agaccgcggg atctcatccc cacgcttcat
   217441 gactcgtgca cccaaaccga actcagatgg cgaagggttt taaccgagtc tcatgccctg
   217501 tggtgcaact gcggggactg gacaccacat gtagagtgcg tagacgacgc gtatttccaa
   217561 ctgcggtggc gcagtcgcca agagcgcacc gccctgcgct ggcgcaggca aatgcacagg
   217621 ttgcacaacc tctggtgcat gtgcggaaac tggcgggaac acgcgctgta ccgccgggga
   217681 cgcttgactg actcgtcatc cggatcgtca gcgtcgtcat cgggtgaatc agccgaaaac
   217741 acattcgtgt ggtggaaatg cttgcgcaag tggaacattc tatggcgaca cagctatgac
   217801 ttctttgata ttcccgtgcc gcctgagtct gagcgtgaaa cgcctgcgta ctcggactca
   217861 ggatcggagg gaacgccatg tacaagcata atagagacac acaggccaca agattgtccc
   217921 atcgtcatgg atgtacgtcc atggtaccga gaaaccgctg tgtaacctcg tcacgaagtt
   217981 gtgcaagcat gtgggagggt gactgtgaca tcagttggaa gggtgtataa agcatgtaac
   218041 cccaagggac tgcagaggcg actcacttga gtgacacttg gctcggtgcc gttgtgcatg
   218101 tggcacgcga tcactgtaca cacaccaagt ggtgtcgcta gcgcggctcg cgctgtaaac
   218161 aacgcactgt cagaccttgt ctgtcgtatc tctatgctgt gtgctcggcg ccgacggcgg
   218221 gctgtgactc aggagacagc aacggccgga tcatctgagg ccagacaggc tgaacagaag
   218281 caggagcagc cacagacaag ctcttcaacc tcgttcctgg gtcgcgctct ggtcctcgtc
   218341 ggtcaacagc tcctggcggc aaaccaggca gcatgccctc cgcccgcttg gctgtggaaa
   218401 taagaacaaa cgccacctag cagattctgc caacaaacaa acagcatgtg ctccacgtcc
   218461 tacattcgta tgggcatttg ggtcacattg gtgattatca tgactattgt gtttttataa
   218521 acgacgttat gtaacccaat aaactacgca tacgctcata gtgtctgtct atgcatgttt
   218581 attcaagctc gagagcagac atagaaaacc aaacagtgta tgagtataaa aacagaaaat
   218641 ttacatatta tatcttagca gcttttgcgt ctgagaactg gggagaatcc aggtagtatg
   218701 tccaagtagc agggattccc gaatccgcgt gtgttggtat cgccaaagtg gttgtcatgg
   218761 aatgtgcttt tcatggcttg ccagtaggct tccatcgttc ggggtgcttc tgcaggaggg
   218821 ggacaaggtg tgtcggtggt cagttctcgg tgaagatagt tagcggaggt gtcccaacac
   218881 gattgaagca tgtcgtcgac ggtgctagtt ggcgccggag gtttctgtcc ctgcgccttg
   218941 tttgtgcatg atgaccgtct acagcagaac gtagagagga aggcattcca accacggcgg
   219001 aggattctgt ggaattttgt gagcgctccc atgtccgtta gaaatagcaa tcaagcaagc
   219061 accactgcca atgggaaaag attggaatga agtgtggaca agtgtgtggg cttgtagtta
   219121 tagtctctag cacgggacga tgagaacacc atcgctggaa tacttgggaa agacggaagg
   219181 gtcacggtca cggggctgaa tgggtaaagg tcgtcggaac ggacgattgg cgcgagcgcg
   219241 atggttgcag atgcggcgtt gcatgaccgt attaggtccg cgtacgcttt ggggatccca
   219301 atggggattg tagtcgccgg ccgcccaggt gcggtacggc aaaagagtaa aggagtcgtc
   219361 ttcgccagga tcttcgtctt cctcgggacc gctgggaagt ttccaataac gcaaatcaaa
   219421 gcgcagtgcg cgcgacacaa gcgcttggtc actctgcgga atgggttcct gaccggcttc
   219481 tgctggcaga gcaagagctt gggcatcgcg aacgcgccag ccgtcctcgt ctcttgattg
   219541 acaggtggac gtgtcagtat ctaaccgcca tctccccggc cgtgttaaaa atgcaaattg
   219601 actggccaaa tcacgggggc caccagaggg acgtggccac agatacaaag catctggtcg
   219661 cgggcgttcc caaacataag ggtcctgatc gggcagcagg cgaacagctg cctgatcagg
   219721 actggcggct gcgtagcccg cagtgagagc agctaacagg ccgacacgta aaaagtgtga
   219781 taagtcctca gccagggggt ataccagtcc atcgtacgta cagtaaccat acacaactcc
   219841 gagttcgtca atgataataa gcatgacagc caaagggttt ttttccaata aacgaccatc
   219901 gtcgtcaacc tccgcacgct catcagactt tcgttcagcg tggcatttgg ggctgtgagt
   219961 gacagttgca gcagcagcgg cggcggcagg acctggcgtg gccgcgggtg gaacgtccga
   220021 ggcgggcgcg ttgtggcgtg aatgtttgtt tggtttcggt cggcgtttta ccgtgctgcc
   220081 ttgataggcg gcgagccgag tgtgttcccg actggggttg cgggagcgtg tgtcaaacca
   220141 gttggcgcga gcagcagccc actcgctcag atattccagc cacggatgtg tagtaacgat
   220201 acccagtaag tgaaatgcgc agcacaggcg ctcggaaata aagttacgga cggctgcgac
   220261 gatggaacca gcgtgtggcc atttacagaa aggtagccaa cgctccactt cttcccaaca
   220321 tgtagttaac aggcacggtt gtggaggacg gcccggagtt tgcaagcaaa tggtttggcc
   220381 agctgcagtg tgaccgatag ctgccgcagc tgcggctgcg ttgggccacg tacgagacag
   220441 gagttccaca ggttcgggag ggtggacggt gagaggaggg agggttgggc atgcatacac
   220501 gcgggggagg tctccaatgc cgtggcgaaa gaagtcatcg gcatcggtag ccgcgaggtg
   220561 taaagtgtga cgagggagat caaaaagaaa cactcgaaag tggcacccaa tggcgagaaa
   220621 gaggccttca tgacggcaca gggtaggcgg gtcttgtgga gagggactca tttcatggac
   220681 caaggtggcg acaaggacaa tccagtcgtc tgtgggtgaa agttgccgta gatcagtggc
   220741 gccaacgtcg cgcatgtgag agcgtggagt gacaacggca taaaagttgg cagggcggcc
   220801 cagtggtagg agttggccag tttggcgttg gcaccatttg cgagtagcgc gagcagtagt
   220861 gttagcaatg aaggcatcgg cccaagcggt agccatgagg aggaattcat ctttagtgag
   220921 agcatgctgc tgtggtggaa tggatgcgag gcgagttcgt gtgtcgagag aagggagagt
   220981 tagcgtggtg ggagctccgg gagcatgtgt gggaggatgc attgcagagg tcggctgatg
   221041 cggaggcgta ggcaaggcat gcatgaggct ggacatgtgg tgtagcggcg agggttgatg
   221101 agggcgccag tgagttggag gagcaggcag gcggtgagag tgaggatcgg ggctggtgcg
   221161 gagacctgcg tagcggagat gctgccagga gtgtggcgag cggtgaggac gcatgtttaa
   221221 gtagcagtgg agtggaggtg tggtgaggaa cacggggacg agtgatgtag gcggacaagg
   221281 ggagagttgc agagcgagac ggtgagagtt tgggcgagta aataaagtgg ggtgttggac
   221341 aggcagcgtt aggagagggg gcgtgcggga gacgtacggc aggcagcttt cctccccagg
   221401 gcgctgaatg cgggtctggc aggcactccg gggtggcgcg ctggcgtgaa gggc
//
DBGET integrated database retrieval system